1NKNA

Visualizing an unstable coiled coil: the crystal structure of an n-terminal segment of the scallop myosin rod
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
74
structure length
74
Chain Sequence
b'MKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMKQLEDKVEELLSKNYHLENEVARLKKLVGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S2N51-GCN4
publication title Visualization of an unstable coiled coil from the scallop myosin rod
pubmed doi rcsb
source organism Argopecten irradians, saccharomyces cerevisiae
molecule tags Contractile protein
total genus 35
structure length 74
sequence length 74
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nknA00
3OJAB 5BU8B 3VP8A 3VP9A 3BATA 1NKNA 3C9IA 3HRNA 4GIFA 1WT6A 5BVZA 3U1AA 3N7NA 4N78D 4I1LA 4N3YB 2JEEA 2POHA 3BASA 3P8CD 2FXMA 3U1CA 3U59A 4ZKPA 1X79B 4ZKUA 5BU5A 4O9BA 1IC2A 5KTBA 3N4XA
chains in the Genus database with same CATH superfamily
1QL2A 2K37A 3HE4A 1LTJC 3USSA 4M3LA 4JF7A 1FZAA 3HE4B 2K88A 1T6AA 2QJYB 4R4LA 1GDTA 1L0NJ 2M5AB 2KP8A 2Q5UA 1M90Q 3V5BA 1PPJG 4L74A 1SFCB 1SQXK 3Q5RA 3H1LG 3BCCE 3VTPC 3AEDC 1KILD 1EXIA 1SP4A 3RL0C 3L70E 5GTIE 2Q3IA 1Z56A 3II6A 2WSEH 3L4FA 3H6PA 3HD7B 3MUDC 1KQLA 3D6YA 1MUUA 3JSVC 3V4QA 1AFOA 1NTZG 1LWUB 1SQBG 1SQXD 1YHQP 4KT0J 3L73G 2P1JA 2RN0A 2Q3EA 1QGKB 4H13C 1KV4A 1NHLA 4H0LB 3GF7A 2NPSD 3RK3B 2IZ0A 1NTME 1NJIQ 1FZGA 2NZ2A 2C9LY 2HG5D 4YPCA 1M7LA 1J1DC 1QVFO 1SQXJ 1KQGB 1OZHA 4IFFA 2QM8A 2I1JA 4H44D 3TYYA 2B87A 5L8RJ 2E76B 3A3YB 3QWOC 2E74C 2JWDA 1QX8A 3H1JD 1URQA 3CCEP 2JDIH 2L5GB 3P8MC 1KYOH 2PP6A 4GDOA 3HD7D 1K8AQ 1VQ6P 1FZFA 1KORA 5KJ7C 3I56P 1S4XA 2IBZD 1UIIA 3A0BH 2OYHC 2XZRA 3H1JJ 1P84E 2O3JA 2HFED 2H7HA 1LP1A 3L70G 3OJAB 3PRJA 2IX7C 1NVOA 2G8YA 1KN7A 2OYIA 4KJMA 3BVHA 3S1KA 2XNXA 2ZYAA 1E79H 3CWBD 2JWAA 1FJPA 3TF5A 3WU2E 5CCHA 2C9NY 1KQFB 3RK2B 3D70A 1SQVK 2O01H 1NTMG 2WSEJ 2IZ1A 1HGVA 3CWBJ 1HTLC 3L36A 3E1RA 1NTKK 4R4MA 1LTJA 1Y9BA 1JMMA 1PZQA 1SQVD 3CXHE 1JB0J 4WBAA 2E5TA 1L4AD 4IOIH 3NXSA 3ABVC 1XTGB 2P2UA 3BRTB 1NTKD 1CSBA 2ZXXA 1SQVJ 3PJSK 1KYOD 5AVQB 3VMZA 1NU1K 2JKVA 2J58A 3S9OA 2BASA 1EQ7A 1NTKJ 3L37A 2M3EA 5B66H 3MUDA 2RKLA 3N7NA 1PP9D 1GD2E 1PGOA 4GOEA 2OTLP 3AE3C 1IZNB 1BDDA 1RE3A 1DEBA 1NU1D 4ASVA 2WT7A 3U59A 3S4RA 3TSIA 2KK7A 1VQ4P 3L74E 1SQQD 2OGUA 2FFDB 2E75B 1N8RQ 3SWFA 1EZVI 3JCUH 1PP9J 5KAFH 1NU1J 1IFPA 3CCRP 1SQQJ 1YQ3C 5TISE 4U3FD 2Q7CA 4Y99B 1LTSC 3C9IA 1JCDA 3M0DC 2KNCB 5KKZC 3MTUE 2O01J 1HJBA 1KMIZ 2WTYA 1EDJA 4UB8H 4U3FJ 3GMAA 1PGQA 3P8CE 1VQOP 2ZT9B 4GIFA 3D6ZA 1KB9E 1Q7YQ 2YXQB 1YI2P 4XE5B 2OTJP 3L71E 1JNMA 2QSIA 3CC4P 3AE7C 3V4WA 1GMJA 3RL0D 2HODA 2IFNA 2KLUA 2YIUB 2KZIA 5AW9B 3V2RA 2WSFH 1FJKA 2A45G 3CX5E 3H1KJ 3B71A 1Q82Q 2K9YA 1GW3A 1SFCC 2KI7B 2WPSA 4PV1D 4C46A 1HUCA 2N1TB 4IFMA 1GL2D 4RO0A 2CK3H 5APYA 3OAKA 1J1EC 4BXLA 2FKWB 4DOJA 1JM0A 1BDCA 3HRNA 2WPVB 1LWUC 5H2FE 3KPEA 1GW4A 1JY2P 1GTWA 3Q5PA 3EWKA 2JJLA 1VF5B 2R3SA 4H0LC 1IO4A 3RK3C 1YITP 2D2CC 2P67A 1N7SD 2L91A 2PRRA 5KLIB 4DJGA 4K35A 3HE5A 1P84I 2WSCH 2QE7H 3HE5B 2E76C 2N1TD 3CD6P 2QIWA 2GA1A 2FYUE 1GK6A 1T3JA 3L71G 1QL1A 3W67A 2E43A 4PD4D 2ZYDA 2WZ7A 3V6IA 2KXPB 3VP9A 4HJGH 3NMDA 1PPJE 1SQPK 5CJ0A 1L0NE 1FZCB 5AW0B 3H1LE 1U7JA 2BCCE 5AW2B 1VQ9P 4IL6E 1IJDB 3EFGA 1XTCC 5BVZA 2Y9ZA 2OYIC 2WSFJ 2BEQD 2R5DA 3CXHI 1SQPD 3BRVB 4XFJA 1NTZE 1VQKP 1YJWP 1LTAC 2Q9IA 1RF1A 1T2KC 3RK2C 2QJKB 1KFMA 1KILB 1YTZT 1YIJP 3CL3D 4WY4D 5CCHC 1RF1B 4UB6E 1JTHA 4OH8B 3H1HD 3H1IE 1SQPJ 3JC22 2E42A 1IK9A 1FBMA 3KZIE 4Z1MH 4WVZA 1EZVE 2N9BA 3L75E 2YMYA 3VMXA 1VQ5P 2A45I 5CBNA 3H1HJ 2YO2A 3M9QA 2NPSB 2FYUG 2HR3A 2M5AA 2WVRA 3L35A 4DCKA 5AVZB 3D71A 1AJYA 2A06E 1PGPA 1M8OB 1N86A 1SFCA 1OW6A 4H44B 2WSCJ 1L0NG 1OWAA 1Q2NA 1FAVA 2BCCG 1ZR2A 1L2PA 1ZRTD 3TGUD 2B9BA 3HD7A 3LW5H 1SQBD 3L73D 1MZ9A 3L72D 1JY3N 3H1JE 1LWUA 2OTKE 3FXDA 1S5LE 2KUBA 3UIAA 2Q6QA 4DZOA 1RQUA 1RE3C 4BWNA 3TGUJ 3N4XA 2E75C 3CMAP 1SQBJ 3L73J 1OW7A 3L72J 2CPBA 3CI9A 3H1IG 1KB9I 3A5TA 4MN4C 1FZEA 2DW3A 5M1BA 3RK3E 1YJ9P 3Q5SA 3CC7P 2YKQA 3MIWA 3SFEC 1BCCE 4Y99C 1EZVG 3L75G 3G6EP 2HPCB 3IFMA 1OVUA 4NPDA 3CX5I 1VPCA 5APSA 3FWLA 2FXMA 1P84H 3O6QB 2M8RA 3LIEA 5E79E 2ZT9C 3BCCD 2GM4A 1RQVA 2WPQA 3L70D 2A06G 2ZYGA 1NTMK 2KLVA 3HUSA 1L4AA 1NGMB 1HH0A 2FYZA 3R4YA 1VDFA 3HUSB 1L4AB 2Z4EA 2YIUC 1OX3A 1H8AA 1LT9B 2LR2A 3WU2H 4C7RA 4YTPC 3BCCJ 1SQVE 1NKNA 3L70J 3ZDMA 4TLFA 3V2QA 1LT1A 3H1JG 2JR8A 3PH0A 2Q1KA 2OARA 3B5ND 1NTMD 1JUNA 1ZXGA 1NTKE 2KSEA 2LKMA 1QEXA 3IN6A 4K3AA 2K3RA 1OMIA 3RBZA 2D2CD 1RY3A 2PFXA 4HB1A 3LW5J 1YYCA 3EQ2A 4HYTB 1NTMJ 1JY3P 1VF5C 2AEMA 5AW7B 1USEA 1BCCG 2XKMA 1DIPA 5CCGD 1NU1E 3M9BA 3VOPA 1VQ8P 5AW8B 1NAFA 4CPGA 1URQD 2Y0EA 2KYVA 1P84D 2A45H 1K04A 4QMAA 4JYCA 2R3CA 3BASA 1ZN5A 5CHXA 1YBKA 1SQQK 4PJ0E 4NPEA 1CI6B 3B4SA 1KC8Q 4KHXA 3E7KA 1SQVG 4I7ZB 2OQQA 1JY2N 1T3UA 1FZCC 1RH5B 1PV3A 1YQ4C 1NTKG 2RH0A 2FFDA 1KQSO 5TISH 3H1KE 2O1KA 3RL0B 4OGQD 3BATA 1ZP0C 4DT0A 3E1IA 1X8YA 1FDIA 1GK4A 1FZBA 2YNYA 1VQMP 4PV1B 2XDJA 1GL2B 2QJKC 1KILC 1RF1C 3AE2C 4H13B 2KNCA 1S9KD 3RBXA 1NU1G 1KB9H 1BGYD 3AEGC 2N9YB 3A2AA 4HKZH 2WWWA 1MFZA 1N73B 4LC1A 3M91A 1QVGO 2W6BA 1L0LK 2QRXA 4WWIA 5APVA 2K9JA 2AXTE 1HF9A 3CX5H 1GU5A 2XNDH 1WRGA 2NPSC 5CMZA 1BGYJ 1ZMEC 1PL5A 2K9JB 1ZV8A 3WUUA 2QJYC 1N7SB 2KB7P 5AVVB 1LTGC 1K9MQ 1PGJA 1DH3A 4JYBA 5KLVE 4H44C 3L74D 1L0LD 2IBZI 2N1TA 5DJUB 5APXA 1SVFA 4BRYB 5H2FH 1BSNA 1AVOA 4D6TE 1DEEG 1H0TB 2OYHB 5AVTB 3G71P 3OA7A 3H1KG 4H13D 1PIXA 3L74J 1L0LJ 3HD7C 4EOTA 2I1KA 5GTHE 1WMKA 3B8EB 1KTMA 4PD4E 4IL6X 3A0HE 1LTTC 2POHA 5KAIE 3KDPB 3G4SP 3VMAA 1Q81Q 2ZAEB 4HH2A 5CJ4A 2K1AA 1LTIC 1IFIA 3FGAD 4GT1A 1EDKA 1JOCA 2YMKA 4N78D 2E74D 3P8CD 1KFNA 3WUTA 1X9VA 1USDA 2J5UA 2FXOA 4ZKPA 2SPZA 3Q1MA 3L71D 1ZR4A 1OIPA 1KZUB 4WY4A 1SQPE 2ZFCA 5KJ7D 4AUWA 4WY4B 4L76A 4N3YB 3CCVP 2Y9YA 4AQRD 5AVYB 3CX5D 1BE3E 4RKUJ 2JO1A 3CMEP 2WITA 2YXRB 2GUSA 3NTNA 3L71J 4IL6H 2QM7A 5KLVG 3H1HE 3VP8A 1KYOI 2HLOA 2O1JA 1BSHA 3M0AA 3TK1A 1NAYA 1FZCA 2WSSH 1W2EA 1FDOA 3HUSC 4D6TG 1EXJA 1L4AC 2KS1B 3FXEA 3OW2O 1A02F 3LIDA 4UB6H 1IK7A 3RGUA 1VQPP 2V7QH 2H89C 4AYCA 2I8DA 1X22A 2FYUK 5B5EE 3FWNA 1CW5A 2M0BA 1NWQA 1JEKA 1T8ZA 5AVWB 2C0XA 1KILA 2W83C 2W90A 1S3JA 2R32A 3KZIH 1J2JB 3AE6C 1RE4A 2QA4P 3CC2P 1AVYA 1MV8A 1S5LX 5AVUB 1IFJA 1ZOYC 2YKOA 1OFCX 1ZRTE 1KILE 5AW6B 2QJPB 4XA4A 2FYUD 3QH9A 1LNQA 3L72E 5APWA 2NPSA 2LXCB 1FOSE 1SQPG 2HYNA 3AE5C 2MJZA 3CLQA 1R5LA 4I1LA 3P32A 1SQXE 3RL0g 1PPJD 5AVRB 1BE3G 2FYUJ 1HWTC 1NTZK 5AW1B 1SQBK 5GTIH 1LTBC 4C7NB 3H1LD 2BCCD 3H1HG 3MHVA 2Y0DA 1S2EA 1EC5A 2R5BA 2GUVA 1X0TA 1S5LH 2W6JH 4U7JA 3H1LJ 2BCCJ 1HGZA 2LXBA 1NTZD 2P7JA 3Q2YA 4I7ZC 3O8ZA 2Y0CA 5APUA 2IFMA 4LLHA 3H32A 1K05A 2KZJA 5AW4B 3H32B 3H1ID 1J1EB 1NTZJ 2FFDC 1RF0A 4WB4A 4L75A 2IBZE 2IYPA 2FYNB 1U7MA 2G3AA 2B88A 2C0WA 4JBZA 2AEJA 2WPRA 4N6JA 4PV1C 1EZVD 3L75D 3B5NA 3TGUG 2H43A 1D7MA 3AE8C 1GL2C 3H1IJ 2V7QJ 3B5NB 3L72G 2KIKA 5E79H 1VL2A 1E5WA 2HPCA 1M57D 3G3ZA 4W80A 3AEFC 1A02J 2D2CB 1W5CE 3CWBE 3L75J 3O6QA 1SQXG 1N73C 2A06D 3AE4C 5C39A 3KHUA 1SS1A 2YO3A 1DD3A 1LJ2A 2R44A 3T97A 2FXPA 2W27A 3CCJP 5CCGA 4L73A 4I2LC 3SWKA 3CCUP 1SFCD 3A7OA 2ZJSE 3T97B 1N7SC 2Z5HA 2B87B 4PD4I 2KOGA 1LT9A 4YXWH 1X79B 1YTZI 2PGDA 4O9BA 1IFMA 1URQB 1JY2O 1S1CX 4ZNCA 2CPSA 1GZLA 1HVVA 3PTZA 5DJTB 2N1TC 2NRGA 3C1LA 1Y8AA 1JCCA 3BCCG 3GHGA 4JQ0D 4H0LD 3MGNA 1KYOE 3RK3D 1M1JA 2QVAA 3GHGB 1H88A 3CCMP 2IBZG 1LP1B 3GF3A 3IAOA 1M1JB 1BCCD 1TU3F 3CXHH 3GW6A 4W7YA 3TNUA 2OYIB 3A0BE 1OXZA 1Y47A 3TNUB 1NOHA 4RJTA 1PP9E 3H25A 2E76D 1BCCJ 4Y28J 4YXDC 4OGQB 3CWBG 2PAJA 4W7ZA 5KLIC 1SQQE 1FS0E 1DX7A 4PJ0H 5APTA 3G9RA 1Q90D 4GODA 1AV1A 4WY4C 1M56D 3AE9C 1FC2C 1ZW0A 1LTJB 1CI6A 2MKVA 2FBWC 3CCQP 5K5GB 3KYQA 4U3FE 1S9KE 4ZKUA 2QEXP 1WT6A 1BGYE 2AXCA 3M06A 1CZQA 1NH4A 3V2PA 1R8EA 1S72P 1MKMA 5EFWB 1Q86Q 2VRSA 5BU5A 1T2KD 3F89A 1AQ5A 3RK2D 1G2CA 5BU8B 5CCHD 3VN0A 3PLNA 1G2CB 2B89A 2KSJA 2AEFA 1GL2A 2JP3A 5APQA 1L0LE 3CXHD 3MD0A 2WT7B 3M9HA 1PP9G 2H88C 2AXTH 1RE4C 5B66E 1IFDA 3PHLA 3U1AA 4LGDE 3IF4A 2QJPC 1N73A 4EDFA 2JEEA 3KQGA 2ZXEB 1SQQG 1J1DB 4TT3H 1FU1A 2P58A 3AE1C 1JO5A 1OVVA 3MP7B 3WMM0 3JCUE 1N7SA 3AEBC 2P10A 3CCSP 2FY8A 5KAFE 1AQTA 2E74B 3F5HA 3K5BA 4U3FG 3I5CA 1FE6A 4EYYQ 2M3BA 2OYOA 1BGYG 4N78E 3SWYA 5AVSB 1SLQA 3C8VA 5GTHH 5KJ7A 4BRYA 3H1KD 4PD4H 1H0TA 1EDLA 3A0HH 1W2BO 3V2NA 2ITAA 2OYHA 5KAIH 5CBOA 1VQLP 4B86A 1MFTA 4EI2A 1IC2A 1ZLLA 2E75D 4JPZB 4UB8E 2HODB 4NPFX 3AECC 3TDKA 3SFDC 2ZVOB 2IPPA 1NKZB 1N7LA 3WUVA 3U1CA 1K73Q 4GKGA 3L74G 1L0LG 1H89A 1NO4A 2FYNC 5KLVK 3CCLP 1RF0C 3HTKA 2E5YA 3HTKB 1EDIA 3B5NC 3NFQA 4I6MC 1KB9D 3PP5A 1JMBA 3Q3DA 3GLMA 3IR9A 2ZT9D 5AW5B 2BEZF 2J59M 5KLVD 1FDMA 4OWFA 1AA0A 2O01N 4OVNF 1KD1Q 1G1IA 3AEEC 4D6TD 3KXDA 1NYHA 1HJ0A 3AEAC 2QG4A 1U57A 1UIXA 2W8ZA 4EIJA 1VQNP 5KLVJ 5CCGC 1OVRA 4ZMDA 5B5EH 1N2DC 2KS1A 3EFFK 1M1KQ 2V4HA 4D6TJ 1LT9C 1URQC 2RMZA 2IYOA 1YJNP 4IFDK 1JY3O 1FOSF 3P7KA 4A7PA 5AVXB 2IDBA 1IFNA 2XV5A 5TJHA 2UWJE 1HBWA 3MZWB 1R5SA 2ZVNB 3FX0A 1LGHB 2W6AA 3VYIA 1VF5D 2Z5IA 3GHGC 5AW3B 1M1JC 2WQYC 3I55P 4RESB 3W68A 3TGUE 1L0NK 1QLED 3GG2A 1SQBE 3L73E 3CPWO 5KTBA 1DD4A 1BE3D 3ITKA 1G1JA 4GOFA 2YKPA 3VMYA 2WMMA 1RHZB 4OGQC 3M0DA 1PFIA 2XU6A 1GU4A 1JTHB 5KKZB 3SSUA 2H8PD 4ASWA 1OW8A 4C7NA 1VQ7P 1L0ND 3R2PA 1BE3J
chains in the Genus database with same CATH topology
2O1KA 1URQB 3RL0B 1JY2O 1IO4A 1QL2A 2CPSA 3RK3C 1GZLA 3BATA 2P67A 1HVVA 3E1IA 3HE4A 1X8YA 1LTJC 2N1TC 1N7SD 1GK4A 4M3LA 4JF7A 1FZAA 3HE4B 1FZBA 2YNYA 1JCCA 2XDJA 1GDTA 3GHGA 1GL2B 3HE5A 1KILC 3MGNA 1RF1C 2KP8A 3RK3D 2WSCH 1M1JA 2Q5UA 3GHGB 1H88A 3HE5B 1S9KD 3V5BA 2N1TD 1M1JB 3A2AA 4W7YA 1GK6A 1SFCB 1SQXK 1T3JA 2WWWA 3TNUA 2OYIB 1OXZA 1MFZA 1QL1A 1N73B 4LC1A 3M91A 2E43A 3VTPC 1KILD 2WZ7A 3TNUB 1SP4A 3RL0C 1NOHA 2W6BA 1L0LK 2Q3IA 1Z56A 3II6A 5APVA 2WSEH 3VP9A 3L4FA 1GU5A 3H6PA 3HD7B 1WRGA 2NPSC 3NMDA 5CMZA 1SQPK 1KQLA 1MUUA 2PAJA 1ZV8A 4W7ZA 5CJ0A 3V4QA 1FZCB 1N7SB 5AW0B 1AFOA 1DX7A 2KB7P 5AVVB 1LWUB 1LTGC 5APTA 5AW2B 2P1JA 1DH3A 4JYBA 1NHLA 4WY4C 2NPSD 1IJDB 3EFGA 1XTCC 2N1TA 3RK3B 5BVZA 5APXA 1SVFA 1FZGA 2OYIC 1LTJB 1CI6A 2R5DA 2C9LY 2HG5D 3KYQA 1M7LA 1J1DC 3BRVB 2OYHB 5AVTB 1S9KE 1LTAC 4ZKUA 2Q9IA 1RF1A 1WT6A 1T2KC 3OA7A 4IFFA 3RK2C 1KFMA 1KILB 2QM8A 1YTZT 2I1JA 3CL3D 3M06A 3HD7C 4WY4D 4EOTA 3TYYA 2I1KA 1CZQA 1NH4A 5CCHC 1RF1B 3B8EB 1JTHA 3V2PA 3A3YB 4OH8B 1LTTC 2POHA 3KDPB 2E42A 2VRSA 1IK9A 1URQA 4HH2A 2L5GB 3P8MC 5BU5A 5CJ4A 1T2KD 1FBMA 1AQ5A 3RK2D 1LTIC 2PP6A 1G2CA 1IFIA 5BU8B 3HD7D 1FZFA 5CCHD 4GT1A 2N9BA 3VN0A 2YMYA 3VMXA 5KJ7C 2A45I 1G2CB 2YO2A 3M9QA 1JOCA 2NPSB 4N78D 2KSJA 3P8CD 1KFNA 1GL2A 1X9VA 2OYHC 2XZRA 4ZKPA 5APQA 3L35A 2HFED 2H7HA 3MD0A 5AVZB 2WT7B 3OJAB 3M9HA 1ZR4A 1KZUB 4WY4A 1RE4C 1IFDA 2IX7C 2ZFCA 5KJ7D 1N86A 1SFCA 2OYIA 3U1AA 4WY4B 4AUWA 4LGDE 3BVHA 4N3YB 1N73A 2JEEA 3KQGA 4AQRD 2ZXEB 1OWAA 5AVYB 2XNXA 1FAVA 1ZR2A 1J1DB 2WITA 2GUSA 1FU1A 3NTNA 1FJPA 2QM7A 3HD7A 3LW5H 5CCHA 2C9NY 3VP8A 1JO5A 2HLOA 2O1JA 3RK2B 1SQVK 1MZ9A 3M0AA 3WMM0 2O01H 3TK1A 1JY3N 1FZCA 1N7SA 1W2EA 1LWUA 3HUSC 1L4AC 1HGVA 3UIAA 4DZOA 1HTLC 3I5CA 1RE3C 3L36A 1NTKK 2M3BA 1A02F 3N4XA 3LIDA 4N78E 3SWYA 5AVSB 1SLQA 5KJ7A 1LTJA 1JMMA 2CPBA 3CI9A 3V2NA 4AYCA 4WBAA 2OYHA 2FYUK 3A5TA 1L4AD 1FZEA 3NXSA 1CW5A 1NWQA 1T8ZA 4B86A 5AVWB 2C0XA 1KILA 2YKQA 1IC2A 1ZLLA 1XTGB 3MIWA 2R32A 1J2JB 1RE4A 4Y99C 2HODB 2P2UA 3BRTB 1MV8A 1CSBA 5AVUB 2HPCB 1IFJA 3IFMA 3VMZA 2YKOA 5AVQB 1NU1K 1VPCA 2IPPA 5AW6B 1NKZB 5APSA 1N7LA 2J58A 4XA4A 2FXMA 3U1CA 2M8RA 3LIEA 4GKGA 1H89A 2BASA 1EQ7A 1NO4A 5APWA 3L37A 5KLVK 2GM4A 1RF0C 2NPSA 1FOSE 2WPQA 3HTKA 2HYNA 3MUDA 2MJZA 3N7NA 3CLQA 1NTMK 4I1LA 2KLVA 3HUSA 1GD2E 3P32A 1L4AA 1HH0A 3HTKB 2FYZA 5AVRB 1RE3A 3B5NC 1DEBA 1VDFA 3HUSB 3NFQA 3U59A 2WT7A 3TSIA 1HWTC 1L4AB 4I6MC 2Z4EA 1NTZK 5AW1B 3PP5A 1H8AA 1SQBK 1LT9B 1LTBC 3IR9A 4C7RA 4C7NB 2FFDB 3SWFA 1NKNA 5AW5B 2J59M 3V2QA 2R5BA 2GUVA 2OARA 1FDMA 3B5ND 1JUNA 1G1IA 2LKMA 1HGZA 2P7JA 2Q7CA 1RY3A 4EIJA 3O8ZA 4Y99B 1LTSC 5APUA 3C9IA 2IFMA 4LLHA 1JCDA 5CCGC 3H32A 3M0DC 1YYCA 3EQ2A 4HYTB 3MTUE 1N2DC 5AW4B 3H32B 1HJBA 1JY3P 2WTYA 1LT9C 1URQC 1J1EB 5AW7B 2FFDC 4IFDK 1RF0A 2XKMA 1JY3O 1FOSF 3P7KA 4WB4A 3P8CE 5AVXB 5CCGD 4GIFA 2C0WA 1IFNA 2XV5A 3M9BA 2WPRA 4N6JA 3VOPA 1HBWA 4XE5B 3B5NA 2H43A 1JNMA 1GL2C 1LGHB 2W6AA 3VYIA 5AW8B 1NAFA 3V4WA 1URQD 3RL0D 2HODA 2Z5IA 3B5NB 2IFNA 3GHGC 5AW3B 1E5WA 2KYVA 5AW9B 2HPCA 3V2RA 2A45H 3G3ZA 2WSFH 1M1JC 1FJKA 2A45G 4W80A 1A02J 4JYCA 1GW3A 1SFCC 2WPSA 4C46A 1HUCA 2N1TB 2R3CA 3BASA 1N73C 4IFMA 4RESB 1ZN5A 1GL2D 1L0NK 5CHXA 1SQQK 5APYA 1CI6B 3OAKA 1J1EC 2FKWB 4DOJA 2YO3A 4KHXA 5KTBA 1G1JA 2YKPA 3VMYA 3T97A 2W27A 5CCGA 4I2LC 3M0DA 3HRNA 1JY2N 1SFCD 3A7OA 1T3UA 1FZCC 1PFIA 1N7SC 2XU6A 2Z5HA 1GU4A 1LWUC 1JTHB 2KOGA 3KPEA 2H8PD 1GW4A 1JY2P 1LT9A 1GTWA 4C7NA 1X79B 1YTZI 2FFDA 4O9BA 3R2PA 2JJLA 1IFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OJA B;  5BU8 B;  3VP8 A;  3VP9 A;  3BAT A;  1NKN A;  3C9I A;  3HRN A;  4GIF A;  1WT6 A;  5BVZ A;  3U1A A;  3N7N A;  4N78 D;  4I1L A;  4N3Y B;  2JEE A;  2POH A;  3BAS A;  3P8C D;  2FXM A;  3U1C A;  3U59 A;  4ZKP A;  1X79 B;  4ZKU A;  5BU5 A;  4O9B A;  1IC2 A;  5KTB A;  3N4X A; 
#chains in the Genus database with same CATH topology
 1QL2 A;  2K37 A;  3HE4 A;  1LTJ C;  3USS A;  4M3L A;  4JF7 A;  1FZA A;  3HE4 B;  2K88 A;  1T6A A;  2QJY B;  4R4L A;  1GDT A;  1L0N J;  2M5A B;  2KP8 A;  2Q5U A;  1M90 Q;  3V5B A;  1PPJ G;  4L74 A;  1SFC B;  1SQX K;  3Q5R A;  3H1L G;  3BCC E;  3VTP C;  3AED C;  1KIL D;  1EXI A;  1SP4 A;  3RL0 C;  3L70 E;  5GTI E;  2Q3I A;  1Z56 A;  3II6 A;  2WSE H;  3L4F A;  3H6P A;  3HD7 B;  3MUD C;  1KQL A;  3D6Y A;  1MUU A;  3JSV C;  3V4Q A;  1AFO A;  1NTZ G;  1LWU B;  1SQB G;  1SQX D;  1YHQ P;  4KT0 J;  3L73 G;  2P1J A;  2RN0 A;  2Q3E A;  1QGK B;  4H13 C;  1KV4 A;  1NHL A;  4H0L B;  3GF7 A;  2NPS D;  3RK3 B;  2IZ0 A;  1NTM E;  1NJI Q;  1FZG A;  2NZ2 A;  2C9L Y;  2HG5 D;  4YPC A;  1M7L A;  1J1D C;  1QVF O;  1SQX J;  1KQG B;  1OZH A;  4IFF A;  2QM8 A;  2I1J A;  4H44 D;  3TYY A;  2B87 A;  5L8R J;  2E76 B;  3A3Y B;  3QWO C;  2E74 C;  2JWD A;  1QX8 A;  3H1J D;  1URQ A;  3CCE P;  2JDI H;  2L5G B;  3P8M C;  1KYO H;  2PP6 A;  4GDO A;  3HD7 D;  1K8A Q;  1VQ6 P;  1FZF A;  1KOR A;  5KJ7 C;  3I56 P;  1S4X A;  2IBZ D;  1UII A;  3A0B H;  2OYH C;  2XZR A;  3H1J J;  1P84 E;  2O3J A;  2HFE D;  2H7H A;  1LP1 A;  3L70 G;  3OJA B;  3PRJ A;  2IX7 C;  1NVO A;  2G8Y A;  1KN7 A;  2OYI A;  4KJM A;  3BVH A;  3S1K A;  2XNX A;  2ZYA A;  1E79 H;  3CWB D;  2JWA A;  1FJP A;  3TF5 A;  3WU2 E;  5CCH A;  2C9N Y;  1KQF B;  3RK2 B;  3D70 A;  1SQV K;  2O01 H;  1NTM G;  2WSE J;  2IZ1 A;  1HGV A;  3CWB J;  1HTL C;  3L36 A;  3E1R A;  1NTK K;  4R4M A;  1LTJ A;  1Y9B A;  1JMM A;  1PZQ A;  1SQV D;  3CXH E;  1JB0 J;  4WBA A;  2E5T A;  1L4A D;  4IOI H;  3NXS A;  3ABV C;  1XTG B;  2P2U A;  3BRT B;  1NTK D;  1CSB A;  2ZXX A;  1SQV J;  3PJS K;  1KYO D;  5AVQ B;  3VMZ A;  1NU1 K;  2JKV A;  2J58 A;  3S9O A;  2BAS A;  1EQ7 A;  1NTK J;  3L37 A;  2M3E A;  5B66 H;  3MUD A;  2RKL A;  3N7N A;  1PP9 D;  1GD2 E;  1PGO A;  4GOE A;  2OTL P;  3AE3 C;  1IZN B;  1BDD A;  1RE3 A;  1DEB A;  1NU1 D;  4ASV A;  2WT7 A;  3U59 A;  3S4R A;  3TSI A;  2KK7 A;  1VQ4 P;  3L74 E;  1SQQ D;  2OGU A;  2FFD B;  2E75 B;  1N8R Q;  3SWF A;  1EZV I;  3JCU H;  1PP9 J;  5KAF H;  1NU1 J;  1IFP A;  3CCR P;  1SQQ J;  1YQ3 C;  5TIS E;  4U3F D;  2Q7C A;  4Y99 B;  1LTS C;  3C9I A;  1JCD A;  3M0D C;  2KNC B;  5KKZ C;  3MTU E;  2O01 J;  1HJB A;  1KMI Z;  2WTY A;  1EDJ A;  4UB8 H;  4U3F J;  3GMA A;  1PGQ A;  3P8C E;  1VQO P;  2ZT9 B;  4GIF A;  3D6Z A;  1KB9 E;  1Q7Y Q;  2YXQ B;  1YI2 P;  4XE5 B;  2OTJ P;  3L71 E;  1JNM A;  2QSI A;  3CC4 P;  3AE7 C;  3V4W A;  1GMJ A;  3RL0 D;  2HOD A;  2IFN A;  2KLU A;  2YIU B;  2KZI A;  5AW9 B;  3V2R A;  2WSF H;  1FJK A;  2A45 G;  3CX5 E;  3H1K J;  3B71 A;  1Q82 Q;  2K9Y A;  1GW3 A;  1SFC C;  2KI7 B;  2WPS A;  4PV1 D;  4C46 A;  1HUC A;  2N1T B;  4IFM A;  1GL2 D;  4RO0 A;  2CK3 H;  5APY A;  3OAK A;  1J1E C;  4BXL A;  2FKW B;  4DOJ A;  1JM0 A;  1BDC A;  3HRN A;  2WPV B;  1LWU C;  5H2F E;  3KPE A;  1GW4 A;  1JY2 P;  1GTW A;  3Q5P A;  3EWK A;  2JJL A;  1VF5 B;  2R3S A;  4H0L C;  1IO4 A;  3RK3 C;  1YIT P;  2D2C C;  2P67 A;  1N7S D;  2L91 A;  2PRR A;  5KLI B;  4DJG A;  4K35 A;  3HE5 A;  1P84 I;  2WSC H;  2QE7 H;  3HE5 B;  2E76 C;  2N1T D;  3CD6 P;  2QIW A;  2GA1 A;  2FYU E;  1GK6 A;  1T3J A;  3L71 G;  1QL1 A;  3W67 A;  2E43 A;  4PD4 D;  2ZYD A;  2WZ7 A;  3V6I A;  2KXP B;  3VP9 A;  4HJG H;  3NMD A;  1PPJ E;  1SQP K;  5CJ0 A;  1L0N E;  1FZC B;  5AW0 B;  3H1L E;  1U7J A;  2BCC E;  5AW2 B;  1VQ9 P;  4IL6 E;  1IJD B;  3EFG A;  1XTC C;  5BVZ A;  2Y9Z A;  2OYI C;  2WSF J;  2BEQ D;  2R5D A;  3CXH I;  1SQP D;  3BRV B;  4XFJ A;  1NTZ E;  1VQK P;  1YJW P;  1LTA C;  2Q9I A;  1RF1 A;  1T2K C;  3RK2 C;  2QJK B;  1KFM A;  1KIL B;  1YTZ T;  1YIJ P;  3CL3 D;  4WY4 D;  5CCH C;  1RF1 B;  4UB6 E;  1JTH A;  4OH8 B;  3H1H D;  3H1I E;  1SQP J;  3JC2 2;  2E42 A;  1IK9 A;  1FBM A;  3KZI E;  4Z1M H;  4WVZ A;  1EZV E;  2N9B A;  3L75 E;  2YMY A;  3VMX A;  1VQ5 P;  2A45 I;  5CBN A;  3H1H J;  2YO2 A;  3M9Q A;  2NPS B;  2FYU G;  2HR3 A;  2M5A A;  2WVR A;  3L35 A;  4DCK A;  5AVZ B;  3D71 A;  1AJY A;  2A06 E;  1PGP A;  1M8O B;  1N86 A;  1SFC A;  1OW6 A;  4H44 B;  2WSC J;  1L0N G;  1OWA A;  1Q2N A;  1FAV A;  2BCC G;  1ZR2 A;  1L2P A;  1ZRT D;  3TGU D;  2B9B A;  3HD7 A;  3LW5 H;  1SQB D;  3L73 D;  1MZ9 A;  3L72 D;  1JY3 N;  3H1J E;  1LWU A;  2OTK E;  3FXD A;  1S5L E;  2KUB A;  3UIA A;  2Q6Q A;  4DZO A;  1RQU A;  1RE3 C;  4BWN A;  3TGU J;  3N4X A;  2E75 C;  3CMA P;  1SQB J;  3L73 J;  1OW7 A;  3L72 J;  2CPB A;  3CI9 A;  3H1I G;  1KB9 I;  3A5T A;  4MN4 C;  1FZE A;  2DW3 A;  5M1B A;  3RK3 E;  1YJ9 P;  3Q5S A;  3CC7 P;  2YKQ A;  3MIW A;  3SFE C;  1BCC E;  4Y99 C;  1EZV G;  3L75 G;  3G6E P;  2HPC B;  3IFM A;  1OVU A;  4NPD A;  3CX5 I;  1VPC A;  5APS A;  3FWL A;  2FXM A;  1P84 H;  3O6Q B;  2M8R A;  3LIE A;  5E79 E;  2ZT9 C;  3BCC D;  2GM4 A;  1RQV A;  2WPQ A;  3L70 D;  2A06 G;  2ZYG A;  1NTM K;  2KLV A;  3HUS A;  1L4A A;  1NGM B;  1HH0 A;  2FYZ A;  3R4Y A;  1VDF A;  3HUS B;  1L4A B;  2Z4E A;  2YIU C;  1OX3 A;  1H8A A;  1LT9 B;  2LR2 A;  3WU2 H;  4C7R A;  4YTP C;  3BCC J;  1SQV E;  1NKN A;  3L70 J;  3ZDM A;  4TLF A;  3V2Q A;  1LT1 A;  3H1J G;  2JR8 A;  3PH0 A;  2Q1K A;  2OAR A;  3B5N D;  1NTM D;  1JUN A;  1ZXG A;  1NTK E;  2KSE A;  2LKM A;  1QEX A;  3IN6 A;  4K3A A;  2K3R A;  1OMI A;  3RBZ A;  2D2C D;  1RY3 A;  2PFX A;  4HB1 A;  3LW5 J;  1YYC A;  3EQ2 A;  4HYT B;  1NTM J;  1JY3 P;  1VF5 C;  2AEM A;  5AW7 B;  1USE A;  1BCC G;  2XKM A;  1DIP A;  5CCG D;  1NU1 E;  3M9B A;  3VOP A;  1VQ8 P;  5AW8 B;  1NAF A;  4CPG A;  1URQ D;  2Y0E A;  2KYV A;  1P84 D;  2A45 H;  1K04 A;  4QMA A;  4JYC A;  2R3C A;  3BAS A;  1ZN5 A;  5CHX A;  1YBK A;  1SQQ K;  4PJ0 E;  4NPE A;  1CI6 B;  3B4S A;  1KC8 Q;  4KHX A;  3E7K A;  1SQV G;  4I7Z B;  2OQQ A;  1JY2 N;  1T3U A;  1FZC C;  1RH5 B;  1PV3 A;  1YQ4 C;  1NTK G;  2RH0 A;  2FFD A;  1KQS O;  5TIS H;  3H1K E;  2O1K A;  3RL0 B;  4OGQ D;  3BAT A;  1ZP0 C;  4DT0 A;  3E1I A;  1X8Y A;  1FDI A;  1GK4 A;  1FZB A;  2YNY A;  1VQM P;  4PV1 B;  2XDJ A;  1GL2 B;  2QJK C;  1KIL C;  1RF1 C;  3AE2 C;  4H13 B;  2KNC A;  1S9K D;  3RBX A;  1NU1 G;  1KB9 H;  1BGY D;  3AEG C;  2N9Y B;  3A2A A;  4HKZ H;  2WWW A;  1MFZ A;  1N73 B;  4LC1 A;  3M91 A;  1QVG O;  2W6B A;  1L0L K;  2QRX A;  4WWI A;  5APV A;  2K9J A;  2AXT E;  1HF9 A;  3CX5 H;  1GU5 A;  2XND H;  1WRG A;  2NPS C;  5CMZ A;  1BGY J;  1ZME C;  1PL5 A;  2K9J B;  1ZV8 A;  3WUU A;  2QJY C;  1N7S B;  2KB7 P;  5AVV B;  1LTG C;  1K9M Q;  1PGJ A;  1DH3 A;  4JYB A;  5KLV E;  4H44 C;  3L74 D;  1L0L D;  2IBZ I;  2N1T A;  5DJU B;  5APX A;  1SVF A;  4BRY B;  5H2F H;  1BSN A;  1AVO A;  4D6T E;  1DEE G;  1H0T B;  2OYH B;  5AVT B;  3G71 P;  3OA7 A;  3H1K G;  4H13 D;  1PIX A;  3L74 J;  1L0L J;  3HD7 C;  4EOT A;  2I1K A;  5GTH E;  1WMK A;  3B8E B;  1KTM A;  4PD4 E;  4IL6 X;  3A0H E;  1LTT C;  2POH A;  5KAI E;  3KDP B;  3G4S P;  3VMA A;  1Q81 Q;  2ZAE B;  4HH2 A;  5CJ4 A;  2K1A A;  1LTI C;  1IFI A;  3FGA D;  4GT1 A;  1EDK A;  1JOC A;  2YMK A;  4N78 D;  2E74 D;  3P8C D;  1KFN A;  3WUT A;  1X9V A;  1USD A;  2J5U A;  2FXO A;  4ZKP A;  2SPZ A;  3Q1M A;  3L71 D;  1ZR4 A;  1OIP A;  1KZU B;  4WY4 A;  1SQP E;  2ZFC A;  5KJ7 D;  4AUW A;  4WY4 B;  4L76 A;  4N3Y B;  3CCV P;  2Y9Y A;  4AQR D;  5AVY B;  3CX5 D;  1BE3 E;  4RKU J;  2JO1 A;  3CME P;  2WIT A;  2YXR B;  2GUS A;  3NTN A;  3L71 J;  4IL6 H;  2QM7 A;  5KLV G;  3H1H E;  3VP8 A;  1KYO I;  2HLO A;  2O1J A;  1BSH A;  3M0A A;  3TK1 A;  1NAY A;  1FZC A;  2WSS H;  1W2E A;  1FDO A;  3HUS C;  4D6T G;  1EXJ A;  1L4A C;  2KS1 B;  3FXE A;  3OW2 O;  1A02 F;  3LID A;  4UB6 H;  1IK7 A;  3RGU A;  1VQP P;  2V7Q H;  2H89 C;  4AYC A;  2I8D A;  1X22 A;  2FYU K;  5B5E E;  3FWN A;  1CW5 A;  2M0B A;  1NWQ A;  1JEK A;  1T8Z A;  5AVW B;  2C0X A;  1KIL A;  2W83 C;  2W90 A;  1S3J A;  2R32 A;  3KZI H;  1J2J B;  3AE6 C;  1RE4 A;  2QA4 P;  3CC2 P;  1AVY A;  1MV8 A;  1S5L X;  5AVU B;  1IFJ A;  1ZOY C;  2YKO A;  1OFC X;  1ZRT E;  1KIL E;  5AW6 B;  2QJP B;  4XA4 A;  2FYU D;  3QH9 A;  1LNQ A;  3L72 E;  5APW A;  2NPS A;  2LXC B;  1FOS E;  1SQP G;  2HYN A;  3AE5 C;  2MJZ A;  3CLQ A;  1R5L A;  4I1L A;  3P32 A;  1SQX E;  3RL0 g;  1PPJ D;  5AVR B;  1BE3 G;  2FYU J;  1HWT C;  1NTZ K;  5AW1 B;  1SQB K;  5GTI H;  1LTB C;  4C7N B;  3H1L D;  2BCC D;  3H1H G;  3MHV A;  2Y0D A;  1S2E A;  1EC5 A;  2R5B A;  2GUV A;  1X0T A;  1S5L H;  2W6J H;  4U7J A;  3H1L J;  2BCC J;  1HGZ A;  2LXB A;  1NTZ D;  2P7J A;  3Q2Y A;  4I7Z C;  3O8Z A;  2Y0C A;  5APU A;  2IFM A;  4LLH A;  3H32 A;  1K05 A;  2KZJ A;  5AW4 B;  3H32 B;  3H1I D;  1J1E B;  1NTZ J;  2FFD C;  1RF0 A;  4WB4 A;  4L75 A;  2IBZ E;  2IYP A;  2FYN B;  1U7M A;  2G3A A;  2B88 A;  2C0W A;  4JBZ A;  2AEJ A;  2WPR A;  4N6J A;  4PV1 C;  1EZV D;  3L75 D;  3B5N A;  3TGU G;  2H43 A;  1D7M A;  3AE8 C;  1GL2 C;  3H1I J;  2V7Q J;  3B5N B;  3L72 G;  2KIK A;  5E79 H;  1VL2 A;  1E5W A;  2HPC A;  1M57 D;  3G3Z A;  4W80 A;  3AEF C;  1A02 J;  2D2C B;  1W5C E;  3CWB E;  3L75 J;  3O6Q A;  1SQX G;  1N73 C;  2A06 D;  3AE4 C;  5C39 A;  3KHU A;  1SS1 A;  2YO3 A;  1DD3 A;  1LJ2 A;  2R44 A;  3T97 A;  2FXP A;  2W27 A;  3CCJ P;  5CCG A;  4L73 A;  4I2L C;  3SWK A;  3CCU P;  1SFC D;  3A7O A;  2ZJS E;  3T97 B;  1N7S C;  2Z5H A;  2B87 B;  4PD4 I;  2KOG A;  1LT9 A;  4YXW H;  1X79 B;  1YTZ I;  2PGD A;  4O9B A;  1IFM A;  1URQ B;  1JY2 O;  1S1C X;  4ZNC A;  2CPS A;  1GZL A;  1HVV A;  3PTZ A;  5DJT B;  2N1T C;  2NRG A;  3C1L A;  1Y8A A;  1JCC A;  3BCC G;  3GHG A;  4JQ0 D;  4H0L D;  3MGN A;  1KYO E;  3RK3 D;  1M1J A;  2QVA A;  3GHG B;  1H88 A;  3CCM P;  2IBZ G;  1LP1 B;  3GF3 A;  3IAO A;  1M1J B;  1BCC D;  1TU3 F;  3CXH H;  3GW6 A;  4W7Y A;  3TNU A;  2OYI B;  3A0B E;  1OXZ A;  1Y47 A;  3TNU B;  1NOH A;  4RJT A;  1PP9 E;  3H25 A;  2E76 D;  1BCC J;  4Y28 J;  4YXD C;  4OGQ B;  3CWB G;  2PAJ A;  4W7Z A;  5KLI C;  1SQQ E;  1FS0 E;  1DX7 A;  4PJ0 H;  5APT A;  3G9R A;  1Q90 D;  4GOD A;  1AV1 A;  4WY4 C;  1M56 D;  3AE9 C;  1FC2 C;  1ZW0 A;  1LTJ B;  1CI6 A;  2MKV A;  2FBW C;  3CCQ P;  5K5G B;  3KYQ A;  4U3F E;  1S9K E;  4ZKU A;  2QEX P;  1WT6 A;  1BGY E;  2AXC A;  3M06 A;  1CZQ A;  1NH4 A;  3V2P A;  1R8E A;  1S72 P;  1MKM A;  5EFW B;  1Q86 Q;  2VRS A;  5BU5 A;  1T2K D;  3F89 A;  1AQ5 A;  3RK2 D;  1G2C A;  5BU8 B;  5CCH D;  3VN0 A;  3PLN A;  1G2C B;  2B89 A;  2KSJ A;  2AEF A;  1GL2 A;  2JP3 A;  5APQ A;  1L0L E;  3CXH D;  3MD0 A;  2WT7 B;  3M9H A;  1PP9 G;  2H88 C;  2AXT H;  1RE4 C;  5B66 E;  1IFD A;  3PHL A;  3U1A A;  4LGD E;  3IF4 A;  2QJP C;  1N73 A;  4EDF A;  2JEE A;  3KQG A;  2ZXE B;  1SQQ G;  1J1D B;  4TT3 H;  1FU1 A;  2P58 A;  3AE1 C;  1JO5 A;  1OVV A;  3MP7 B;  3WMM 0;  3JCU E;  1N7S A;  3AEB C;  2P10 A;  3CCS P;  2FY8 A;  5KAF E;  1AQT A;  2E74 B;  3F5H A;  3K5B A;  4U3F G;  3I5C A;  1FE6 A;  4EYY Q;  2M3B A;  2OYO A;  1BGY G;  4N78 E;  3SWY A;  5AVS B;  1SLQ A;  3C8V A;  5GTH H;  5KJ7 A;  4BRY A;  3H1K D;  4PD4 H;  1H0T A;  1EDL A;  3A0H H;  1W2B O;  3V2N A;  2ITA A;  2OYH A;  5KAI H;  5CBO A;  1VQL P;  4B86 A;  1MFT A;  4EI2 A;  1IC2 A;  1ZLL A;  2E75 D;  4JPZ B;  4UB8 E;  2HOD B;  4NPF X;  3AEC C;  3TDK A;  3SFD C;  2ZVO B;  2IPP A;  1NKZ B;  1N7L A;  3WUV A;  3U1C A;  1K73 Q;  4GKG A;  3L74 G;  1L0L G;  1H89 A;  1NO4 A;  2FYN C;  5KLV K;  3CCL P;  1RF0 C;  3HTK A;  2E5Y A;  3HTK B;  1EDI A;  3B5N C;  3NFQ A;  4I6M C;  1KB9 D;  3PP5 A;  1JMB A;  3Q3D A;  3GLM A;  3IR9 A;  2ZT9 D;  5AW5 B;  2BEZ F;  2J59 M;  5KLV D;  1FDM A;  4OWF A;  1AA0 A;  2O01 N;  4OVN F;  1KD1 Q;  1G1I A;  3AEE C;  4D6T D;  3KXD A;  1NYH A;  1HJ0 A;  3AEA C;  2QG4 A;  1U57 A;  1UIX A;  2W8Z A;  4EIJ A;  1VQN P;  5KLV J;  5CCG C;  1OVR A;  4ZMD A;  5B5E H;  1N2D C;  2KS1 A;  3EFF K;  1M1K Q;  2V4H A;  4D6T J;  1LT9 C;  1URQ C;  2RMZ A;  2IYO A;  1YJN P;  4IFD K;  1JY3 O;  1FOS F;  3P7K A;  4A7P A;  5AVX B;  2IDB A;  1IFN A;  2XV5 A;  5TJH A;  2UWJ E;  1HBW A;  3MZW B;  1R5S A;  2ZVN B;  3FX0 A;  1LGH B;  2W6A A;  3VYI A;  1VF5 D;  2Z5I A;  3GHG C;  5AW3 B;  1M1J C;  2WQY C;  3I55 P;  4RES B;  3W68 A;  3TGU E;  1L0N K;  1QLE D;  3GG2 A;  1SQB E;  3L73 E;  3CPW O;  5KTB A;  1DD4 A;  1BE3 D;  3ITK A;  1G1J A;  4GOF A;  2YKP A;  3VMY A;  2WMM A;  1RHZ B;  4OGQ C;  3M0D A;  1PFI A;  2XU6 A;  1GU4 A;  1JTH B;  5KKZ B;  3SSU A;  2H8P D;  4ASW A;  1OW8 A;  4C7N A;  1VQ7 P;  1L0N D;  3R2P A;  1BE3 J; 
#chains in the Genus database with same CATH homology
 2O1K A;  1URQ B;  3RL0 B;  1JY2 O;  1IO4 A;  1QL2 A;  2CPS A;  3RK3 C;  1GZL A;  3BAT A;  2P67 A;  1HVV A;  3E1I A;  3HE4 A;  1X8Y A;  1LTJ C;  2N1T C;  1N7S D;  1GK4 A;  4M3L A;  4JF7 A;  1FZA A;  3HE4 B;  1FZB A;  2YNY A;  1JCC A;  2XDJ A;  1GDT A;  3GHG A;  1GL2 B;  3HE5 A;  1KIL C;  3MGN A;  1RF1 C;  2KP8 A;  3RK3 D;  2WSC H;  1M1J A;  2Q5U A;  3GHG B;  1H88 A;  3HE5 B;  1S9K D;  3V5B A;  2N1T D;  1M1J B;  3A2A A;  4W7Y A;  1GK6 A;  1SFC B;  1SQX K;  1T3J A;  2WWW A;  3TNU A;  2OYI B;  1OXZ A;  1MFZ A;  1QL1 A;  1N73 B;  4LC1 A;  3M91 A;  2E43 A;  3VTP C;  1KIL D;  2WZ7 A;  3TNU B;  1SP4 A;  3RL0 C;  1NOH A;  2W6B A;  1L0L K;  2Q3I A;  1Z56 A;  3II6 A;  5APV A;  2WSE H;  3VP9 A;  3L4F A;  1GU5 A;  3H6P A;  3HD7 B;  1WRG A;  2NPS C;  3NMD A;  5CMZ A;  1SQP K;  1KQL A;  1MUU A;  2PAJ A;  1ZV8 A;  4W7Z A;  5CJ0 A;  3V4Q A;  1FZC B;  1N7S B;  5AW0 B;  1AFO A;  1DX7 A;  2KB7 P;  5AVV B;  1LWU B;  1LTG C;  5APT A;  5AW2 B;  2P1J A;  1DH3 A;  4JYB A;  1NHL A;  4WY4 C;  2NPS D;  1IJD B;  3EFG A;  1XTC C;  2N1T A;  3RK3 B;  5BVZ A;  5APX A;  1SVF A;  1FZG A;  2OYI C;  1LTJ B;  1CI6 A;  2R5D A;  2C9L Y;  2HG5 D;  3KYQ A;  1M7L A;  1J1D C;  3BRV B;  2OYH B;  5AVT B;  1S9K E;  1LTA C;  4ZKU A;  2Q9I A;  1RF1 A;  1WT6 A;  1T2K C;  3OA7 A;  4IFF A;  3RK2 C;  1KFM A;  1KIL B;  2QM8 A;  1YTZ T;  2I1J A;  3CL3 D;  3M06 A;  3HD7 C;  4WY4 D;  4EOT A;  3TYY A;  2I1K A;  1CZQ A;  1NH4 A;  5CCH C;  1RF1 B;  3B8E B;  1JTH A;  3V2P A;  3A3Y B;  4OH8 B;  1LTT C;  2POH A;  3KDP B;  2E42 A;  2VRS A;  1IK9 A;  1URQ A;  4HH2 A;  2L5G B;  3P8M C;  5BU5 A;  5CJ4 A;  1T2K D;  1FBM A;  1AQ5 A;  3RK2 D;  1LTI C;  2PP6 A;  1G2C A;  1IFI A;  5BU8 B;  3HD7 D;  1FZF A;  5CCH D;  4GT1 A;  2N9B A;  3VN0 A;  2YMY A;  3VMX A;  5KJ7 C;  2A45 I;  1G2C B;  2YO2 A;  3M9Q A;  1JOC A;  2NPS B;  4N78 D;  2KSJ A;  3P8C D;  1KFN A;  1GL2 A;  1X9V A;  2OYH C;  2XZR A;  4ZKP A;  5APQ A;  3L35 A;  2HFE D;  2H7H A;  3MD0 A;  5AVZ B;  2WT7 B;  3OJA B;  3M9H A;  1ZR4 A;  1KZU B;  4WY4 A;  1RE4 C;  1IFD A;  2IX7 C;  2ZFC A;  5KJ7 D;  1N86 A;  1SFC A;  2OYI A;  3U1A A;  4WY4 B;  4AUW A;  4LGD E;  3BVH A;  4N3Y B;  1N73 A;  2JEE A;  3KQG A;  4AQR D;  2ZXE B;  1OWA A;  5AVY B;  2XNX A;  1FAV A;  1ZR2 A;  1J1D B;  2WIT A;  2GUS A;  1FU1 A;  3NTN A;  1FJP A;  2QM7 A;  3HD7 A;  3LW5 H;  5CCH A;  2C9N Y;  3VP8 A;  1JO5 A;  2HLO A;  2O1J A;  3RK2 B;  1SQV K;  1MZ9 A;  3M0A A;  3WMM 0;  2O01 H;  3TK1 A;  1JY3 N;  1FZC A;  1N7S A;  1W2E A;  1LWU A;  3HUS C;  1L4A C;  1HGV A;  3UIA A;  4DZO A;  1HTL C;  3I5C A;  1RE3 C;  3L36 A;  1NTK K;  2M3B A;  1A02 F;  3N4X A;  3LID A;  4N78 E;  3SWY A;  5AVS B;  1SLQ A;  5KJ7 A;  1LTJ A;  1JMM A;  2CPB A;  3CI9 A;  3V2N A;  4AYC A;  4WBA A;  2OYH A;  2FYU K;  3A5T A;  1L4A D;  1FZE A;  3NXS A;  1CW5 A;  1NWQ A;  1T8Z A;  4B86 A;  5AVW B;  2C0X A;  1KIL A;  2YKQ A;  1IC2 A;  1ZLL A;  1XTG B;  3MIW A;  2R32 A;  1J2J B;  1RE4 A;  4Y99 C;  2HOD B;  2P2U A;  3BRT B;  1MV8 A;  1CSB A;  5AVU B;  2HPC B;  1IFJ A;  3IFM A;  3VMZ A;  2YKO A;  5AVQ B;  1NU1 K;  1VPC A;  2IPP A;  5AW6 B;  1NKZ B;  5APS A;  1N7L A;  2J58 A;  4XA4 A;  2FXM A;  3U1C A;  2M8R A;  3LIE A;  4GKG A;  1H89 A;  2BAS A;  1EQ7 A;  1NO4 A;  5APW A;  3L37 A;  5KLV K;  2GM4 A;  1RF0 C;  2NPS A;  1FOS E;  2WPQ A;  3HTK A;  2HYN A;  3MUD A;  2MJZ A;  3N7N A;  3CLQ A;  1NTM K;  4I1L A;  2KLV A;  3HUS A;  1GD2 E;  3P32 A;  1L4A A;  1HH0 A;  3HTK B;  2FYZ A;  5AVR B;  1RE3 A;  3B5N C;  1DEB A;  1VDF A;  3HUS B;  3NFQ A;  3U59 A;  2WT7 A;  3TSI A;  1HWT C;  1L4A B;  4I6M C;  2Z4E A;  1NTZ K;  5AW1 B;  3PP5 A;  1H8A A;  1SQB K;  1LT9 B;  1LTB C;  3IR9 A;  4C7R A;  4C7N B;  2FFD B;  3SWF A;  1NKN A;  5AW5 B;  2J59 M;  3V2Q A;  2R5B A;  2GUV A;  2OAR A;  1FDM A;  3B5N D;  1JUN A;  1G1I A;  2LKM A;  1HGZ A;  2P7J A;  2Q7C A;  1RY3 A;  4EIJ A;  3O8Z A;  4Y99 B;  1LTS C;  5APU A;  3C9I A;  2IFM A;  4LLH A;  1JCD A;  5CCG C;  3H32 A;  3M0D C;  1YYC A;  3EQ2 A;  4HYT B;  3MTU E;  1N2D C;  5AW4 B;  3H32 B;  1HJB A;  1JY3 P;  2WTY A;  1LT9 C;  1URQ C;  1J1E B;  5AW7 B;  2FFD C;  4IFD K;  1RF0 A;  2XKM A;  1JY3 O;  1FOS F;  3P7K A;  4WB4 A;  3P8C E;  5AVX B;  5CCG D;  4GIF A;  2C0W A;  1IFN A;  2XV5 A;  3M9B A;  2WPR A;  4N6J A;  3VOP A;  1HBW A;  4XE5 B;  3B5N A;  2H43 A;  1JNM A;  1GL2 C;  1LGH B;  2W6A A;  3VYI A;  5AW8 B;  1NAF A;  3V4W A;  1URQ D;  3RL0 D;  2HOD A;  2Z5I A;  3B5N B;  2IFN A;  3GHG C;  5AW3 B;  1E5W A;  2KYV A;  5AW9 B;  2HPC A;  3V2R A;  2A45 H;  3G3Z A;  2WSF H;  1M1J C;  1FJK A;  2A45 G;  4W80 A;  1A02 J;  4JYC A;  1GW3 A;  1SFC C;  2WPS A;  4C46 A;  1HUC A;  2N1T B;  2R3C A;  3BAS A;  1N73 C;  4IFM A;  4RES B;  1ZN5 A;  1GL2 D;  1L0N K;  5CHX A;  1SQQ K;  5APY A;  1CI6 B;  3OAK A;  1J1E C;  2FKW B;  4DOJ A;  2YO3 A;  4KHX A;  5KTB A;  1G1J A;  2YKP A;  3VMY A;  3T97 A;  2W27 A;  5CCG A;  4I2L C;  3M0D A;  3HRN A;  1JY2 N;  1SFC D;  3A7O A;  1T3U A;  1FZC C;  1PFI A;  1N7S C;  2XU6 A;  2Z5H A;  1GU4 A;  1LWU C;  1JTH B;  2KOG A;  3KPE A;  2H8P D;  1GW4 A;  1JY2 P;  1LT9 A;  1GTW A;  4C7N A;  1X79 B;  1YTZ I;  2FFD A;  4O9B A;  3R2P A;  2JJL A;  1IFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...