1NKNA

Visualizing an unstable coiled coil: the crystal structure of an n-terminal segment of the scallop myosin rod
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
74
structure length
74
Chain Sequence
MKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMKQLEDKVEELLSKNYHLENEVARLKKLVGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Visualization of an unstable coiled coil from the scallop myosin rod
pubmed doi rcsb
source organism Argopecten irradians, saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords S2N51-GCN4
total genus 35
structure length 74
sequence length 74
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nknA00
4I1LA 4GIFA 5KTBA 3BATA 5BU8B 3BASA 3VP9A 3N4XA 3OJAB 3U59A 3HRNA 3N7NA 3U1CA 2POHA 4N3YB 4N78D 2JEEA 3U1AA 1IC2A 1WT6A 4O9BA 2FXMA 1X79B 3P8CD 3C9IA 4ZKUA 1NKNA 5BU5A 3VP8A 5BVZA 4ZKPA
chains in the Genus database with same CATH superfamily
3IN6A 5AVRB 1Q81Q 1DEBA 1SQVD 1EXJA 2ITAA 1RY3A 1G2CB 5APTA 2WT7B 3H25A 2I1JA 3RK2B 3BRVB 3MIWA 3IAOA 1PIXA 2HODA 1OX3A 1PP9G 5APUA 3O6QA 4PJ0E 1MV8A 1WRGA 2YKOA 1KORA 3C8VA 2I8DA 3OJAB 1PL5A 2V7QJ 4PV1B 3U59A 4ASVA 1YITP 2FFDB 3GMAA 2DW3A 3SFDC 3OW2O 3AEFC 1BE3G 4UB8H 1KB9I 1J1DC 3H32A 1EZVD 4OVNF 1NTKJ 4OGQD 1L0NK 1KB9D 1NTKG 3AEEC 3CWBJ 4R4MA 1NVOA 3A0HE 1OW6A 2M8RA 2E5TA 3V2NA 2W90A 1SFCD 3D6YA 3PLNA 1U7MA 3FGAD 5GTIH 4DCKA 3AE4C 4ZNCA 2QG4A 3B71A 4WBAA 3HE5B 3H1JG 5KAFE 2IPPA 2A45I 3CL3D 3A7OA 3FXDA 3G9RA 2G8YA 1Y47A 2WQYC 3W68A 2MJZA 2OYIC 3V2QA 3CCUP 3BASA 4AYCA 1FBMA 5TISE 2IX7C 2M0BA 2Y0DA 3RBZA 1SFCA 3H1JD 1SQXG 4R4LA 1T3JA 2WMMA 3IF4A 2NPSC 4Y99B 2BCCJ 3T97B 3TNUA 1K05A 1YQ3C 4XA4A 4GODA 5AVZB 5KLVE 3WUVA 1BSHA 1Y8AA 1GW3A 2E75C 2POHA 5AVQB 1GTWA 2KB7P 3PJSK 1VL2A 1LTJB 5C39A 1LWUA 3PHLA 1S9KE 1GK4A 3GF3A 1NO4A 1RF0C 2GUSA 3BCCJ 1VQ6P 1AJYA 2KZJA 3WMM0 2O01H 2Q9IA 2M5AA 5B5EH 3MZWB 1PGPA 5GTIE 1R5SA 1K04A 2PAJA 3TDKA 3Q5SA 1M8OB 2AXCA 3SWYA 1ZR4A 1ZMEC 2YKQA 1M1JA 3BCCD 2FBWC 2UWJE 4BXLA 1RF1C 5CJ4A 2QM7A 1EZVE 1GU5A 1HVVA 1VQKP 5TISH 3JSVC 1N73C 2O1JA 3CCMP 4K35A 1KQSO 1SVFA 1X0TA 2G3AA 3L35A 2PFXA 3B8EB 3CX5I 4UB8E 2E76B 2RH0A 3RL0D 1GU4A 2FXOA 4L75A 5CCHD 2N1TC 2H89C 1CW5A 3L74J 2O01N 1VQLP 1NTME 1SQPG 3OAKA 2IDBA 1D7MA 2WSCH 3L74G 2GUVA 3L75G 3CXHI 3L70G 3NFQA 4W7YA 2WT7A 1N73B 1L0LG 1SQQD 3A0HH 3AEDC 1ZXGA 4RKUJ 1BCCE 5CCHC 3Q5PA 2OYHB 4DOJA 2YMYA 2E74D 3RL0C 3H1IJ 1NTMJ 1URQB 4H0LC 2R5BA 1GL2D 1ZRTE 3ABVC 3W67A 1M56D 3V5BA 1RE3C 3TGUD 1LT9A 1L0LE 4ZKPA 1HF9A 1OVVA 1SQBE 1ZLLA 2C0WA 5CJ0A 2XV5A 5AVTB 4Z1MH 1JB0J 5CCGC 2WSCJ 3B4SA 5TJHA 3MP7B 4I6MC 1SQVK 1HJ0A 3B5NA 2CPSA 2J59M 3L74D 3E1RA 4YPCA 2Y9ZA 2GM4A 1BE3D 1KYOE 4JYCA 1VQ5P 3HUSA 3L36A 1YJ9P 1N8RQ 1VQ8P 1GL2A 1NU1E 3IFMA 1PGOA 1YJWP 2OTLP 1NTZJ 1IFMA 1FZAA 1DEEG 1NTKE 3AECC 1JY2N 1KYOI 4Y28J 1FZFA 1LP1B 4W7ZA 1H88A 1JCDA 1RE4A 1NOHA 4BWNA 4WY4B 1BE3E 1KYOD 2ZVNB 2NPSD 1EDJA 3B5ND 3VMYA 1L2PA 2Z5HA 2FYNB 2N9YB 3BRTB 3O8ZA 3SWFA 2FXMA 3T97A 4C46A 2E75B 1PGQA 2JJLA 2K9YA 3GW6A 1RH5B 2HG5D 2JDIH 2W8ZA 4JPZB 3M9HA 1LT9B 2IBZE 3CX5D 3K5BA 1GDTA 1HGZA 2YNYA 4CPGA 3CCVP 3R2PA 3VTPC 1R5LA 1NTMK 1L0NJ 2WPSA 2XZRA 3L71E 1CI6A 1JY3O 1NTKK 2NPSA 3PH0A 1L0NG 1MUUA 3EFFK 1Q82Q 1KILB 1AV1A 1SFCC 1URQD 4H0LB 1BGYJ 3WUTA 2XNDH 3TGUE 2WPRA 1LTAC 1Q90D 2KYVA 2XDJA 4JYBA 4NPFX 2C0XA 4WWIA 1KMIZ 5B66H 3V6IA 1LP1A 1AA0A 1EC5A 3L75E 3HD7A 1QLED 1NYHA 2MKVA 3CWBE 3NXSA 5APWA 1NU1G 3RK2C 3MGNA 1K73Q 1KN7A 5CCGA 1QL1A 2W83C 1L0LK 5GTHE 3JCUE 1L4AB 1PP9J 4H13C 3RK3C 3I55P 2QM8A 2R3SA 1UIXA 1ZV8A 1NKNA 2D2CD 2E76C 3Q5RA 2K9JB 2QSIA 2QJPB 5AW1B 2FFDA 4YTPC 1K9MQ 2JKVA 1MZ9A 1M1JC 1SQQJ 1ZP0C 2GA1A 1NU1K 3EFGA 3MUDC 3KZIH 1L4AC 2RN0A 3LW5H 4H13B 3RK3B 2FYZA 1ZOYC 3L72G 4KHXA 2QJYC 1FJKA 3A3YB 2QE7H 3VP9A 1H0TB 3Q1MA 5DJUB 2XNXA 1BGYD 1GMJA 1USDA 1NWQA 1JY2P 4NPDA 2WPVB 4NPEA 1OVUA 4I7ZC 4PD4D 3KZIE 2JEEA 2IBZG 3MTUE 2Q6QA 3SWKA 1AQTA 2FXPA 1G1IA 1JY2O 3D71A 5DJTB 1HTLC 2FY8A 2KSEA 2KS1B 1GD2E 2J58A 3AE6C 4D6TG 2JO1A 4HKZH 3M9QA 4WB4A 1SQBK 5CCHA 1S4XA 2O3JA 3L72D 1PGJA 3H1LE 2OYIA 1GW4A 2BCCG 2ZT9D 3R4YA 3AE8C 3CPWO 2FFDC 1FDMA 1H89A 4IL6X 3H1KD 3L71J 4UB6E 1JMMA 1IK9A 1FZCB 1VQNP 1SQPK 3L71G 5B66E 3PTZA 1BCCD 5AW4B 2Q7CA 1Z56A 1NTZD 1YHQP 2XKMA 3KQGA 3B5NC 1P84D 4C7NB 5AW7B 2P10A 2Q1KA 2A45G 1JNMA 2N9BA 5APYA 2M5AB 2HR3A 1JCCA 2QIWA 1LTBC 1N7SC 3L4FA 2K88A 4GDOA 1ZW0A 2RKLA 1LTJA 2H88C 2E5YA 1DD3A 2FKWB 3AE5C 2VRSA 4H13D 5GTHH 3RK3D 1RF1B 1FOSF 1YQ4C 1CI6B 1LTIC 1FAVA 1S5LE 1WT6A 3CCJP 2R3CA 4AQRD 1EZVI 1YTZT 2PP6A 3H1LG 1OIPA 2AXTH 3H1HE 1HH0A 2AEFA 2V7QH 3L73E 2P1JA 4I7ZB 2R32A 4PV1D 4U3FG 2N1TB 4D6TE 1Q86Q 2JWDA 5EFWB 5BVZA 1AQ5A 4Y99C 1S2EA 1N7SB 2OYOA 4PD4E 4JQ0D 4JF7A 2QVAA 3AE7C 4GOEA 1U7JA 4OGQB 1SQBJ 3LIDA 3JC22 3QWOC 4U3FD 2WTYA 3CCQP 1QVGO 2OTKE 1HBWA 2B87B 3GHGB 1PV3A 3CCEP 1VQOP 3P8CE 5E79H 2FYUK 3AEBC 2BASA 3I56P 2C9NY 1ZRTD 3F89A 1A02J 3TNUB 1OWAA 1IJDB 1BCCJ 1FU1A 1L0ND 4EDFA 3L72E 1VQ9P 2WITA 1BSNA 3OA7A 3P7KA 3U1AA 1H0TA 4GT1A 3VN0A 2QJYB 4O9BA 5APXA 2YO3A 3L74E 1VQMP 1QGKB 1URQA 2K3RA 4B86A 1FZGA 1JEKA 1YBKA 1LTSC 1VF5C 2Q5UA 4MN4C 1RE3A 1NU1D 3RL0g 2Y0CA 4L76A 1U57A 1LTTC 3CX5H 2BEZF 1X9VA 1A02F 2WSFJ 5APVA 3LW5J 2QRXA 3HD7D 1RHZB 5KAIE 1LTGC 5KLVG 5AVYB 1NGMB 1S5LX 2QJKC 4N78E 5CCGD 2KXPB 3D6ZA 1RE4C 4WY4A 3H1IG 3H1JJ 1Y9BA 1FDIA 1NH4A 4U3FJ 3IR9A 1S72P 1M1JB 2IBZD 1J1EC 2YIUB 3HUSC 1KB9H 2E74C 2LXBA 2IZ0A 3CWBG 1SFCB 1N73A 2W6AA 4WVZA 4H44D 5AVXB 1DX7A 3GG2A 3EWKA 2KOGA 2W27A 1SS1A 3VMZA 1JMBA 3A5TA 2BCCE 1NTMD 4U3FE 2A06D 2LR2A 3H1HG 3L73G 1R8EA 1XTGB 2KIKA 3AE9C 3Q2YA 2QA4P 2HPCA 4HYTB 3WUUA 1AFOA 1LJ2A 2FYUE 2V4HA 1BCCG 3TSIA 1FDOA 3FX0A 2IYOA 2H7HA 1LT1A 1NJIQ 1KQGB 2JP3A 2E74B 4IOIH 1PPJE 4TLFA 3MD0A 3HTKA 5AW5B 2FYNC 2OYHA 1VQ7P 1GK6A 4AUWA 1GL2B 5AW9B 4KJMA 4WY4C 1KTMA 2YO2A 1EDIA 1IFPA 3HE4A 4ASWA 3CCSP 3E7KA 4DZOA 1BDCA 1Q7YQ 1JO5A 2OQQA 2CK3H 1L0LD 3HE5A 1IZNB 4DT0A 2CPBA 1IO4A 3TK1A 3L70J 3KXDA 3M0AA 5L8RJ 2YKPA 3VMAA 1YJNP 1KC8Q 1SQXK 3B5NB 3O6QB 2W6JH 1FZCA 1KZUB 1PZQA 2YXQB 3FWLA 2I1KA 5APSA 5APQA 2E75D 1MKMA 4RJTA 1JOCA 1CSBA 2KK7A 1JY3N 2O01J 2W6BA 4LGDE 1FJPA 3AEGC 4K3AA 4H44C 2B88A 2HODB 4IL6E 5AW8B 1S5LH 4EOTA 3BVHA 2Z5IA 3BATA 2IBZI 2K1AA 1Q2NA 2HYNA 2Q3IA 1VF5B 1LNQA 1X8YA 3JCUH 4GOFA 3RBXA 5CMZA 3WU2H 5KKZB 2BCCD 4QMAA 2ZT9C 1FZCC 1EDLA 1JTHB 3HRNA 3S4RA 3V4WA 5KAFH 1IFNA 3CXHD 1H8AA 2SPZA 1KD1Q 1RQVA 1SQPJ 3CLQA 1HGVA 2KLVA 1LT9C 2A06E 3NTNA 2R44A 1NTZG 1OXZA 2WWWA 2P7JA 4EI2A 4GKGA 2KNCA 4IFDK 2FYUD 3TGUJ 1UIIA 1W2EA 3GHGC 1NAFA 1KILC 3P8CD 1OZHA 1NTZK 2OARA 1VQPP 3GF7A 1GL2C 3V2PA 2FYUJ 1SQQE 1J1DB 2FYUG 5KLVD 2YIUC 3HD7B 3I5CA 1LWUB 4HJGH 4M3LA 3BCCG 5AVSB 1NTKD 5BU5A 1L4AD 5KKZC 5KTBA 3CC7P 5AW3B 2JR8A 1S9KD 1HUCA 2ZYAA 1N2DC 3LIEA 2A45H 1JTHA 4OH8B 3G4SP 1X22A 2OTJP 1OVRA 1J2JB 1YTZI 3H1LJ 1ZN5A 4W80A 3S1KA 3S9OA 2HFED 2IFNA 2IZ1A 2N1TD 4TT3H 3ITKA 3H32B 1SQVE 2AEJA 3L75J 2Y9YA 3UIAA 2B9BA 3M06A 3H1KG 3G3ZA 3II6A 4HB1A 4IL6H 4N3YB 3M0DA 3VOPA 1IFDA 1NAYA 1HJBA 3RK2D 1N7SA 3KHUA 1KYOH 3C1LA 1SLQA 3L70E 4H44B 1OW7A 1FZBA 1IC2A 1SQQK 1NU1J 4PV1C 5AW6B 1NTMG 1SQPE 1JY3P 1SQBG 2ZFCA 4PD4I 3P32A 4WY4D 3V4QA 2QEXP 5KJ7A 1NHLA 1NKZB 1IFIA 3PRJA 4ZKUA 1BDDA 3CCRP 3ZDMA 2N1TA 2KLUA 2ZT9B 4KT0J 3A2AA 1EXIA 3CI9A 1WMKA 3L70D 2H43A 4LLHA 1KFNA 1SQQG 2RMZA 2ZXXA 1EZVG 1N7SD 1L0LJ 3WU2E 5BU8B 3CCLP 3M9BA 1XTCC 3G71P 1M90Q 1T2KD 2L91A 2ZXEB 3H1LD 2JWAA 1BE3J 2OYHC 4N6JA 2Z4EA 1OMIA 3USSA 3SSUA 1PPJG 1FOSE 1DIPA 1SQBD 2M3EA 1DH3A 3D70A 2AXTE 2ZYGA 4XE5B 1PP9E 1NTZE 2QJKB 1W2BO 4OWFA 2ZVOB 5AVVB 1M7LA 1USEA 4UB6H 2WZ7A 1OW8A 1RF0A 3H6PA 3QH9A 4JBZA 5CBNA 2HPCB 2E43A 1LWUC 1P84H 5KJ7D 1KQLA 3V2RA 4XFJA 1J1EB 3CXHH 3HUSB 1PP9D 3RGUA 1BGYE 1TU3F 1SQXE 3CWBD 3L37A 4IFMA 2P2UA 4ZMDA 1KFMA 2P67A 4A7PA 3TYYA 3AEAC 4GIFA 2BEQD 1SQVG 2J5UA 3SFEC 3EQ2A 3RK3E 2B87A 4DJGA 2NRGA 1VF5D 3N4XA 3H1HD 3L73D 1IFJA 3H1IE 5B5EE 5KJ7C 1QEXA 1SQXJ 1K8AQ 5KLVK 4C7RA 3CMAP 3VMXA 2ZJSE 2LXCB 4PJ0H 4L73A 3KDPB 5H2FE 1PFIA 1KV4A 2LKMA 3CMEP 1M57D 3BCCE 5KAIH 2R5DA 1YI2P 1G2CA 2P58A 3CX5E 4L74A 5M1BA 2WSFH 5K5GB 1KQFB 2H8PD 1SP4A 4C7NA 2KSJA 2NPSB 2AEMA 2D2CC 2KP8A 2Y0EA 3L72J 3GHGA 1X79B 2E76D 3CXHE 1N7LA 3FWNA 3H1JE 4BRYB 1GZLA 5H2FH 2C9LY 2M3BA 5CHXA 1E79H 4YXWH 3AE3C 3TF5A 3CC2P 3KPEA 1FS0E 3MUDA 1OFCX 1AVYA 2KI7B 3PP5A 5AVUB 3VYIA 1YYCA 3AE1C 1S3JA 2KUBA 3P8MC 3L75D 5AW2B 5E79E 5KLIC 3Q3DA 5KLIB 1S1CX 2D2CB 1URQC 3HE4B 1N86A 3N7NA 4I2LC 4RO0A 1SQXD 4D6TJ 4EYYQ 1P84I 1MFTA 5CBOA 3H1HJ 1EQ7A 2OGUA 3L73J 3G6EP 1YIJP 2OYIB 4N78D 4EIJA 1FC2C 1FZEA 2K37A 1T6AA 1VPCA 1AVOA 1P84E 1T8ZA 1G1JA 2WVRA 1L4AA 3F5HA 1DD4A 5KLVJ 3A0BE 1JM0A 3M0DC 3CC4P 1KILE 1T3UA 3NMDA 2WSSH 4BRYA 1CZQA 3CD6P 3H1ID 3VP8A 1M1KQ 1EDKA 4RESB 2WSEH 1IK7A 2YMKA 4IFFA 2ZYDA 1LTJC 2K9JA 3GLMA 4I1LA 1QX8A 1T2KC 1QL2A 1KB9E 1KILD 1E5WA 1QVFO 2WSEJ 1SQPD 1RF1A 2WPQA 2QJPC 4D6TD 3KYQA 3RL0B 2PGDA 2B89A 2PRRA 3HD7C 4HH2A 3U1CA 5AVWB 4YXDC 2NZ2A 3H1KE 2XU6A 2IFMA 3AE2C 2YXRB 3FXEA 3E1IA 1VQ4P 1JUNA 2KNCB 3H1KJ 3L71D 1LGHB 1SQVJ 1KILA 3A0BH 3HTKB 3TGUG 1HWTC 2O1KA 2E42A 1PPJD 4OGQC 1ZR2A 3MHVA 2A06G 4U7JA 3M91A 1FE6A 1BGYG 1RQUA 1W5CE 2IYPA 1MFZA 4H0LD 3C9IA 1L0NE 2ZAEB 2KS1A 2Q3EA 5AW0B 2KZIA 2L5GB 4PD4H 1VDFA 4LC1A 2HLOA
chains in the Genus database with same CATH topology
5AVRB 1DEBA 1RY3A 1G2CB 5APTA 2WT7B 2I1JA 3RK2B 3BRVB 3MIWA 2HODA 5APUA 1MV8A 1WRGA 2YKOA 3OJAB 3VMXA 5KJ7A 2FFDB 3U59A 1J1DC 3H32A 1L0NK 2M8RA 3V2NA 1SFCD 4WBAA 3HE5B 2IPPA 2A45I 3CL3D 3A7OA 2MJZA 2OYIC 3BASA 4AYCA 1FBMA 2IX7C 1SFCA 1T3JA 2NPSC 4Y99B 3TNUA 4XA4A 5AVZB 1GW3A 2POHA 5AVQB 2KB7P 1LTJB 1LWUA 1S9KE 1GK4A 1NO4A 1RF0C 2GUSA 3WMM0 2O01H 2Q9IA 2PAJA 3SWYA 1ZR4A 2YKQA 1M1JA 1RF1C 5CJ4A 2QM7A 1GU5A 1HVVA 1N73C 2O1JA 1SVFA 3L35A 3RL0D 3B8EB 1GU4A 5CCHD 2N1TC 1CW5A 4LLHA 3OAKA 2WSCH 3NFQA 1DX7A 2GUVA 4W7YA 1N73B 2WT7A 5CCHC 2OYHB 4DOJA 2YMYA 3RL0C 1URQB 2R5BA 1GL2D 3V5BA 1RE3C 1LT9A 4ZKPA 1ZLLA 2C0WA 5CJ0A 2XV5A 5AVTB 5CCGC 4I6MC 1SQVK 3B5NA 2CPSA 2J59M 2GM4A 4JYCA 3HUSA 3L36A 1GL2A 3IFMA 1IFMA 1FZAA 1FZFA 1JY2N 4W7ZA 1H88A 1JCDA 1RE4A 1NOHA 4WY4B 2NPSD 3B5ND 3VMYA 2Z5HA 3BRTB 3O8ZA 3SWFA 2FXMA 3T97A 4C46A 2JJLA 3V2QA 5APWA 1FZCB 2HG5D 1GDTA 3M9HA 1LT9B 1HGZA 2YNYA 3R2PA 3VTPC 1NTMK 2WPSA 2XZRA 1CI6A 1JY3O 1NTKK 2NPSA 1MUUA 1KILB 1SFCC 1URQD 2WPRA 1LTAC 2KYVA 2XDJA 4JYBA 1GTWA 2C0XA 3HD7A 3NXSA 3RK2C 3MGNA 5CCGA 1QL1A 1L0LK 1L4AB 3RK3C 2QM8A 1ZV8A 1NKNA 5AW1B 2FFDA 3EFGA 1MZ9A 1M1JC 1NU1K 1L4AC 3LW5H 3RK3B 2FYZA 4KHXA 3VP9A 1FJKA 3A3YB 2XNXA 1NWQA 1JY2P 2JEEA 3MTUE 1G1IA 1JY2O 1HTLC 1GD2E 2J58A 4WB4A 3M9QA 1SQBK 5CCHA 2OYIA 1GW4A 2FFDC 1FDMA 1H89A 1JMMA 1IK9A 1SQPK 5AW4B 2Q7CA 1Z56A 2XKMA 3KQGA 3B5NC 4C7NB 5AW7B 2A45G 1JNMA 2N9BA 5APYA 1JCCA 1LTBC 1N7SC 3L4FA 1LTJA 2FKWB 2VRSA 3RK3D 1FOSF 1RF1B 1CI6B 1LTIC 1FAVA 1WT6A 2R3CA 4AQRD 1YTZT 2PP6A 3V2PA 1HH0A 5BU5A 2P1JA 2R32A 2N1TB 5BVZA 1AQ5A 4Y99C 1N7SB 4JF7A 3LIDA 2WTYA 1HBWA 3GHGB 3P8CE 2FYUK 2C9NY 2BASA 1A02J 3TNUB 1OWAA 1IJDB 1FU1A 2WITA 3OA7A 3P7KA 3U1AA 4GT1A 3VN0A 4O9BA 5APXA 2YO3A 1URQA 4B86A 1FZGA 1LTSC 2Q5UA 1RE3A 1LTTC 1X9VA 1A02F 5APVA 3HD7D 1LTGC 5AVYB 4N78E 5CCGD 1RE4C 4WY4A 1NH4A 3IR9A 1M1JB 1J1EC 3HUSC 1SFCB 1N73A 2W6AA 5AVXB 2KOGA 2W27A 3VMZA 3A5TA 1XTGB 4HYTB 1AFOA 3TSIA 2H7HA 5AW5B 3MD0A 3HTKA 4AUWA 2OYHA 1GK6A 1GL2B 5AW9B 4WY4C 2YO2A 3HE4A 4DZOA 1JO5A 3HE5A 2CPBA 1IO4A 3TK1A 3M0AA 2YKPA 1SQXK 3B5NB 1FZCA 1KZUB 2I1KA 5APSA 5APQA 1JOCA 1CSBA 2W6BA 1JY3N 4LGDE 1FJPA 2HODB 5AW8B 4EOTA 3BVHA 2Z5IA 3BATA 2HYNA 2Q3IA 2HPCA 1X8YA 1FZCC 5CMZA 1JTHB 3HRNA 3V4WA 1IFNA 1H8AA 3CLQA 1HGVA 2KLVA 1LT9C 3NTNA 2WWWA 1OXZA 2P7JA 4GKGA 4IFDK 1W2EA 3GHGC 1NAFA 1KILC 3P8CD 1NTZK 2OARA 1GL2C 1J1DB 3I5CA 3HD7B 1LWUB 2Z4EA 4M3LA 5AVSB 5KTBA 1L4AD 5AW3B 1S9KD 1HUCA 1N2DC 3LIEA 2A45H 1JTHA 4OH8B 1YTZI 1J2JB 4W80A 1ZN5A 2HFED 2IFNA 2N1TD 3H32B 3UIAA 3M06A 3G3ZA 3II6A 4N3YB 1HJBA 3M0DA 3VOPA 1IFDA 3RK2D 1N7SA 1SLQA 1FZBA 1IC2A 1SQQK 5AW6B 2ZFCA 3V4QA 1JY3P 4WY4D 3P32A 1NHLA 1NKZB 1IFIA 4ZKUA 2N1TA 3A2AA 3CI9A 2H43A 1KFNA 1N7SD 5BU8B 3M9BA 1XTCC 1T2KD 2ZXEB 2OYHC 4N6JA 1FOSE 1DH3A 4XE5B 5AVVB 1M7LA 2WZ7A 1RF0A 3H6PA 2HPCB 2E43A 1LWUC 5KJ7D 1KQLA 3V2RA 1J1EB 3HUSB 3L37A 4IFMA 2P2UA 1KFMA 2P67A 3TYYA 4GIFA 3EQ2A 3N4XA 5KJ7C 1IFJA 5KLVK 4C7RA 3KDPB 1PFIA 2LKMA 2R5DA 1G2CA 2WSFH 4C7NA 2H8PD 1SP4A 2KSJA 2NPSB 2KP8A 3GHGA 1X79B 1N7LA 1GZLA 2C9LY 2M3BA 5CHXA 3KPEA 3MUDA 3PP5A 5AVUB 3VYIA 1YYCA 3P8MC 5AW2B 1URQC 3HE4B 1N86A 3N7NA 4I2LC 1EQ7A 2OYIB 4N78D 4EIJA 1FZEA 1VPCA 1T8ZA 1G1JA 1L4AA 3M0DC 1T3UA 3NMDA 1CZQA 3VP8A 4RESB 2WSEH 4IFFA 1LTJC 4I1LA 1T2KC 1QL2A 1KILD 1E5WA 1RF1A 2WPQA 3KYQA 3RL0B 3HD7C 4HH2A 3U1CA 5AVWB 2XU6A 2IFMA 3E1IA 1JUNA 1LGHB 1KILA 1HWTC 3HTKB 2O1KA 2E42A 1ZR2A 3M91A 5AW0B 1MFZA 3C9IA 2L5GB 1VDFA 4LC1A 2HLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I1L A;  4GIF A;  5KTB A;  3BAT A;  5BU8 B;  3BAS A;  3VP9 A;  3N4X A;  3OJA B;  3U59 A;  3HRN A;  3N7N A;  3U1C A;  2POH A;  4N3Y B;  4N78 D;  2JEE A;  3U1A A;  1IC2 A;  1WT6 A;  4O9B A;  2FXM A;  1X79 B;  3P8C D;  3C9I A;  4ZKU A;  1NKN A;  5BU5 A;  3VP8 A;  5BVZ A;  4ZKP A; 
#chains in the Genus database with same CATH topology
 3IN6 A;  5AVR B;  1Q81 Q;  1DEB A;  1SQV D;  1EXJ A;  2ITA A;  1RY3 A;  1G2C B;  5APT A;  2WT7 B;  3H25 A;  2I1J A;  3RK2 B;  3BRV B;  3MIW A;  3IAO A;  1PIX A;  2HOD A;  1OX3 A;  1PP9 G;  5APU A;  3O6Q A;  4PJ0 E;  1MV8 A;  1WRG A;  2YKO A;  1KOR A;  3C8V A;  2I8D A;  3OJA B;  1PL5 A;  2V7Q J;  4PV1 B;  3U59 A;  4ASV A;  1YIT P;  2FFD B;  3GMA A;  2DW3 A;  3SFD C;  3OW2 O;  3AEF C;  1BE3 G;  4UB8 H;  1KB9 I;  1J1D C;  3H32 A;  1EZV D;  4OVN F;  1NTK J;  4OGQ D;  1L0N K;  1KB9 D;  1NTK G;  3AEE C;  3CWB J;  4R4M A;  1NVO A;  3A0H E;  1OW6 A;  2M8R A;  2E5T A;  3V2N A;  2W90 A;  1SFC D;  3D6Y A;  3PLN A;  1U7M A;  3FGA D;  5GTI H;  4DCK A;  3AE4 C;  4ZNC A;  2QG4 A;  3B71 A;  4WBA A;  3HE5 B;  3H1J G;  5KAF E;  2IPP A;  2A45 I;  3CL3 D;  3A7O A;  3FXD A;  3G9R A;  2G8Y A;  1Y47 A;  2WQY C;  3W68 A;  2MJZ A;  2OYI C;  3V2Q A;  3CCU P;  3BAS A;  4AYC A;  1FBM A;  5TIS E;  2IX7 C;  2M0B A;  2Y0D A;  3RBZ A;  1SFC A;  3H1J D;  1SQX G;  4R4L A;  1T3J A;  2WMM A;  3IF4 A;  2NPS C;  4Y99 B;  2BCC J;  3T97 B;  3TNU A;  1K05 A;  1YQ3 C;  4XA4 A;  4GOD A;  5AVZ B;  5KLV E;  3WUV A;  1BSH A;  1Y8A A;  1GW3 A;  2E75 C;  2POH A;  5AVQ B;  1GTW A;  2KB7 P;  3PJS K;  1VL2 A;  1LTJ B;  5C39 A;  1LWU A;  3PHL A;  1S9K E;  1GK4 A;  3GF3 A;  1NO4 A;  1RF0 C;  2GUS A;  3BCC J;  1VQ6 P;  1AJY A;  2KZJ A;  3WMM 0;  2O01 H;  2Q9I A;  2M5A A;  5B5E H;  3MZW B;  1PGP A;  5GTI E;  1R5S A;  1K04 A;  2PAJ A;  3TDK A;  3Q5S A;  1M8O B;  2AXC A;  3SWY A;  1ZR4 A;  1ZME C;  2YKQ A;  1M1J A;  3BCC D;  2FBW C;  2UWJ E;  4BXL A;  1RF1 C;  5CJ4 A;  2QM7 A;  1EZV E;  1GU5 A;  1HVV A;  1VQK P;  5TIS H;  3JSV C;  1N73 C;  2O1J A;  3CCM P;  4K35 A;  1KQS O;  1SVF A;  1X0T A;  2G3A A;  3L35 A;  2PFX A;  3B8E B;  3CX5 I;  4UB8 E;  2E76 B;  2RH0 A;  3RL0 D;  1GU4 A;  2FXO A;  4L75 A;  5CCH D;  2N1T C;  2H89 C;  1CW5 A;  3L74 J;  2O01 N;  1VQL P;  1NTM E;  1SQP G;  3OAK A;  2IDB A;  1D7M A;  2WSC H;  3L74 G;  2GUV A;  3L75 G;  3CXH I;  3L70 G;  3NFQ A;  4W7Y A;  2WT7 A;  1N73 B;  1L0L G;  1SQQ D;  3A0H H;  3AED C;  1ZXG A;  4RKU J;  1BCC E;  5CCH C;  3Q5P A;  2OYH B;  4DOJ A;  2YMY A;  2E74 D;  3RL0 C;  3H1I J;  1NTM J;  1URQ B;  4H0L C;  2R5B A;  1GL2 D;  1ZRT E;  3ABV C;  3W67 A;  1M56 D;  3V5B A;  1RE3 C;  3TGU D;  1LT9 A;  1L0L E;  4ZKP A;  1HF9 A;  1OVV A;  1SQB E;  1ZLL A;  2C0W A;  5CJ0 A;  2XV5 A;  5AVT B;  4Z1M H;  1JB0 J;  5CCG C;  2WSC J;  3B4S A;  5TJH A;  3MP7 B;  4I6M C;  1SQV K;  1HJ0 A;  3B5N A;  2CPS A;  2J59 M;  3L74 D;  3E1R A;  4YPC A;  2Y9Z A;  2GM4 A;  1BE3 D;  1KYO E;  4JYC A;  1VQ5 P;  3HUS A;  3L36 A;  1YJ9 P;  1N8R Q;  1VQ8 P;  1GL2 A;  1NU1 E;  3IFM A;  1PGO A;  1YJW P;  2OTL P;  1NTZ J;  1IFM A;  1FZA A;  1DEE G;  1NTK E;  3AEC C;  1JY2 N;  1KYO I;  4Y28 J;  1FZF A;  1LP1 B;  4W7Z A;  1H88 A;  1JCD A;  1RE4 A;  1NOH A;  4BWN A;  4WY4 B;  1BE3 E;  1KYO D;  2ZVN B;  2NPS D;  1EDJ A;  3B5N D;  3VMY A;  1L2P A;  2Z5H A;  2FYN B;  2N9Y B;  3BRT B;  3O8Z A;  3SWF A;  2FXM A;  3T97 A;  4C46 A;  2E75 B;  1PGQ A;  2JJL A;  2K9Y A;  3GW6 A;  1RH5 B;  2HG5 D;  2JDI H;  2W8Z A;  4JPZ B;  3M9H A;  1LT9 B;  2IBZ E;  3CX5 D;  3K5B A;  1GDT A;  1HGZ A;  2YNY A;  4CPG A;  3CCV P;  3R2P A;  3VTP C;  1R5L A;  1NTM K;  1L0N J;  2WPS A;  2XZR A;  3L71 E;  1CI6 A;  1JY3 O;  1NTK K;  2NPS A;  3PH0 A;  1L0N G;  1MUU A;  3EFF K;  1Q82 Q;  1KIL B;  1AV1 A;  1SFC C;  1URQ D;  4H0L B;  1BGY J;  3WUT A;  2XND H;  3TGU E;  2WPR A;  1LTA C;  1Q90 D;  2KYV A;  2XDJ A;  4JYB A;  4NPF X;  2C0X A;  4WWI A;  1KMI Z;  5B66 H;  3V6I A;  1LP1 A;  1AA0 A;  1EC5 A;  3L75 E;  3HD7 A;  1QLE D;  1NYH A;  2MKV A;  3CWB E;  3NXS A;  5APW A;  1NU1 G;  3RK2 C;  3MGN A;  1K73 Q;  1KN7 A;  5CCG A;  1QL1 A;  2W83 C;  1L0L K;  5GTH E;  3JCU E;  1L4A B;  1PP9 J;  4H13 C;  3RK3 C;  3I55 P;  2QM8 A;  2R3S A;  1UIX A;  1ZV8 A;  1NKN A;  2D2C D;  2E76 C;  3Q5R A;  2K9J B;  2QSI A;  2QJP B;  5AW1 B;  2FFD A;  4YTP C;  1K9M Q;  2JKV A;  1MZ9 A;  1M1J C;  1SQQ J;  1ZP0 C;  2GA1 A;  1NU1 K;  3EFG A;  3MUD C;  3KZI H;  1L4A C;  2RN0 A;  3LW5 H;  4H13 B;  3RK3 B;  2FYZ A;  1ZOY C;  3L72 G;  4KHX A;  2QJY C;  1FJK A;  3A3Y B;  2QE7 H;  3VP9 A;  1H0T B;  3Q1M A;  5DJU B;  2XNX A;  1BGY D;  1GMJ A;  1USD A;  1NWQ A;  1JY2 P;  4NPD A;  2WPV B;  4NPE A;  1OVU A;  4I7Z C;  4PD4 D;  3KZI E;  2JEE A;  2IBZ G;  3MTU E;  2Q6Q A;  3SWK A;  1AQT A;  2FXP A;  1G1I A;  1JY2 O;  3D71 A;  5DJT B;  1HTL C;  2FY8 A;  2KSE A;  2KS1 B;  1GD2 E;  2J58 A;  3AE6 C;  4D6T G;  2JO1 A;  4HKZ H;  3M9Q A;  4WB4 A;  1SQB K;  5CCH A;  1S4X A;  2O3J A;  3L72 D;  1PGJ A;  3H1L E;  2OYI A;  1GW4 A;  2BCC G;  2ZT9 D;  3R4Y A;  3AE8 C;  3CPW O;  2FFD C;  1FDM A;  1H89 A;  4IL6 X;  3H1K D;  3L71 J;  4UB6 E;  1JMM A;  1IK9 A;  1FZC B;  1VQN P;  1SQP K;  3L71 G;  5B66 E;  3PTZ A;  1BCC D;  5AW4 B;  2Q7C A;  1Z56 A;  1NTZ D;  1YHQ P;  2XKM A;  3KQG A;  3B5N C;  1P84 D;  4C7N B;  5AW7 B;  2P10 A;  2Q1K A;  2A45 G;  1JNM A;  2N9B A;  5APY A;  2M5A B;  2HR3 A;  1JCC A;  2QIW A;  1LTB C;  1N7S C;  3L4F A;  2K88 A;  4GDO A;  1ZW0 A;  2RKL A;  1LTJ A;  2H88 C;  2E5Y A;  1DD3 A;  2FKW B;  3AE5 C;  2VRS A;  4H13 D;  5GTH H;  3RK3 D;  1RF1 B;  1FOS F;  1YQ4 C;  1CI6 B;  1LTI C;  1FAV A;  1S5L E;  1WT6 A;  3CCJ P;  2R3C A;  4AQR D;  1EZV I;  1YTZ T;  2PP6 A;  3H1L G;  1OIP A;  2AXT H;  3H1H E;  1HH0 A;  2AEF A;  2V7Q H;  3L73 E;  2P1J A;  4I7Z B;  2R32 A;  4PV1 D;  4U3F G;  2N1T B;  4D6T E;  1Q86 Q;  2JWD A;  5EFW B;  5BVZ A;  1AQ5 A;  4Y99 C;  1S2E A;  1N7S B;  2OYO A;  4PD4 E;  4JQ0 D;  4JF7 A;  2QVA A;  3AE7 C;  4GOE A;  1U7J A;  4OGQ B;  1SQB J;  3LID A;  3JC2 2;  3QWO C;  4U3F D;  2WTY A;  3CCQ P;  1QVG O;  2OTK E;  1HBW A;  2B87 B;  3GHG B;  1PV3 A;  3CCE P;  1VQO P;  3P8C E;  5E79 H;  2FYU K;  3AEB C;  2BAS A;  3I56 P;  2C9N Y;  1ZRT D;  3F89 A;  1A02 J;  3TNU B;  1OWA A;  1IJD B;  1BCC J;  1FU1 A;  1L0N D;  4EDF A;  3L72 E;  1VQ9 P;  2WIT A;  1BSN A;  3OA7 A;  3P7K A;  3U1A A;  1H0T A;  4GT1 A;  3VN0 A;  2QJY B;  4O9B A;  5APX A;  2YO3 A;  3L74 E;  1VQM P;  1QGK B;  1URQ A;  2K3R A;  4B86 A;  1FZG A;  1JEK A;  1YBK A;  1LTS C;  1VF5 C;  2Q5U A;  4MN4 C;  1RE3 A;  1NU1 D;  3RL0 g;  2Y0C A;  4L76 A;  1U57 A;  1LTT C;  3CX5 H;  2BEZ F;  1X9V A;  1A02 F;  2WSF J;  5APV A;  3LW5 J;  2QRX A;  3HD7 D;  1RHZ B;  5KAI E;  1LTG C;  5KLV G;  5AVY B;  1NGM B;  1S5L X;  2QJK C;  4N78 E;  5CCG D;  2KXP B;  3D6Z A;  1RE4 C;  4WY4 A;  3H1I G;  3H1J J;  1Y9B A;  1FDI A;  1NH4 A;  4U3F J;  3IR9 A;  1S72 P;  1M1J B;  2IBZ D;  1J1E C;  2YIU B;  3HUS C;  1KB9 H;  2E74 C;  2LXB A;  2IZ0 A;  3CWB G;  1SFC B;  1N73 A;  2W6A A;  4WVZ A;  4H44 D;  5AVX B;  1DX7 A;  3GG2 A;  3EWK A;  2KOG A;  2W27 A;  1SS1 A;  3VMZ A;  1JMB A;  3A5T A;  2BCC E;  1NTM D;  4U3F E;  2A06 D;  2LR2 A;  3H1H G;  3L73 G;  1R8E A;  1XTG B;  2KIK A;  3AE9 C;  3Q2Y A;  2QA4 P;  2HPC A;  4HYT B;  3WUU A;  1AFO A;  1LJ2 A;  2FYU E;  2V4H A;  1BCC G;  3TSI A;  1FDO A;  3FX0 A;  2IYO A;  2H7H A;  1LT1 A;  1NJI Q;  1KQG B;  2JP3 A;  2E74 B;  4IOI H;  1PPJ E;  4TLF A;  3MD0 A;  3HTK A;  5AW5 B;  2FYN C;  2OYH A;  1VQ7 P;  1GK6 A;  4AUW A;  1GL2 B;  5AW9 B;  4KJM A;  4WY4 C;  1KTM A;  2YO2 A;  1EDI A;  1IFP A;  3HE4 A;  4ASW A;  3CCS P;  3E7K A;  4DZO A;  1BDC A;  1Q7Y Q;  1JO5 A;  2OQQ A;  2CK3 H;  1L0L D;  3HE5 A;  1IZN B;  4DT0 A;  2CPB A;  1IO4 A;  3TK1 A;  3L70 J;  3KXD A;  3M0A A;  5L8R J;  2YKP A;  3VMA A;  1YJN P;  1KC8 Q;  1SQX K;  3B5N B;  3O6Q B;  2W6J H;  1FZC A;  1KZU B;  1PZQ A;  2YXQ B;  3FWL A;  2I1K A;  5APS A;  5APQ A;  2E75 D;  1MKM A;  4RJT A;  1JOC A;  1CSB A;  2KK7 A;  1JY3 N;  2O01 J;  2W6B A;  4LGD E;  1FJP A;  3AEG C;  4K3A A;  4H44 C;  2B88 A;  2HOD B;  4IL6 E;  5AW8 B;  1S5L H;  4EOT A;  3BVH A;  2Z5I A;  3BAT A;  2IBZ I;  2K1A A;  1Q2N A;  2HYN A;  2Q3I A;  1VF5 B;  1LNQ A;  1X8Y A;  3JCU H;  4GOF A;  3RBX A;  5CMZ A;  3WU2 H;  5KKZ B;  2BCC D;  4QMA A;  2ZT9 C;  1FZC C;  1EDL A;  1JTH B;  3HRN A;  3S4R A;  3V4W A;  5KAF H;  1IFN A;  3CXH D;  1H8A A;  2SPZ A;  1KD1 Q;  1RQV A;  1SQP J;  3CLQ A;  1HGV A;  2KLV A;  1LT9 C;  2A06 E;  3NTN A;  2R44 A;  1NTZ G;  1OXZ A;  2WWW A;  2P7J A;  4EI2 A;  4GKG A;  2KNC A;  4IFD K;  2FYU D;  3TGU J;  1UII A;  1W2E A;  3GHG C;  1NAF A;  1KIL C;  3P8C D;  1OZH A;  1NTZ K;  2OAR A;  1VQP P;  3GF7 A;  1GL2 C;  3V2P A;  2FYU J;  1SQQ E;  1J1D B;  2FYU G;  5KLV D;  2YIU C;  3HD7 B;  3I5C A;  1LWU B;  4HJG H;  4M3L A;  3BCC G;  5AVS B;  1NTK D;  5BU5 A;  1L4A D;  5KKZ C;  5KTB A;  3CC7 P;  5AW3 B;  2JR8 A;  1S9K D;  1HUC A;  2ZYA A;  1N2D C;  3LIE A;  2A45 H;  1JTH A;  4OH8 B;  3G4S P;  1X22 A;  2OTJ P;  1OVR A;  1J2J B;  1YTZ I;  3H1L J;  1ZN5 A;  4W80 A;  3S1K A;  3S9O A;  2HFE D;  2IFN A;  2IZ1 A;  2N1T D;  4TT3 H;  3ITK A;  3H32 B;  1SQV E;  2AEJ A;  3L75 J;  2Y9Y A;  3UIA A;  2B9B A;  3M06 A;  3H1K G;  3G3Z A;  3II6 A;  4HB1 A;  4IL6 H;  4N3Y B;  3M0D A;  3VOP A;  1IFD A;  1NAY A;  1HJB A;  3RK2 D;  1N7S A;  3KHU A;  1KYO H;  3C1L A;  1SLQ A;  3L70 E;  4H44 B;  1OW7 A;  1FZB A;  1IC2 A;  1SQQ K;  1NU1 J;  4PV1 C;  5AW6 B;  1NTM G;  1SQP E;  1JY3 P;  1SQB G;  2ZFC A;  4PD4 I;  3P32 A;  4WY4 D;  3V4Q A;  2QEX P;  5KJ7 A;  1NHL A;  1NKZ B;  1IFI A;  3PRJ A;  4ZKU A;  1BDD A;  3CCR P;  3ZDM A;  2N1T A;  2KLU A;  2ZT9 B;  4KT0 J;  3A2A A;  1EXI A;  3CI9 A;  1WMK A;  3L70 D;  2H43 A;  4LLH A;  1KFN A;  1SQQ G;  2RMZ A;  2ZXX A;  1EZV G;  1N7S D;  1L0L J;  3WU2 E;  5BU8 B;  3CCL P;  3M9B A;  1XTC C;  3G71 P;  1M90 Q;  1T2K D;  2L91 A;  2ZXE B;  3H1L D;  2JWA A;  1BE3 J;  2OYH C;  4N6J A;  2Z4E A;  1OMI A;  3USS A;  3SSU A;  1PPJ G;  1FOS E;  1DIP A;  1SQB D;  2M3E A;  1DH3 A;  3D70 A;  2AXT E;  2ZYG A;  4XE5 B;  1PP9 E;  1NTZ E;  2QJK B;  1W2B O;  4OWF A;  2ZVO B;  5AVV B;  1M7L A;  1USE A;  4UB6 H;  2WZ7 A;  1OW8 A;  1RF0 A;  3H6P A;  3QH9 A;  4JBZ A;  5CBN A;  2HPC B;  2E43 A;  1LWU C;  1P84 H;  5KJ7 D;  1KQL A;  3V2R A;  4XFJ A;  1J1E B;  3CXH H;  3HUS B;  1PP9 D;  3RGU A;  1BGY E;  1TU3 F;  1SQX E;  3CWB D;  3L37 A;  4IFM A;  2P2U A;  4ZMD A;  1KFM A;  2P67 A;  4A7P A;  3TYY A;  3AEA C;  4GIF A;  2BEQ D;  1SQV G;  2J5U A;  3SFE C;  3EQ2 A;  3RK3 E;  2B87 A;  4DJG A;  2NRG A;  1VF5 D;  3N4X A;  3H1H D;  3L73 D;  1IFJ A;  3H1I E;  5B5E E;  5KJ7 C;  1QEX A;  1SQX J;  1K8A Q;  5KLV K;  4C7R A;  3CMA P;  3VMX A;  2ZJS E;  2LXC B;  4PJ0 H;  4L73 A;  3KDP B;  5H2F E;  1PFI A;  1KV4 A;  2LKM A;  3CME P;  1M57 D;  3BCC E;  5KAI H;  2R5D A;  1YI2 P;  1G2C A;  2P58 A;  3CX5 E;  4L74 A;  5M1B A;  2WSF H;  5K5G B;  1KQF B;  2H8P D;  1SP4 A;  4C7N A;  2KSJ A;  2NPS B;  2AEM A;  2D2C C;  2KP8 A;  2Y0E A;  3L72 J;  3GHG A;  1X79 B;  2E76 D;  3CXH E;  1N7L A;  3FWN A;  3H1J E;  4BRY B;  1GZL A;  5H2F H;  2C9L Y;  2M3B A;  5CHX A;  1E79 H;  4YXW H;  3AE3 C;  3TF5 A;  3CC2 P;  3KPE A;  1FS0 E;  3MUD A;  1OFC X;  1AVY A;  2KI7 B;  3PP5 A;  5AVU B;  3VYI A;  1YYC A;  3AE1 C;  1S3J A;  2KUB A;  3P8M C;  3L75 D;  5AW2 B;  5E79 E;  5KLI C;  3Q3D A;  5KLI B;  1S1C X;  2D2C B;  1URQ C;  3HE4 B;  1N86 A;  3N7N A;  4I2L C;  4RO0 A;  1SQX D;  4D6T J;  4EYY Q;  1P84 I;  1MFT A;  5CBO A;  3H1H J;  1EQ7 A;  2OGU A;  3L73 J;  3G6E P;  1YIJ P;  2OYI B;  4N78 D;  4EIJ A;  1FC2 C;  1FZE A;  2K37 A;  1T6A A;  1VPC A;  1AVO A;  1P84 E;  1T8Z A;  1G1J A;  2WVR A;  1L4A A;  3F5H A;  1DD4 A;  5KLV J;  3A0B E;  1JM0 A;  3M0D C;  3CC4 P;  1KIL E;  1T3U A;  3NMD A;  2WSS H;  4BRY A;  1CZQ A;  3CD6 P;  3H1I D;  3VP8 A;  1M1K Q;  1EDK A;  4RES B;  2WSE H;  1IK7 A;  2YMK A;  4IFF A;  2ZYD A;  1LTJ C;  2K9J A;  3GLM A;  4I1L A;  1QX8 A;  1T2K C;  1QL2 A;  1KB9 E;  1KIL D;  1E5W A;  1QVF O;  2WSE J;  1SQP D;  1RF1 A;  2WPQ A;  2QJP C;  4D6T D;  3KYQ A;  3RL0 B;  2PGD A;  2B89 A;  2PRR A;  3HD7 C;  4HH2 A;  3U1C A;  5AVW B;  4YXD C;  2NZ2 A;  3H1K E;  2XU6 A;  2IFM A;  3AE2 C;  2YXR B;  3FXE A;  3E1I A;  1VQ4 P;  1JUN A;  2KNC B;  3H1K J;  3L71 D;  1LGH B;  1SQV J;  1KIL A;  3A0B H;  3HTK B;  3TGU G;  1HWT C;  2O1K A;  2E42 A;  1PPJ D;  4OGQ C;  1ZR2 A;  3MHV A;  2A06 G;  4U7J A;  3M91 A;  1FE6 A;  1BGY G;  1RQU A;  1W5C E;  2IYP A;  1MFZ A;  4H0L D;  3C9I A;  1L0N E;  2ZAE B;  2KS1 A;  2Q3E A;  5AW0 B;  2KZI A;  2L5G B;  4PD4 H;  1VDF A;  4LC1 A;  2HLO A; 
#chains in the Genus database with same CATH homology
 5AVR B;  1DEB A;  1RY3 A;  1G2C B;  5APT A;  2WT7 B;  2I1J A;  3RK2 B;  3BRV B;  3MIW A;  2HOD A;  5APU A;  1MV8 A;  1WRG A;  2YKO A;  3OJA B;  3VMX A;  5KJ7 A;  2FFD B;  3U59 A;  1J1D C;  3H32 A;  1L0N K;  2M8R A;  3V2N A;  1SFC D;  4WBA A;  3HE5 B;  2IPP A;  2A45 I;  3CL3 D;  3A7O A;  2MJZ A;  2OYI C;  3BAS A;  4AYC A;  1FBM A;  2IX7 C;  1SFC A;  1T3J A;  2NPS C;  4Y99 B;  3TNU A;  4XA4 A;  5AVZ B;  1GW3 A;  2POH A;  5AVQ B;  2KB7 P;  1LTJ B;  1LWU A;  1S9K E;  1GK4 A;  1NO4 A;  1RF0 C;  2GUS A;  3WMM 0;  2O01 H;  2Q9I A;  2PAJ A;  3SWY A;  1ZR4 A;  2YKQ A;  1M1J A;  1RF1 C;  5CJ4 A;  2QM7 A;  1GU5 A;  1HVV A;  1N73 C;  2O1J A;  1SVF A;  3L35 A;  3RL0 D;  3B8E B;  1GU4 A;  5CCH D;  2N1T C;  1CW5 A;  4LLH A;  3OAK A;  2WSC H;  3NFQ A;  1DX7 A;  2GUV A;  4W7Y A;  1N73 B;  2WT7 A;  5CCH C;  2OYH B;  4DOJ A;  2YMY A;  3RL0 C;  1URQ B;  2R5B A;  1GL2 D;  3V5B A;  1RE3 C;  1LT9 A;  4ZKP A;  1ZLL A;  2C0W A;  5CJ0 A;  2XV5 A;  5AVT B;  5CCG C;  4I6M C;  1SQV K;  3B5N A;  2CPS A;  2J59 M;  2GM4 A;  4JYC A;  3HUS A;  3L36 A;  1GL2 A;  3IFM A;  1IFM A;  1FZA A;  1FZF A;  1JY2 N;  4W7Z A;  1H88 A;  1JCD A;  1RE4 A;  1NOH A;  4WY4 B;  2NPS D;  3B5N D;  3VMY A;  2Z5H A;  3BRT B;  3O8Z A;  3SWF A;  2FXM A;  3T97 A;  4C46 A;  2JJL A;  3V2Q A;  5APW A;  1FZC B;  2HG5 D;  1GDT A;  3M9H A;  1LT9 B;  1HGZ A;  2YNY A;  3R2P A;  3VTP C;  1NTM K;  2WPS A;  2XZR A;  1CI6 A;  1JY3 O;  1NTK K;  2NPS A;  1MUU A;  1KIL B;  1SFC C;  1URQ D;  2WPR A;  1LTA C;  2KYV A;  2XDJ A;  4JYB A;  1GTW A;  2C0X A;  3HD7 A;  3NXS A;  3RK2 C;  3MGN A;  5CCG A;  1QL1 A;  1L0L K;  1L4A B;  3RK3 C;  2QM8 A;  1ZV8 A;  1NKN A;  5AW1 B;  2FFD A;  3EFG A;  1MZ9 A;  1M1J C;  1NU1 K;  1L4A C;  3LW5 H;  3RK3 B;  2FYZ A;  4KHX A;  3VP9 A;  1FJK A;  3A3Y B;  2XNX A;  1NWQ A;  1JY2 P;  2JEE A;  3MTU E;  1G1I A;  1JY2 O;  1HTL C;  1GD2 E;  2J58 A;  4WB4 A;  3M9Q A;  1SQB K;  5CCH A;  2OYI A;  1GW4 A;  2FFD C;  1FDM A;  1H89 A;  1JMM A;  1IK9 A;  1SQP K;  5AW4 B;  2Q7C A;  1Z56 A;  2XKM A;  3KQG A;  3B5N C;  4C7N B;  5AW7 B;  2A45 G;  1JNM A;  2N9B A;  5APY A;  1JCC A;  1LTB C;  1N7S C;  3L4F A;  1LTJ A;  2FKW B;  2VRS A;  3RK3 D;  1FOS F;  1RF1 B;  1CI6 B;  1LTI C;  1FAV A;  1WT6 A;  2R3C A;  4AQR D;  1YTZ T;  2PP6 A;  3V2P A;  1HH0 A;  5BU5 A;  2P1J A;  2R32 A;  2N1T B;  5BVZ A;  1AQ5 A;  4Y99 C;  1N7S B;  4JF7 A;  3LID A;  2WTY A;  1HBW A;  3GHG B;  3P8C E;  2FYU K;  2C9N Y;  2BAS A;  1A02 J;  3TNU B;  1OWA A;  1IJD B;  1FU1 A;  2WIT A;  3OA7 A;  3P7K A;  3U1A A;  4GT1 A;  3VN0 A;  4O9B A;  5APX A;  2YO3 A;  1URQ A;  4B86 A;  1FZG A;  1LTS C;  2Q5U A;  1RE3 A;  1LTT C;  1X9V A;  1A02 F;  5APV A;  3HD7 D;  1LTG C;  5AVY B;  4N78 E;  5CCG D;  1RE4 C;  4WY4 A;  1NH4 A;  3IR9 A;  1M1J B;  1J1E C;  3HUS C;  1SFC B;  1N73 A;  2W6A A;  5AVX B;  2KOG A;  2W27 A;  3VMZ A;  3A5T A;  1XTG B;  4HYT B;  1AFO A;  3TSI A;  2H7H A;  5AW5 B;  3MD0 A;  3HTK A;  4AUW A;  2OYH A;  1GK6 A;  1GL2 B;  5AW9 B;  4WY4 C;  2YO2 A;  3HE4 A;  4DZO A;  1JO5 A;  3HE5 A;  2CPB A;  1IO4 A;  3TK1 A;  3M0A A;  2YKP A;  1SQX K;  3B5N B;  1FZC A;  1KZU B;  2I1K A;  5APS A;  5APQ A;  1JOC A;  1CSB A;  2W6B A;  1JY3 N;  4LGD E;  1FJP A;  2HOD B;  5AW8 B;  4EOT A;  3BVH A;  2Z5I A;  3BAT A;  2HYN A;  2Q3I A;  2HPC A;  1X8Y A;  1FZC C;  5CMZ A;  1JTH B;  3HRN A;  3V4W A;  1IFN A;  1H8A A;  3CLQ A;  1HGV A;  2KLV A;  1LT9 C;  3NTN A;  2WWW A;  1OXZ A;  2P7J A;  4GKG A;  4IFD K;  1W2E A;  3GHG C;  1NAF A;  1KIL C;  3P8C D;  1NTZ K;  2OAR A;  1GL2 C;  1J1D B;  3I5C A;  3HD7 B;  1LWU B;  2Z4E A;  4M3L A;  5AVS B;  5KTB A;  1L4A D;  5AW3 B;  1S9K D;  1HUC A;  1N2D C;  3LIE A;  2A45 H;  1JTH A;  4OH8 B;  1YTZ I;  1J2J B;  4W80 A;  1ZN5 A;  2HFE D;  2IFN A;  2N1T D;  3H32 B;  3UIA A;  3M06 A;  3G3Z A;  3II6 A;  4N3Y B;  1HJB A;  3M0D A;  3VOP A;  1IFD A;  3RK2 D;  1N7S A;  1SLQ A;  1FZB A;  1IC2 A;  1SQQ K;  5AW6 B;  2ZFC A;  3V4Q A;  1JY3 P;  4WY4 D;  3P32 A;  1NHL A;  1NKZ B;  1IFI A;  4ZKU A;  2N1T A;  3A2A A;  3CI9 A;  2H43 A;  1KFN A;  1N7S D;  5BU8 B;  3M9B A;  1XTC C;  1T2K D;  2ZXE B;  2OYH C;  4N6J A;  1FOS E;  1DH3 A;  4XE5 B;  5AVV B;  1M7L A;  2WZ7 A;  1RF0 A;  3H6P A;  2HPC B;  2E43 A;  1LWU C;  5KJ7 D;  1KQL A;  3V2R A;  1J1E B;  3HUS B;  3L37 A;  4IFM A;  2P2U A;  1KFM A;  2P67 A;  3TYY A;  4GIF A;  3EQ2 A;  3N4X A;  5KJ7 C;  1IFJ A;  5KLV K;  4C7R A;  3KDP B;  1PFI A;  2LKM A;  2R5D A;  1G2C A;  2WSF H;  4C7N A;  2H8P D;  1SP4 A;  2KSJ A;  2NPS B;  2KP8 A;  3GHG A;  1X79 B;  1N7L A;  1GZL A;  2C9L Y;  2M3B A;  5CHX A;  3KPE A;  3MUD A;  3PP5 A;  5AVU B;  3VYI A;  1YYC A;  3P8M C;  5AW2 B;  1URQ C;  3HE4 B;  1N86 A;  3N7N A;  4I2L C;  1EQ7 A;  2OYI B;  4N78 D;  4EIJ A;  1FZE A;  1VPC A;  1T8Z A;  1G1J A;  1L4A A;  3M0D C;  1T3U A;  3NMD A;  1CZQ A;  3VP8 A;  4RES B;  2WSE H;  4IFF A;  1LTJ C;  4I1L A;  1T2K C;  1QL2 A;  1KIL D;  1E5W A;  1RF1 A;  2WPQ A;  3KYQ A;  3RL0 B;  3HD7 C;  4HH2 A;  3U1C A;  5AVW B;  2XU6 A;  2IFM A;  3E1I A;  1JUN A;  1LGH B;  1KIL A;  1HWT C;  3HTK B;  2O1K A;  2E42 A;  1ZR2 A;  3M91 A;  5AW0 B;  1MFZ A;  3C9I A;  2L5G B;  1VDF A;  4LC1 A;  2HLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...