1NKNA

Visualizing an unstable coiled coil: the crystal structure of an n-terminal segment of the scallop myosin rod
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
74
structure length
74
Chain Sequence
MKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFGSMKQLEDKVEELLSKNYHLENEVARLKKLVGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S2N51-GCN4
publication title Visualization of an unstable coiled coil from the scallop myosin rod
pubmed doi rcsb
source organism Argopecten irradians, saccharomyces cerevisiae
molecule tags Contractile protein
total genus 35
structure length 74
sequence length 74
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2003-01-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nknA00
3U1CA 3N4XA 1WT6A 4N78D 3C9IA 3OJAB 4I1LA 4O9BA 5BU5A 1NKNA 3BASA 1X79B 2FXMA 3BATA 1IC2A 3N7NA 2POHA 3U59A 3VP8A 5KTBA 3P8CD 4N3YB 5BU8B 4ZKPA 3VP9A 3U1AA 2JEEA 4GIFA 4ZKUA 5BVZA 3HRNA
chains in the Genus database with same CATH superfamily
2L5GB 3R4YA 1FJKA 1WT6A 3F5HA 2Y0DA 1PL5A 1NU1D 3PRJA 2IBZD 1M57D 2KZJA 3H1JJ 1NTKG 2QRXA 4LC1A 2YMKA 1NTKE 4D6TJ 2FY8A 1W2BO 1KTMA 2OGUA 2QG4A 1ZOYC 4W80A 5TISE 4L74A 2Q3EA 2AEJA 3F89A 3I56P 2CK3H 3AEDC 5AW1B 3HD7B 4L76A 1Q2NA 3HD7A 3H25A 5DJUB 3RBZA 4U3FD 1FC2C 4JPZB 5CBOA 1FDIA 4WWIA 1M1JC 3CCRP 2AEFA 3AEFC 3CCSP 1NAFA 3HE5B 3V5BA 4EI2A 2G3AA 4XE5B 3CMAP 3HE5A 3L73J 4DOJA 5E79E 1SFCD 5CJ4A 1NU1K 1GL2D 1NTZJ 5APTA 2IFNA 4WY4D 1YJ9P 2GUVA 1D7MA 1AA0A 2RN0A 4IFMA 2B87B 1L0NG 1L0NE 3H1HD 2N1TA 3IN6A 2V7QJ 2PGDA 2YO3A 3HUSC 1LTJC 1KQGB 1M1JB 3IR9A 4ASVA 3V6IA 1M1JA 2WSEJ 3U59A 1W5CE 3CXHD 3P32A 1PGPA 2WT7B 5APUA 3NMDA 2WT7A 5GTIE 2IBZI 3KZIE 3AE1C 1OMIA 4HJGH 5AW2B 3E1RA 3KYQA 1EXIA 5AW4B 2CPSA 3SWYA 4N78E 3FWNA 3FWLA 2WITA 3IF4A 1IC2A 1KB9H 2QIWA 4OWFA 4LLHA 3RL0D 2Z5IA 3Q5SA 3TGUD 4YTPC 1L0LG 1JY2O 2BCCD 2FXPA 1L0LE 3HUSB 1LTJB 5KLVD 3HUSA 1LTJA 2ZYAA 1SQQD 1HTLC 2Q1KA 1T2KD 1AVYA 1NTMD 2M3BA 2IYOA 1R5LA 1S9KE 4AUWA 3FX0A 1QGKB 2FYUD 2A45I 1G1IA 3B8EB 1VQOP 4HB1A 1HGVA 1FOSF 1YITP 2W83C 4IL6H 3D70A 2BEZF 1Q82Q 4JQ0D 1PPJG 2H89C 1FZCA 2E76D 3ABVC 3LIEA 1PPJE 1L4AA 4YXDC 2Z5HA 2H88C 3TGUJ 1KMIZ 2V7QH 1SP4A 4GDOA 4HH2A 4XA4A 1JUNA 3B5NC 2ZT9D 3H1JE 2WSEH 3L74G 3QH9A 1KN7A 3L74E 3W67A 3ZDMA 1KYOE 3CXHI 5KLVK 1BE3G 3TF5A 1YIJP 3AE8C 3JCUH 1KB9E 1R5SA 5CBNA 5APVA 4BXLA 2V4HA 1NTMK 3O6QB 2NZ2A 1EQ7A 3O6QA 3II6A 1K05A 4RESB 2H43A 2ZFCA 1VQLP 1AJYA 3B5NB 1GDTA 1NU1G 1SFCC 3B5NA 1VPCA 1NU1E 3CC4P 3MGNA 1OVRA 3M91A 2IBZG 1PGQA 2IBZE 1LT1A 2ZYGA 1H8AA 1S5LE 2P7JA 1N7LA 5K5GB 5APYA 1K04A 4EDFA 2WZ7A 3BVHA 1S5LX 1HGZA 4U3FG 1MUUA 1JY3P 4U3FE 1EDJA 3L72J 1XTCC 1SFCB 1DX7A 1X8YA 4LGDE 1ZW0A 1CW5A 1URQD 1IFMA 1U7JA 2C0WA 2YXQB 3G4SP 2E42A 3CWBJ 3HRNA 2OYOA 4H44C 1AQ5A 4OH8B 2XNDH 3NXSA 1LTGC 3PLNA 1HH0A 2JWAA 1H88A 1ZN5A 1PP9D 1RQVA 3CCQP 3D6YA 1CSBA 1PV3A 1G1JA 2XZRA 3H1HG 3G71P 4PJ0E 3H1HE 2KSJA 1LTSC 1GW4A 2KYVA 2I8DA 1FDOA 1NTKK 3P8CD 3H1ID 4RKUJ 1SLQA 1NAYA 3CXHE 2B88A 2IDBA 3BRTB 5GTHH 1LTAC 4H44B 2QM7A 1SQBD 3WU2E 2E76C 1K73Q 2WWWA 4PV1C 1HF9A 5APXA 3PH0A 3VP8A 2MJZA 1SQPJ 2BCCG 3TGUE 1EZVD 1KILC 4AYCA 5KLVG 2H7HA 1IFIA 2K1AA 1BGYD 3VYIA 2PP6A 3V2QA 1VF5C 1SQQG 1SQQE 1OWAA 4Y28J 1OIPA 1Y47A 1NTMG 2KP8A 1IFJA 1SQVD 3L36A 2E76B 2FYUG 3C8VA 4PV1B 1OVVA 2FYUE 4KJMA 2IPPA 3L71J 4IOIH 4DT0A 1JCDA 3NTNA 5CCGA 1L0NK 2P2UA 2WTYA 4GOEA 4KT0J 3TNUB 3C1LA 5CCHA 3H1LJ 2P1JA 1HBWA 3TNUA 1KILB 2KLVA 1KORA 3AE9C 1KILA 2WSFJ 1JCCA 1USEA 1VF5B 1JNMA 4I2LC 1RH5B 1GK4A 2R44A 1QX8A 1DD3A 1UIXA 3VTPC 3H1JD 2ZVNB 1L0LK 5C39A 1AQTA 4D6TD 2K88A 2XDJA 2GUSA 2WVRA 1NGMB 1N7SC 1EZVI 3GF7A 3V4WA 2WMMA 3AE4C 3NFQA 2GA1A 4KHXA 4DZOA 1GTWA 2B89A 3TYYA 1HJ0A 1VQKP 3JC22 1IJDB 1N8RQ 1GD2E 2E43A 4BRYB 1OFCX 1IK9A 3L73D 2Q9IA 2I1JA 1IFDA 3AE6C 2KUBA 1NOHA 1N7SB 2YKPA 3W68A 1NTZD 3BCCJ 1N7SA 2WSFH 4JYBA 1BDCA 2Y0CA 2BASA 3L37A 2ZVOB 4UB8H 4IFFA 2QVAA 2A06D 1IO4A 3CCLP 1LWUC 4Y99C 3USSA 2M3EA 1NWQA 1K9MQ 1FAVA 1DEBA 3L35A 4H13D 2J59M 1X22A 1E5WA 4DJGA 1PP9G 1CI6B 1PP9E 1BCCD 2LXCB 5TJHA 1CI6A 2OQQA 3PTZA 3V2NA 1QLED 3SWFA 5KAIH 1RY3A 1KYOI 4WB4A 1ZMEC 2LKMA 3M9BA 4ZMDA 1KB9I 3PJSK 5AVQB 4PD4H 3B71A 3V4QA 1JB0J 1LWUB 3H1IG 3OW2O 3P8CE 3H1IE 4Y99B 1LWUA 2FXOA 5AW0B 4L75A 1SQBG 3L71E 2G8YA 2B87A 3M0AA 1JMMA 1VQNP 5AVWB 1SQBE 1S4XA 3S4RA 1HJBA 1BDDA 4I1LA 4RJTA 2CPBA 2W8ZA 1JO5A 3H1KJ 3P7KA 4MN4C 2AXTH 3SFDC 2M8RA 2KK7A 1EZVG 3GHGC 1EZVE 1BCCJ 4UB8E 4H0LC 1M56D 2J5UA 1BGYG 1T3UA 2SPZA 3VOPA 1BGYE 1S1CX 1W2EA 3SFEC 3L75J 2JWDA 1VL2A 1OX3A 2YKOA 1J2JB 1SQVG 1SQVE 1DEEG 3CCEP 1OZHA 3CCJP 2Z4EA 1M7LA 4IFDK 2FYZA 4YXWH 2WSSH 1GW3A 2WPRA 3GHGB 1OXZA 3Q1MA 1LP1B 4Z1MH 4I6MC 4PD4E 3M06A 2D2CC 4H0LB 1LP1A 2HYNA 1MKMA 3TK1A 4YPCA 2OARA 2C9LY 2QE7H 1Q86Q 1YQ4C 3AEGC 1UIIA 2IYPA 3WUUA 1GZLA 2HPCB 1PGOA 2HPCA 1YBKA 4R4LA 2WPSA 2YIUC 3H1JG 4D6TG 4D6TE 3RK2D 1OW7A 2D2CB 3WUVA 3M0DC 3L70J 1NH4A 1SQQK 3H32B 3RL0g 2NPSD 3H32A 3AE5C 1QVFO 3A0BH 2PRRA 5AVXB 2W27A 2FYUK 4GIFA 1ZRTD 3L72D 1KV4A 2IFMA 1E79H 2A45H 2YIUB 1ZR2A 2P67A 2BEQD 3HE4B 3TDKA 3VMAA 3L73G 2QM8A 3HE4A 1GL2C 3CWBD 1X0TA 3L73E 1A02F 1R8EA 2LR2A 4WY4C 2FBWC 2PAJA 1SQXJ 1NTZG 4EYYQ 1NTZE 4HKZH 4IL6E 1JY3O 5AVSB 1Q90D 3M0DA 1U57A 3MD0A 2H8PD 2A06G 4A7PA 2A06E 4N6JA 4EOTA 3FXDA 1JY2N 1PGJA 1YQ3C 2R3SA 5KJ7D 1L2PA 1KD1Q 1P84H 3OA7A 1YJNP 4GODA 2E5TA 1GL2B 2POHA 1SFCA 3AECC 1GL2A 3JCUE 3G6EP 4WY4B 1BCCE 1XTGB 4WY4A 2Y9ZA 4ZNCA 3CX5D 1YHQP 3L4FA 3RL0C 1RF0C 1VQ4P 5EFWB 4O9BA 3CCVP 2FYNC 2K9YA 1FZBA 1SQPD 2Q3IA 2KLUA 1N73C 3Q2YA 3Q5RA 1T2KC 4JBZA 3AEEC 1GMJA 3HD7D 1LTTC 3BASA 4N3YB 3A3YB 5AVYB 5KAFH 3L71D 1YYCA 1KFMA 3RL0B 5B5EH 1NTKJ 1RE4C 1RF0A 1T6AA 2FYNB 2E5YA 1OVUA 4QMAA 2JJLA 3H1LD 3T97B 3CLQA 2OYHC 1N73B 5BU8B 1P84E 1N73A 3TGUG 1JEKA 2ZT9C 4ZKUA 1FZGA 5AW5B 1NO4A 3RK2C 3CD6P 4NPFX 3RK3E 2N1TD 1FDMA 1NKZB 2QJPC 1DH3A 3Q3DA 5AVUB 3L70E 4K35A 1VQ9P 1J1DC 1GK6A 1RE4A 1NYHA 3MTUE 3VMZA 4R4MA 2KNCB 1QL2A 2YKQA 3ITKA 2KNCA 3QWOC 1YI2P 2OYHB 2IX7C 5L8RJ 1A02J 1FE6A 2OYHA 1SQBK 3BRVB 2ZT9B 1IZNB 2O1KA 2KB7P 4PD4D 4XFJA 1L0NJ 3RK2B 5CJ0A 5KAFE 1T8ZA 5GTHE 1TU3F 3M9HA 3AEAC 3RBXA 2QJPB 5B5EE 1Y9BA 2OYIC 3AE2C 3AEBC 2KXPB 1J1DB 3KDPB 5KJ7C 1IFNA 3CX5H 2DW3A 2JDIH 1Y8AA 2N9BA 2GM4A 1SQVK 5TISH 3BCCD 3GMAA 5DJTB 3PHLA 1N2DC 2K3RA 3RGUA 1PZQA 3L72G 1ZRTE 1JOCA 3L72E 1URQC 2W90A 4OGQD 1Q7YQ 1L0LJ 2O01J 3VN0A 2O1JA 1ZLLA 1L4AD 2ZXXA 3CWBG 4UB6H 3CWBE 2OYIB 1S2EA 2YNYA 1FJPA 1EDKA 2OYIA 1FBMA 1FZEA 3HTKB 1KC8Q 4JF7A 3UIAA 2Q7CA 3HTKA 5H2FH 3CMEP 2R3CA 1PIXA 2O01N 1NKNA 5KJ7A 5E79H 4BRYA 3GLMA 1T3JA 3AE7C 2IZ0A 1M90Q 1URQB 2QEXP 1FOSE 2R5DA 1OW6A 1URQA 4PD4I 1AFOA 1CZQA 1M8OB 2ZYDA 2JO1A 3VMYA 2FKWB 1HWTC 2KS1B 1KQSO 4W7YA 1X9VA 2KS1A 1U7MA 4NPEA 1QEXA 1RQUA 3B5ND 3L74J 3CX5E 2HG5D 3H1KD 3PP5A 3U1CA 5GTIH 1BE3J 3EQ2A 3KZIH 1VQPP 1SQPG 3TSIA 1J1EC 1SQPE 1OW8A 1EDLA 2XU6A 1LJ2A 5AVTB 3GG2A 2N1TC 5B66H 1SS1A 2W6AA 1NHLA 2KSEA 1VDFA 3L75D 4UB6E 2WSCJ 2O01H 2O3JA 5H2FE 1NTZK 2Y9YA 1NU1J 1WRGA 3V2RA 3E1IA 5KLIC 1SVFA 3L71G 1VQ7P 2QA4P 4TLFA 1JMBA 3E7KA 1KFNA 2VRSA 4WVZA 3H1LG 1DD4A 1J1EB 3WMM0 3EFGA 3H1LE 3P8MC 3D71A 1MFTA 3U1AA 3CPWO 2N1TB 2IZ1A 1QVGO 1DIPA 3FGAD 1KQLA 1S3JA 2KOGA 4GOFA 4U3FJ 3S9OA 1VQ8P 3LW5J 3FXEA 1P84D 1MV8A 1M1KQ 5KLIB 4GT1A 1GU5A 3KQGA 2B9BA 2OTLP 2JP3A 5KKZC 1KYOH 2E74D 3GF3A 4OGQC 3RK3D 5KAIE 5B66E 4H44D 1FZCC 2HODB 1L4AC 2HODA 3VP9A 3L70D 3GHGA 2I1KA 4ASWA 2UWJE 4I7ZC 1IFPA 3I55P 1NVOA 2FFDC 3H1HJ 1PFIA 2WSCH 1KZUB 2MKVA 1USDA 1JY2P 1LGHB 1RF1C 5APQA 4C7RA 1QL1A 5KKZB 2ZAEB 2AXTE 3A0HH 3OJAB 2W6BA 3R2PA 5AVRB 4OGQB 2OTKE 1BSNA 1H89A 1S5LH 1SQXD 1FZCB 3BCCG 3MZWB 1L4AB 3BCCE 4PV1D 2C0XA 3MP7B 3A7OA 5CCGD 4I7ZB 2FFDB 2BCCJ 4U7JA 3EWKA 2FFDA 5CCHD 3CC7P 1ZP0C 1RHZB 3MHVA 1KILD 2J58A 5KLVJ 5AVZB 4H13C 3LW5H 2HFED 5AW9B 3D6ZA 3CCMP 2JKVA 1P84I 1SQQJ 5AW7B 1RF1B 3Q5PA 1Q81Q 1BE3E 2L91A 1VF5D 1RF1A 2AEMA 1NTMJ 1Z56A 2FYUJ 1KQFB 4AQRD 1MFZA 3MUDC 3IFMA 2E75D 1S72P 3AE3C 1AV1A 3OAKA 3V2PA 3N4XA 5AVVB 1SQXK 2XV5A 1ZR4A 3SSUA 2YO2A 1EXJA 4PJ0H 1X79B 5AW6B 4H13B 1VQ6P 2LXBA 1ZXGA 3A0HE 4IL6X 1YJWP 2QJYC 4WBAA 1FU1A 3H1KG 3CXHH 1HVVA 4RO0A 3H1KE 5CMZA 2WPVB 1MZ9A 4JYCA 2N9YB 3WU2H 4C46A 3S1KA 1BCCG 3MUDA 1H0TB 1NTKD 1H0TA 3CC2P 3IAOA 3L75G 1WMKA 3L75E 3A0BE 2JR8A 2M0BA 3I5CA 3EFFK 3WUTA 2E74C 2P58A 1N7SD 1RE3C 2KI7B 4ZKPA 2XKMA 3RK3C 2A45G 2QJYB 1NJIQ 4L73A 3MIWA 2R32A 5CHXA 1N86A 2KIKA 3JSVC 1G2CB 1G2CA 2RKLA 1EDIA 3C9IA 3A2AA 1FZFA 2E74B 1YTZI 1JTHB 4GKGA 2HR3A 1FZAA 2WQYC 1RE3A 3CL3D 3T97A 3RK3B 1JTHA 2RMZA 2HLOA 2Y0EA 2P10A 1L0ND 2KZIA 1BSHA 1JM0A 2ZJSE 1SQPK 3K5BA 5AW3B 2ZXEB 2QJKC 5CCGC 3BATA 4EIJA 4DCKA 5CCHC 3SWKA 2NPSC 1HUCA 3L70G 5AW8B 1PP9J 2BCCE 1VQMP 4BWNA 4NPDA 1JY3N 4N78D 3CX5I 5KLVE 2WPQA 4B86A 3GW6A 2XNXA 2K37A 3A5TA 3KPEA 5KTBA 4CPGA 2AXCA 1NTME 1L0LD 2K9JB 2JEEA 2YXRB 3H1IJ 2K9JA 1K8AQ 2E75C 1GU4A 1EC5A 2R5BA 2QJKB 1SQBJ 2ITAA 2FXMA 3G3ZA 1SQXG 1SQXE 1LT9C 2NPSB 4HYTB 1YTZT 2NPSA 1S9KD 2Q5UA 3B4SA 2RH0A 3VMXA 3KHUA 4M3LA 3G9RA 4TT3H 3N7NA 1KILE 1BGYJ 2OTJP 3KXDA 1PPJD 2C9NY 2YMYA 4H0LD 5APSA 2PFXA 5BVZA 3CI9A 4C7NB 2E75B 2QSIA 3LIDA 4C7NA 1SQVJ 1LTBC 5M1BA 5APWA 1LTIC 1LT9B 3L74D 3CCUP 2NRGA 1LT9A 2W6JH 1KYOD 1FS0E 3H6PA 1BE3D 1LNQA 2Q6QA 1IK7A 1KB9D 2M5AB 5BU5A 2M5AA 3M9QA 1AVOA 1VQ5P 3HD7C 3O8ZA 4K3AA 2D2CD 4OVNF 1ZV8A 4W7ZA
chains in the Genus database with same CATH topology
2L5GB 1FJKA 1JY3O 1WT6A 5AVSB 3M0DA 2H7HA 1IFIA 3VYIA 3MD0A 2PP6A 3V2QA 2H8PD 3RK3D 1FZCC 2HODB 4N6JA 4EOTA 1JY2N 1OWAA 1L4AC 2HODA 2KP8A 3VP9A 1IFJA 4LC1A 3L36A 5KJ7D 3GHGA 2I1KA 4W80A 3OA7A 2IPPA 2FFDC 1PFIA 1JCDA 2WSCH 3NTNA 5CCGA 1GL2B 5AW1B 2POHA 1SFCA 1KZUB 3HD7B 1L0NK 2P2UA 2WTYA 1GL2A 3HD7A 3TNUB 4WY4B 5CCHA 1XTGB 1JY2P 2P1JA 1HBWA 3TNUA 1KILB 4WY4A 2KLVA 1LGHB 1RF1C 1KILA 5APQA 4C7RA 3L4FA 1JCCA 3RL0C 1QL1A 1RF0C 3OJAB 4O9BA 2W6BA 3R2PA 5AVRB 1M1JC 1JNMA 1FZBA 1H89A 4I2LC 2Q3IA 1FZCB 1NAFA 1L4AB 3HE5B 3V5BA 1N73C 4XE5B 3HE5A 1GK4A 2C0XA 3A7OA 4DOJA 5CCGD 1T2KC 1SFCD 5CJ4A 1NU1K 3VTPC 2FFDB 1GL2D 3HD7D 2FFDA 5APTA 1LTTC 2IFNA 5CCHD 3BASA 4WY4D 2GUVA 1KILD 2J58A 5AVZB 1L0LK 4N3YB 3LW5H 2HFED 5AW9B 3A3YB 4IFMA 2XDJA 2GUSA 5AVYB 5AW7B 1RF1B 1YYCA 1KFMA 3RL0B 1N7SC 1RF1A 2N1TA 1RE4C 1Z56A 1RF0A 3V4WA 2YO3A 3HUSC 1LTJC 1M1JB 2JJLA 3IR9A 1M1JA 3NFQA 4AQRD 4KHXA 3U59A 3CLQA 1MFZA 2OYHC 4DZOA 1N73B 5BU8B 3P32A 3IFMA 2WT7B 5APUA 1GTWA 3NMDA 1N73A 3TYYA 2WT7A 4ZKUA 1IJDB 1FZGA 5AW5B 5AW2B 1GD2E 3OAKA 3V2PA 3KYQA 3N4XA 5AW4B 5AVVB 2CPSA 2E43A 1SQXK 3SWYA 4N78E 2XV5A 1ZR4A 2YO2A 1IK9A 1NO4A 3RK2C 1X79B 2WITA 5AW6B 1IC2A 2Q9IA 2N1TD 1FDMA 3RL0D 4LLHA 2I1JA 1IFDA 2Z5IA 1NKZB 1DH3A 1NOHA 5AVUB 1JY2O 1N7SB 2YKPA 4WBAA 1FU1A 1N7SA 1J1DC 1GK6A 1HVVA 2WSFH 4JYBA 1RE4A 3HUSB 1LTJB 5CMZA 3HUSA 3MTUE 1LTJA 1MZ9A 4JYCA 2BASA 3VMZA 3L37A 4C46A 1QL2A 2YKQA 4IFFA 1HTLC 2OYHB 1IO4A 2IX7C 1A02J 1LWUC 2OYHA 1T2KD 1SQBK 3BRVB 3MUDA 4Y99C 2M3BA 1S9KE 1NWQA 2O1KA 4AUWA 1FAVA 2KB7P 1DEBA 2A45I 3L35A 1G1IA 3B8EB 1HGVA 3RK2B 2J59M 5CJ0A 1FOSF 3I5CA 1E5WA 1T8ZA 3M9HA 1N7SD 1CI6B 1RE3C 4ZKPA 1CI6A 2XKMA 1FZCA 2OYIC 3LIEA 3RK3C 2A45G 3V2NA 3SWFA 1L4AA 1RY3A 1J1DB 2Z5HA 4WB4A 3KDPB 3MIWA 2LKMA 3M9BA 1SP4A 2R32A 4HH2A 4XA4A 5CHXA 1N86A 5KJ7C 1JUNA 3B5NC 1IFNA 5AVQB 2N9BA 2GM4A 3V4QA 1LWUB 1SQVK 2WSEH 3P8CE 4Y99B 1LWUA 1G2CB 1N2DC 1G2CA 5AW0B 5KLVK 1JOCA 3M0AA 1JMMA 1URQC 5AVWB 1HJBA 3C9IA 3A2AA 4I1LA 3VN0A 2CPBA 5APVA 2O1JA 1ZLLA 1JO5A 1FZFA 1L4AD 3P7KA 1NTMK 1EQ7A 2M8RA 1YTZI 1JTHB 4GKGA 1FZAA 3CL3D 1RE3A 3II6A 3T97A 2OYIB 3RK3B 1JTHA 2YNYA 4RESB 1FJPA 2OYIA 2HLOA 1FBMA 1FZEA 3HTKB 3GHGC 4JF7A 3UIAA 2H43A 2Q7CA 3HTKA 2ZFCA 2R3CA 1SQPK 5AW3B 2ZXEB 1T3UA 3B5NB 1GDTA 1NKNA 5KJ7A 5CCGC 3VOPA 1W2EA 1SFCC 3B5NA 3BATA 1VPCA 4EIJA 1T3JA 3MGNA 5CCHC 3M91A 2YKOA 2NPSC 1HUCA 1J2JB 5AW8B 1URQB 1JY3N 1FOSE 2R5DA 1URQA 4N78D 1H8AA 1AFOA 1CZQA 2Z4EA 1M7LA 3VMYA 2WPQA 4IFDK 4B86A 2FKWB 2FYZA 2P7JA 1HWTC 2XNXA 3A5TA 1N7LA 1GW3A 3KPEA 5APYA 4W7YA 1X9VA 5KTBA 2WPRA 3GHGB 2WZ7A 2JEEA 1OXZA 3BVHA 3B5ND 1HGZA 4I6MC 1MUUA 2HG5D 1JY3P 3M06A 1GU4A 2HYNA 3PP5A 3U1CA 2R5BA 1XTCC 3EQ2A 1SFCB 1DX7A 3TK1A 2FXMA 1X8YA 3TSIA 2OARA 3G3ZA 4LGDE 2C9LY 1J1EC 1CW5A 1URQD 1LT9C 2NPSB 1IFMA 2XU6A 4HYTB 1YTZT 2C0WA 2NPSA 1S9KD 2Q5UA 5AVTB 2E42A 1GZLA 3HRNA 2N1TC 2W6AA 1AQ5A 2HPCB 4OH8B 3VMXA 1NHLA 2HPCA 1VDFA 3NXSA 1LTGC 2O01H 4M3LA 2WPSA 1HH0A 3N7NA 1H88A 1ZN5A 1NTZK 1CSBA 2C9NY 2YMYA 1WRGA 3V2RA 5APSA 3E1IA 1SVFA 5BVZA 3CI9A 4C7NB 1G1JA 2XZRA 3LIDA 3RK2D 4C7NA 2KSJA 3M0DC 1LTSC 1LTBC 1NH4A 1SQQK 3H32B 1KFNA 2VRSA 2NPSD 3H32A 1GW4A 2KYVA 5APWA 1LTIC 1J1EB 3WMM0 1NTKK 3EFGA 3P8CD 1LT9B 1SLQA 3P8MC 5AVXB 1LT9A 2W27A 2FYUK 3BRTB 3U1AA 2N1TB 1LTAC 4GIFA 3H6PA 2QM7A 1KQLA 2WWWA 2IFMA 2KOGA 2A45H 5BU5A 5APXA 3M9QA 1ZR2A 2P67A 3HE4B 2QM8A 3HE4A 3VP8A 1GL2C 3HD7C 3O8ZA 1MV8A 1A02F 2MJZA 4WY4C 1ZV8A 4GT1A 2PAJA 1KILC 1GU5A 3KQGA 4AYCA 4W7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1C A;  3N4X A;  1WT6 A;  4N78 D;  3C9I A;  3OJA B;  4I1L A;  4O9B A;  5BU5 A;  1NKN A;  3BAS A;  1X79 B;  2FXM A;  3BAT A;  1IC2 A;  3N7N A;  2POH A;  3U59 A;  3VP8 A;  5KTB A;  3P8C D;  4N3Y B;  5BU8 B;  4ZKP A;  3VP9 A;  3U1A A;  2JEE A;  4GIF A;  4ZKU A;  5BVZ A;  3HRN A; 
#chains in the Genus database with same CATH topology
 2L5G B;  3R4Y A;  1FJK A;  1WT6 A;  3F5H A;  2Y0D A;  1PL5 A;  1NU1 D;  3PRJ A;  2IBZ D;  1M57 D;  2KZJ A;  3H1J J;  1NTK G;  2QRX A;  4LC1 A;  2YMK A;  1NTK E;  4D6T J;  2FY8 A;  1W2B O;  1KTM A;  2OGU A;  2QG4 A;  1ZOY C;  4W80 A;  5TIS E;  4L74 A;  2Q3E A;  2AEJ A;  3F89 A;  3I56 P;  2CK3 H;  3AED C;  5AW1 B;  3HD7 B;  4L76 A;  1Q2N A;  3HD7 A;  3H25 A;  5DJU B;  3RBZ A;  4U3F D;  1FC2 C;  4JPZ B;  5CBO A;  1FDI A;  4WWI A;  1M1J C;  3CCR P;  2AEF A;  3AEF C;  3CCS P;  1NAF A;  3HE5 B;  3V5B A;  4EI2 A;  2G3A A;  4XE5 B;  3CMA P;  3HE5 A;  3L73 J;  4DOJ A;  5E79 E;  1SFC D;  5CJ4 A;  1NU1 K;  1GL2 D;  1NTZ J;  5APT A;  2IFN A;  4WY4 D;  1YJ9 P;  2GUV A;  1D7M A;  1AA0 A;  2RN0 A;  4IFM A;  2B87 B;  1L0N G;  1L0N E;  3H1H D;  2N1T A;  3IN6 A;  2V7Q J;  2PGD A;  2YO3 A;  3HUS C;  1LTJ C;  1KQG B;  1M1J B;  3IR9 A;  4ASV A;  3V6I A;  1M1J A;  2WSE J;  3U59 A;  1W5C E;  3CXH D;  3P32 A;  1PGP A;  2WT7 B;  5APU A;  3NMD A;  2WT7 A;  5GTI E;  2IBZ I;  3KZI E;  3AE1 C;  1OMI A;  4HJG H;  5AW2 B;  3E1R A;  3KYQ A;  1EXI A;  5AW4 B;  2CPS A;  3SWY A;  4N78 E;  3FWN A;  3FWL A;  2WIT A;  3IF4 A;  1IC2 A;  1KB9 H;  2QIW A;  4OWF A;  4LLH A;  3RL0 D;  2Z5I A;  3Q5S A;  3TGU D;  4YTP C;  1L0L G;  1JY2 O;  2BCC D;  2FXP A;  1L0L E;  3HUS B;  1LTJ B;  5KLV D;  3HUS A;  1LTJ A;  2ZYA A;  1SQQ D;  1HTL C;  2Q1K A;  1T2K D;  1AVY A;  1NTM D;  2M3B A;  2IYO A;  1R5L A;  1S9K E;  4AUW A;  3FX0 A;  1QGK B;  2FYU D;  2A45 I;  1G1I A;  3B8E B;  1VQO P;  4HB1 A;  1HGV A;  1FOS F;  1YIT P;  2W83 C;  4IL6 H;  3D70 A;  2BEZ F;  1Q82 Q;  4JQ0 D;  1PPJ G;  2H89 C;  1FZC A;  2E76 D;  3ABV C;  3LIE A;  1PPJ E;  1L4A A;  4YXD C;  2Z5H A;  2H88 C;  3TGU J;  1KMI Z;  2V7Q H;  1SP4 A;  4GDO A;  4HH2 A;  4XA4 A;  1JUN A;  3B5N C;  2ZT9 D;  3H1J E;  2WSE H;  3L74 G;  3QH9 A;  1KN7 A;  3L74 E;  3W67 A;  3ZDM A;  1KYO E;  3CXH I;  5KLV K;  1BE3 G;  3TF5 A;  1YIJ P;  3AE8 C;  3JCU H;  1KB9 E;  1R5S A;  5CBN A;  5APV A;  4BXL A;  2V4H A;  1NTM K;  3O6Q B;  2NZ2 A;  1EQ7 A;  3O6Q A;  3II6 A;  1K05 A;  4RES B;  2H43 A;  2ZFC A;  1VQL P;  1AJY A;  3B5N B;  1GDT A;  1NU1 G;  1SFC C;  3B5N A;  1VPC A;  1NU1 E;  3CC4 P;  3MGN A;  1OVR A;  3M91 A;  2IBZ G;  1PGQ A;  2IBZ E;  1LT1 A;  2ZYG A;  1H8A A;  1S5L E;  2P7J A;  1N7L A;  5K5G B;  5APY A;  1K04 A;  4EDF A;  2WZ7 A;  3BVH A;  1S5L X;  1HGZ A;  4U3F G;  1MUU A;  1JY3 P;  4U3F E;  1EDJ A;  3L72 J;  1XTC C;  1SFC B;  1DX7 A;  1X8Y A;  4LGD E;  1ZW0 A;  1CW5 A;  1URQ D;  1IFM A;  1U7J A;  2C0W A;  2YXQ B;  3G4S P;  2E42 A;  3CWB J;  3HRN A;  2OYO A;  4H44 C;  1AQ5 A;  4OH8 B;  2XND H;  3NXS A;  1LTG C;  3PLN A;  1HH0 A;  2JWA A;  1H88 A;  1ZN5 A;  1PP9 D;  1RQV A;  3CCQ P;  3D6Y A;  1CSB A;  1PV3 A;  1G1J A;  2XZR A;  3H1H G;  3G71 P;  4PJ0 E;  3H1H E;  2KSJ A;  1LTS C;  1GW4 A;  2KYV A;  2I8D A;  1FDO A;  1NTK K;  3P8C D;  3H1I D;  4RKU J;  1SLQ A;  1NAY A;  3CXH E;  2B88 A;  2IDB A;  3BRT B;  5GTH H;  1LTA C;  4H44 B;  2QM7 A;  1SQB D;  3WU2 E;  2E76 C;  1K73 Q;  2WWW A;  4PV1 C;  1HF9 A;  5APX A;  3PH0 A;  3VP8 A;  2MJZ A;  1SQP J;  2BCC G;  3TGU E;  1EZV D;  1KIL C;  4AYC A;  5KLV G;  2H7H A;  1IFI A;  2K1A A;  1BGY D;  3VYI A;  2PP6 A;  3V2Q A;  1VF5 C;  1SQQ G;  1SQQ E;  1OWA A;  4Y28 J;  1OIP A;  1Y47 A;  1NTM G;  2KP8 A;  1IFJ A;  1SQV D;  3L36 A;  2E76 B;  2FYU G;  3C8V A;  4PV1 B;  1OVV A;  2FYU E;  4KJM A;  2IPP A;  3L71 J;  4IOI H;  4DT0 A;  1JCD A;  3NTN A;  5CCG A;  1L0N K;  2P2U A;  2WTY A;  4GOE A;  4KT0 J;  3TNU B;  3C1L A;  5CCH A;  3H1L J;  2P1J A;  1HBW A;  3TNU A;  1KIL B;  2KLV A;  1KOR A;  3AE9 C;  1KIL A;  2WSF J;  1JCC A;  1USE A;  1VF5 B;  1JNM A;  4I2L C;  1RH5 B;  1GK4 A;  2R44 A;  1QX8 A;  1DD3 A;  1UIX A;  3VTP C;  3H1J D;  2ZVN B;  1L0L K;  5C39 A;  1AQT A;  4D6T D;  2K88 A;  2XDJ A;  2GUS A;  2WVR A;  1NGM B;  1N7S C;  1EZV I;  3GF7 A;  3V4W A;  2WMM A;  3AE4 C;  3NFQ A;  2GA1 A;  4KHX A;  4DZO A;  1GTW A;  2B89 A;  3TYY A;  1HJ0 A;  1VQK P;  3JC2 2;  1IJD B;  1N8R Q;  1GD2 E;  2E43 A;  4BRY B;  1OFC X;  1IK9 A;  3L73 D;  2Q9I A;  2I1J A;  1IFD A;  3AE6 C;  2KUB A;  1NOH A;  1N7S B;  2YKP A;  3W68 A;  1NTZ D;  3BCC J;  1N7S A;  2WSF H;  4JYB A;  1BDC A;  2Y0C A;  2BAS A;  3L37 A;  2ZVO B;  4UB8 H;  4IFF A;  2QVA A;  2A06 D;  1IO4 A;  3CCL P;  1LWU C;  4Y99 C;  3USS A;  2M3E A;  1NWQ A;  1K9M Q;  1FAV A;  1DEB A;  3L35 A;  4H13 D;  2J59 M;  1X22 A;  1E5W A;  4DJG A;  1PP9 G;  1CI6 B;  1PP9 E;  1BCC D;  2LXC B;  5TJH A;  1CI6 A;  2OQQ A;  3PTZ A;  3V2N A;  1QLE D;  3SWF A;  5KAI H;  1RY3 A;  1KYO I;  4WB4 A;  1ZME C;  2LKM A;  3M9B A;  4ZMD A;  1KB9 I;  3PJS K;  5AVQ B;  4PD4 H;  3B71 A;  3V4Q A;  1JB0 J;  1LWU B;  3H1I G;  3OW2 O;  3P8C E;  3H1I E;  4Y99 B;  1LWU A;  2FXO A;  5AW0 B;  4L75 A;  1SQB G;  3L71 E;  2G8Y A;  2B87 A;  3M0A A;  1JMM A;  1VQN P;  5AVW B;  1SQB E;  1S4X A;  3S4R A;  1HJB A;  1BDD A;  4I1L A;  4RJT A;  2CPB A;  2W8Z A;  1JO5 A;  3H1K J;  3P7K A;  4MN4 C;  2AXT H;  3SFD C;  2M8R A;  2KK7 A;  1EZV G;  3GHG C;  1EZV E;  1BCC J;  4UB8 E;  4H0L C;  1M56 D;  2J5U A;  1BGY G;  1T3U A;  2SPZ A;  3VOP A;  1BGY E;  1S1C X;  1W2E A;  3SFE C;  3L75 J;  2JWD A;  1VL2 A;  1OX3 A;  2YKO A;  1J2J B;  1SQV G;  1SQV E;  1DEE G;  3CCE P;  1OZH A;  3CCJ P;  2Z4E A;  1M7L A;  4IFD K;  2FYZ A;  4YXW H;  2WSS H;  1GW3 A;  2WPR A;  3GHG B;  1OXZ A;  3Q1M A;  1LP1 B;  4Z1M H;  4I6M C;  4PD4 E;  3M06 A;  2D2C C;  4H0L B;  1LP1 A;  2HYN A;  1MKM A;  3TK1 A;  4YPC A;  2OAR A;  2C9L Y;  2QE7 H;  1Q86 Q;  1YQ4 C;  3AEG C;  1UII A;  2IYP A;  3WUU A;  1GZL A;  2HPC B;  1PGO A;  2HPC A;  1YBK A;  4R4L A;  2WPS A;  2YIU C;  3H1J G;  4D6T G;  4D6T E;  3RK2 D;  1OW7 A;  2D2C B;  3WUV A;  3M0D C;  3L70 J;  1NH4 A;  1SQQ K;  3H32 B;  3RL0 g;  2NPS D;  3H32 A;  3AE5 C;  1QVF O;  3A0B H;  2PRR A;  5AVX B;  2W27 A;  2FYU K;  4GIF A;  1ZRT D;  3L72 D;  1KV4 A;  2IFM A;  1E79 H;  2A45 H;  2YIU B;  1ZR2 A;  2P67 A;  2BEQ D;  3HE4 B;  3TDK A;  3VMA A;  3L73 G;  2QM8 A;  3HE4 A;  1GL2 C;  3CWB D;  1X0T A;  3L73 E;  1A02 F;  1R8E A;  2LR2 A;  4WY4 C;  2FBW C;  2PAJ A;  1SQX J;  1NTZ G;  4EYY Q;  1NTZ E;  4HKZ H;  4IL6 E;  1JY3 O;  5AVS B;  1Q90 D;  3M0D A;  1U57 A;  3MD0 A;  2H8P D;  2A06 G;  4A7P A;  2A06 E;  4N6J A;  4EOT A;  3FXD A;  1JY2 N;  1PGJ A;  1YQ3 C;  2R3S A;  5KJ7 D;  1L2P A;  1KD1 Q;  1P84 H;  3OA7 A;  1YJN P;  4GOD A;  2E5T A;  1GL2 B;  2POH A;  1SFC A;  3AEC C;  1GL2 A;  3JCU E;  3G6E P;  4WY4 B;  1BCC E;  1XTG B;  4WY4 A;  2Y9Z A;  4ZNC A;  3CX5 D;  1YHQ P;  3L4F A;  3RL0 C;  1RF0 C;  1VQ4 P;  5EFW B;  4O9B A;  3CCV P;  2FYN C;  2K9Y A;  1FZB A;  1SQP D;  2Q3I A;  2KLU A;  1N73 C;  3Q2Y A;  3Q5R A;  1T2K C;  4JBZ A;  3AEE C;  1GMJ A;  3HD7 D;  1LTT C;  3BAS A;  4N3Y B;  3A3Y B;  5AVY B;  5KAF H;  3L71 D;  1YYC A;  1KFM A;  3RL0 B;  5B5E H;  1NTK J;  1RE4 C;  1RF0 A;  1T6A A;  2FYN B;  2E5Y A;  1OVU A;  4QMA A;  2JJL A;  3H1L D;  3T97 B;  3CLQ A;  2OYH C;  1N73 B;  5BU8 B;  1P84 E;  1N73 A;  3TGU G;  1JEK A;  2ZT9 C;  4ZKU A;  1FZG A;  5AW5 B;  1NO4 A;  3RK2 C;  3CD6 P;  4NPF X;  3RK3 E;  2N1T D;  1FDM A;  1NKZ B;  2QJP C;  1DH3 A;  3Q3D A;  5AVU B;  3L70 E;  4K35 A;  1VQ9 P;  1J1D C;  1GK6 A;  1RE4 A;  1NYH A;  3MTU E;  3VMZ A;  4R4M A;  2KNC B;  1QL2 A;  2YKQ A;  3ITK A;  2KNC A;  3QWO C;  1YI2 P;  2OYH B;  2IX7 C;  5L8R J;  1A02 J;  1FE6 A;  2OYH A;  1SQB K;  3BRV B;  2ZT9 B;  1IZN B;  2O1K A;  2KB7 P;  4PD4 D;  4XFJ A;  1L0N J;  3RK2 B;  5CJ0 A;  5KAF E;  1T8Z A;  5GTH E;  1TU3 F;  3M9H A;  3AEA C;  3RBX A;  2QJP B;  5B5E E;  1Y9B A;  2OYI C;  3AE2 C;  3AEB C;  2KXP B;  1J1D B;  3KDP B;  5KJ7 C;  1IFN A;  3CX5 H;  2DW3 A;  2JDI H;  1Y8A A;  2N9B A;  2GM4 A;  1SQV K;  5TIS H;  3BCC D;  3GMA A;  5DJT B;  3PHL A;  1N2D C;  2K3R A;  3RGU A;  1PZQ A;  3L72 G;  1ZRT E;  1JOC A;  3L72 E;  1URQ C;  2W90 A;  4OGQ D;  1Q7Y Q;  1L0L J;  2O01 J;  3VN0 A;  2O1J A;  1ZLL A;  1L4A D;  2ZXX A;  3CWB G;  4UB6 H;  3CWB E;  2OYI B;  1S2E A;  2YNY A;  1FJP A;  1EDK A;  2OYI A;  1FBM A;  1FZE A;  3HTK B;  1KC8 Q;  4JF7 A;  3UIA A;  2Q7C A;  3HTK A;  5H2F H;  3CME P;  2R3C A;  1PIX A;  2O01 N;  1NKN A;  5KJ7 A;  5E79 H;  4BRY A;  3GLM A;  1T3J A;  3AE7 C;  2IZ0 A;  1M90 Q;  1URQ B;  2QEX P;  1FOS E;  2R5D A;  1OW6 A;  1URQ A;  4PD4 I;  1AFO A;  1CZQ A;  1M8O B;  2ZYD A;  2JO1 A;  3VMY A;  2FKW B;  1HWT C;  2KS1 B;  1KQS O;  4W7Y A;  1X9V A;  2KS1 A;  1U7M A;  4NPE A;  1QEX A;  1RQU A;  3B5N D;  3L74 J;  3CX5 E;  2HG5 D;  3H1K D;  3PP5 A;  3U1C A;  5GTI H;  1BE3 J;  3EQ2 A;  3KZI H;  1VQP P;  1SQP G;  3TSI A;  1J1E C;  1SQP E;  1OW8 A;  1EDL A;  2XU6 A;  1LJ2 A;  5AVT B;  3GG2 A;  2N1T C;  5B66 H;  1SS1 A;  2W6A A;  1NHL A;  2KSE A;  1VDF A;  3L75 D;  4UB6 E;  2WSC J;  2O01 H;  2O3J A;  5H2F E;  1NTZ K;  2Y9Y A;  1NU1 J;  1WRG A;  3V2R A;  3E1I A;  5KLI C;  1SVF A;  3L71 G;  1VQ7 P;  2QA4 P;  4TLF A;  1JMB A;  3E7K A;  1KFN A;  2VRS A;  4WVZ A;  3H1L G;  1DD4 A;  1J1E B;  3WMM 0;  3EFG A;  3H1L E;  3P8M C;  3D71 A;  1MFT A;  3U1A A;  3CPW O;  2N1T B;  2IZ1 A;  1QVG O;  1DIP A;  3FGA D;  1KQL A;  1S3J A;  2KOG A;  4GOF A;  4U3F J;  3S9O A;  1VQ8 P;  3LW5 J;  3FXE A;  1P84 D;  1MV8 A;  1M1K Q;  5KLI B;  4GT1 A;  1GU5 A;  3KQG A;  2B9B A;  2OTL P;  2JP3 A;  5KKZ C;  1KYO H;  2E74 D;  3GF3 A;  4OGQ C;  3RK3 D;  5KAI E;  5B66 E;  4H44 D;  1FZC C;  2HOD B;  1L4A C;  2HOD A;  3VP9 A;  3L70 D;  3GHG A;  2I1K A;  4ASW A;  2UWJ E;  4I7Z C;  1IFP A;  3I55 P;  1NVO A;  2FFD C;  3H1H J;  1PFI A;  2WSC H;  1KZU B;  2MKV A;  1USD A;  1JY2 P;  1LGH B;  1RF1 C;  5APQ A;  4C7R A;  1QL1 A;  5KKZ B;  2ZAE B;  2AXT E;  3A0H H;  3OJA B;  2W6B A;  3R2P A;  5AVR B;  4OGQ B;  2OTK E;  1BSN A;  1H89 A;  1S5L H;  1SQX D;  1FZC B;  3BCC G;  3MZW B;  1L4A B;  3BCC E;  4PV1 D;  2C0X A;  3MP7 B;  3A7O A;  5CCG D;  4I7Z B;  2FFD B;  2BCC J;  4U7J A;  3EWK A;  2FFD A;  5CCH D;  3CC7 P;  1ZP0 C;  1RHZ B;  3MHV A;  1KIL D;  2J58 A;  5KLV J;  5AVZ B;  4H13 C;  3LW5 H;  2HFE D;  5AW9 B;  3D6Z A;  3CCM P;  2JKV A;  1P84 I;  1SQQ J;  5AW7 B;  1RF1 B;  3Q5P A;  1Q81 Q;  1BE3 E;  2L91 A;  1VF5 D;  1RF1 A;  2AEM A;  1NTM J;  1Z56 A;  2FYU J;  1KQF B;  4AQR D;  1MFZ A;  3MUD C;  3IFM A;  2E75 D;  1S72 P;  3AE3 C;  1AV1 A;  3OAK A;  3V2P A;  3N4X A;  5AVV B;  1SQX K;  2XV5 A;  1ZR4 A;  3SSU A;  2YO2 A;  1EXJ A;  4PJ0 H;  1X79 B;  5AW6 B;  4H13 B;  1VQ6 P;  2LXB A;  1ZXG A;  3A0H E;  4IL6 X;  1YJW P;  2QJY C;  4WBA A;  1FU1 A;  3H1K G;  3CXH H;  1HVV A;  4RO0 A;  3H1K E;  5CMZ A;  2WPV B;  1MZ9 A;  4JYC A;  2N9Y B;  3WU2 H;  4C46 A;  3S1K A;  1BCC G;  3MUD A;  1H0T B;  1NTK D;  1H0T A;  3CC2 P;  3IAO A;  3L75 G;  1WMK A;  3L75 E;  3A0B E;  2JR8 A;  2M0B A;  3I5C A;  3EFF K;  3WUT A;  2E74 C;  2P58 A;  1N7S D;  1RE3 C;  2KI7 B;  4ZKP A;  2XKM A;  3RK3 C;  2A45 G;  2QJY B;  1NJI Q;  4L73 A;  3MIW A;  2R32 A;  5CHX A;  1N86 A;  2KIK A;  3JSV C;  1G2C B;  1G2C A;  2RKL A;  1EDI A;  3C9I A;  3A2A A;  1FZF A;  2E74 B;  1YTZ I;  1JTH B;  4GKG A;  2HR3 A;  1FZA A;  2WQY C;  1RE3 A;  3CL3 D;  3T97 A;  3RK3 B;  1JTH A;  2RMZ A;  2HLO A;  2Y0E A;  2P10 A;  1L0N D;  2KZI A;  1BSH A;  1JM0 A;  2ZJS E;  1SQP K;  3K5B A;  5AW3 B;  2ZXE B;  2QJK C;  5CCG C;  3BAT A;  4EIJ A;  4DCK A;  5CCH C;  3SWK A;  2NPS C;  1HUC A;  3L70 G;  5AW8 B;  1PP9 J;  2BCC E;  1VQM P;  4BWN A;  4NPD A;  1JY3 N;  4N78 D;  3CX5 I;  5KLV E;  2WPQ A;  4B86 A;  3GW6 A;  2XNX A;  2K37 A;  3A5T A;  3KPE A;  5KTB A;  4CPG A;  2AXC A;  1NTM E;  1L0L D;  2K9J B;  2JEE A;  2YXR B;  3H1I J;  2K9J A;  1K8A Q;  2E75 C;  1GU4 A;  1EC5 A;  2R5B A;  2QJK B;  1SQB J;  2ITA A;  2FXM A;  3G3Z A;  1SQX G;  1SQX E;  1LT9 C;  2NPS B;  4HYT B;  1YTZ T;  2NPS A;  1S9K D;  2Q5U A;  3B4S A;  2RH0 A;  3VMX A;  3KHU A;  4M3L A;  3G9R A;  4TT3 H;  3N7N A;  1KIL E;  1BGY J;  2OTJ P;  3KXD A;  1PPJ D;  2C9N Y;  2YMY A;  4H0L D;  5APS A;  2PFX A;  5BVZ A;  3CI9 A;  4C7N B;  2E75 B;  2QSI A;  3LID A;  4C7N A;  1SQV J;  1LTB C;  5M1B A;  5APW A;  1LTI C;  1LT9 B;  3L74 D;  3CCU P;  2NRG A;  1LT9 A;  2W6J H;  1KYO D;  1FS0 E;  3H6P A;  1BE3 D;  1LNQ A;  2Q6Q A;  1IK7 A;  1KB9 D;  2M5A B;  5BU5 A;  2M5A A;  3M9Q A;  1AVO A;  1VQ5 P;  3HD7 C;  3O8Z A;  4K3A A;  2D2C D;  4OVN F;  1ZV8 A;  4W7Z A; 
#chains in the Genus database with same CATH homology
 2L5G B;  1FJK A;  1JY3 O;  1WT6 A;  5AVS B;  3M0D A;  2H7H A;  1IFI A;  3VYI A;  3MD0 A;  2PP6 A;  3V2Q A;  2H8P D;  3RK3 D;  1FZC C;  2HOD B;  4N6J A;  4EOT A;  1JY2 N;  1OWA A;  1L4A C;  2HOD A;  2KP8 A;  3VP9 A;  1IFJ A;  4LC1 A;  3L36 A;  5KJ7 D;  3GHG A;  2I1K A;  4W80 A;  3OA7 A;  2IPP A;  2FFD C;  1PFI A;  1JCD A;  2WSC H;  3NTN A;  5CCG A;  1GL2 B;  5AW1 B;  2POH A;  1SFC A;  1KZU B;  3HD7 B;  1L0N K;  2P2U A;  2WTY A;  1GL2 A;  3HD7 A;  3TNU B;  4WY4 B;  5CCH A;  1XTG B;  1JY2 P;  2P1J A;  1HBW A;  3TNU A;  1KIL B;  4WY4 A;  2KLV A;  1LGH B;  1RF1 C;  1KIL A;  5APQ A;  4C7R A;  3L4F A;  1JCC A;  3RL0 C;  1QL1 A;  1RF0 C;  3OJA B;  4O9B A;  2W6B A;  3R2P A;  5AVR B;  1M1J C;  1JNM A;  1FZB A;  1H89 A;  4I2L C;  2Q3I A;  1FZC B;  1NAF A;  1L4A B;  3HE5 B;  3V5B A;  1N73 C;  4XE5 B;  3HE5 A;  1GK4 A;  2C0X A;  3A7O A;  4DOJ A;  5CCG D;  1T2K C;  1SFC D;  5CJ4 A;  1NU1 K;  3VTP C;  2FFD B;  1GL2 D;  3HD7 D;  2FFD A;  5APT A;  1LTT C;  2IFN A;  5CCH D;  3BAS A;  4WY4 D;  2GUV A;  1KIL D;  2J58 A;  5AVZ B;  1L0L K;  4N3Y B;  3LW5 H;  2HFE D;  5AW9 B;  3A3Y B;  4IFM A;  2XDJ A;  2GUS A;  5AVY B;  5AW7 B;  1RF1 B;  1YYC A;  1KFM A;  3RL0 B;  1N7S C;  1RF1 A;  2N1T A;  1RE4 C;  1Z56 A;  1RF0 A;  3V4W A;  2YO3 A;  3HUS C;  1LTJ C;  1M1J B;  2JJL A;  3IR9 A;  1M1J A;  3NFQ A;  4AQR D;  4KHX A;  3U59 A;  3CLQ A;  1MFZ A;  2OYH C;  4DZO A;  1N73 B;  5BU8 B;  3P32 A;  3IFM A;  2WT7 B;  5APU A;  1GTW A;  3NMD A;  1N73 A;  3TYY A;  2WT7 A;  4ZKU A;  1IJD B;  1FZG A;  5AW5 B;  5AW2 B;  1GD2 E;  3OAK A;  3V2P A;  3KYQ A;  3N4X A;  5AW4 B;  5AVV B;  2CPS A;  2E43 A;  1SQX K;  3SWY A;  4N78 E;  2XV5 A;  1ZR4 A;  2YO2 A;  1IK9 A;  1NO4 A;  3RK2 C;  1X79 B;  2WIT A;  5AW6 B;  1IC2 A;  2Q9I A;  2N1T D;  1FDM A;  3RL0 D;  4LLH A;  2I1J A;  1IFD A;  2Z5I A;  1NKZ B;  1DH3 A;  1NOH A;  5AVU B;  1JY2 O;  1N7S B;  2YKP A;  4WBA A;  1FU1 A;  1N7S A;  1J1D C;  1GK6 A;  1HVV A;  2WSF H;  4JYB A;  1RE4 A;  3HUS B;  1LTJ B;  5CMZ A;  3HUS A;  3MTU E;  1LTJ A;  1MZ9 A;  4JYC A;  2BAS A;  3VMZ A;  3L37 A;  4C46 A;  1QL2 A;  2YKQ A;  4IFF A;  1HTL C;  2OYH B;  1IO4 A;  2IX7 C;  1A02 J;  1LWU C;  2OYH A;  1T2K D;  1SQB K;  3BRV B;  3MUD A;  4Y99 C;  2M3B A;  1S9K E;  1NWQ A;  2O1K A;  4AUW A;  1FAV A;  2KB7 P;  1DEB A;  2A45 I;  3L35 A;  1G1I A;  3B8E B;  1HGV A;  3RK2 B;  2J59 M;  5CJ0 A;  1FOS F;  3I5C A;  1E5W A;  1T8Z A;  3M9H A;  1N7S D;  1CI6 B;  1RE3 C;  4ZKP A;  1CI6 A;  2XKM A;  1FZC A;  2OYI C;  3LIE A;  3RK3 C;  2A45 G;  3V2N A;  3SWF A;  1L4A A;  1RY3 A;  1J1D B;  2Z5H A;  4WB4 A;  3KDP B;  3MIW A;  2LKM A;  3M9B A;  1SP4 A;  2R32 A;  4HH2 A;  4XA4 A;  5CHX A;  1N86 A;  5KJ7 C;  1JUN A;  3B5N C;  1IFN A;  5AVQ B;  2N9B A;  2GM4 A;  3V4Q A;  1LWU B;  1SQV K;  2WSE H;  3P8C E;  4Y99 B;  1LWU A;  1G2C B;  1N2D C;  1G2C A;  5AW0 B;  5KLV K;  1JOC A;  3M0A A;  1JMM A;  1URQ C;  5AVW B;  1HJB A;  3C9I A;  3A2A A;  4I1L A;  3VN0 A;  2CPB A;  5APV A;  2O1J A;  1ZLL A;  1JO5 A;  1FZF A;  1L4A D;  3P7K A;  1NTM K;  1EQ7 A;  2M8R A;  1YTZ I;  1JTH B;  4GKG A;  1FZA A;  3CL3 D;  1RE3 A;  3II6 A;  3T97 A;  2OYI B;  3RK3 B;  1JTH A;  2YNY A;  4RES B;  1FJP A;  2OYI A;  2HLO A;  1FBM A;  1FZE A;  3HTK B;  3GHG C;  4JF7 A;  3UIA A;  2H43 A;  2Q7C A;  3HTK A;  2ZFC A;  2R3C A;  1SQP K;  5AW3 B;  2ZXE B;  1T3U A;  3B5N B;  1GDT A;  1NKN A;  5KJ7 A;  5CCG C;  3VOP A;  1W2E A;  1SFC C;  3B5N A;  3BAT A;  1VPC A;  4EIJ A;  1T3J A;  3MGN A;  5CCH C;  3M91 A;  2YKO A;  2NPS C;  1HUC A;  1J2J B;  5AW8 B;  1URQ B;  1JY3 N;  1FOS E;  2R5D A;  1URQ A;  4N78 D;  1H8A A;  1AFO A;  1CZQ A;  2Z4E A;  1M7L A;  3VMY A;  2WPQ A;  4IFD K;  4B86 A;  2FKW B;  2FYZ A;  2P7J A;  1HWT C;  2XNX A;  3A5T A;  1N7L A;  1GW3 A;  3KPE A;  5APY A;  4W7Y A;  1X9V A;  5KTB A;  2WPR A;  3GHG B;  2WZ7 A;  2JEE A;  1OXZ A;  3BVH A;  3B5N D;  1HGZ A;  4I6M C;  1MUU A;  2HG5 D;  1JY3 P;  3M06 A;  1GU4 A;  2HYN A;  3PP5 A;  3U1C A;  2R5B A;  1XTC C;  3EQ2 A;  1SFC B;  1DX7 A;  3TK1 A;  2FXM A;  1X8Y A;  3TSI A;  2OAR A;  3G3Z A;  4LGD E;  2C9L Y;  1J1E C;  1CW5 A;  1URQ D;  1LT9 C;  2NPS B;  1IFM A;  2XU6 A;  4HYT B;  1YTZ T;  2C0W A;  2NPS A;  1S9K D;  2Q5U A;  5AVT B;  2E42 A;  1GZL A;  3HRN A;  2N1T C;  2W6A A;  1AQ5 A;  2HPC B;  4OH8 B;  3VMX A;  1NHL A;  2HPC A;  1VDF A;  3NXS A;  1LTG C;  2O01 H;  4M3L A;  2WPS A;  1HH0 A;  3N7N A;  1H88 A;  1ZN5 A;  1NTZ K;  1CSB A;  2C9N Y;  2YMY A;  1WRG A;  3V2R A;  5APS A;  3E1I A;  1SVF A;  5BVZ A;  3CI9 A;  4C7N B;  1G1J A;  2XZR A;  3LID A;  3RK2 D;  4C7N A;  2KSJ A;  3M0D C;  1LTS C;  1LTB C;  1NH4 A;  1SQQ K;  3H32 B;  1KFN A;  2VRS A;  2NPS D;  3H32 A;  1GW4 A;  2KYV A;  5APW A;  1LTI C;  1J1E B;  3WMM 0;  1NTK K;  3EFG A;  3P8C D;  1LT9 B;  1SLQ A;  3P8M C;  5AVX B;  1LT9 A;  2W27 A;  2FYU K;  3BRT B;  3U1A A;  2N1T B;  1LTA C;  4GIF A;  3H6P A;  2QM7 A;  1KQL A;  2WWW A;  2IFM A;  2KOG A;  2A45 H;  5BU5 A;  5APX A;  3M9Q A;  1ZR2 A;  2P67 A;  3HE4 B;  2QM8 A;  3HE4 A;  3VP8 A;  1GL2 C;  3HD7 C;  3O8Z A;  1MV8 A;  1A02 F;  2MJZ A;  4WY4 C;  1ZV8 A;  4GT1 A;  2PAJ A;  1KIL C;  1GU5 A;  3KQG A;  4AYC A;  4W7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...