1NKUA

Nmr solution structure of zinc-binding protein 3-methyladenine dna glycosylase i (tag)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
187
structure length
187
Chain Sequence
MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVLKKRENYRACFHQFDPVKVAAMQEEDVERLVQDAGIIRHRGKIQAIIGNARAYLQMEQNGEPFADFVWSFVNHQPQMTQATTLSEIPTSTPASDALSKALKKRGFKFVGTTICYSFMQACGLVNDHVVGCCCYPGNKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-Methyladenine Dna Glycosylase I (TAG)
publication title A Novel Zinc Snap Motif Conveys Structural Stability to 3-Methyladenine DNA Glycosylase I
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 45
structure length 187
sequence length 187
ec nomenclature ec 3.2.2.20: DNA-3-methyladenine glycosylase I.
pdb deposition date 2003-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03352 Adenine_glyco Methyladenine glycosylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1nkuA00
2JHJA 1HU0A 3CVTA 1PU7A 2NOHA 2I5WA 4OFHA 2NOBA 2XHIA 3OGDA 4EW4A 2ABKA 4E9EA 4E9FA 1XQPA 3S6IA 1N3AA 3F0ZA 3CW7A 1EBMA 3FHFA 3D4VA 3N5NX 1M3QA 4E9HA 1PU8A 1XG7A 1VRLA 1YQRA 1YQLA 2YG8A 1RRSA 3KTUA 1PU6A 2H56A 4YPHA 2NOEA 1ORPA 2NOIA 2NOLA 4YPRA 1MUDA 4EVVA 1MPGA 2OFKA 4EW0A 3CWSA 1WEIA 4HSBA 1ORNA 4PIIA 1DIZA 4EJZA 3G0QA 3IHOA 1KG6A 1P7MA 3FHGA 2OFIA 1FN7A 1KG2A 1P59A 4B22A 4AI4A 1M3HA 1MUYA 3IH7A 4EA5A 1KO9A 3CWUA 1KEAA 2JHNA 1WEGA 1KG3A 1LWWA 3F10A 3OH6A 1WEFA 1NKUA 1KQJA 3KNTA 4B24A 5CHZA 1PVSA 1NGNA 2JG6A 4AI5A 1RRQA 1KG4A 3FSPA 1LMZA 4YOQA 2NOZA 3I0XA 4EJYA 1KG5A 3CVSA 4DK9A 3I0WA 1N39A 5KN9A 1LWVA 3OH9A 4UNFA 3CWTA 4EA4A 4B23A 4OFEA 4OFAA 4UOBA 1YQKA 5AN4A 4AIAA 1N3CA 1XQOA 1YQMA 3CWAA 1MUNA 4E9GA 2NOFA 5DPKA 1KG7A 5KN8A 3N0UA 4B21A 1LWYA 2YG9A
chains in the Genus database with same CATH superfamily
2JHJA 2JPSA 1HU0A 3CVTA 3L2UA 1PU7A 2W03A 2NOHA 2I5WA 3L2VA 3OYFA 4OFHA 4ZTJA 2NOBA 2XHIA 3S3MA 3OGDA 3OYEA 4EW4A 2ABKA 5FRMA 4E9EA 4E9FA 1XQPA 3S6IA 1N3AA 3F0ZA 3CW7A 1U84A 1EBMA 3FHFA 4BE0A 3R2XC 3OYDA 3D4VA 3VW4A 3N5NX 1M3QA 4E9HA 1PU8A 3OYLA 2V75A 1XG7A 3OYAA 3L2RA 1VRLA 3OYMA 1YQRA 1YQLA 2YG8A 3OYJA 1RRSA 3KTUA 4BACA 1PU6A 3NNQA 3OY9A 2H56A 4YPHA 2NOEA 3OYGA 1ORPA 3L2WA 2NOIA 2NOLA 3OYCA 4ZTFA 4YPRA 1MUDA 4BE1A 4EVVA 1MPGA 2OFKA 3OS0A 3OYBA 4EW0A 1WEIA 3CWSA 4HSBA 1ORNA 4PIIA 3S3OA 1DIZA 4EJZA 4BE2A 3G0QA 3IHOA 1KG6A 1P7MA 3FHGA 2OFIA 1FN7A 3OS2A 1KG2A 1P59A 4B22A 4E7KA 4E7LA 4AI4A 1M3HA 1MUYA 3IH7A 4E7HA 4EA5A 1KO9A 3CWUA 1KEAA 2JHNA 1WEGA 1KG3A 4BDYA 1LWWA 3F10A 3OH6A 4E7IA 3OYKA 1WEFA 1NKUA 1KQJA 3KNTA 4B24A 5CHZA 1PVSA 4NZGA 1NGNA 2JG6A 4AI5A 3OYIA 1RRQA 1KG4A 3FSPA 1LMZA 3S3NA 4YOQA 2NOZA 5FROA 4BDZA 3I0XA 4EJYA 1KG5A 3CVSA 4DK9A 3I0WA 3OYHA 5KN9A 1N39A 1LWVA 3OH9A 4UNFA 3OS1A 3CWTA 4EA4A 4B23A 4OFEA 3L2QA 3LCNA 4OFAA 2W04A 4UOBA 1YQKA 5AN4A 4AIAA 1N3CA 1XQOA 1YQMA 3CWAA 1MUNA 4IKFA 4E9GA 2NOFA 5DPKA 1KG7A 5KN8A 3N0UA 5FRNA 4B21A 1LWYA 3OYNA 2YG9A 4E7JA
chains in the Genus database with same CATH topology
2JHJA 1HU0A 3CVTA 1PU7A 2NOHA 2I5WA 4OFHA 2NOBA 2XHIA 3OGDA 4EW4A 2ABKA 4E9EA 4E9FA 1XQPA 3S6IA 1N3AA 3F0ZA 3CW7A 1EBMA 3FHFA 3D4VA 3N5NX 1M3QA 4E9HA 1PU8A 1XG7A 1VRLA 1YQRA 1YQLA 2YG8A 1RRSA 3KTUA 1PU6A 2H56A 4YPHA 2NOEA 1ORPA 2NOIA 2NOLA 4YPRA 1MUDA 4EVVA 1MPGA 2OFKA 4EW0A 3CWSA 1WEIA 4HSBA 1ORNA 4PIIA 1DIZA 4EJZA 3G0QA 3IHOA 1KG6A 1P7MA 3FHGA 2OFIA 1FN7A 1KG2A 1P59A 4B22A 4AI4A 1M3HA 1MUYA 3IH7A 4EA5A 1KO9A 3CWUA 1KEAA 2JHNA 1WEGA 1KG3A 1LWWA 3F10A 3OH6A 1WEFA 1NKUA 1KQJA 3KNTA 4B24A 5CHZA 1PVSA 1NGNA 2JG6A 4AI5A 1RRQA 1KG4A 3FSPA 1LMZA 4YOQA 2NOZA 3I0XA 4EJYA 1KG5A 3CVSA 4DK9A 3I0WA 1N39A 5KN9A 1LWVA 3OH9A 4UNFA 3CWTA 4EA4A 4B23A 4OFEA 4OFAA 4UOBA 1YQKA 5AN4A 4AIAA 1N3CA 1XQOA 1YQMA 3CWAA 1MUNA 4E9GA 2NOFA 5DPKA 1KG7A 5KN8A 3N0UA 4B21A 1LWYA 2YG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JHJ A;  1HU0 A;  3CVT A;  1PU7 A;  2NOH A;  2I5W A;  4OFH A;  2NOB A;  2XHI A;  3OGD A;  4EW4 A;  2ABK A;  4E9E A;  4E9F A;  1XQP A;  3S6I A;  1N3A A;  3F0Z A;  3CW7 A;  1EBM A;  3FHF A;  3D4V A;  3N5N X;  1M3Q A;  4E9H A;  1PU8 A;  1XG7 A;  1VRL A;  1YQR A;  1YQL A;  2YG8 A;  1RRS A;  3KTU A;  1PU6 A;  2H56 A;  4YPH A;  2NOE A;  1ORP A;  2NOI A;  2NOL A;  4YPR A;  1MUD A;  4EVV A;  1MPG A;  2OFK A;  4EW0 A;  3CWS A;  1WEI A;  4HSB A;  1ORN A;  4PII A;  1DIZ A;  4EJZ A;  3G0Q A;  3IHO A;  1KG6 A;  1P7M A;  3FHG A;  2OFI A;  1FN7 A;  1KG2 A;  1P59 A;  4B22 A;  4AI4 A;  1M3H A;  1MUY A;  3IH7 A;  4EA5 A;  1KO9 A;  3CWU A;  1KEA A;  2JHN A;  1WEG A;  1KG3 A;  1LWW A;  3F10 A;  3OH6 A;  1WEF A;  1NKU A;  1KQJ A;  3KNT A;  4B24 A;  5CHZ A;  1PVS A;  1NGN A;  2JG6 A;  4AI5 A;  1RRQ A;  1KG4 A;  3FSP A;  1LMZ A;  4YOQ A;  2NOZ A;  3I0X A;  4EJY A;  1KG5 A;  3CVS A;  4DK9 A;  3I0W A;  1N39 A;  5KN9 A;  1LWV A;  3OH9 A;  4UNF A;  3CWT A;  4EA4 A;  4B23 A;  4OFE A;  4OFA A;  4UOB A;  1YQK A;  5AN4 A;  4AIA A;  1N3C A;  1XQO A;  1YQM A;  3CWA A;  1MUN A;  4E9G A;  2NOF A;  5DPK A;  1KG7 A;  5KN8 A;  3N0U A;  4B21 A;  1LWY A;  2YG9 A; 
#chains in the Genus database with same CATH topology
 2JHJ A;  2JPS A;  1HU0 A;  3CVT A;  3L2U A;  1PU7 A;  2W03 A;  2NOH A;  2I5W A;  3L2V A;  3OYF A;  4OFH A;  4ZTJ A;  2NOB A;  2XHI A;  3S3M A;  3OGD A;  3OYE A;  4EW4 A;  2ABK A;  5FRM A;  4E9E A;  4E9F A;  1XQP A;  3S6I A;  1N3A A;  3F0Z A;  3CW7 A;  1U84 A;  1EBM A;  3FHF A;  4BE0 A;  3R2X C;  3OYD A;  3D4V A;  3VW4 A;  3N5N X;  1M3Q A;  4E9H A;  1PU8 A;  3OYL A;  2V75 A;  1XG7 A;  3OYA A;  3L2R A;  1VRL A;  3OYM A;  1YQR A;  1YQL A;  2YG8 A;  3OYJ A;  1RRS A;  3KTU A;  4BAC A;  1PU6 A;  3NNQ A;  3OY9 A;  2H56 A;  4YPH A;  2NOE A;  3OYG A;  1ORP A;  3L2W A;  2NOI A;  2NOL A;  3OYC A;  4ZTF A;  4YPR A;  1MUD A;  4BE1 A;  4EVV A;  1MPG A;  2OFK A;  3OS0 A;  3OYB A;  4EW0 A;  1WEI A;  3CWS A;  4HSB A;  1ORN A;  4PII A;  3S3O A;  1DIZ A;  4EJZ A;  4BE2 A;  3G0Q A;  3IHO A;  1KG6 A;  1P7M A;  3FHG A;  2OFI A;  1FN7 A;  3OS2 A;  1KG2 A;  1P59 A;  4B22 A;  4E7K A;  4E7L A;  4AI4 A;  1M3H A;  1MUY A;  3IH7 A;  4E7H A;  4EA5 A;  1KO9 A;  3CWU A;  1KEA A;  2JHN A;  1WEG A;  1KG3 A;  4BDY A;  1LWW A;  3F10 A;  3OH6 A;  4E7I A;  3OYK A;  1WEF A;  1NKU A;  1KQJ A;  3KNT A;  4B24 A;  5CHZ A;  1PVS A;  4NZG A;  1NGN A;  2JG6 A;  4AI5 A;  3OYI A;  1RRQ A;  1KG4 A;  3FSP A;  1LMZ A;  3S3N A;  4YOQ A;  2NOZ A;  5FRO A;  4BDZ A;  3I0X A;  4EJY A;  1KG5 A;  3CVS A;  4DK9 A;  3I0W A;  3OYH A;  5KN9 A;  1N39 A;  1LWV A;  3OH9 A;  4UNF A;  3OS1 A;  3CWT A;  4EA4 A;  4B23 A;  4OFE A;  3L2Q A;  3LCN A;  4OFA A;  2W04 A;  4UOB A;  1YQK A;  5AN4 A;  4AIA A;  1N3C A;  1XQO A;  1YQM A;  3CWA A;  1MUN A;  4IKF A;  4E9G A;  2NOF A;  5DPK A;  1KG7 A;  5KN8 A;  3N0U A;  5FRN A;  4B21 A;  1LWY A;  3OYN A;  2YG9 A;  4E7J A; 
#chains in the Genus database with same CATH homology
 2JHJ A;  1HU0 A;  3CVT A;  1PU7 A;  2NOH A;  2I5W A;  4OFH A;  2NOB A;  2XHI A;  3OGD A;  4EW4 A;  2ABK A;  4E9E A;  4E9F A;  1XQP A;  3S6I A;  1N3A A;  3F0Z A;  3CW7 A;  1EBM A;  3FHF A;  3D4V A;  3N5N X;  1M3Q A;  4E9H A;  1PU8 A;  1XG7 A;  1VRL A;  1YQR A;  1YQL A;  2YG8 A;  1RRS A;  3KTU A;  1PU6 A;  2H56 A;  4YPH A;  2NOE A;  1ORP A;  2NOI A;  2NOL A;  4YPR A;  1MUD A;  4EVV A;  1MPG A;  2OFK A;  4EW0 A;  3CWS A;  1WEI A;  4HSB A;  1ORN A;  4PII A;  1DIZ A;  4EJZ A;  3G0Q A;  3IHO A;  1KG6 A;  1P7M A;  3FHG A;  2OFI A;  1FN7 A;  1KG2 A;  1P59 A;  4B22 A;  4AI4 A;  1M3H A;  1MUY A;  3IH7 A;  4EA5 A;  1KO9 A;  3CWU A;  1KEA A;  2JHN A;  1WEG A;  1KG3 A;  1LWW A;  3F10 A;  3OH6 A;  1WEF A;  1NKU A;  1KQJ A;  3KNT A;  4B24 A;  5CHZ A;  1PVS A;  1NGN A;  2JG6 A;  4AI5 A;  1RRQ A;  1KG4 A;  3FSP A;  1LMZ A;  4YOQ A;  2NOZ A;  3I0X A;  4EJY A;  1KG5 A;  3CVS A;  4DK9 A;  3I0W A;  1N39 A;  5KN9 A;  1LWV A;  3OH9 A;  4UNF A;  3CWT A;  4EA4 A;  4B23 A;  4OFE A;  4OFA A;  4UOB A;  1YQK A;  5AN4 A;  4AIA A;  1N3C A;  1XQO A;  1YQM A;  3CWA A;  1MUN A;  4E9G A;  2NOF A;  5DPK A;  1KG7 A;  5KN8 A;  3N0U A;  4B21 A;  1LWY A;  2YG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...