1NLAA

Solution structure of switch arc, a mutant with 3(10) helices replacing a wild-type beta-ribbon
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
53
structure length
53
Chain Sequence
MKGMSKMPQFLNRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Switch Arc, a mutant with 3(10) helices replacing a wild-type beta-ribbon
pubmed doi rcsb
source organism Enterobacteria phage p22
molecule tags Transcription
molecule keywords Transcriptional repressor arc
total genus 11
structure length 53
sequence length 53
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03869 Arc Arc-like DNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 1nlaA00
2BJ8A 2KELA 2BSQE 2CAJA 1MYKA 3VEBA 1MNTA 1X93A 4D8JA 2WVDA 2WVFA 1EA4A 2H1OE 2JXIA 2K6LA 4ME7E 2CAXA 3GXQA 1BDTA 2BNZA 3QOQA 2BJ9A 2K29A 2AY0A 2WVCA 2GPEA 3VEAA 3FT7A 1IRQA 4HV0A 2BJ1A 1NLAA 1BAZA 2HZAA 2JXGA 3H87C 2K5JA 2BA3A 2BJ7A 2BJ3A 1B01A 2WVBA 1QTGA 2K9IA 1PARA 1B28A 1P94A 2K1OA 1ARQA 3VW4A 4FXEA 2WVEA 2BNWA 1MYLA 1ARRA 2HZVA 3OD2A 2RBFA 1BDVA 2CA9A 3FMTA 2JXHA 1U9PA 3LGHA 2CPGA 1Q5VA 2CADA
chains in the Genus database with same CATH superfamily
2BSQE 3UPFA 2JXIA 2WVDA 1Q16A 2K6LA 2KKEA 4QPXA 4NRTA 2BNZA 2AY0A 3FT7A 2JXGA 2K5JA 1B01A 2A2BA 2K9IA 2AN7A 2UUTA 3NNEA 4LRVA 2CADA 4NRUA 2CAJA 1MYKA 3VEBA 2ADLA 4ME7E 3GXQA 1SIWA 3LJPA 2WVCA 2GPEA 1IRQA 1NLAA 2BA3A 3BSNA 2WVBA 1ARQA 2BNWA 1ARRA 4LQ3A 2CA9A 3FMTA 1U9PA 3LGHA 3SFUA 4AAIA 3NAHA 1OG7A 1OHNA 1EA4A 3UR0A 2KOEA 3H5YA 3QOQA 2K29A 3UQSA 3VEAA 4LQ9A 1SH0A 4HV0A 1BAZA 2HZAA 3H87C 2BJ7A 2BJ3A 1PARA 1P94A 4FXEA 4O4RA 2WVEA 2B43A 3BSOA 1MYLA 2JBVA 2HZVA 3OD2A 2JXHA 2CPGA 2H3AA 2CKWA 2BJ8A 2KELA 2Q2KA 2H1OE 1MNTA 1SH3A 1X93A 4D8JA 2CAXA 1BDTA 2BJ9A 3G5OA 3IR7A 3QIDA 2BJ1A 1QTGA 3SFGA 1B28A 2K1OA 3NO7A 3VW4A 3NAIA 1SH2A 2RBFA 1BDVA 2UUWA 2WK4A 4MJWA 1Q5VA 2WVFA 3H5XA
chains in the Genus database with same CATH topology
2BJ8A 2KELA 2BSQE 2CAJA 1MYKA 3VEBA 1MNTA 1X93A 4D8JA 2WVDA 2WVFA 1EA4A 2H1OE 2JXIA 2K6LA 4ME7E 2CAXA 3GXQA 1BDTA 2BNZA 3QOQA 2BJ9A 2K29A 2AY0A 2WVCA 2GPEA 3VEAA 3FT7A 1IRQA 4HV0A 2BJ1A 1NLAA 1BAZA 2HZAA 2JXGA 3H87C 2K5JA 2BA3A 2BJ7A 2BJ3A 1B01A 2WVBA 1QTGA 2K9IA 1PARA 1B28A 1P94A 2K1OA 1ARQA 3VW4A 4FXEA 2WVEA 2BNWA 1MYLA 1ARRA 2HZVA 3OD2A 2RBFA 1BDVA 2CA9A 3FMTA 2JXHA 1U9PA 3LGHA 2CPGA 1Q5VA 2CADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJ8 A;  2KEL A;  2BSQ E;  2CAJ A;  1MYK A;  3VEB A;  1MNT A;  1X93 A;  4D8J A;  2WVD A;  2WVF A;  1EA4 A;  2H1O E;  2JXI A;  2K6L A;  4ME7 E;  2CAX A;  3GXQ A;  1BDT A;  2BNZ A;  3QOQ A;  2BJ9 A;  2K29 A;  2AY0 A;  2WVC A;  2GPE A;  3VEA A;  3FT7 A;  1IRQ A;  4HV0 A;  2BJ1 A;  1NLA A;  1BAZ A;  2HZA A;  2JXG A;  3H87 C;  2K5J A;  2BA3 A;  2BJ7 A;  2BJ3 A;  1B01 A;  2WVB A;  1QTG A;  2K9I A;  1PAR A;  1B28 A;  1P94 A;  2K1O A;  1ARQ A;  3VW4 A;  4FXE A;  2WVE A;  2BNW A;  1MYL A;  1ARR A;  2HZV A;  3OD2 A;  2RBF A;  1BDV A;  2CA9 A;  3FMT A;  2JXH A;  1U9P A;  3LGH A;  2CPG A;  1Q5V A;  2CAD A; 
#chains in the Genus database with same CATH topology
 2BSQ E;  3UPF A;  2JXI A;  2WVD A;  1Q16 A;  2K6L A;  2KKE A;  4QPX A;  4NRT A;  2BNZ A;  2AY0 A;  3FT7 A;  2JXG A;  2K5J A;  1B01 A;  2A2B A;  2K9I A;  2AN7 A;  2UUT A;  3NNE A;  4LRV A;  2CAD A;  4NRU A;  2CAJ A;  1MYK A;  3VEB A;  2ADL A;  4ME7 E;  3GXQ A;  1SIW A;  3LJP A;  2WVC A;  2GPE A;  1IRQ A;  1NLA A;  2BA3 A;  3BSN A;  2WVB A;  1ARQ A;  2BNW A;  1ARR A;  4LQ3 A;  2CA9 A;  3FMT A;  1U9P A;  3LGH A;  3SFU A;  4AAI A;  3NAH A;  1OG7 A;  1OHN A;  1EA4 A;  3UR0 A;  2KOE A;  3H5Y A;  3QOQ A;  2K29 A;  3UQS A;  3VEA A;  4LQ9 A;  1SH0 A;  4HV0 A;  1BAZ A;  2HZA A;  3H87 C;  2BJ7 A;  2BJ3 A;  1PAR A;  1P94 A;  4FXE A;  4O4R A;  2WVE A;  2B43 A;  3BSO A;  1MYL A;  2JBV A;  2HZV A;  3OD2 A;  2JXH A;  2CPG A;  2H3A A;  2CKW A;  2BJ8 A;  2KEL A;  2Q2K A;  2H1O E;  1MNT A;  1SH3 A;  1X93 A;  4D8J A;  2CAX A;  1BDT A;  2BJ9 A;  3G5O A;  3IR7 A;  3QID A;  2BJ1 A;  1QTG A;  3SFG A;  1B28 A;  2K1O A;  3NO7 A;  3VW4 A;  3NAI A;  1SH2 A;  2RBF A;  1BDV A;  2UUW A;  2WK4 A;  4MJW A;  1Q5V A;  2WVF A;  3H5X A; 
#chains in the Genus database with same CATH homology
 2BJ8 A;  2KEL A;  2BSQ E;  2CAJ A;  1MYK A;  3VEB A;  1MNT A;  1X93 A;  4D8J A;  2WVD A;  2WVF A;  1EA4 A;  2H1O E;  2JXI A;  2K6L A;  4ME7 E;  2CAX A;  3GXQ A;  1BDT A;  2BNZ A;  3QOQ A;  2BJ9 A;  2K29 A;  2AY0 A;  2WVC A;  2GPE A;  3VEA A;  3FT7 A;  1IRQ A;  4HV0 A;  2BJ1 A;  1NLA A;  1BAZ A;  2HZA A;  2JXG A;  3H87 C;  2K5J A;  2BA3 A;  2BJ7 A;  2BJ3 A;  1B01 A;  2WVB A;  1QTG A;  2K9I A;  1PAR A;  1B28 A;  1P94 A;  2K1O A;  1ARQ A;  3VW4 A;  4FXE A;  2WVE A;  2BNW A;  1MYL A;  1ARR A;  2HZV A;  3OD2 A;  2RBF A;  1BDV A;  2CA9 A;  3FMT A;  2JXH A;  1U9P A;  3LGH A;  2CPG A;  1Q5V A;  2CAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...