1NLBL

Crystal structure of anti-hcv monoclonal antibody 19d9d6
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
220
structure length
220
Chain Sequence
b'DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKVLIYWASTRESGVPDRFTGRGSGTDFTLTISSVQAEDQAVYYCKQAYIPPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords antibody 19D9D6 light chain
publication title Crystal structure of a hydrophobic immunodominant antigenic site on hepatitis C virus core protein complexed to monoclonal antibody 19D9D6.
pubmed rcsb
molecule tags Immune system
total genus 53
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2003-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nlbL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nlbL01
1S5IH 5FM8A 4RNRB 4HUWB 3SPVB 2BVQB 2HTLD 1G7JB 5DJ8B 1UH3A 1DDHB 5DMGD 3EHBD 5CD5D 4GQ9H 1MFCH 1CLYL 3T0AA 4LPWA 1Z9MA 3TO2A 1BD2B 2HFFA 3TN0C 4RX4A 3GBLA 1UB6A 3U7WL 1E6JH 3E1F1 2ICCA 5DMIH 2G60L 4Z7WA 3QDMA 2VWEC 5DQ9A 5IMLB 4JKWA 3CVIL 3BOVA 2WLZA 4NQUA 4YK4C 5C0JA 4PGCA 3KYOA 1KJ2L 3BKCL 3OJMB 1MCOH 2NY4D 1FVCB 5IKCA 3X11B 5IB4B 1AY1H 3IXAB 1QLFA 4QRQB 4XCYA 1YY9C 1ZT4A 4XZUA 4PP1C 4JDTH 1J1OL 1TNNA 3UBXA 1GGBL 5JW4Q 4RCAA 2Q6WA 1M4KA 1GPOL 1GC1C 3NA4A 1T3FA 4LLQA 1GYAA 5KS9B 4JRXA 2WK2A 2GJ6D 1T0MB 5H37G 5AUMA 2CLZB 2GQHA 3PDOA 1VACA 3IDNB 3FT3A 1JYWA 3ARFA 4X83A 3SQOL 4YDLB 5J7CC 4R7DB 1OGAE 1U92B 4GRWB 3EOBA 1F6AA 3T0EC 1J0IA 1IGTB 2HVJA 3GFUA 5IFAH 43CAA 4X9IA 3RVTC 5CJXC 5J6HA 3FO2A 4GRMA 5CZXC 1PYWB 2I9LA 3WIHA 3IU3B 4XNQB 4OF6A 1K8DA 5GRWA 3TC9A 4X4YA 1I9JH 2WIIA 1BFTA 1JPTH 1S7XB 4HEPG 4M8QA 4DKFH 3MLTA 1QHPA 4PRPE 1C5DA 1TZGH 5EOCH 1CGYA 1W72L 3D0LA 1BVKB 3RNQA 5C0IA 3WMSA 5IVZA 3QEUA 2VC2H 3NOIA 1KELH 5C09A 3B43A 3CMOL 1HOCB 1A3LL 5BCAA 3S34H 4NO3B 1AGDB 1PG7X 1GZQB 4WFGE 5C08E 2EIZA 3KPMA 4MQSB 2X10A 5KSBA 4YHLH 4PS4L 2IMNA 4R4ND 3LKNA 3I9GL 1OAKL 4OJFL 4NHCL 5DUBB 4Y4FD 4YIQA 5C6TL 3QXDB 3Q1SL 2X70B 4AIZB 5F6IC 2R4SH 3O3AA 4CL7A 5DR5L 3PL6B 3IFLH 4PY7B 5HYSG 3ABZA 4RGND 3W9EB 2FR4A 3LD8B 3IDMA 4HJGA 2DLHA 4MA3B 2XG5A 2IJ0C 5GRJH 3E3QE 1H0DB 2NLJA 3EYUH 5CEXA 4J3XA 4UOW0 4D9RE 3TN0A 2PO6B 4PRDB 2UYLA 2ADGB 2OR8A 4YBQC 4HT1L 2AEWA 1NBZA 2MPAH 4PJAB 2HH0H 2NY2B 4U1HA 4D8PB 3MRNB 3NFSH 4Y19D 2JK5B 2VDRL 5DMKB 1HINL 1P84J 3BDXA 5KOMC 3RWFB 4L4TD 1ZT1B 3STLB 4QGYA 2PNDA 4PJFB 4KZDH 4B41A 5E95B 3PWVB 5HY9A 2DM3A 3O9WC 4ZFGL 1CE1L 4JO1L 4JPIA 5LKNA 1EGJL 3HB3C 5TE4H 5C92A 1MCCA 5HHPA 3NN8A 3VXUE 1WT5A 2XFXB 4MNGB 3CUPB 1UM4L 3QRFM 4QXGH 4JM2F 6FABH 4LIQE 1LILA 3HNSL 2Y9RT 2FBOJ 1O0VA 4H0HB 2AABH 2P5EB 5BOZG 1DLFL 1F2QA 3MJ6A 3RBGA 1BZ7A 3U46B 3LQAC 1S7WA 4PBWD 5F44A 3OB0K 4NQDA 3GRWA 4TOYL 1MHCB 3WUWB 1Q9WB 1AXIB 3MZTA 4DOHE 3X3GH 3T0EA 4NO2B 5T5NG 3WFBH 4OB5H 4AG4L 2RCSH 3GB7A 4MGXA 1MVFA 3GMMB 4LHUA 1P7QB 3VXQB 1DFBL 4W4NA 5GISL 5CJXA 3LCYA 4FQ2H 5CP7B 1EXUA 4WJ5A 3VGFA 3JWOH 5D96C 3OKEA 2X4QA 3HMWH 3VFOB 2OL3A 3X3FL 4KMTH 1QYGL 1S7UB 3V79C 1D5XA 4A2LA 4GO6B 2BX5A 3OMZA 2CDEA 2BERA 4EIGB 3RGVC 5C0AA 3PP3H 1IEBA 3NTCH 2F74A 4FP8H 1RZFL 2IAND 3CSGA 5DQJB 4DN4L 2L4OA 1QLEH 1KCLA 3PHQB 4NC1C 1R3LB 1HH9B 1INDL 5IG7A 2V2TB 3D85D 2H3NB 1R5IA 5EO9B 3UJIH 2YSSB 4U1MB 2HKHL 4K9EL 2HWZH 2IF7A 3DGCR 1MJUH 2ZCKH 3P4NA 4N8VB 3ARZA 4IRSC 1VFAA 4V1DB 2IH1B 1A6TB 3QO1B 3BO8A 2IQAB 2NY0D 3QEGH 2EYRA 4AMKH 3U4EB 5CSZB 2B1HH 4J3VA 5DFWH 4HF5H 3NIDF 1T21A 1U8IB 3OAUH 1A7QH 4O5LL 5JPNA 2Z0BA 4FQHB 2R1WA 3RWHA 4NBZB 5TFSL 4X7SL 5IJVA 2JCCE 3WBDA 3DUUB 3QB7C 2WUBL 1Q9KB 1UVQB 3LPGA 2IG2H 5IMKA 4LVHB 3KPPA 3QCUL 3Q5YA 4H8WC 4NQEE 5CBAA 4S1SH 1WEJH 2EYSA 4Y2DB 3TZVB 4JAMA 2WNGA 5E9DA 1CXKA 4GBXB 3PWPE 3O9WA 3P30H 3KPTA 5I1HH 4KKLD 5IV2A 1NLDL 4PGJA 3SKMB 3BKJL 3TH3T 2BRRL 1KTLB 5ANMB 5D1XC 2RR3A 4N1EA 3JSSA 2NX5A 4WU7B 1IM9D 1SM3L 4DTGH 4H1LB 1LO2L 4OFYD 2BXZA 4N0CD 1IFHL 5E24E 1GSMA 5F70A 4HIXH 2ID5A 5I71C 1P53A 2VLLB 3DXAE 1YUHA 2W0KA 2IFGA 4Q6IB 5MENA 4PY8J 3QDJD 1SY6H 4OQTL 1NAMH 2C7UA 4F80A 2GSGA 1L7IH 3TNNA 5C0BD 4UT9H 5JA9A 4Z7OF 1QQDB 2ERJC 4ALAH 5L7XL 3BYYA 2YXFA 3WJLC 4TUOB 2BSTA 5LVEA 2WV3A 2HA1A 5EORH 1QZ1A 4NOFA 5CWSA 3IETA 4X6DF 1J18A 2GEEA 4YHKL 1MWAL 4JJ5B 1JZ5A 2Z4QA 4GT7A 3RZCC 1DBAH 5D9SA 3A67H 4A6YB 3KDMB 5FYKE 3RGVA 5E6ZA 3MUHL 3QRGL 5C07A 2X05A 3U1SL 2J3SA 4WGWB 3B9KD 3WIHL 4OUUB 1IGYB 3VFMB 1GRWA 1DP0A 1MFEL 4JG0H 2DWDA 4KVNL 1WK0A 3NPSC 4NUJB 5T1MA 4TTDD 3VXPB 3SDXA 1VADA 1L0XA 4X6FA 1MQ8A 3H2WA 4O2CB 1K3ZA 5T3ZH 2M1KA 4MNQA 1RJZA 5JUEH 4LSVH 5FO9B 1IJ9A 3C6SA 3MV7A 1O7SA 4IRSA 4JRYD 4G3YL 3UC0H 2BC4B 1I85C 4YXLH 5E1HB 5JXED 4KUZL 4GKZB 5IVXA 1HHGA 1RUML 3QQNA 3RIFK 5I6XC 5ICXB 4JKPH 5K59E 5HDLA 3KLHC 4XHJC 1BLNB 4NN5C 4ZOBA 5DJXB 2AJVL 4KK8C 4U0QB 5EO1B 4WFED 3WXWH 1RMFH 5C86A 2AKRA 5HBBA 2WINA 2JKXA 3DYOA 3GHBL 4Z76B 2GK2A 2HG5B 4GS7B 2GJJA 3K2UL 3GBML 5HYEA 1ADQH 2P7TA 5C0FB 4GG6A 2AJ3B 2H1PL 2QQNH 4CW1B 1ITCA 2Z31B 4Y1AA 4QHKJ 1UKQA 1WCBB 1R3IL 4HQQL 1HKLL 3CXDL 5DZNA 5FGBA 4PJXF 4KPHL 5JDSA 3EYFA 2W9EH 2HJFA 3ALWA 4PJ8D 2VISB 4N8PA 1MRCL 5CILL 4B53A 2NYYC 1Y6NR 1N26A 3PWLA 3QUKA 5D1XA 5EBLB 2FYYA 3ZTNH 2VZ3A 4QOKB 5GS0H 1KNOB 2BNRB 5DXWA 1AKJD 3P0YH 3LKQA 2CJUL 2E3VA 4S1RL 4BK4A 3ULVF 3G5YA 1FFOA 4Z7VB 4IM8A 5KG9B 5L0QB 1U3YA 4GH7B 4GAGH 1GC1L 3V5KA 3ELAT 1CDIA 3W11C 3WJLA 4WUKH 1F3JA 1VERA 3VFUB 3RL2A 3GRWL 4ZOCA 3GJFK 1QFUH 1LP9F 4P4RB 4ETYA 3RZCA 1BJ1J 1A02N 4KK5D 3L5JA 4HIHB 3HNVL 3VFVB 3IU4L 1FVEB 3EO1B 1OSZB 1OB1B 2YUZA 3MBXH 5C8JB 3RA7H 1IT9H 2WWKT 3DNKA 4TVPE 5TDPA 4OGXL 4PJ5D 4P46B 4QRSA 1WIOA 1Q8MA 3T1FB 3CDGB 3EBAA 1KC5H 4N90E 3BP5B 3WFHB 3MNWB 2J4WL 3GJFA 1BOGB 5IBUB 3V2AR 4BH8B 2VL5B 3RNKA 2YWYA 1UQSA 3OKDA 4M8VA 5HPMB 2VSCA 4RISH 1MCBA 5D7KE 3Q48A 4JFDB 3VI3E 5JPMA 4R26H 3BEWA 4G8GA 4ZS6D 1NUNB 3HNTL 4U6YB 1P5UA 4WFFE 3RWGB 5LCVL 4XX1G 3B9EA 1JHLH 3FB6A 3QXAB 1I7TA 2PR4H 4IRZH 4MCZB 2J88L 1K4CA 3B9VA 3G5ZB 3GSOB 4N1HB 1YPZA 3L3GB 4PGBA 2D7MA 3CU1A 5C0RL 5GJTL 5FDWA 3BAEL 1OSPL 2X4OA 2ICEB 2IFFL 2DQFB 4NKMA 2LAGB 4OLZL 4PJEE 4Y5YB 4ZPTA 3SCMC 4F9LC 3MV9A 3AB0B 3QT2A 4HC1L 3M8OL 3U30B 1FG2A 5D7IF 1MHEA 4OLUH 1JYNA 5F7DA 1J10A 1AC6A 1DUZB 5I73B 4RQQA 4RGMB 5E7BA 4NSKA 5MEOB 2BHUA 1OLLA 1GGIL 1NLBL 1ZSDB 1AFVH 2O93L 3OR7A 3B4NA 4LHJB 32C2B 4POUB 4LCCC 2A6IB 2C26A 4JQIL 4ZDHB 5JW3H 5E7FA 2ZNXA 5DRNA 4MD5A 4JZOB 5BRZE 2H2PD 5D5MF 2HJKB 3V0AC 3E6FA 5AD0A 1NCTA 4F7PB 1EAPA 4M1GL 5C0DA 1U93A 2FJFA 5F88B 3LQAL 2NY3D 1M05B 1TDQA 4PYHA 2CKBA 1XR8A 3AAZA 2L0DA 1MJ8L 4HH9A 4LVOB 4W68A 5ITFA 1LE9A 5GGUB 5HDOA 4G6MH 2V17H 3A6CL 2MKWA 5CS7A 5J06A 3FTGB 1W0WA 3HE6B 3P9WB 2GK0A 3KYMB 3RGHA 3TPKA 3ARXA 3GMRB 3WV0A 3PNWA 3ARDA 4X8JB 4I2XE 5L9DL 4X6EA 4PRHD 1F4YL 1NAKH 5HGDA 4KI5E 2YUXA 4RFOH 2VLJD 3T65B 3EJZC 4LCUA 2H2SC 2ZKHH 1SHMA 2AI0H 2DKMA 2NY1C 5ACLA 4ZO9A 4XP6H 2BY2A 5HGHB 3LMJL 2IPTH 4HMCA 3U9PL 2BMKB 3GKWH 4KJPC 5FHAH 5KSUA 5LWYH 2Q87A 1ZVHA 3OWEA 3K80A 5E00A 4WFHD 1S9WB 5I1LB 4X6DB 3D0VB 5AAWA 5I15H 2A6JA 4NQCD 1DQJA 4PRIB 1YEIH 1MVUB 4P2RA 1FFNA 2W92A 4LCWD 5ID1A 1EPFA 1TITA 1BQUA 5TE7H 5FHBH 4PRAB 3UTTE 4JDVA 4KKNA 3T0BA 3NZ8B 3SCMA 4I1NB 1FL6B 5BZWA 1KULA 1I3GH 4F9LA 4PR5A 5IFHL 4XPAL 3L95B 3CLEH 3ULUD 2ZG2A 1S5HB 2XKNB 1YEHH 1YDPA 5GRZA 3RPIA 5D71L 3L5XH 4JY5H 3V4UL 4LU5L 1KCRL 3MBED 5MP6L 5FUZH 5DK3A 2CDGB 4Z0BH 4IHOB 2AEQL 2QQKH 2EZ0D 5IBTL 4HBCL 4EDWH 1CDYA 3QG7L 3UTSB 1AIFA 2EDOA 2VN4A 4LCCA 1YN7B 5GGVH 1YJDL 2VXVL 1K3IA 2QHRL 1WWAX 2WW8A 2R0KH 4XX1E 1T20A 2YXMA 3L3OA 1BGXL 1X5FA 3V6OC 3T4AA 4BH7A 5FB8B 4YDVA 3VH8A 5F71A 2R8SL 3FFCD 2HT2C 4YUEL 4L3EE 4F2MA 4N5EC 1DBMH 1KLGB 4ODUA 5DO2C 3D39E 2GAZA 2MSPA 1ORQA 4CAGA 1NC4D 2YMXL 3VXRA 3U0WH 1DBBL 3ARBB 1QSFE 3CC5A 5E8PB 4EIZC 4YX2L 1T89C 4R90L 2FO1A 3SO5A 2X4NB 3GI8L 4OCWL 4E41B 3MRFA 4U1SB 3S37H 4LGPB 4YHPB 4Y4HD 3T4YB 1T2JA 4Z77A 3QEQB 4CADB 1DVFB 3HE7D 5T1KB 3O11B 1B6DA 1KF9B 5JO5B 3VDCA 2Y06H 4RMWA 4CN6A 3RUGF 4HULB 4MAUH 4GXVL 4WI3A 3STZA 1KJMB 2A9MH 1UKTA 5KANI 2AJUL 3W2DL 2VABA 5IIEA 5FOJA 2GYSA 3HHRB 3QZWB 2XWTA 4ZSOA 1LP9B 3BGMA 4XCNB 3HRZB 3LQZA 4OZHB 1C5BH 3SO3C 3EYSH 4RAVB 5TGBB 4ZFFB 1F42A 4JM2A 5INDB 1JGEA 1QO3B 1G9MC 1CFSB 1CK0L 2YPLB 2NY6C 5D1ZC 4TSAL 3O2DH 4XCCL 1TVBB 3CNKA 5DK0B 3WKMH 1QA9A 3ILQC 5F9AC 1NC2B 1FE8H 1G0YR 5C3TA 3ALXA 4YXKL 3TO2B 3P4LA 5IMMA 1UM6H 1GJIA 3PWUA 4K3DL 4UTBL 1RU9H 1WBXB 3BUTA 2O5XH 1WZMA 1X4YA 3UTQA 1FGNH 5C9JA 3ZKMC 4OM0L 5BMFL 1FORL 2R0LL 1R3JA 4NHUA 1KJ3H 1XH3B 4XGZA 1MHPL 3TBSB 2X1XR 1KCVL 3HS0A 3Q5OA 3GMQA 3NCJL 5ACZA 4OT1L 3GBNH 5BVJA 5T1LD 3HZVA 1P1ZA 1WC7B 3G5XA 1QLFB 3KPSA 4XCYB 4HCRH 2IBBA 2YWZA 1MEXL 3ARSA 5HI3C 5BOPA 2O5YL 3UBXB 3THMH 2JB5H 2B4CL 1RHFA 4E5XB 5EZJA 1FNFA 1T3FB 3V6OA 2DQEH 4FG6C 5SWSA 4AEFA 5AUMB 2GY5A 3PDOB 2R29L 3CFJA 4HX1A 4XXDA 3WIFB 4G5ZH 2Z91B 5D7IB 5ADOH 1IAOB 3SDAB 4K8RD 4RMSA 4HK3J 3IXTB 2X4UA 1GXEA 3Q3GB 1C8PA 1EUUA 4HPOH 4PB9L 5T33L 3BP6A 4F15C 1T89A 4LLMA 5B3NA 1K8DB 1LEGB 3HR5A 2DB8A 5EH1A 3LRHA 3K4AA 2BNQB 1HQ4A 1FZMB 1W0VA 4U3CA 5KBNC 1FSKC 3HMXL 3MLTB 1T03H 2HLFD 1C5DB 2JJVA 3L3IB 4LDLB 3DMMC 5D5MB 3QHZL 4EXKA 4OCXH 1CFTB 2UWEF 3NAAH 5J6GA 1XIWC 3DETD 1U8PB 3KPNB 4ZXBD 5J1SC 4PJGE 1G9NL 1JNHB 1ZT7A 1A0QL 3QEUB 1NANH 3R4DA 1UCTA 2R2CA 5C2UB 3BN9C 4MNHA 4LOUD 1ORSA 5DT1L 2DLGA 4U4BA 2ARJA 4RFNC 4O9HL 5HHOA 2IAMD 1QR4A 4TNVK 2XA8H 4MJ6A 1N0LA 3ET9F 1O5DT 1UWXH 1RUAH 3MLWL 3WNKA 3LKNB 3DX7B 3QQ3A 3B2UD 5EIIA 2ESVA 1U8OB 2HLAA 1E4XH 4JANA 4YIQB 3QDAA 5FYJL 4U1IB 3FT4B 4A6YL 1LO5B 3G9VA 4LLWA 1X6LA 5D1ZA 1L9MA 2AEIT 4CJ0A 4LKXB 3X12B 3NMEA 1A7OH 5BJTB 1WIUA 5I1JL 3MRCA 3QUZC 2H8PA 4QF1A 3MFGB 2EE2A 2VR9A 3HZKA 3ECBA 3TIDA 4E0RA 4H26B 4YDKH 1B0WA 4UU9A 2H26A 1FH5L 5D7LE 3EYVB 4OKDA 4XMKH 3BP7B 1S3KH 4LCYB 3OX8A 1I4FA 2F19L 2OI9B 1GOFA 4PJCE 1XGYH 1ZLUK 2ZUSA 5E2VL 4G8EB 2DICA 1SEBA 5FXCH 1MLCB 2LABA 4QYOB 4TYUA 1A6VH 3NN8B 3SKUD 1IGFH 1U3JA 5ITBL 1RK0A 5FGRA 1I9RH 3P73A 3VG0L 1MIMH 2DD8L 2HMID 4QGTA 4FMKA 3P4OA 2VAJA 1B3JA 1UADC 4LLYB 4XNXL 4NBYB 1RV6X 2WWMC 4ZNEA 1MI5B 2VDOH 2FL5B 1D9KC 5EIQA 2BVEA 4NQDB 5HXMA 1BFSA 3SY0A 3NH7L 3VWJC 4NKIL 3QJHA 3OAZK 5EBWB 1T2QH 2G75B 1H15B 2AAVA 3TNMA 1CYGA 2OTUA 3VW3L 3LY6A 1I3RA 1FDLL 3OKEB 4BM7A 4XH2A 2XG4A 4KKBD 2H41A 4OI9A 12E8L 2B20A 5C0EB 5M94B 4LFHD 3QUYD 1IEBB 4JFZH 3DMMA 3MV8A 1KN2L 3LH2H 4AIXA 4L9LC 2RAMA 1XIWA 3LIZH 4ZYKA 3DBXA 4LAJH 3NGBB 3QPXL 4HKXA 3VU2A 4HFWA 4NWTH 2AK1H 2WLYA 4YC2B 1I1AB 3BQUD 3GMPA 1HYSD 4NN7C 3VXME 3L3HB 4PJXA 2GKIA 3MLZH 4H5SB 5GGTH 3I6GA 4D9LH 4UINH 2QQLL 3G08A 5CAYB 2WBKA 2GW5A 4Z78A 4HXBH 3TEUA 3QHTC 3TVMC 1N6VA 1KTDB 1RZ7L 3QIBC 2SEBA 4H1LH 4LSRL 2VDPH 5DYOB 1O7VA 4MX7A 1KCKA 1BM3H 4QRPE 4UDTA 3FRPA 3CH8A 3FO9B 3D3VA 3LKPA 3AU1B 5IESH 1JRHH 3QUZA 3IKKA 1GAFH 3RWHB 3G04A 4MVBD 2Q8BH 1P7KB 5IJVB 3RUGB 2E8YA 1CDCA 2OTWA 3BW9B 2J5LC 5GIRB 4BJLA 1MFBH 2HN7B 2PYEA 4WGVB 2HTLC 1S9YB 3KLAA 3MRGA 5CJOL 4L29B 5DMGC 3B5TA 3ALPA 1R3KB 4NZUH 1DQQA 5EBMA 2O61A 1YY8B 4AH2A 1PFCA 3BPLC 4AK1A 5CBAB 1C7TA 2EYSB 2DYPB 4WY7L 5L2KB 1BHGA 3OZ9L 1UA6L 2D31A 5T3ZE 1G7LB 3O6FC 1RJYB 1LE5B 1VGEH 3FQUB 1NGXA 1D5MA 4M6NL 1E6OH 3RWCB 1FIGH 3KJ6L 1Y6MR 5ICZB 4P2OD 3P77A 3B83A 3C08H 4LVNC 2EIDA 2NNAA 5E94A 3WD5H 3HG1A 4JB9H 1IKFL 3A0OA 4JO4L 4P5TD 1D9KA 3QDGE 5EFIA 1AQKH 5C2BH 5MENB 3KR3L 3K46A 2WWKO 2ITCB 2VLRA 4M1DL 3HAEB 3PP4H 4XP5L 2V5MA 3VWJA 3QP3A 1P4LB 5IF0A 2E9WA 4M93B 4HWEH 2BSTB 2A83A 5D2LE 3VRIB 4G6KL 5CWSB 4WCYL 3D39D 3C6LB 3VCLA 3WYRA 5CKGA 2Z4QB 4PUBL 4OFPA 2YC1B 4P2YA 3BZEB 3QXUA 1QEWA 5ISZE 4DKEH 1DQTA 4FXKB 4IMLA 4L9LA 1NDGA 4PJHE 4IRJB 1CI5A 4LPUA 1WF5A 3GKZA 4R0LC 4Y16A 4X6FB 1QSZA 2F53D 2EC9T 5HYJB 4DK3A 1JWSA 4X4ME 2YZ8A 3MV7B 5B38B 3UJJH 4Q9CA 4DUXA 4Y0GA 4IRSB 3TVMA 3VJ6B 4JFEB 3L3JB 5DJZA 3WFDL 2CUIA 4P2QB 1EV2E 4ZOAA 2WBJB 5DJ0B 3QIBA 4PY8I 4TULL 3ORJA 1INQB 4LLUA 2R0WH 2X4PB 1AP2A 4KTDL 4URTB 2ZUXA 1U3ZA 4MD4A 5KTEL 1FZOA 1G7HB 2UWEB 1ZGLB 4NJAL 4OLYH 1UG9A 1IAKA 4Y4FC 4BSWB 2ITDA 5I1DB 3TA3D 2AKRB 4BFIB 4QRRE 2WINB 3BHBB 4RDQG 5EA0L 2CXGA 4YR6A 1UXSB 1B9ZA 4GUPA 5DHXB 2VQUA 5IEKB 3HLAA 3V5DA 4JR9L 1A47A 1AXTH 1HZHL 5KVGL 2IMMA 2V2XA 4LASH 3ZKND 4RWYH 2PTUA 2JB6B 3MRJB 2YD8A 4KAQH 4NJ9L 3S4SA 4HJ0D 1WIPA 5BO1H 1D5ZB 3LEXA 4XP4L 3O6FA 1F00I 5EB9A 1EA9C 3I3BA 4ODVL 2ZUWA 5EBGA 3QUKB 3PWLB 5B39G 3RZWA 1S7TB 4XMLL 5EZOH 4OGYH 1QFWH 4XB8A 2FJGB 5EU5A 3GHEH 3QCVL 4WV1C 1SBSH 2XKSA 43C9B 2FD6L 3KXFB 4UDUB 2P42B 4I0PD 5ELIA 3B5GA 4KHXH 4NNXA 3P0VL 5ENWA 1MJ7L 4WW1A 4G43A 1FYTE 4IIQB 1TETL 4TRPL 3IFPB 5CEZL 1D5IL 4P9HC 2XZQH 3OXRB 2D7NA 4HW6A 4CVXA 3EAKA 3N1GC 4LSDA 3FMGL 1QRND 3RL2B 4F7CA 4NCC1 4LF3A 2D03L 5L88H 3AREB 1MRDH 4B5EA 3BE1L 1Y6KR 3VE0B 1G6RH 4M7LL 4HUUB 2ED9A 4UQ3A 4G42A 4H25B 1QTYT 3ZLQC 1FO0A 2BVPB 2CR3A 3KAAA 2JCCF 4Q7DA 2EH8H 3JV4A 4FFYH 1MCKA 1OM3L 4PJIE 3MRBB 1RULH 4EVNB 1T2XA 4HGWA 4R0LA 3TO4C 4HK0B 3P9LA 3GMNB 1UZ8B 5DWUL 3T77B 2FO4A 3DO3A 4G9FA 4JZNB 5KJRL 4LSUH 4L4VA 4OFKA 4KJYB 1SEQH 4MMXC 4U1LA 4LSSL 1UWEL 4OGAD 4FQXC 1YNTA 3L7EA 4NO5A 5ID0A 1U8QA 1YEGH 3WHXA 3LS5L 3QIUD 2VR5A 3LRSA 3QUMA 1RZ8A 1UACH 1L4IA 4TPRL 1EX0A 4YHYC 3MNVA 3IDXH 5A2LH 5GPRA 4ZD3H 5T3XH 15C8L 1NJ9A 2Z8WC 2GTWA 4H20H 1LD9A 4NYLA 5LQBH 4D0DA 1I7TB 2AERT 2C4XA 3FL7A 2X7LA 4IBLT 4Y4FA 1QSEE 1KG0A 1YPZB 2OJZL 4PGBB 3ULVL 1KGCE 4Z8FL 3HC3L 2NY0C 2R39A 4MJIE 2CGRL 1FFRA 1HIML 1PW3A 5DRXA 1J11A 3IDJA 1QBMH 1VENA 5JIPA 5F9OL 1FAIL 1GHFL 3L3KA 4YHML 5J1AB 5FYJU 3AVEA 3ZT5A 1CLZH 4NQVB 4OZGE 1PLGH 3MYJA 5DI8B 1IBGL 3F7YB 2J12B 4GAYB 4XPHL 1N3NA 1IGCH 4OD1L 4NSKB 3RX7A 2HJLB 1JWUA 4WHTA 3EOTH 3HUJA 3PGCB 4XC3H 2DF3A 5EDXA 4BSVB 3D18A 4UV4L 1J9CT 5KW9L 1WZ1H 2P5WB 2VXUL 4XMPL 4WV1A 4XPFH 4MD5B 1WSST 3VFTB 4D94A 4P3WA 2XOTA 2OP4H 3BEVB 3CFCH 5F6HI 3CVHB 1MJJA 3UPCA 3BRFA 1HH6A 1EAPB 1TQBC 1HXYA 4QHMB 3BPNB 1FBIL 3GK8L 4N0CC 2CIIA 2D7QA 1J0KA 5JHDE 3TBWA 4MB3A 2BVYA 2CKBB 1ZHBA 4K7FA 3OV6A 2EICA 3V5HA 1F90H 1NMBH 1ZANH 4QTIH 3BGAA 4R2GC 5IVNA 5ITFB 4LARL 4CVZB 4ODHH 4PRPB 2J7LA 4PJ9C 1JNLH 3ZZ1A 4ORGA 2D2OA 5K59F 2IADA 1Q9OB 2XTJD 5I1IL 2C1PB 1X6NA 5KZCD 3LDBC 5DD5L 4X6EB 1OP9A 5HHMD 2ATKA 3GUTA 1F2XK 5GGRA 1QUNA 2UZIH 4JDZA 3TO4A 4PPTA 5CEYB 1CU4H 4HS3B 4HFUL 3WFEL 1I75A 3T08A 3LB6D 4ZO7A 4CUCA 1ZLWH 1E4JA 4FQXA 5B8CB 2PTTA 2IANA 2HRPL 3BZ4B 5HHQB 5I1GL 2DMCA 4PREA 3WNNA 1YMHA 2A6JB 1U3HD 3VFSB 4FQIL 3HA0A 1T04B 3D85A 4HV8B 1QP1A 1ZS8B 1J1XH 4LDEB 1DQJB 4MDJB 1CDUA 4IDJL 4ZMAT 3UDWC 4P2RB 2OZ4H 2AS5M 5IMOB 2OTPA 3FB5B 3G6DH 4WHYH 4WI7A 5DGRA 4ODTH 4CNIA 4NCDA 4H0IA 3ZYOA 3LOWA 1RHHA 5E6ID 4NWUL 2NY5H 1GIGH 1INEH 1ZTXL 1J8HA 1TJGH 2R69L 5JXEC 3WUWG 4A2MA 4EOWH 1UKSA 3V4PL 2VAAA 1QNZH 3E8UH 5J89A 4UT7L 2R1YB 5DRZB 4FFWD 4RZCB 3LZFH 1YQVL 2X4SA 2FEEL 1F58H 2Y4SA 1YDPB 4Y4KB 4ETQB 4R7NA 3RPIB 2DAVA 3O3BA 5GGSA 5D7JB 3CZFB 5C7XH 1ETZA 2E8ZA 5I0DA 2BOCB 4MXWH 4LEXL 1LK2B 5FM4A 4XB7A 4KQ3H 1B0RB 4G80A 3WSQL 1AIFB 3R1GL 4FNLH 3B2VL 3PV6A 4LCCB 5F7NC 2ICWI 2FBJL 5EU6A 1FVDA 3O8XB 1EMTL 4JE4B 1RZKL 1T1YB 4HWBH 4NRYA 1PAMA 4DOHB 4PJ8C 3CDFA 1JYVA 4UT6L 5HGGS 4G8FB 4BH7B 3LKOA 4YDVB 5EOQL 1IM9A 5CHNB 3C5ZB 1BX2B 4HS6B 3VI3F 5SX5H 3KWWA 4MQXD 1YQ2A 2MOVA 4XI5D 5EC2A 2QTEA 3OKKA 4N9OB 2RBLA 1FFPA 2XPGA 5IR1A 4PJ9A 4UIKH 3OB8A 3UTPD 2EECA 5C0BA 4LKCA 3G6JA 3RJDA 1J0ZA 4P99A 3EFFA 1SYVB 5KN5B 1J12A 5E08H 2ZNWA 2CO7B 2QR0A 3F6IA 2IPKB 1YYLL 5ISZD 4PJEF 2KH2B 4Z77B 2Z92A 3I2CH 4KK5C 2NY1B 2BCKB 3IDYC 1XGQB 2GFBA 3NCYS 1N7ML 1ZAGA 4AEIH 2IQ9L 3IS0X 3VXSD 4EDXA 3VG9C 4TUJA 3BIBX 2FEDD 3VMOA 5IW6A 4DUVA 4MAYB 5EZIL 3LQZB 3BFOA 4O2FA 3DX8A 1JK8A 3UDWA 2XZCL 1U8NB 1X4XA 4ODWB 5DVMA 5I18H 4H1LG 4L8SB 5EUKB 5KSAD 3H0TB 2NW2B 2K9UA 3ILPB 2JCCB 4JRYA 3MRPA 3E6HB 2ZCHH 4ZS6C 2OMBA 2QV2A 5JXEA 3QDMD 1LEKB 2IALA 3WDIA 1FL5B 1FZJB 4PBXA 2W07A 1AJ7H 4DQOH 4JFQA 4JQVC 3UJTL 5A2JH 3AROA 4M48L 4NQEB 4O02L 1IAIL 5DEGA 5IQ9B 5DJ6A 4OLVL 2A1WL 2R15A 5DJCA 1D5BB 4Z9KB 5BS0B 1XF2A 3CFEB 4U2ZA 3D25B 5M7QA 3UTQB 5D8JH 2DQTL 3EKCA 4DN3H 5HHVL 1R3JB 4PJAE 3A6BL 2JE8A 4FTVB 5ACZB 5GRUL 3BD3A 4JRXD 3BT2L 4G7YH 2AGJL 5BVJB 4PJFE 1JZ2A 4KI5F 5ADPL 3QQ9D 1ND0B 1NGPH 3ARFD 4P59H 1QFOA 5GS2D 1U91A 3I02A 3O2WH 3JUZA 4JPWH 4X7TA 3DVNB 4P23B 5IB5B 3ARGB 4HEME 4PJ8A 4XVSH 4MNGE 3VFGL 4PJ7B 3KPRD 3BXNB 2GJZA 4G7VL 5EU7E 3KYAA 2P5EE 1AKJA 1GGTA 3U36A 1CCZA 4HS8H 4EN3C 2BSSA 3SDCB 4XNZC 4DVBA 1NGYB 4IJ3C 3FQXA 1CLOH 3OKOA 5KAQF 3D2UA 1IM3B 4P9HL 2Y7QA 5I16A 4DGYL 5C71A 3MRLA 4LLMB 3NFNB 5C09D 3HR5B 4YAQA 5E8DL 5GSRB 3TYGL 2NY3C 2FJHA 3WIIH 2F8OA 4XXCC 1PDKA 1A1OB 3O41A 2DKUA 1YMME 4UNUA 5DHYB 1QR1A 1KEML 1NFDF 1BECA 3BH9B 3MUJA 4MNHB 3S7GA 1A6UL 2AXHA 4PJ5A 4YXHH 5HHOB 3DV4A 3K3QA 3I3EA 5A1AA 1TJIL 1ZA3B 4K94H 5EIIB 1OAUL 3P4MA 1MHHA 3VFNB 3SKJH 2EDLA 1DSFL 1JHKL 5E2TL 1MY7A 1FLTX 3TN0D 4V1DE 4P2CG 4ELMF 3MRDA 5MEQA 8FABA 2C3HA 4IOIA 3P2TA 3WFCL 4JGUA 5E8EB 3RHWK 1GC1H 2AK4B 5I1CL 1PY4A 5D1ZB 5C08A 3V6BR 3PHOA 4HIEA 3UXFA 1BMGA 2VDLL 5IK3A 3RWEB 2AXJA 4HHAB 5HSFA 4XNYH 1E4WH 4Q58C 4K23L 3F12A 4HUNB 1T1ZB 4U1NA 4JQVA 3LKRB 1P4BH 2QJDA 3HNVH 4R3SA 1KGCD 3TIEB 3MLUH 3FAWA 4ZQKB 1XZ0A 4NQXA 2YHGA 1YY9D 2OL3H 1T5XA 3FQRA 4X6CE 3TWCH 5DRWA 2NY7L 3OX8B 4PP1D 5DF0A 3QJFB 3TM6A 1YEFH 3DGGA 1CGVA 2NMSA 4C4KT 1DBKL 3UZEA 3ULUC 3OB0H 5EZLA 2OJEB 2COQA 3S96B 4XBPB 4UAOC 1V05A 2P45B 5JQ6L 4ZG1A 4WEBL 2DI7A 4DGVH 5E4EC 3SGDI 3MBEC 3T0ED 4J2XA 4PGZA 1MREH 4P5MB 2BSRB 5ANME 4KV5F 2YK1L 3QIWB 2EDHA 4K7PH 4LHUD 2EZ0C 3BP4B 1EH9A 1TZIA 2H32A 3P4OB 3RDTD 5C0CB 3BKMH 4U1GB 1DQLL 5CZXD 4X5LA 1MH5A 3ZO0A 2DIJA 3QCTH 4M5YL 1PBYA 3MXWH 3O2VH 4TNWF 2AV7A 1NSNL 5LCVH 2JELH 4YFDB 1G7PA 3RP1A 1AE6L 3AMLA 4YBHA 3VXUA 3SY0B 1LDPL 4EN3A 4AT6A 5SWZB 5C0AD 3L6FA 5JLZA 3S35L 5SV3A 2C4FT 2A6DA 5C0RH 2OTUB 5GJTH 4JPVH 3WNOA 3REVB 1OP3K 1DE4B 3N9GH 4NKDA 1RZIB 3VFWA 1IARB 2Y36L 4PGDA 2P4AB 5B3JE 3MCLL 4XXCA 4RMQA 1EEZA 4PLJD 1T7XA 3H42L 3RRQA 4TSBL 2K1MA 3ZKXC 1NKOA 5F96H 1JFQH 4FQQA 3BZFB 4NO0D 3SE8H 4HFWB 4M6OH 3ZDYF 3KPQB 2J8UF 1NLBH 4PRHA 1PX3A 3GMPB 3OKNB 4RFNB 5INCB 2VLJA 1CDBA 3HE7C 3H3KA 4YHNA 3WO3B 3TJHD 2QL1A 4JFXB 1A6ZB 4BYHA 4NM8L 2W65A 4GKSB 4N0YL 1J7VR 4NC2B 4J3TA 4NZDA 1RUPL 4BELD 3VRJB 2Q86A 1MCPH 2JJSC 5HHNB 1D6EB 3QFJD 4MXQC 1FZKB 2CRIA 4LL9A 4UDTB 1MCFA 1OLZA 4L8BB 4NQCA 5CINL 4C56D 2OXHA 5AZEL 3MRKB 2GITB 3FHAA 4KFZC 3WHE1 4CMMA 4OZFB 1NCAH 3LEVH 1UXWA 4PTTB 5AZ2H 5JR1L 5E9DD 1GGCH 4P5KB 3TT3H 5AG8A 3O9WD 2I27N 4RGOL 3FN0L 2APXA 3QNZA 3EO0B 1IEAA 3BH8B 2ZJSL 4XNMA 1WUNT 1BD2D 1M1SA 1MFAL 1VPOL 4LRNH 4NPYA 1CXLA 1S7SA 3MRMA 1M7IA 1FYHB 3LHPH 4M43H 3MRRA 5MEPB 5MERA 4F7TA 1DQDH 3MJ7B 5SWQA 5FO7B 2DQJH 1NGXB 1KEGH 5BRZB 3KYNB 3MBEA 3MGTB 5I19H 1HHJA 5K9QG 3MLYH 5EOTB 5TDNA 5H35A 4PJGF 4HIIB 2ZSVB 4QOKE 5AYUH 2ZPKH 3FQNB 3AUVA 3WNPA 2BNRE 5E94B 1N4XH 1TQCB 4NKQB 3PWPA 5CIPA 2NXYB 1KIRB 1T4KB 4BQ8A 1QKZH 1WWBX 4G6FD 1A4JA 1XF3A 2VLRB 1YECL 5H2BB 4Z7VE 3JWDL 5C07D 1CGUA 1YEEL 2X9YA 3VCLB 3DXAA 3DIFB 5HYSA 4BUGA 5F7HA 35C8H 4LLVB 4K8RC 4OF5A 3ARTA 4P4KC 4MNQD 4FFZH 2XRAH 4L9LB 2M8XA 5FO8A 4Z7UF 1KFAL 3JUYA 5LGHH 2DLFH 5CUSL 2F54D 4H8WH 4QRTA 3P9MB 4NN7B 4OCRL 1JWMA 1XF4B 2HLFC 4QWWD 4R96A 1VESA 4PJCF 4X99A 3HE7A 5I9QC 1R3HB 3HC0B 2CIKB 2B5IC 3GSXA 3MACH 3TVMB 4UQ2A 3GM8A 4XCEB 1QFWM 2RQ8A 4YNYA 3ES6B 5ETUB 1R0AL 4CN4A 4LOUC 4JFDE 1NDMA 4S0TD 4KXZI 2JJSA 5ALCL 4XP1L 1DN0A 1CL7L 3SJVE 4U49A 1AP2B 4NUGL 4WHYG 5K9OA 1FRGH 3I50H 3QWQB 5I75C 1BIIA 4HPYL 4M02A 4MD4B 3B2UC 1MQKL 3CSPA 3BUYB 1T7WA 3RWDA 2E27H 4FQCL 4Y1AD 5DZOA 4BZ1H 1LHZA 1NFDB 2J5LB 4LEOB 3PL6D 1R6VA 3MZGB 1R24B 2VLME 3SN6N 3NCYP 5D6CB 3V7AG 1UH4A 1FL3B 1RFDH 3IGAB 2BJML 2XQBL 4P3DA 5JW4N 1W2KT 4ZFZA 5DJAA 4D9QE 5KVDL 3HZYA 3BWAB 2EE3A 4QRUA 4N0UB 3CCHA 1KPRA 1PKQA 2Q3AA 3S4SB 2CMRL 1HHIA 3I84A 3EO9L 4ELMB 3LEXB 4Q74A 5BV7C 4YHOL 5TQ0H 2G5BB 5DDHB 4D3CL 4YQXL 4UOW1 1LK3H 1X7QB 4M6MH 1A14H 1T7YA 1K85A 3GJFH 4OLWH 4NRXA 2NY4B 3FT2A 4L3EB 1EO8H 4QHLB 1ZVSA 2XTLA 5T3XE 1TZHA 3RZCD 5J1TC 3QA3A 1B4JL 3MNZA 4OZIE 4JFFE 2NTFB 1E27B 2HMIC 4UIMA 1JNNH 4WUUD 4QHUA 1UH2A 1KYOK 1A6AB 2GJ6B 1PZ5A 1NFKA 4X80L 5CBEB 3K4DA 1IC4L 1P6AB 2DDQL 1YNKH 4MD0B 3CH1A 5JMRA 5D72L 1JUFA 4LMQE 4EI5C 1JHTB 5CMAA 2DM2A 1P7QD 2KZ1B 4LIQL 4YE4H 3GSNA 5E8OB 1CIDA 4P4KA 5FKPA 1S7VA 3TFKD 1WISA 4PB0L 4DGIL 2EEDA 4JKMA 2R0LH 4I77L 1IZJA 3MCKB 1R5VB 3NZHL 4KKBC 5HVHC 2Y1VA 5EIVA 3H9SE 4G8GD 5FF6A 3SGKC 3VD7A 3GIZL 4U1LB 5CZKA 2C1OA 1A4KA 1L7TL 1DTUA 5ID0B 5GS1B 4M7KL 1N64H 1EEUA 4QXWA 4XHJD 4Z7OE 3T0XA 3QUMB 4HUVB 2W1NA 3DPBA 4QXTA 4KK8D 5EU3B 2AXFA 1N0XL 2VXTH 4X6DE 1NKRA 2ADJA 3S36H 4EKXA 5IUSA 5F9WB 4KY1H 3O4LB 4PRIE 4HAFA 1JF1A 4TQEL 1OCWH 3UBXG 4E9LA 5L8LB 1EFXB 3MV9D 4J7RA 4MDIA 3CVHH 3BRDA 2VE6B 2X7LB 4HWZA 2FB4L 5HHXH 2F8VA 4RA3A 3KGRA 1H3PL 1EJOH 5FV2A 2J8UB 2Y5EA 2H9GB 2VLKE 2CKBH 4RGNB 5F9JB 1A9BA 2V7HB 3H3PL 4QHNA 5D2LF 2EKSA 3DRQA 2DQCH 3SE9H 1G7MA 1IVLA 4MVBC 4M7JL 3MYJB 4UB0L 3VGAB 1RK1A 1YEJL 4ZTOH 1J1PH 1BVLA 4Q9BA 2DBJA 2OX5A 3ZHDA 4JN2A 4U3HA 1JWUB 3BDBA 5L2JB 2J6EA 4Y19B 3V52L 3REWB 2I60L 1MCHA 3LN5A 4AEHH 3TZVD 4L4TB 4GBXD 3S97C 3UTSE 5BQ7A 4TTGA 1WFUA 4ENED 1UZ6F 1J86A 3IFOA 3E2HC 2B2XL 2VTFA 1UWGL 2FH6A 3QYCA 4ODXA 2D3VA 4ISVA 4RBPK 4LLDA 1WBZA 4B7LA 5TDOA 4KDTC 1HH6B 2J2ZA 5CKAA 4FABL 4C58B 4P2OC 4ZUUB 5A2KH 3RU8L 3ARDD 4XVTL 3TBWB 4KKAD 3FOMA 4QXUH 1WAAA 1AGFA 4DKAA 5E5MB 3V7AE 4MA1B 4N0FA 4PBVC 1TXKA 4EI5A 2VRAA 2IH3B 2WUCH 1K4DB 5HGAB 1KN4L 3H6JA 4Y5XB 5ICYA 1V3JA 1Z5LB 4PJGB 1KIUA 3IB4A 4CU7A 4E41E 5FCUL 3GUTB 4HDIB 5FYJD 3QEHA 2ED8A 1I9EA 5CP3A 3QEQE 3SGKA 2YUWA 4Z95H 5KVMC 3VXNB 2EO9A 1A9EA 5E1AA 4L8CB 3OJDB 1PSKH 1B2WH 2W91A 4I2XA 3DSFH 3VD4A 5F7FA 4HSQA 1E28A 4PREB 1CZ8L 5IHUL 2NR6C 3HI6H 3MXVL 4Q0XL 2XN9B 5FYKL 2GUOA 1ZWIB 2PW1A 3IVKB 1MNUL 3EOAA 3SOBH 3DUHA 3C5JA 1BAFL 3SCMD 3MLRL 4X5XB 4OZHE 3L7FB 1V7NH 1X5HA 3C8DA 3T04D 4R4BB 4XBGB 1H3TA 2V9RA 1WZKA 2DWEA 1NUGA 4Z7UB 2YPLE 1DQML 2LTQC 1RZJC 5K33A 3GSUB 3ZE0F 4YFLI 1MFDH 1NCDL 5KSVA 3HCVB 4KI1A 1OAYL 5FK9B 5ALBH 2BXYA 2HKFH 1RUQH 4PJCB 4MHHG 4DKDC 2FX8L 1QPXA 2DLIA 2PCPA 5EO0A 4M5ZL 3TA3C 4BZYA 1LQSR 3UTTA 4AM0A 1XGTA 4YO0A 5BXFB 4MXVF 4DAGH 2IBZY 2Q7YB 1H9VA 4Z7WE 1VGKA 4OD2A 1TLKA 2X44D 3TYFB 2I25N 1A5FL 4PJIF 1S8DB 2B8OT 3FO1B 4X9HA 1GGYA 2ZG3A 1X9QA 2OSLB 4KDVA 1FVDB 3GSVB 5F1NA 5J13C 3HI1A 3H7BB 5EWIH 3SE3C 4DFHA 3DYPA 4KDTA 1FPTH 4OAWA 4P2OA 4KGJA 3QNXB 4Q9QL 1RZGB 3PGDA 3SDYH 1X5ZA 1EUTA 1ACYL 3ROLB 1NBVL 3OKKB 5JIIA 3MUZ1 3QDJB 1FFPB 3UROR 3OKLB 4ZPVA 2R4RL 2H6PA 2JIXB 3L5IA 2Q76B 5ESAA 1AD9B 4NP4H 5HI5D 1KT2B 2DBLL 4I3SH 3G6JB 4BQBA 1RJLB 4XRCA 3IFNH 3QWOA 3KPLA 3I6LE 3D39A 2A74A 4JY4A 3CGTA 3VXOA 2BNQE 3VXMB 1HILB 3C5SB 2CRZA 2IBZX 5IFJB 3Q5TA 1Q38A 4TNWK 4U05A 4HKJB 4JM2D 5FA3A 3B9KB 5LAXB 4LSTL 4OZGF 3MOAH 2BP3A 1OWWA 1IC5L 1IQWH 2APFA 3GSQA 3KYKH 3U0PB 2OK0H 2R1XB 2UY6A 4NGHH 1NAMB 2W9LA 3EJJX 2DQIH 4F33A 4EDXB 4KC3B 1YNLH 1VFOA 3MOBH 5IW6B 4JO2L 4K3EL 5KSBE 4OF8A 4F58L 1JK8B 2AEPH 2F53A 4OD3L 3UO1H 2MQ0A 1DUYA 2Y6SD 4TVPL 2R23B 4HWNA 5CJBA 3PWJA 3IF1A 4NNPH 4K3HA 1MRFL 4MZ3A 3QIUC 5FM5M 3DO7B 3ZL4L 4ESKA 1S7RA 2DQDL 4UUJB 2E7CA 3ARVA 3UYRH 1NCNA 1IL1B 3F58H 5GJSL 3G9AB 2XWBA 3C8KB 3HAEG 4ONGH 5DEGB 4JFHE 5K9KB 1DN2A 5DJCB 1XF2B 4FHBD 3KPSD 3TA3A 2CK0L 1SJEA 4XBEL 5JW5B 5TQ2H 5JXAH 2DS4A 1ZOXA 1SYSB 2VWEE 4LSPH 5SWSD 2HT2D 4NFCA 4N5ED 1I9IL 4DZ8A 5BV7L 5DO2D 2F5AL 3N06B 4RAUB 3QDGB 1OAXL 2YBRA 2K7PA 1D6VH 4FQ1L 5FA4B 4OIAA 5JTWA 3SE3A 4R8WL 3H9HA 1CFNA 4HJJL 2ICES 1RVFL 4XCFH 4MWFA 4FXGA 2ICWA 3DECA 4O51B 4PG2C 3U36B 1UT9A 5DFVC 5L6YL 4NQDE 5DJ2A 2EIBA 2BSSB 2DQUL 1G9MH 2AV1B 4K3JL 3CLFL 1D7FA 4DVBB 1K5NB 2NW3B 5HGBB 5CJQL 3VD9A 1N59B 1UYWH 2LU7A 5JORA 4LPYA 1NEZB 1ZLSL 1OT1A 4U7MA 2FJHB 5FYLH 2Q8AL 3Q6GH 2QADB 2P24B 3I6KB 4KROC 3U4AA 1A3RL 2QLVB 1GOGA 3MUGB 1U8MA 5KVFH 1Z6JT 1LO0L 2XNAB 4MCYA 2ESVD 2CPCA 4XPTL 5DEFA 1F97A 3MA7A 2BNUA 4X0KA 2XTJC 1F6LL 1NCWH 4OFDA 1A7RL 1T22B 5H94B 4X4XB 1MIEH 4UV7L 5C3LD 2NY6D 1VKXA 4XMLH 2ADFH 1CD1B 1ED3A 3NCEB 4ZUTB 4F37F 1CGSH 4MJ5A 1HHHB 4UILL 4YFEA 4XP9H 3ILQD 3P4MB 1MHHB 2FD6H 3QPQD 3RVUD 4LAQH 4NKOA 3FZUC 3SGJC 1YEKH 3GJEA 3QIUA 5HI4D 3GM0A 2DMKA 4D0BA 1WBYA 4NRZA 4CN1A 5EUOA 1BBDH 1AGBA 3ZKMD 3P3YA 5MHSE 2D7PA 4KQ4H 4XAKD 5DEZA 5E8NB 1ZLUH 4GG8B 2DTSA 2DTML 3MODL 5I74C 1N5YH 4U1NB 4I13B 3MGOA 1IC7L 1HSAB 3RUGE 1WWCA 2P8PA 1KJ2A 3CX5K 1A6WL 1S9VA 5E6IC 2Z35A 2ATPA 4MSWB 4OUOA 1H5BC 5HI3D 2XY2A 3EIFA 4PD4K 1AO7D 5DQDH 4XC1L 2YEZB 4J1UA 3MJ9L 2BY0A 3TCLA 1DZBA 4X9FA 3ULSB 1ZA6A 1Z3GL 1ZEAL 5MI0B 3SGEI 4ONOA 4S2SA 5CEZD 4DZBB 1AI1L 1RD6A 4LSSH 1UWEH 2ZSWA 3PV7A 3MRHA 4IMKC 4EI6B 3L3DA 1C12B 1I7UB 2IGFH 5D7LA 3LS5H 3OAZH 2LAAA 1H8OA 5T1DH 3QI9D 5D7SL 2ZUUA 2NX5E 3B9AA 2DQGH 4L5FL 1KPVA 2H32B 2OR9L 1F8TH 4I48B 5EN2A 2VXSL 4MJ4A 5FKAA 5I30H 4ERSH 1MH5B 4LK4A 4BUHA 3DTXB 2AV7B 4LLAA 3RY6C 5KOVC 2GY7B 4WIQA 4PG2A 4M61B 4XNUH 5MENE 3MROA 1FLRL 3NA9L 5D70L 3S5LA 1VFBA 3L6FB 4ELKA 5DJDB 1FNGA 3MV8D 4IJ3B 1U8KB 3L1OL 4GAJL 4OSUH 1Q9LA 4PRBA 1T0PB 3MCG1 1XIWD 3EYOA 2A6DB 4WO4C 3IAQA 1W72A 2GHWB 3C9NB 4X98B 4V2CB 4MQXC 3U9UA 2YD1A 2X09A 1XGUA 4Z5RA 3B6SB 5FOBB 4D0CB 1S5IL 2DN7A 1EEZB 2FRGP 3DX6B 3DSNA 3I75A 2CRYA 4O2EB 4OLEA 5GGSY 4K9EC 3OHXA 3JV6B 5T5FH 4HKBA 1TPXB 1HSBA 1UB5A 1WJ3A 1G7IB 4GQ9L 1MFCL 4GW5A 1H3XA 2DKSA 4GW4B 2YD3A 3O0RH 3SDXE 2VLJB 3V4VH 3ULVD 5FECB 1NMAH 3W9DA 2R2BA 4QTHB 1JTOA 5BW7A 4XMPH 1IGJB 1UM5H 1E6JL 2IWGA 5DMIL 1LNUA 3MV7E 3IDGB 3SGJA 5IGXH 4JFEE 2Q86B 4P2QE 3P40A 1BQSA 2DLEA 4NZTH 2R9HD 5GS0C 1FCCA 1MCOL 4NQCB 2FEDC 4MJIB 3RPKA 5IVXE 2CLRB 1M7DB 1AY1L 1MPAH 4OZ4B 5FV1L 3O6LH 3CFDB 5I66A 2UWEE 2V7NB 4JDTL 4LCWB 5KSAC 3CD4A 1JPSH 3HZMB 3EGSA 5FYKU 1RZJL 3L9RA 3BGFB 4YDJA 3W39B 2X9WA 3TBVA 1SMAA 1EGJA 1H5BA 3DVFA 1GVIA 3MRIB 4JFYA 4GG6E 1S7SB 4PJBF 3RWIB 5IFAL 1T5WB 5GRVK 1S9XB 3HG1D 5FUOH 1D9KD 4F7TB 4IMKA 3ZHLA 5E4EB 4Z7QE 1HHJB 4RFEA 4LNRB 2P49B 3VWJD 5IEHA 1KB9J 1I9JL 1JPTL 4Y88A 4DKFL 1NBYB 1TZGL 5EOCL 4PTUB 1I8IB 4U1KA 2BY3A 5CCKH 3QQ9C 5DD1H 1NQBA 4HZLB 1NGWB 1YZZA 3RY6A 2I9TA 4PFEA 2YA1A 2VC2L 2X4TA 1KELL 4MQ7B 4F7EA 3S35X 4YPGB 3QUXC 2AJXH 1A1MB 3S34L 1Z9LA 3W5MA 1CICD 4WO4A 2P8LA 3MREA 3FFCB 3GDBA 4YHLL 5L8JB 5F3HA 2G9HA 2XZAH 1KSRA 4Y16D 3IRZA 4AENA 2EDBA 3IJYA 3A6OA 1F4WH 1NC4B 3HC4H 4PLNC 4QCIB 5B39B 2R4SL 2FIKA 1EEYB 2XIDA 3IFLL 5D2LA 3CK0H 5L8KB 3SKOA 2D9QB 2VDNH 5GRJL 3OSKA 1FNAA 4S1QH 5DSCB 3EYUL 4Y4HB 4X6CF 5DUPH 5ISZA 4QO1A 3EOYG 3KJ4B 4JHAH 5F1IB 5DHVA 3W0WD 5IOPA 4ZFOL 3F7VA 3N85H 4PJHA 3GI9H 2MPAL 4XAWH 1T6WA 2HH0L 5I8OH 4M7ZB 2LFGA 2YRLA 1UC6A 3NFSL 3LKSA 4X4ZA 3RWJB 1NDMB 4UT6H 3WLBA 1K8IB 4KHTH 4JFPA 3QFDA 3VXSA 1EO7A 3DOSA 4KZDL 3FONB 5HYQA 3LN4A 1HI6B 5FIEA 2VXQH 4FZEH 2GSIB 2FSEA 1CD8A 5EC1A 2QKIB 5CZVH 5ILTH 5C0GA 5KSAA 4QXGL 3VFPB 2NQCA 1UEMA 3F5WB 6FABL 1KCUH 1YPZE 3O6FD 2AABL 1KOAA 1I1CA 1LO3H 2VZUA 1NCUA 1JN6A 3U4BH 1ES0A 4ZFZB 1C1EH 1J0YA 3HZYB 2XYCA 5HVFB 1U8JA 3MMEB 3X3GL 3WFBL 3CCHB 1AXSB 4OB5L 1FFQA 2RCSL 1PKQB 2Y23A 5B3JF 1U8LA 1BFOA 1FO0H 4QRRA 4ZUSA 4FQ2L 3NCBB 2CDFB 2WMPA 3JWOL 4OF0A 1AGEB 4ODBD 3HMWL 1WT5C 3QWRD 5I17B 4L4JA 4OQTA 4KMTL 1CG9A 1JV5A 2MNUA 5E2WH 4PP2A 3MJGX 5T1LB 3NTCL 2P5WE 1TZHB 3U82B 1QLEL 5AWNH 1MWAA 3QUMH 2I5YH 1BZ9A 3TT1H 3QULA 1LMKA 3QUXA 4JRWA 4OF3A 2MMXA 1Y18B 3UJIL 3RDTC 1MI5D 3KPRA 1WQVT 2HWZL 1ZXQA 1CT8B 4UMGA 1JPGA 1MJUL 2ZCKL 1FN4B 3GSRA 1XCTA 3U0TA 5E70A 3K8MA 3PQYD 5CMAB 1I7ZA 3C60B 3FN9A 1G84A 2ZWLT 4G9FD 1Q72H 4L4VD 1XGRA 3GIVB 4HLZH 4N9GB 1MLBA 5TPWH 3DV6B 3QEGL 4AMKL 2MKLC 2HT4D 2B1HL 4OLXH 4KGLA 4WI9A 1GH7A 1HWHB 4HF5L 2DJSA 1JVKA 4JKKA 4I9WD 3OAUL 3MO1A 4ZAKB 1A7QL 3NBNA 1EHLH 1QPPA 1NFIA 3SE4C 4U1JA 5FF6B 4K71C 1JPST 2AGJH 5J12B 4F3FB 3NFPB 4PLJC 5DJYB 3OGCA 4KUCF 2AJSH 1N8ZA 4ZXBB 5GSVB 2IG2L 5A16A 2X4RB 3DURA 4PJIA 2JJWA 1S7QA 4S1SL 2ADJB 1WEJL 4JLRA 2I07A 4NFDA 3TBYA 3ZKSD 1Q0XH 2IAMB 2F58H 2CH8A 1JF1B 4EBQL 3P30L 5I1HL 3TJHC 5I75B 4Z0XA 4P2RE 3FQTB 1GGUA 1C5CH 3R8QA 4KU1A 3LS4H 5DD0H 3U48A 2FGWL 5CGTA 5HDBE 4DTGL 3IDIA 4WI6A 1N2RB 1KB5B 4PJDA 2KDGA 4Z7VF 3BRGC 2VITA 1VSCA 3BIKA 4HIXL 1DEEB 3ROOA 2RHEA 1JGLH 3HI5L 4QHNB 3WS6C 3V6FA 3ZYZA 1SY6L 1HNFA 1NAML 1L7IL 4JZJB 2ZG1A 3CIQA 5IB3B 1QSEA 4UT9L 4OV5A 4UOJA 3UTOA 1U2HA 3ETBF 4ALAL 5J9PA 2W0FB 5EORL 4N1CA 1QBLH 1FNEB 4JN2B 3DROB 4X6BA 1Q94B 1EEQA 3QNYA 4IS6B 2EDFA 1DBAL 3FRUA 3D5OF 2FCBA 3A67L 3QQ4A 4NQSA 5L2KD 5BQ7B 4Q9RH 3WN5B 4L3CB 4OIIH 5I76A 3PF2A 4LBEA 1CE6A 3N0PB 1DSFH 4JG0L 1M6OB 2YPVH 2ZOKB 5E0QA 3QXVA 2EDDA 3FCTA 1TVHB 3RDTA 3IJSA 1OT2A 5T3ZL 2VDLH 1PQZA 4PJBB 5JUEL 1AGFB 1OPGH 4LSVL 5GRVL 4YEEA 2PKDA 3TO4D 2VDKH 2D4FA 1DBJH 3GMLB 2W60A 3UC0L 4TUKH 3S3SA 3VXRE 1G6VK 1Y0LB 1YMMB 4FQXD 4YXLL 5TF0A 5I8EB 3MJ8A 3IJHA 4NN6B 2KKQA 4BK5A 1NPUA 5JHDA 2GT9A 3BVNA 1EAJA 1F4AA 1ROWA 1T0NB 2YKLH 3CZJA 4YDLC 4WDIA 3BZDA 3SE4A 1MCQA 1U8HB 3CSYA 3WXWL 1A9EB 3QUYB 1RMFL 3B8YA 1MCLA 4IRJD 1QD0A 4JG1H 4NO0A 1ADQL 4PV8B 5IM7B 3BQUB 4J12A 3EUUA 1J8HD 2QQNL 3T8XA 2FEEI 4M62H 5HYJD 5F3BB 4Q2ZB 3ME0A 4QWWC 2N1KA 2IBGA 4JREB 1XCQB 5IW1A 1BVZA 2W9EL 5GZND 1YC7A 3FB7A 2WBJD 2FHBA 5E2UH 4FFVC 4HC1A 3ZTNL 5GS0L 4H88H 3FQWA 3P0YL 3QFJA 5LBSH 4OZIF 4X6CB 3KPOA 1CR9H 4C56A 1KYOJ 3WS6A 2YS4A 1G7QA 2PCPB 2IC2A 1ZHKB 4RNRA 4HUWA 3T3PE 3SPVA 3H42H 4AYFA 4GAGL 5BS0E 4YO0B 3PL6C 5EU6D 1SJHA 3PIQB 1G7JA 5DJ8A 5FGBC 2VN7A 5ESVB 1DDHA 3HPJB 4POZD 4J3UA 1YJDC 1JBJA 3V0VB 2NXZB 1QFUL 2DQHH 2P8MB 4Y7MA 4U6HB 4FTVE 1BD2A 1GL4B 3FFDA 4WTXA 2PO6C 4NQTA 1IQDA 3MBXL 4PV9B 3RA7L 5F1NB 1WVZA 4FQLH 4OKVB 1IT9L 4R2GD 4I3RH 4OM1L 5IMLA 4WI5A 4PJ9D 4MS8D 4PJ7E 5F7UA 1WGOA 1KC5L 4WW2C 3X11A 4I0CC 3KXFD 5IB4A 3IXAA 4P5TB 4QRQA 1ONQB 1OTSD 1NGZB 1CDHA 4RISL 3EJYC 4L8DA 3RY5A 4NCC2 3K7UA 4R26L 4HKZB 5EU7C 4XRCB 5KS9A 1F02I 5JOPD 4OZFG 1URLA 5ERWB 1T0MA 3KPLB 4CMHB 3IDNA 1JHLL 3OJ2C 3AC0A 4R7DA 1U92A 3GO1H 1FGVH 3RVXD 1IGTA 3ZDZF 2PR4L 2C3XA 4IRZL 4WU5B 3DX9B 4B7IA 2B1AH 4QY8B 1AHWB 5GGQH 3TFKC 1PYWA 1NCBH 3LV3A 4L9DA 3IU3A 4XNQA 2D7TH 3BPCB 2VYRE 3WS3B 1S7XA 4LPTA 2F54A 1IAII 4OLUL 2BOBB 5HHOE 4WNQB 4F57H 2EYTA 3OF6D 2F53B 3FN3A 5DTFA 4HXAH 1BVKA 4HCRA 4KH2A 1HHKB 1KLFA 4JY6B 1HDMB 1HOCA 1S7RB 1CF8H 1AFVL 2AK4E 1AGDA 2XY1A 1GZQA 4X9GA 4MA7H 3NCCB 5EU4A 1C16B 4ZUVB 1CDGA 4LSQH 3OGOE 5JW3L 1NUDA 4C83A 5FYLE 2B0SH 3QAZB 5DUBA 2MCPH 1FV1A 2PYFB 2C3GA 4BZ2H 3SDDB 3QXDA 2X70A 4AIZA 4U6XB 3TA3B 3PL6A 2AJZB 4PY7A 3QXWA 3RIAK 1OGTB 2A77H 3PDGA 3W9EA 3AGVA 2XI9A 1YN6B 4MA3A 1EVTC 5JOFB 2B4CC 1H0DA 4X7DC 1YYMH 2PO6A 4G6ML 5SX4I 4PRDA 2V17L 2GTZB 1PG7H 5DUMH 2ADGA 3MLVH 2XWJB 5B22A 3O4OB 5DURD 1BBJB 1BREA 4UBDC 5J13B 4PJAA 1KCSH 1I8MB 4LVHC 4D8PA 3MRNA 1NAKL 5CLTA 1R0AH 2JK5A 4RFOL 5DMKA 3RWFA 3D2UD 2ZKHL 1RIUH 2AI0L 1ZT1A 3STLA 4ZNEE 5JNYB 5C0CE 1T7VA 2FGZA 2VH5H 4FXGB 4PJFA 4WW2A 4YHIB 3RAJH 3TZVC 4GBXC 4XP6L 2PXYB 3PWVA 4ENEC 5KAQG 2IPTL 2MQ3A 1OGAD 4WTZA 5DJ2B 1MF2H 3GKWL 5FHAL 3RI5K 4I0PB 5LWYL 1NEUA 2X1QA 4OZHF 5SWZE 3CUPA 1A7PH 5AAMA 4ZOEA 1ZK9A 5I15L 2VSDA 3AS1A 1TMCB 1T1XB 2P5EA 3V6ZB 1YEIL 3ARDC 1G9NC 4LCIH 4WUUA 4KKAC 2A73B 1VDGA 1QRNB 4Q6IC 5DVKA 1MHCA 5IP4A 1IZKA 3WUWA 1Q9WA 1EERB 3K8LA 4PRPD 2O5ZH 3QSKB 1U8MB 5TE7L 5FHBL 2FATH 3DRTB 3GMMA 1P7QA 3O6KH 3VXQA 3BESR 2OQJB 3U2SB 4HGKC 5JW4R 1HYRC 3VFOA 2LVCA 1I3GL 1S7UA 3S4SG 5A2FA 1OVZA 4WFGD 1AD0B 3QBTB 5C08D 3CLEL 4Z7WF 3AXLA 1KLUA 3SJVB 4JCLA 1YEHL 3OBAA 1MUJB 1J5OH 1RUKH 3JTSB 1EDQA 3L5XL 5F6HJ 5GS3A 4JY5L 5DQJA 5FUZL 4Z0BL 1R3LA 1HH9A 4ZS7H 2QQKL 4ONFH 1S78C 4EDWL 3PGFH 2H32H 1XF5B 3T09A 4D0BB 5IB1B 1P2CB 5EUOB 1G6RB 2H3NA 5DD6B 1CBVH 2HFGH 1X5IA 5EO9A 2HTKD 3BMWA 1ZHLA 2YSSA 4U1MA 4GSDH 3MA9H 1R5WB 1W8NA 2FECL 3ESUF 3D3VE 4UTAH 1HEZB 3QH3A 5GGVL 2EXWC 4N8VA 2WAHA 3MLSH 1A2YB 4D9RD 4V1DA 2R0KL 2P47B 3MGOB 2IH1A 1A6TA 3QO1A 3T0DA 2IQAA 3BMVA 2L7JA 3C09B 3KNBB 2PYEE 1XR9A 1UCBH 3MLXH 4H0GA 1MCEA 3U4EA 5CSZA 4I5BB 2RB8A 3S3JA 3BI9X 1DBML 2FDBP 4PGEB 1B0GB 4KVCH 1U8IA 3RKDD 4FQHA 2EXYD 4Y4KD 1N5AA 3U0WL 1U0QA 3O45B 2FX9H 5D7JD 3VMPA 1Q9KA 1UVQA 5TH2B 3L3DB 3VXUD 4EN3D 3ZKQD 5F7LB 4GS7C 3TPUB 3WXVH 3S37L 1U42A 1SBBA 4OZIB 1OP3H 5FKAB 1T66C 4JFFB 3RTQD 2Z31C 3TZVA 2VDQH 3RKPA 4GBXA 4C59B 3VXTB 1A21A 2Y06L 3HPLB 4MAUL 1REIA 2WZPD 3MROB 4Y5VB 3SKMA 2VLRE 2A9ML 2DOCA 5KSBF 3OAYK 4F7MB 2CUMA 1KTLA 5ANMA 5TE6H 5LJYH 1I8KA 1Q9LB 3HMXA 2AJYH 3EYOB 3C5ZD 4EJ1C 1BQHB 3B3IB 3T2NH 1NCCH 1C5BL 3OKMB 3TCXA 3EYSL 2CLVA 1XGUB 5H37H 4Q6IA 5DC4B 5F89A 3LPFA 1RURH 1DEDA 3H9SB 4HLZG 4ONHB 1I7RB 4RIRB 4FQJH 2DM7A 5CD3B 1QQDA 5HI5C 1B90A 3O2DL 4HKBB 4TUOA 1JZ4A 1HSBB 2QSCH 5E2JA 3WKML 2A9NH 5KZCB 3ZE2E 3NPZB 1FE8L 4GW5B 1IRAY 4JJ5A 1SVZA 5J8OA 2QEJA 1UM6L 5HHMB 4JHWH 4GW1B 2ICWJ 3ULUH 4A6YA 2R2BB 4AL8H 1F4HA 5TF1H 1RU9L 1KPUB 2VIRB 2O5XL 1I1FB 2Z93B 4XPBH 1JTTA 1FGNL 1OARH 1EVUA 4OUUA 1IGYA 4JM4H 4JM2C 3VFMA 4AEEA 1KJ3L 4DW2H 5JHLH 2PW2A 4MLSA 1X5JA 3GMOB 4NUJA 3FKUS 3VXPA 2ORBH 1KIPB 4MAYD 4P0DA 1U3HB 3GBNL 5CIPH 25C8H 4O2CA 1F11B 1A7NH 2LU3A 2VB5A 1AR2A 2VLKB 4K55A 4OCNC 3UPRA 3W82A 4HCRL 5FO9A 2Y6SC 1U6AH 4S0SD 1ZHNB 4I18B 2JB5L 3G5VB 2VJXA 3THML 2ED7A 1NFDE 2BC4A 1CS6A 1RIHH 2DQEL 1TFHA 5E6IB 1TCRB 3CPLA 2QQQA 4P49A 3BKYH 4GKZA 4G5ZL 5ADOL 1J05B 4J8RB 4NQED 5ICXA 5CSGA 3MSPA 4N0UE 5I8CB 5BS0D 3INUH 3PWPD 5DJXA 1Q1JH 5HD8C 4XHQA 5EO1A 4HPOL 4ELME 4Y5YC 1W0YT 5GQBA 4Z76A 3PJSB 4Q6YA 2W38A 4FTVD 4PLKC 5GHWH 5C0FA 3DVIA 1Q0YH 3U30C 1T03L 4CW1A 2Z31A 1P69B 4OCXL 3NAAL 3DXAD 5EPMB 4HIJB 1WCBA 4MZ2A 3UYOD 1CFBA 4P23D 4RGMC 2VISA 2DJUA 5EBLA 3R06B 1EHNA 4O58H 2R2EA 4QOKA 1L6ZA 1KNOA 2BNRA 2ENSA 4Z6AT 2P8LB 2XA8L 1RUAL 5ESQB 2GJ6E 3IKCB 4KRPD 1JI2A 3SDCD 4J6RL 5I2IB 4WWKB 1E4XL 2P1YA 4XWOC 5FYKD 5KG9A 3PABB 2Q20A 1CL7I 4KV5E 5HVGB 5I1KL 2CQVA 3CX5J 4BKLB 4U0RB 3VFUA 1A7OL 4JN1H 2UVFA 4P4RA 4LVOC 4MXQD 4PD4J 3VFVA 2Z9TA 4YDKL 1JE6A 1OY3B 5DHVB 1FVEA 1OSZA 3J7HA 5C1MB 4MLIA 4M4RA 3RVVD 3CFKB 4RRPG 4XMKL 3O3UN 1S3KL 5BVPH 3WLBB 2Y25A 4P46A 4JVWA 1XGYL 4JPKH 3T1FA 5A3IC 3CDGA 2VDMH 3MNWA 4YJZL 3W5NA 1BOGA 3O4LE 1X5LA 4GMSH 1A6VL 1HWGB 3QPQC 2FSEB 2VL5A 1K6QH 4BH8A 5C0ND 3KLSA 1IGFL 1TJHH 3RVUC 5HPMA 2HFFB 5C0GB 5KSAB 4OCSH 5HI4C 1I9RL 4JFDA 2JLLA 4G6JH 1UB6B 3ZDYE 3CFIC 2J8UE 3RWGA 4U6YA 2VDOL 4Z7WB 1N6QH 4RGNE 4WEUD 3QDMB 5DQ9B 1HKFA 3BSZH 4WEMB 5C0JB 4PGCB 3KYOB 4K8RH 3GSNH 2EDTA 5E99H 4MCZA 5IKCB 3X17A 3G5ZA 1U8LB 1T2QL 2VQ1A 3L3GA 3D9AH 1LVEA 1VEPA 1PKOA 1ZT4B 1U95A 1JGUH 2DQFA 2ICEA 4K2UL 4XZUB 4Y5YA 3S88H 1FNSH 1IGMH 1JTPA 1CG9B 3O6MH 2VZTA 4Y19E 3NACH 2Q6WB 4CKVX 4LLQB 4JFZL 4L4TE 4JRXB 3LH2L 4OD3H 1F13A 3SDXF 1OQXA 1VACB 3FT3B 3ARFB 4QT5A 3LIZL 1DUZA 1MWAB 3EOBB 1F6AB 1BZ9B 4XWGH 2HVJB 4NWTL 5IT2H 43CAB 2AK1L 3QI9C 4P4KD 1ZSDA 4KKCD 1DANT 3MRQA 32C2A 1QRKA 1OAZH 3KPRB 4KK9D 5J6HB 3FO2B 3MLZL 4GRMB 5GGTL 2I9LB 3PUCA 4UINL 4D9LL 3RQ3A 5K9JH 1I3VA 3GSRB 1FNLA 4JGMA 4ZDHA 3FO0H 4HXBL 3V7MA 4JZOA 4X4YB 2WIIB 4LQFH 5IVXF 4O4YH 2HJKA 4M8QB 1XGRB 3S9DB 4F7PA 4MA8H 2QSTA 1KB5H 3D0LB 3K0WA 2CK0H 2VDPL 2Y07H 4N8CH 1IMHC 2NY5C 7CGTA 3V0WH 1BM3L 1X5AA 3ARUA 4TVPD 5C0IB 3RNQB 5IVZB 5F88A 3P11H 2I26N 5C09B 5IESL 1JRHL 1BQLH 4U1JB 1GAFL 5LXGH 4N90D 2EIZB 3KPMB 3MUY1 2IPUG 5KSBB 1MFBL 2X42A 1PG7W 4GG6F 2UUDH 5BV7H 3FTGA 1N8ZB 2IANE 5A16B 5D7KD 4NZUL 2NPLX 2J6EH 1S7QB 2WM0A 2RJMA 2XV6B 3T65A 1Z0NA 3O3AB 3TV3H 2XN9E 2I07B 1BEYH 4Z7QF 5FCSH 3ULVC 1DVFC 4WFFD 2FR4B 5HGHA 1W8OA 4Z0XB 3IDMB 4HJGB 2R0ZH 1VGEL 3BJLA 2YZ1A 5KVEH 2BMKA 1E6OL 2NLJB 5CEXB 1FIGL 1CTOA 3TN0B 1WLHA 2VKWA 5CJQH 2UYLB 1S9WA 3C08L 3DUSA 4Z7UE 5I1LA 4KRNA 4X6DA 2UVEA 4PJDB 1MAMH 2R9HC 2VITB 1NBZB 3F7RA 3WD5L 3BIKB 4NM4H 4JB9L 4PRIA 2EDWA 4U1HB 1D3CA 1MVUA 1AQKL 5C2BL 3V6FB 5FEBA 1CFVH 4YK4B 1NEZG 2APVA 2ZOLA 3PP4L 5HY9B 3GGWA 4HWEL 4PRAA 5D2NC 4RBPH 3P0GB 4JPIB 5J9PB 2C3WA 5AYQA 3EFDH 5HHPB 4OFVA 4X6BB 4YHZH 2VZOA 3NZ8A 1F4XH 2EDJA 3U7YH 1AO7A 1UJTA 3FRUB 4KRLB 4PRNA 5DD3H 4ZUWA 5CP3H 3L95A 4GMTH 1S5HA 2ZCLH 2XKNA 2N7BA 1P4IH 4DKEL 1BZ7B 3MR9A 1HNGA 4GLRI 1T6VN 1S7WB 5BRZD 4EI5D 3B9DA 1T7ZA 2CDGA 3T0EB 4IHOA 1PY9A 4DVRH 3GB7B 3FCTB 3QI9A 4LHUB 4FXLA 4M00A 3RDTB 3UTSA 1EXUB 4WJ5B 4X8XA 3S8WA 2AW2A 2BZDA 2X4QB 3B5HA 2OL3B 1YN7A 3UJJL 4XPGH 1D5XB 2W60B 3QDJE 2CDEB 1KBGH 5C0AB 1Z9SA 2R0WL 3MJ8B 5C0BE 2F74B 3G6JE 1CICC 1HE7A 3BVNB 3NIFE 1YPZF 4KI5D 1BFVH 5IG7B 4Y16C 4GRLD 1GCFA 3SDAC 4OLYL 1R5IB 1BJ1H 4K71B 3MGAA 3BYTA 4R4FH 4NZRH 3P4NB 5E8PA 1MCDA 2X4NA 1VFAB 4E41A 4GKNA 3FHQA 1AXTL 3BO8B 5D7SH 4U1SA 7FABH 2D0GA 2XZZA 4LASL 5F6IB 4RWYL 3ZMRA 4CADA 2EYRB 1MOEA 1DVFA 5T1KA 3VFRA 3QHFH 2FX7H 4KAQL 3O11A 5AEAA 1MAJA 5BO1L 1FNHA 5JO5A 1V7MH 4YZFE 1EHXA 1T21B 5JPNB 3UZVB 1KJMA 1BF2A 2R1WB 3OPZH 2WANA 3BDYH 4TN9A 2EH7H 4JRYE 3UTTD 2ARWA 5EZOL 2EC8A 4OGYL 3F62A 1QFWL 3HFMH 3QFJB 1U41A 3QZWA 4ZTPH 1LP9A 3GHEL 4L3AA 3HRZA 1IKNC 1SBSL 4OZHA 1JGVH 5IMKB 4RAVA 5TGBA 3KPPB 4ZFFA 4KHXL 5INDA 1QO3A 1CFSA 2YPLA 4JAMB 5E9DB 1SJHB 5DS8A 3O9WB 5D2NA 1CIUA 4P48A 1FC2D 5IV2B 4WFEE 3TF7C 2XZQL 1TVBA 5DK0A 4ZO8A 1RZKC 4YWGH 1NC2A 3WE6A 5L88L 2NX5B 1FG9C 3PDDA 1MRDL 1U2CA 3FFDB 1NL0H 1WFOA 5I1EH 1G6RL 1IQDB 4O00A 1WBXA 1YUHB 2EH8L 4FFYL 1XH3A 1KTKE 1ZLVK 2C7UB 1RULL 2GSGB 2NZ9D 2OI9C 3TNNB 2V9TA 3TBSA 5BZDA 2W9DH 4L3ED 4LSUL 1SEQL 1WC7A 3IETB 4K94C 5D96B 5IWLC 1YEGL 1LO4H 4G6FB 3TP4A 4L8DB 3GNMH 5D9SB 5F7EH 1X3DA 2XQYG 1MCJA 3RGVB 1UACL 1RZJH 5C07B 1QSFD 4KZEH 1XF1A 4E5XA 1CD9B 3TBTA 1RIVH 3IDXL 4JO3H 1CICA 2G5RA 5FAAA 3QISA 4ZD3L 2R56H 5HDBF 5T3XL 3WIFA 2DWDB 2Z91A 2YD9A 5D7IA 4U6TA 1IAOA 4H20L 5T1MB 2NR6D 3X13A 3NCMA 1UZ6E 3SDXB 1VADB 4TSCL 3SDAA 5LQBL 3IXTA 1OAQH 2BDNH 2BHYA 3Q3GA 4HBQA 4MNQB 1I8LC 4X9BA 1RJZB 5C6WH 2HT4C 2YN5A 3LV3B 2MHAA 2J1KA 3C6SB 4ZODA 4U6VH 1LEGA 1QBML 1FCGA 4KTEH 2BNQA 2F54B 1FZMA 4PJ5E 5E6YA 1CLZL 3L3IA 2EYTB 1PLGL 5D5MA 5DTFB 5IVXB 1CFTA 5IHZA 1HHGB 1U8PA 3KPNA 3D69A 3W0WA 1JNHA 1IGCL 4I3GA 3NGBC 4X7CC 4FZ8H 4YC2C 1I1AC 1OTTC 3EOTL 2OR7A 4XC3L 2VZVA 2EC9U 5EU4B 3O4LD 1WZ1L 5IQ7H 8CGTA 3EYQC 4WRLA 1EFXD 1IKNA 4XPFL 3JZ7A 3DX7A 4C83B 1U8OA 2OP4L 2P7TB 4GG6B 3CFCL 1FV1B 3QG6A 4AQ1B 4Y1AB 4U1IA 1PD6A 2F5BH 3FT4A 1LO5A 4L1HA 4LKXA 3X12A 5JDSB 3EYFB 1H8SA 4JKLA 5I8KH 2HJFB 5BJTA 3Q2CA 5DLMH 3C2AH 1F90L 1NMBL 1ZANL 4QTIL 5D1XB 4NT6A 2FYYB 3CAFA 3OXSA 4ODHL 1S9KC 1JNLL 3LKQB 4H26A 1DL7H 3TJEH 5CFHA 1KENH 2PTVA 5I71B 2FLRT 3G5YB 3KHQA 3UAJD 4YDIH 3EYVA 1FFOB 3BP7A 3ZE0E 4LCYA 4M4PA 2UZIL 3QWRA 5E56A 4LGSB 1CU4L 3V5KB 2ERJB 4WW2B 4HLJA 4G8EA 4LGRB 1F3JB 1MLCA 3QR2A 4QYOA 4J3SA 2D9CA 5IWLA 5J11C 1CLYH 3RZCB 3ISWA 3M07A 4MXVE 3ARYA 3U7WH 1J1XL 4LLYA 4WUUB 1MI5A 2FL5A 2G60H 2OZ4L 5TDPB 2PUQT 3HR6A 4WVRA 3G6DL 3NPSB 4QRSB 2ZUQC 3CVIH 4ODTL 5D1QD 1KJ2H 5CGYC 3BKCH 3PQYA 4HUKB 4JJHA 9CGTA 4X5WA 2JF1A 4GKOA 4M93C 3GJFB 3ZTJH 5EBWA 2NY5L 2G75A 1H15A 1GIGL 1INEL 1I8LA 3T3PF 1TJGL 4K07A 3RNKB 3KS0J 1UQSB 3OKDB 3C6LC 4EOWL 3E8UL 1QNZL 1J1OH 3MX0A 4PRHE 1GGBH 5JPMB 3AXLB 5C0EA 1GPOH 2VLJE 3LZFL 3VWKD 2EDEA 3BEWB 1KLUB 3T2QA 4G8GB 1F58L 5C9KA 2E7BA 3FB6B 4IRJC 3DARA 3SQOH 5C7XL 1OF2A 5I6XB 1GOHA 1A22B 4MXWL 5DMJB 1QVOA 4OTXL 2XN9D 1U36A 4NN5B 1V5JA 1I1AA 1K4CB 4HMDA 1CGXA 4KQ3L 1MAKA 4WFHE 1ZHLB 3L3HA 4FNLL 5FDWB 4H5SA 2X4OB 4NQCE 4NKMB 4ZPTB 4PJ7F 3QH3B 3D87B 4HWBL 3MV9B 2E6JA 1FP5A 4LCWE 1FG2B 3ARPA 3C87A 1KTDA 3V8CA 5GZNC 1MHEB 2WBJC 3ZYIA 2G2RA 2DJ4A 1W72H 5F7DB 3OR6A 1XR9B 5DYOA 2ADIA 5D7LD 5HJ3A 4RQQB 3FO9A 3AU1A 3CMOH 1A3LH 3OR7B 1N5AB 1P7KA 4ZNCD 3RUGA 1EFQA 3BW9A 3ULUE 4UIKL 5GIRA 3H3BC 4PS4H 2HN7A 1VFUA 5DFVD 5DRNB 1S9YA 3I9GH 1OAKH 4OJFH 4L29A 5E08L 4POZC 4NHCH 4Y89A 1R3KA 4Y8AA 3UYPA 5C6TH 1YY8A 3E6FB 2YUVA 5AD0B 3Q1SH 5SV4A 5C0DB 3I2CL 5DR5H 4OCMC 3MC0A 2DYPA 5L2KA 2EKJA 1U93B 2FJFB 2E6PA 4EBQH 2N4IA 1G7LA 5GGVY 1RJYA 1XR8B 2DI9A 1LE5A 3FQUA 3AAZB 4XVUC 4KROD 3RWCA 4HH9B 4AEIL 1LE9B 3AM8C 1I8KB 5ICZA 2FGWH 4MS8C 3ZYJA 4HUMB 3CJJA 1W0WB 4HT1H 2GK0B 3FFCE 5K93A 4ACPA 3PNWB 3ARDB 2VR4A 2CLVB 3HI5H 5HGDB 5F89B 5I18L 4HG4K 2VDRH 1OTSC 3M1BA 2ITCA 3ZDXF 1HINH 4HD9A 2JIXD 3HAEA 4LCUB 2JJTC 4IIQC 1P4LA 2XXMB 4ZFGH 4APQD 4TNVF 3NCFB 1CE1H 4JO1H 2ZCHL 4G6AC 1EGJH 3VRIA 4HGMA 3FZUD 5KSUB 2LE9A 1VCAA 3C6LA 3KG5A 3MYZA 1AJ7L 3AREC 5E00B 4DQOL 1UM4H 2YC1A 3VXMD 3LEYL 3BZEA 3RVXC 3HNSH 3NIGE 1DLFH 2YD7A 4FXKA 5D8JL 4DN3L 1J88A 1FFNB 2OS7A 4IRJA 4TOYH 1PEWA 1XT5A 2PW2B 5ID1B 4AG4H 3WNLA 3OQ3B 3EW3B 3MV01 1KXTB 1DFBH 4G7YL 4QRPD 5GISH 3JVGC 4JDVB 4OCYL 4PG9A 5HYJA 1NGPL 3UPRB 4P59L 3SGDH 3SCMB 1WICA 3O2WL 3X3FH 5F9DC 5BZWB 2OMNA 4JPWL 5B38A 4PR5B 1QYGH 2GIYA 3VJ6A 5F1OB 4JFEA 2DRUA 3L3JA 4XVSL 4P2QA 2WBJA 5DJ0A 2CD0A 1INQA 3CDYA 1H8NA 3CPLB 2X4PA 1RZFH 3CXHK 4DN4H 1BPVA 1INDH 4HS8L 1G7HA 2UWEA 1HXMA 1ZGLA 2YD4A 4BSWA 4KMLB 5I1DA 1U9KA 1PKQE 2YPKA 5T3ZD 1CLOL 2HKHH 2Y5TA 4K9EH 4HWUA 4BFIA 3BHBA 3KHOA 1UXSA 4JVUA 5D4QA 3S37X 5IEKA 1QFHA 3T0WA 1T20B 3JWDC 3L3OB 3WIIL 1CGWA 4LFHG 3T4AB 4WO4D 3VH8B 2JB6A 3MRJA 5DHVH 4F2MB 3QDGD 4ODUB 1D5ZA 4Z7NF 2GAZB 4O5LH 1ORQB 5TFSH 4P3CL 4X7SH 3VXRB 2R2EB 3AM8A 1S7TA 5TJWK 4YXHL 2WUBH 5JDJA 5E5UB 5J3HC 2ARJQ 3CC5B 2FJGA 1YC8A 4K94L 1RAMA 2HT3D 43C9A 3MRFB 3KXFA 4UDUA 3SKJL 3QCUH 2KL6A 2I24N 1NBQA 3IDUA 1PJ9A 2JJTA 4IIQA 1NH6A 3IAGC 3BPNC 3IFPA 1H3UA 3TESA 1NLDH 3OXRA 3STZB 2FLBT 3BKJH 5JA8B 3CFBA 4XNYL 2QADD 2BRR