1NLDH

Fab fragment of a neutralizing antibody directed against an epitope of gp41 from hiv-1
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
215
structure length
215
Chain Sequence
QVKLQQSGPGLVQPSQSLSITCTVSGFSLTCYGVHWVRQSPGKGLEWLGVIWSGGDTDYNAAFISRLSITKDNSKSQVFFKMNSLQPNDRAIYYCARRGGDFWGQGTTVTVSSASTTAPSVYPLAPVSGDQTNSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSPWPSETITCNVAHPASSTKVDKKIEPRGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords FAB1583
publication title Structure of the Fab fragment from a neutralizing monoclonal antibody directed against an epitope of gp41 from HIV-1.
pubmed doi rcsb
total genus 35
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 1996-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nldH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1nldH02
5I8OL 2ICWJ 3GUTA 5CBEA 1FLRL 1PG7H 3DUUB 4PRDB 3WFHA 1HZHH 4TUKL 5IB2A 3FO9A 3RWCA 1XZ0A 3ISWA 2ZSVB 2ARJA 3HNTH 4PR5A 3QEHA 2EO9A 5DJ2A 4YZFF 3B9EA 3S3JA 3SJVD 2XWTA 4O2FB 2P8LB 3QDMB 5IB1A 5I1DA 2C3XA 3KDMB 1BHGA 1FIEA 2OYPA 4POZC 5ICYB 3STZB 1RQ5A 1CXIA 1MY5A 4Y4KB 3G5YB 2UYLA 3CU1A 4XP5H 5CEZE 1C08B 4BQBA 5C0CD 5C08E 1S7UB 3U4EA 2F5AH 1GC1H 5CGYC 1CVSC 4WCYL 1RULL 4JDVB 1YJDH 5TH2B 3MRRB 2ERJB 1A6UH 1FGVH 3NN8B 3CMOL 5DD1H 1DR9A 2XPGA 4JM2B 1N5AB 4JO3L 1TZHB 5J4MA 1T7WA 1R6VA 1MEXH 4K71C 3SO5A 4C54A 1EGJH 4NQSB 1E6JL 4XAWH 2BCKA 4GJTB 5F7EH 2B2XL 5EUOA 3C60B 1S3KL 1ITCA 1IGJB 5C6TH 4EDWH 3K81A 2DL9A 2NY6D 4FP8H 4BZ1L 4HKJB 4JFYA 3BMVA 5DVLA 3VFPB 3S36H 2NY2D 1UEYA 1ZT4A 4YDJB 1QEWB 5C0AD 4LKCB 5B3JF 2X7LB 4CMMA 3BQUC 4UIMB 4QHLA 4PJXA 2R9HD 3MLWH 3KJ4B 5H8DA 3EYQD 4EIZC 1JPSH 3UO1H 4U1SB 1BEYH 4YUEL 3B4NA 2AK1L 2VDRL 1DANT 2VZUA 3MLZL 3DTXA 5D2LE 2Q76A 3MUGA 4OGXH 1ZXQA 1CL7L 4NQED 2JK5B 2ICWI 1LK3H 4YE4H 3VDCA 1G6VK 1GAFH 5HYSG 3VXUA 5IKCA 2OP4L 3UP1A 1C5CH 4PV9A 3L6FB 3S37X 3PV7A 1T89C 4TNWK 1CICD 4KUCF 4AM0A 2ZPKH 1IE5A 2ITCA 4OCLC 1CFNA 4NC2B 4OAWB 1MRDL 4HV8B 4M7KL 1PG7W 4JKKA 3RPIB 5A3ID 2PYEA 5GS3A 4M4RA 2PO6B 4HZLB 5I1GH 3O9WC 4GG6F 4Z7NF 4MNHA 2GW5A 3HE6D 5CEZL 4MAUL 3K46A 4LLWA 2P5WA 4HPYL 3T77B 1BLNA 1YDPA 1KB5L 4ENEC 4D8PA 1B2WL 1D6VL 2F58L 3IFLH 2GJ6B 5J8OA 1FG2B 1ZLVH 1K9TA 5KW9H 3NIFF 3SO3B 2R0KL 2BSTB 3DYPA 3C09B 2Z8RA 1CYGA 4TOYL 1G7HA 3MV01 3KYMA 4EXPX 4OT1L 1T83A 2E6QA 1F3RB 4XVUC 4PRHB 1F3JA 2Y25A 5IFAL 1FFRA 3MLVL 5I1LA 1YECH 5A2LH 1LNUB 5JORB 2XYCA 3MV9A 3VI3F 3GJEB 2E27L 1ADQH 1XIWD 2F9BT 3G5ZB 1S8DB 4KQ3H 5E2WH 2MPAH 4EKXA 5B4MC 2IBGA 1TITA 5DT1H 4OGYL 3BJLA 1A6VH 1NBQA 2OXHA 3F8UB 4OF5A 5DFVC 1ORQA 5KVGL 1Q94A 3I50L 2VLJD 2DYPA 1AC0A 3SKMA 2DTSA 1I1AC 3C8KA 4LLYB 4JFHE 4OLUH 3ARQA 3I02B 3LHPH 5FA3A 4Z8FL 1CD1B 2B4CH 4GS7B 3QZWB 1F02I 1MHPH 1NCBL 4A6YL 4AK1A 4MQXD 4DGIL 1D5ZB 1O5DT 5CZVL 1G7IA 5DEGB 4U6YB 4X5LA 4DQOL 1XF4A 1HHKB 4JZJA 1MHCA 4YDLC 3RWDB 1T2XA 4KKAC 4PJDE 2VLRA 2EH7L 1GGYA 4Z7VB 3WL9B 1AC6A 2D7NA 3PWJA 5FEBA 2WQRA 4TQEH 4BSWA 5E99L 2JCCF 4O5LL 5IB4A 4HUVA 1KTKE 3RVWD 3IGAB 3ZKMD 3G9AB 5E1HB 2PNDA 5JUEH 1DBJL 3IDGB 5I17A 1KXTB 3F7VB 3HE7B 1A7NH 3BGFC 1NEZG 1CE1H 3ARSA 3UYRL 3HG1B 4Y4HC 1P2CB 5EIVA 1T04A 4JZOB 1SVZA 3Q1SL 3EZ8A 3SJVE 3MLYH 4TPRL 5F6IB 2DWDB 3H3PH 5I18L 5ESVA 3EYOA 4RZCB 4OCSH 5BVJA 5DD3H 2FBOJ 3RY6A 4JO2L 5E03A 3FFDA 5DGQA 5FUZH 4PY7A 1AFVH 4I4WA 4WFFD 4YDVB 1AXIB 1NCWL 2YD3A 3IYLW 4LSVL 4NN7C 4V1DA 5ADOH 1QFOA 3ZT5A 2EXWC 1EEQA 5B38A 5BOZG 5ESQA 2I5YL 4ELKA 1BAFL 4S10A 1E4XL 3DBXB 2HVJA 1KJ2L 1W0VA 3PWUB 3MACH 1ZA6A 2GQHA 2C4FU 3KYOB 4AMKH 4L5FH 4RA0C 4TULL 1OP3K 1ZLUK 4OQTL 4NWUL 1CT8A 1TCRA 3ABZA 4LCWB 3FMGL 3UTTD 5AG8A 3CFDA 1INQB 2P49B 2VH5H 5C0AE 3ARFC 2L4OA 3FFCA 3HTLX 1X5YA 3FB8B 1BD2B 1YEIH 1U95B 3IDYC 4GT7A 5DRXA 5C0GA 5KAQF 5MP6L 3TBVA 3M8OH 4KV5E 5B38G 3GMOA 3QFDA 5D96B 4XP6H 3K1DA 3TNMA 4OKVA 5H35B 5CD3B 2VC2L 3F7YA 1TJIH 2JJVA 1VFAA 3AY4A 3L3KB 4NT6B 2JJTA 2QQKH 3QWQB 1U93B 2QR0B 5TQ0L 4NQEE 4U0RC 1BJ1H 5MEOB 2FB4H 3W9DB 2J8OA 4DW2H 3WN5A 2WLZA 1X5XA 4DUVA 3ESUF 5F8QC 4LLUA 1V5JA 2XFXB 4ISVA 1EHAA 4PJHB 1MREL 4L4TA 1ADQA 3RGVA 2A6DA 3V0AC 4HH8A 1FRGH 3GSWB 3NCYS 1DE4A 1QSFB 4JFOB 3KHQA 5BZDA 4QHUB 3T2PA 1TJGH 3CH1B 3UAJC 1PEWA 5CSBA 4ZFGL 3RVTD 2FHFA 3NCBB 3B9VA 2P8PA 3PV6B 4G6MH 1OT1A 4O58L 2JB6B 4Y7MA 5D2LB 3HNVL 4OLXH 1KUMA 1MWAH 4BQ6A 2F15A 5D2NB 1NUFA 3L3GA 5EOTA 1HSBB 3KWWB 4M6NH 2GITA 3EYFB 4HHAB 1JHKL 3BKMH 5FGCB 4JY4B 2OJEA 1DQMH 5EZLA 5KVMC 2WWMC 5HXMA 1N2RB 2HN7A 3ET9F 1AD9B 3HC3H 3ES6A 1YEGL 3OAUH 4I3SH 1VDGA 4MDIB 1UM4H 4ONGH 2R8SL 4Q9CA 4Z7WF 2XG4A 2XZAL 4PJGB 4UTAL 5FOBB 1LO5A 4WJ5A 4QTIL 3GB7B 3SDAB 4TTGA 3BVNB 5E8DH 4Y5VB 2DLTA 3MR9B 3T65A 4X6EB 4YPJA 4GKSB 3TO2B 4F58L 4Z6AT 3QWRD 1A4JA 4F15B 2Y06L 3EOBA 5GGQH 3HFMH 1IAOB 2ZKHL 3FQRA 2SEBA 2VLJE 5D7SL 1EAPB 2IQAB 4KDVA 2DQCL 1SYVA 4NDMA 2FYYA 5HGDB 2D0GA 3WNPA 2EECA 5BXFB 2V9TA 3QDJD 3CFJB 3S35L 3IJSA 1R5VB 1Q0YL 3P4NA 1DQQB 1UM6L 2ZUSA 1MCPL 4UV7H 5AZEH 5FM4A 4RCAA 5ICXB 3BRDA 4PJCF 3P9WB 2DL2A 2VDMH 1CXFA 4UTBL 12E8L 5DD6B 1JGVH 4NO2B 4XPFL 1OTTC 4XXDA 3TP4A 3STBA 2WLYA 3M07A 1TIUA 3HZVA 3T09A 2NXZB 2R1XA 4WDIB 4KXZH 4JPVH 3G6DH 3PHOB 5KZCD 1CXLA 2PW2A 5DQJA 1OLLA 3K3QA 1BGXL 2H8PB 4AEEA 2APWA 1GIGH 4AH2A 3HC4L 2EDXA 3VD7A 3E8UL 3RIAF 3MOBH 4NHUA 3SGKC 2AJYL 2HJFA 4FZEL 2K1MA 4Y8DC 1FG9C 1HK6A 4LPUA 5HVGB 4F7CA 5IB3A 1MJUL 3S7GA 4QRSA 3U6RA 4WFFE 5KVDL 4IIQB 1MFDH 5D1QD 1AGBA 1T83C 2ZCLL 4Z95L 5AD0B 4ODHL 5EZJA 4PJ5D 3V5DB 4KDWA 3QI9A 3QEUB 4DZ8B 2X4TB 3S6CA 5TJWK 3OKEA 3GIZL 4C58B 2CRZA 1U3HA 5GGRA 2EE6A 4XGZB 3BP4A 3GSOB 4QWWC 3V9FA 3BP6A 2BNRA 3K2UL 2WUBH 3H9HA 4XC3H 3VWKD 3PP4H 3HCVB 5FF6B 4PJFB 3UTTE 2X4PA 3DV6B 3O8XB 2CLRA 1NGQH 3GK8H 1NCDH 2QV2A 5C0CB 2IBBA 3QHZL 1JYNA 4Z9KB 4HX1A 2V5YA 4KK6C 4NHCH 3RX7A 1JZ6A 4RGNB 1M7IA 2IPTH 1MWAA 2CLVA 5BO1L 4JY6B 1V3JA 4C56D 2H45A 3R06B 3F58L 4JDZB 2VUOA 2PTVA 1DP0A 1GC1C 1CVRA 4JZJC 1T21B 4PP2A 4Q7DA 3WFZA 4MGXA 4WHYG 3GKWL 2HKHL 1TETL 1VFUA 1Q1JL 1ZHKA 3ULVL 1KULA 1IM3A 4I3RL 4JHZA 3LZFH 1U92A 3IFNH 1CFVH 3G6JA 3F7QA 5IQ9A 2MKWA 4JGMA 4OZIA 2N1KA 4OLVL 4J3VA 2NZ9D 3FN0L 4J23A 3CFIC 5D1XA 2AK4A 2JLLA 1BF2A 4FQXB 4G43A 3O4OB 4N0CC 4S1QH 3QCUH 1G7LA 1KGCD 5K59E 4DGVH 4K07A 5DJZB 2P7TA 1JF1A 2DQUL 5J6GA 2WUCL 5C0RL 3V6OA 3WFCL 1J1OL 1QPPA 3U4BL 2ZG1A 3RY6C 4CN1A 4R4FL 4I0PD 3GJFK 2HAZA 1OAXL 1UZ8A 5C0DB 5T1DL 3ZYJA 1FZMA 1TZIB 3QUYD 4M1DH 5I1KL 1JI2A 4HUNB 2CDGA 3B5GA 1CICB 2VLKA 3HZMA 1ZHBB 2IFFL 3X13A 5D70L 2CLZB 1CU4H 4JLRA 2KQMA 4PJBE 3E3QC 4FTVA 1MAJA 2F5BL 4QRTA 3VGDA 1ZHLB 3ZDXE 2CDFB 4WI6A 4Y19A 3QUML 2ZCKL 3AS1A 3KHOA 4Q0XH 2A73B 5E1AA 5TE6L 3KPRD 5EO1B 3ULSB 4IDJH 1YPZE 5IV2A 1DBAH 1EJOL 3TIDA 3MV7A 3ZT6A 4ELMB 3LRSA 3EZJB 4EN3C 5E94B 3ZTNL 2OBGA 1SYSA 1NKRA 4PJ9A 3P0YH 4Z7VF 3X11A 2NY7L 1FCGA 5F9WB 4NJ9H 4PGCA 3NGBC 3IU3B 2HLFD 3GM0A 3QDJE 3TT1L 2VDPL 3AY4C 2HKFH 3MOQA 4G5ZH 2B5IB 3T2QA 4NN5B 2JJTC 4LASL 4NO0B 4WFHD 4KGJA 5E8PA 4U6TA 1YYMH 3GNML 1CBVH 3UBXG 1INEL 1T0MA 3WN5C 1GOHA 4MA7H 1J8HE 1KTRL 5C0BE 4XCNA 1RIUL 4ZFOB 1MF2H 3RGVC 5KTEL 1OTUD 1IBGL 4UIKL 1UCBL 5LG1A 3VA2C 3O3EB 3T2NH 1IC7L 1X4XA 3TA3C 3U0WL 2PCPB 2EYTB 1JRHL 4MD5A 4XWGL 3QNZA 5AYUH 3NFPA 1EBPA 1ZGLM 5E2JA 1R0AL 2AXFA 1U3YA 1IQDA 3ZKNC 4QOKB 5IROA 2ZOLA 5M95B 4OFVA 2B4CC 1MAML 3D25A 1G7MB 3GJFB 4ZPTB 3MV8A 1QPXA 3QQ9C 2I07B 1F5WA 5IBTH 2BY0A 1JIBA 3L5IA 4H0IA 2IPUK 3OAZK 2CIKB 1DSFH 5FYKD 1NKOA 2FGWH 3DO7A 1U8IA 1NCCL 4PJ5E 4J8RB 1EFXD 2GK0A 1OARL 4XBEH 3BT2L 3BN3B 3GSVB 1FIGL 2VO5A 2OTUA 3KPNB 1RZGB 1NFDB 4G80A 3TWCH 3DMMA 4HJGA 1LE9B 5GGUB 1DLFL 4J6RL 1YEHL 5JOFA 5FXCH 4QXUH 4X6DB 4AEFA 1LEGA 2BNUB 2Z93A 5JNYA 3RL1A 5E4IA 4R8WH 1KPVA 3QHTC 1A47A 3CXHJ 4NGHH 5CD5D 4HC1H 3TF7C 2DMKA 2PF6A 3T4YA 2IH1B 4HG4J 4M8QB 1PEZA 1JWMB 3VFSA 5E9DA 3QHFL 1BMGA 1U8OB 2JB5L 2CKNA 4C56E 1B0RA 3AGVA 1G0XA 1RJLB 4PJHF 3R4DA 2BX5A 4FQLH 3D2UD 3TIEA 2JKXA 4X0KB 2F74B 5IP4A 2EXYD 5I74B 5BRZB 3DIFA 1HYSC 1LDSA 5FCUH 3QQ3B 4OFIA 4DCQB 2VXVL 1JHTA 5GSVB 1UJ3A 5A2FA 1GGIH 1JPTL 5E08H 3LSOB 1AP2B 5EOCL 4HF5H 5AAMA 5D2LF 3CXDH 3MFFA 5DUPH 3BYYA 1KGCE 4LGSB 3L1OH 1UKQA 3CDYA 4LKXB 3O81A 1OAKH 1YNLL 4YGVA 5ILTH 3E6FA 1KCSL 5EC1B 2YPKB 4HWBL 4BELD 4AL8L 3OF6A 3HPJA 3EIFA 3KLAB 3QIBD 4F7PA 1JUFA 3JV0A 2R2BB 2Z92B 4WU7B 5I1HL 1LO4L 5F9OL 4BH7B 2ZSWB 3LKRA 4BFIB 2X44D 2FEDC 1DFBL 1I8KB 4PTTA 4UV4H 4PJGF 5TDOB 3I6GB 2EH8L 2B39A 2VKXA 3A6CH 3EDFA 4HEME 5ERWA 2NY5H 4X4XB 2FDBP 4EUPH 3KPSA 5ID1A 5TE7H 3SOBL 3EYVB 4OI8A 4GKZA 3T4AB 4N5UA 2FCBA 4PS4L 2FATH 3CMGA 3MLRH 3AU1B 5HHMB 3U7YL 1WBZA 2F53B 3KPRE 2NR6D 5CBAA 2CO7B 5F7YC 1KYOK 4W6XB 3FONA 5KVEL 1DN0A 5IW3A 1NCNA 1VENA 4APQD 3M17B 3V6FB 5SV4A 1T66C 3BN9C 5E2TL 3CCHB 3BP5B 1JTOA 1P4BL 4JFFA 4PTUB 2AQ2A 5MEPB 5D9SB 4LLQA 1D5BA 1QFWI 1AO7D 4XI5D 1CGSH 5BV7L 2XZQH 3HC0B 3MRMB 1AR1C 1CLOL 1PLGL 1JPGB 3G08A 5ELIA 2WP3T 4LPVA 4WFHE 4Q6IB 5GRVL 2Y7QB 5GSRA 2D03H 4PYGA 4X6BB 3RWIA 1JYXA 2VDLH 35C8L 4KTYA 4L29B 1H0DB 4LEXH 4HWEH 1HHIB 3NH7L 4NNPH 1D5IL 1YPZB 1Z5LB 3FZUD 2FZ3A 2YPLD 1FSKC 4WUUE 5DJDB 1MLCB 1ZLSL 3KYKL 2K9UA 3LV3A 5D1XC 1P84K 2DJSA 1JP5A 1CLYH 2NXYB 4PJDF 5E2UL 3RDTB 4GUPB 3V4UH 5DJXA 4MWFB 3I6LD 2UWEA 3E2HC 3GMPB 4D0BB 4YLQT 4GQ9L 5F72S 1N4XH 3LIZL 3OPZL 1MUJA 1RK0A 4G8IB 6CGTA 5CINH 3V6OC 4HC1A 4MQSB 4HUWB 3IRZA 3RKDD 2UVEA 4C57C 4XXCC 1ES0B 4XAKE 2A6IA 1N7ML 5GRVK 3RNKB 4LDLB 2BSED 2OR7A 2YR3A 3G04A 5IT2L 2FSEA 1SY6L 2Z31D 4POYA 1L7TH 5FYKE 1QFWM 1M1SA 3T8XA 2DBJA 4GLRH 1G9MH 3V4PL 3JZ7A 5KZCB 1R5WA 4EDXB 4F9PA 5D7JD 4PJFF 4I0KA 3FQUA 4ZOAA 5C92A 3RWGB 3MC0A 3CVHL 3EO0A 4RRPA 4PBXA 3CFKB 4PUBL 3ECBB 1U8MA 4PLNC 1F4XH 3VD9A 1UENA 1BBDL 1HSAB 5DEFA 5A2IH 3GGWA 1TQCC 2W07A 2DQEL 5B39G 5BVPH 5L7XH 3NA4A 3OJ2C 4MQ7A 3K4ZA 2LTQB 4M1CC 1NLBH 4GW1B 3D87B 4PGDB 3PGFH 3O4LD 4KAQH 4PJ9C 5SWZE 3W39A 4D3CL 2FEEL 1I3UA 2ADFL 4U1HA 1OLZA 2BNQD 4JRYB 4EI6B 4L8CB 4G8EA 1MSPA 2RIKA 2Z8VC 5E8NB 4YFLF 3MODH 1RV6X 1TVDA 4OLWH 1RZ8A 4NOBA 5FHAH 4PBWD 3EDJA 4HFWB 5HYQB 5DSCB 1GZPB 4PRAA 2DQFA 5B8CB 4GMTH 2J1KA 5I8KH 4PB9H 1NLDL 3VXNB 4EUPA 3A6BL 4KROC 5DQ9B 3RWEA 4X98A 4OUOA 3DXAD 4Z0BL 2FBJL 5J13B 3OMZA 2XKNB 4F7EB 3WO4B 1RUAH 3JTSA 2NY4B 2XTJC 4FMKA 3QJFB 2OQJB 3MREB 2Q20A 3NVQA 4P0DA 2IH3B 1NMBH 3ARBD 2PR4H 5IROC 2GI7A 4Y2DA 2A6JB 1YY8A 1HXMA 1KCRH 2DAVA 1UWXK 2AEQL 5FYKL 1PGRB 4OM0L 5TE4H 4GRLD 1UT9A 4RNRA 5I1JH 3FT3A 1JZ2A 1UH2A 2WANA 1U8LB 2X1PA 1IGTB 4X99A 4X4YA 1X5FA 1RHFA 5C8JA 5HSFA 3T3ME 4MA1B 1UXWB 4ZOCA 1MRCL 4NZUH 3WEXA 5HBBA 1NBZA 4LVOC 1M71B 3IJYA 3RZCA 5GGVY 2R4SL 3N9GH 5DLML 1MQKH 1WZMA 4ELMF 3DMMC 3WJLA 5JHLL 4FXKB 4OCWH 3MLPA 5BQ7B 5C0IB 5D72L 2BFVL 3PWPA 1KNOA 1XGTA 5GRJH 4ERSL 3BSZL 1I1FB 3OGOE 4POUB 3VGHA 3HB3C 4UQ2A 1VGKA 3BIKA 5HVHB 5HPMB 1D9KA 1AO7E 1BQHA 4PRBB 2NY0D 1R3KB 3H7BA 3HMWH 2VR4A 4HIIA 1LDPL 2NX5B 1JV5B 3OKKA 1I1AB 4YHLH 2CJUL 1JNHA 3P11H 4TSAH 4U1LB 5DUMH 2P4AB 1OTSD 1CLCA 4Z0XB 1T1XB 3KPRB 3BRGC 4R0LA 3SDDD 1UJ3C 5T1KD 3EO9H 4NQCB 4MNGB 5IMKA 1UWEH 1AR2A 5FB8A 2YK1L 2R1WA 4U6HB 2YPLE 1JFQL 5DMKA 1SJVA 4P2YA 3Q5OA 3IKCB 4ZDHB 3RVXC 5DJ8A 1T7YA 3AXLB 3SQBA 2HLAA 3I6LE 4HH9B 4OZFH 1IKFL 5FO9B 5FYLD 1WFNA 2HT4C 1A6TB 4LSSL 5C1MB 2BSRA 5D7IB 4HLZH 1BVLB 5EBLB 4IRSB 1LMKA 2DKMA 3CVIL 1IT9H 5I73B 1NMAL 4IM8A 1FFNA 3N1FC 2WIIA 15C8L 3QUZD 4S1DD 1IQWH 1NBYA 3FCTB 4NKIH 3S5LB 4NNYB 5IHUL 3F5WB 2ILLA 3Q6FB 5MI0B 3WFBH 2CIIB 1HHHA 2M2DA 1NAKL 1NFDF 1T03L 2YUWA 4FABL 3GO1H 4XMKH 5ITFA 1FZJB 2H9GA 5IVXA 1RUML 3L3DB 4X6DF 1T5XA 4NJAH 5HI4D 5MHSD 1INDL 4RWHA 2Y36L 4L8DA 1MPAL 4X9GA 4DKEL 5C0FB 3S4SA 1NAMH 2OSLA 3L5WB 4KPHH 3T0BA 1X5AA 3PHSA 4YHOH 4FNLH 1XGRA 1V7NH 1TZGL 5KJRL 1BZ7A 1EO5A 1QLRA 2AJXL 4O2CA 2ORBH 4DZBA 2R0WH 5IEKA 1H8SA 4UT9L 5IMLB 3S3SA 4OJFL 2O93L 1FNGA 4Y8AA 3WDJA 2WW8A 2BNQE 1M7XA 3CDGA 5KSAA 1S5HA 5EBMA 4ZFZB 1UFUA 2AQ1A 4NBYB 1EFXB 5C9JA 1LK2A 4J3XA 3QXDA 1P7KB 2O5ZH 1X7QB 1HXYB 5MEQB 5I6XC 4QXGH 4JJHA 2EDWA 5IOPB 4ZAKD 1VADB 2HA1A 5DQDH 3U9UB 1CQYA 4F33B 2H3NA 4OF0A 3QG6A 3SDCB 3TC9A 4PLOB 3EO1A 3LN4B 2BVEA 4GO6B 4Q2ZA 3SDXE 5F1KC 3DX9A 5HHXL 3U1SL 2F54D 2R69L 2LAGB 5JZ7D 1HE7A 5IMMB 3DXAE 4KQ4H 5DZNA 1NDMB 3BRFA 4X6CB 4OI7A 3B3IB 4IMKA 3MRFB 3MRDB 5C07A 3GUTB 1KBGH 5F7LB 1CQKA 1F3DH 1MNUH 4XVJL 4B50A 25C8H 4K7PH 5I1CL 3P40A 2ENYA 3DHMA 1CGUA 2FJHA 4JEGB 4M7ZC 2NLJB 4OB5H 2WINA 1A5FH 4XMPL 2ADGA 5IB2B 1N0XL 2BHUA 2EIZB 3FO9B 3RWCB 4WUKH 1RZFL 4YXLL 2XQYG 3D2UB 1XZ0B 3S37L 2ARJB 1A7RH 4GSDH 5GJTL 4Z7UB 3O6MH 4WO4B 3ZL4H 4MSWB 3T0EB 4ZOEA 4F9PC 3TZVD 1K2DA 1VGEH 5EIQA 4S11A 3U4EB 2QADC 3LRHA 2EZ0D 1WWAX 5I2IA 4TVPD 3LRGA 3HN3A 4WFED 1I1YA 1PG7X 3KPLB 3BPLC 2NW2B 4HSQA 1IAIH 3Q5YA 2PTUA 3QIBB 2X89D 4OZFA 5HGAB 4L3ED 4O51A 2EIEA 2BCKB 1SJXA 4M5YL 2V2TA 5EUOB 4MNQD 1AKJD 1QOKA 2G9HA 2A9MH 2XQBL 4YHNB 3WLWC 1RFDH 4Q9RL 2AV7A 1JVKA 3O6FD 3FJTA 3VFUB 4YNYB 3JTTB 3X3FH 4IOFC 3OB8A 1YPZF 2BVTA 4YXKH 2Q86B 3TBWB 3O2DL 4Z76B 4WIQA 1LP9E 4ONFH 3ARDC 4HJJL 3BE1L 3FRPG 4AT6B 4RSVA 5F7NC 4OZGE 4QRRD 4E41E 5DJ6B 4ZFFB 5HD8C 4UT6H 4U1KA 1OGAD 4JPIA 4LLDA 4QF1A 4KVCL 3C08H 4H8WH 1NAMA 3BPNC 1NPUA 3P4MA 4P9MH 2R4RH 3VXUB 5IKCB 5L6YH 4PV9B 1U8QA 2MQ0A 4L4VE 4X4MA 3S36X 5FYLE 1JTTA 1BQLL 2ITCB 2WBJA 5EO0B 1FJ1B 3TNNB 4ZXBD 5JIIA 2KH2B 2VN7A 5M7QA 4K2UH 5HJ3A 1K6QH 5GQBA 2BOCA 6FABL 4NKDA 1UB6B 5IW6A 4MNHB 3RU8L 2B1AH 4HWNA 1WZ1L 2XZCL 1Q8MA 5L88L 3EHBC 4LLWB 1BBJA 1XEDA 1YDPB 1NFKA 4NO3B 4BQ9A 4D8PB 1UC6A 3DRQA 4HK0A 2DQJH 3UBXI 1JN6B 2DMCA 1NUNB 4RFEA 5HI3C 5MHSE 4AIXA 1F00I 5JR1L 3RZCC 2J8UB 1IL1B 2R2HB 3OKLA 4XZUA 1Q38A 3PHQB 4D9RD 1G7PB 3WKMH 1OPGH 3ROLB 4ORGA 4PLKC 1KXVC 4Y16A 3IAGC 5I8CA 2ZZUT 1WSST 4LF3A 3V79C 4IMLA 1AGCA 4F8QA 2C4FT 5HDQH 2DLGA 3VXRA 4XVSL 1ORSB 3V5KA 4GAYA 1YNTA 5DFWH 1MI5D 3MLSL 1D9KC 1X5KA 5D7JB 3QCTL 3R0NA 3IVKA 1V7ML 4OD1H 4KVNH 1IFHH 2DYPB 3SKMB 3HI5L 1QRNA 3EFDH 4NQUA 1S7QB 4OIIL 2IEPA 1G9MC 4FFVC 1MFNA 5DRWB 4HPOH 2QQNH 2NYYC 1A14L 1ZT1A 5ACZA 1G7IB 5ISZB 1B4RA 3FO0H 4ACPA 4AEIL 3CFEB 4M7LT 4WFGD 3MRQB 5I30L 5T1LD 2F54E 5FYLL 1FO0H 3QFJB 4Y2OA 1Y0LA 1FFOB 3O4LB 2MWCA 2ADIA 1KIUA 5GXBB 4GG6A 4BSWB 5CJQH 3WXWL 2R0LL 1T5WA 2W9DL 4K3DL 5ANMA 4YPGA 3QBTB 1FP5A 2FX8H 3BAEH 3NMEA 1RVFL 4H25A 4I9WD 2VZSA 4CNIA 3VFOA 5T33L 4LSUH 1T04B 4K9EH 4Q6YA 3C5ZD 4DEPB 1CDYA 3UTSA 4P2RD 3CFCL 5LAXA 5DMIL 2YPVL 3EYOB 3UJTL 5BVJB 5I15H 3WDHA 5LXGL 1CK0H 2E9IA 3CDCA 2Y07H 4G8GB 4IEFB 5BCAA 2YA2A 3KG5A 5HHOA 4PJ7A 3PABB 5JOPD 3U7WH 5HHNA 1A7PL 1DBBH 3FTGA 3UXFA 5HGGS 2YWYA 4TVPE 1AHWA 1ED3A 4B0MM 4WFEE 5ESQB 1ZT7A 3TFKC 1JWSA 3GHBH 4ELKB 4KTEL 1GVIA 2HVJB 1N5YH 1W0VB 5ENWB 3O3UN 3IETA 1F6AA 1ZA6B 3ARBB 4OCNC 5DS8A 3UZVB 4MX7B 3LEVL 4RBPH 4HS6A 2GK2A 4BQCA 2PTTB 5LGKA 1JNLH 4HIJA 4L3EE 5H2BA 3SDYH 4O9HH 1E4KC 4LPWA 1KC5L 2DWEA 5KSBE 1GL4B 3VWJD 4PRIA 3AREC 4KJWC 2GSGA 2R15A 3L3OA 2EDFA 5KSAC 4XH2B 2O61A 1T7XA 2NY1D 1X6NA 4NWTL 1F90L 1RUQL 3FFCB 1A3RH 7FABH 3FQXA 3TBVB 1S5IH 1HNFA 4FQ1H 1JGLL 4QRRE 2WBKA 4LBEA 2JCCA 3GI8L 4XPTL 4ZTPL 5F89B 5E00A 4OKVB 3V6ZA 1NH6A 1U3JA 3F7YB 1OGAE 1IM9A 4I1NB 5DD5L 4JG1L 4IOIA 4F7TA 4M7JL 4IMKC 3T1FA 3UJJH 3WN5B 3OR7A 4LLUB 4FQIH 4ISVB 2A6DB 2VMFA 4HCRH 1DE4B 2HH0H 5D5MB 1LP9B 2QQQA 3EDDA 3SY0B 4BSJA 1FYHB 4LFHD 2JE8A 1DTUA 3MRGB 2XN9B 4IRZL 2BERA 3O45B 1T2QH 2Q7YA 4W70A 1BECA 1CGXA 2VYRE 1J12A 5J7CC 4YDIL 3C87A 4TVPL 4PD4K 4OF6A 1DBKL 3PQYA 4NYLB 5FFLA 5KVFH 4HS3A 3OKMB 3UROR 1WBYA 2GITB 4RFOH 3JV6A 1YN7A 2OJEB 4RGOH 3Q3GA 3R1GH 2W38A 4XPAH 4OM1L 1FO0A 3NCMA 2AV1A 2E8ZA 3EJZC 3FO1B 4JKLA 4F7MA 2DLIA 2DQHH 3ES6B 4POZD 3FT4B 1I7ZB 1TQBB 5D93C 5I75C 1HH9B 1LO5B 5GGTH 1FZKB 1DL7L 4RMVA 4GAFB 3W9EA 5J0BA 5CGYD 4OD2A 4GBXD 2I9TA 2CK0H 1MI5E 3QG7H 3EOBB 1ZVSA 1RAMA 2FX9H 3QCVL 2SEBB 4LARL 3B5HA 1YA5A 5F1OB 4NDMB 5DD0H 2FYYB 4Y5XA 3TH2T 1WWCA 1JWUB 3PGDA 3VD3A 4K8RL 1MFBH 2ICES 5E6IC 3FO2A 1P7QA 3P4NB 4AENA 2FL5B 3VXSD 3O2VL 1BFVH 4FN0A 4WFGE 3ORJA 5AWNH 3WS6C 3QNXA 3V7AE 2Q8AL 3MRBA 5KAQG 3LEXA 1FAIL 1A7QH 3BQUD 4JO4H 4MCYA 3HUJA 5KSUA 3NFSL 4U33A 1QSEB 4WU5B 3HZVB 1PBYA 4Z7UF 2QHLA 2Z35B 4DKAA 3IKKA 2WBJC 4JQIH 5HGHB 4YEEA 2PW2B 1WWBX 2HMIC 5DQJB 4CL7A 2DQIL 1CZ8L 4I9WE 4M1GL 2D7TH 4QRPA 5DVOA 3QAZC 4WW2B 4LLVA 2MCG1 1Q9KB 1P7HL 5J3HC 3NABH 2E6JA 4HWZA 1W2KT 3NZHL 2F54B 4HXBH 4P9HH 5JPNA 3QDGD 4NZTH 2IALA 1GGUA 4KC3B 2MTPA 4M43H 3GDBA 3U6RB 2OJZL 1J7VR 4N0FA 2XNAA 4Z7WA 4UDTB 5E8EB 2X2YA 4K94L 5EUOF 2MFNA 3T0AA 3O9WD 5D7KE 4ZS6C 3RX5A 2ED8A 3CC5B 1MLBB 4ODSL 4AG4L 4KZEH 2ESVA 3LN5A 3QI9B 3T3MF 3DX6B 2O5YL 3CSGA 4ENED 1U3HB 5GGRB 4HIXH 3LD8C 5GS2H 3BOVA 3BP4B 4OKDA 4E5XB 3BP6B 4OV5A 1R3JA 1Q72L 4HCRA 1JYVA 3PXHA 3TBYB 2MQCA 2CLRB 3ZDZE 4KK8C 4LP4A 3PJSB 4TUKH 3AROA 1J11A 2EE2A 4G9DB 4HX1B 3DUUA 4PRDA 4KI5D 4U6VH 5D71L 4PJCA 1DLHA 1KN2L 1MWAB 3HMXH 2EEAA 4P2CG 5JDSA 4FFYH 3QDMA 3BW9B 3KDMA 5EH1A 3GRWL 4MCZA 5ICYA 3STZA 4NZRL 1L0QA 4BUHA 4F57L 4I77L 4MNQB 5DFVD 2P5ED 4Y4KA 1H8NA 3G5YA 2ICEA 3TGXA 1C08A 1GGCH 3RAJH 3ULUF 4U1GB 1RULH 4JB9L 1S7UA 2EC9U 2P45B 4S0TD 3HNSL 4UBDC 5GGTA 1GJIA 3GI9L 3MRRA 1N64L 3D0VB 4WI2A 3MZTA 4G43B 1G7LB 1Z9MA 1E6JH 4MS8C 3IJHB 4KKAD 2B2XH 2BP3A 1S3KH 4P59L 2GY5A 5J6GB 2J8UF 1QACA 4BZ1H 1DUZA 1N0LA 2DF3A 1A4KA 4X5WA 1KJ3H 3P0VL 4HKJA 1E27A 2YD1A 1FZMB 4LHUA 5CUSL 4LKCA 2X7LA 3CPLA 2Z8WC 2CDGB 2R1YB 4OLEA 4UIMA 1AHWC 4Y4HD 1J10A 3I9GL 4UOW0 4YUEH 3QUXD 3DO3A 3X13B 2GAZA 4U1SA 4FTVB 4LLMA 4LPXA 1WT5A 3WYRA 1RIVL 5T5NF 1A9EB 4G42A 4JY5L 4Y19B 1OB1B 2FRGP 1QA9B 2R2EA 3RY5A 2OP4H 2YXMA 2EYSB 3OAYK 5K9JH 2A0LC 2NY3C 3MLXL 2EXWD 5IV2B 3FOLB 4LQ1A 3L6FA 4EQ3A 5KN5B 1CDJA 1ZWIA 5DJCA 3CGTA 4M7KH 4UOJA 1SYSB 4HV8A 1MCEA 2AJUL 1E6OL 4N0UE 1S9YB 1E4WH 3OB0H 5FGRA 3RPIA 3X11B 4YK4C 4G3YH 4PGCB 4J4PA 5GGRY 4KH2A 2E3VA 4HZLA 4I13B 1N8ZB 5CEZH 4GRWE 3VGBA 2F19L 2VNCA 3FAWA 4HPYH 4J12A 4KZDL 1KB5H 2X4NB 5CP3H 4PLJC 1VEMA 5F7WC 2EYRA 2GEEA 5T3ZD 1M7DB 2VXSL 2GJ6A 2R0KH 2HTLC 4DN3H 1PSKL 4TOYH 5EO9B 2BSTA 1WIPA 4WY7L 3IT8D 4RMWA 2V5TA 3SKJL 5IFAH 2RB8A 1HWHB 3MLVH 5T1MB 3W5NA 4NZJA 4WI3A 1WAAA 1LNUA 5JORA 2MHAB 4ZTOL 4MD5B 1SEBB 3BZEB 3G5ZA 1S8DA 1IQDB 3DSFL 1REIA 4P23C 2EDJA 4RIRB 1KOAA 2ZOLB 5T1LB 4OGYH 5GGVL 3QDGE 3SQOL 3KXFD 3D25B 2V7NB 2HWZH 3MV8B 3HMXA 4KRPB 3EJJX 43C9B 3AS0A 1BX2B 1AGEB 1V05A 1U36A 3BD3A 3IFPA 1OCWL 4LLYA 3UAJD 3PL6B 3WFEH 2UVFA 3TVMA 4A6YH 1CD1A 2QSTA 3RVVC 4DGIH 4N1HB 5AG9A 3QZWA 5CZVH 4Q74A 2E8YA 4MJ5A 4ZYKB 3C5ZB 3TJEL 5DEGA 2XRAL 2ZCHL 4U6YA 2CKBL 4P2RB 1HHKA 3RWDA 3EOAA 2AEWA 3SHSA 4CRPA 4HJGB 5TF0A 3UMTA 3WL9A 4Z7VA 4YDKL 5E99H 3BDBA 3PDGA 4LOUC 4O5LH 1EHXA 4DKFL 1LEGB 2WWMD 2Z93B 1P69B 5JNYB 3RL1B 1C7TA 3ILPB 3WNOA 1ITBB 3IGAA 1FC1A 1DBJH 5K9QG 1F2XK 4KI5E 4LCYA 1OP3H 2Y9RT 4KMTH 2W60B 3IDGA 4UAOB 3F7VA 4KKLC 5DUBA 4HKXA 5FDWB 3Q1SH 3QEQA 4FQJL 2CR6A 4TPRH 3HG1A 3VFSB 2VABB 1HINL 2VB5A 5E9DB 5FYJH 1EUTA 2MCPL 4NKMA 1MOEA 5F96L 1GZQB 2VXTL 4RGMC 3V0VB 3EJYC 4XHJC 2DTMH 4RZCA 3DIFB 4XPBH 2X4QB 2WWKO 2P5EE 3WUZA 2ARJQ 5D5MF 1LP9F 3O6KL 2BVOA 1JHTB 2RCSL 1XMWA 1DQJA 3PG2A 4U6XB 3TBTA 1XGYL 2L7UA 4OZGF 1KIRB 1F42A 3BIAX 3B2UD 1BAFH 1E4XH 1KJ2H 3UTQB 5I9QB 4NBXB 3AB0B 3MFFB 5J11C 3T3PE 3LH2L 3T0XA 3KYOA 3AVEA 1CR9H 4OQTH 4NWUH 1BM3L 4YGVB 3E6FB 1OTTD 1VPOL 5A2JH 3ARZA 4KKCC 4K3JH 1ZGLP 1INQA 1YYLH 2BXZA 4W4NA 4KKBC 3BZ4A 3LKRB 1HKFA 4ZQKB 2N7AA 4PTTB 5C08A 3LEYL 3WBDA 2XIDA 5MP6H 1KB5A 4X9FA 5CP3A 1B4JL 2XICA 1BD2A 3FB8A 1U95A 4MB5A 3TPUB 5ERWB 4YHPB 2VC2H 3B8SA 4YWGH 5ICZB 5H35A 4JREB 2X4RB 5TQ0H 3L3KA 4NT6A 5EU6B 5D4QA 5T3XH 3WCYA 2R23B 4RMQA 2IBZX 1F8TL 5MEOA 2IAMA 1MREH 3CUPA 2XFXA 4PJHA 4XTRC 5IIEA 4MLIA 1RZKH 2Q7NA 3BKJL 3GBLA 4P46A 3VE0B 3VMPA 3MV9D 3GSWA 1IC5L 1QSFA 4JFOA 4ODUA 4H20H 4RWYL 1MVFA 3GMMB 4LLQB 1D5BB 4C4KO 2EEDA 3CH1A 2AEPH 4O58H 4LQFH 3MNWB 3PV6A 4PP1D 3DETC 4ONHB 4RA3A 2JB6A 1T1WB 2JF1A 5DZOA 3U36A 5D2LA 4N8CL 5D8JH 4CDHA 4D0CA 3RVUD 4Y4KC 4JRXB 3RRQA 2R56L 4A6YA 5T3ZE 3K8KA 1A2YA 1FZOB 4LDOB 4KK6D 4LPTA 5D2NA 3U7AA 1JHKH 1AJ7H 5FUCE 1HSBA 3KWWA 4P3DB 4GBXB 3EYFA 2XT1B 4WW2F 2QEJA 4JFZL 2CRMA 2UY6A 1S7RB 5IG7B 2ERJC 1N2RA 1YEGH 1O0VA 3I3DA 4JM2C 5CLTA 1L0XA 3EYSL 2UWEB 3KYAA 1BVKB 2VLRD 2MOVA 4MDIA 4XNYH 1JF6A 4UTAH 4JN1L 1HCVA 4QTIH 5IGXL 5FOBA 1RK0B 4PJGA 3VXSB 3L5XL 3GB7A 2PN5A 3C2SA 3SDAA 3BVNA 4HXAL 4Y5VA 3MR9A 1B9ZA 4OCRL 1AY1L 4X6EA 4NNXB 4GKSA 3TO2A 5DEZA 5EU3B 2A6IB 2BSSB 5CSZB 2YOCA 5D7SH 1IAOA 4NFCA 4N0CD 1QRKA 2DQCH 4I18A 2YC1A 1Z3GL 4EOWL 1UKSA 3KJ4C 3Q6GL 4XCCH 5HGDA 3S35H 5BXFA 2Y5TA 1MCPH 1MIML 2HFEA 3CFJA 5EWIH 1R5VA 1DQQA 4MVBD 5JW5B 3THML 4CW1A 5EOCJ 1F4WH 4ODWB 4W4OC 4HK3N 1WBXA 5ICXA 4P4KA 5T5FL 12E8H 1FVDA 1JRHI 5DEFB 3PWLB 4I0CC 5JA8B 3GGWB 3ARWA 4NO2A 5IR1B 4NQTA 3D5OF 1YMHB 4OQTA 4JN2A 4MQ7B 4WDIA 1KCKA 5F7DA 3WUWB 5F7UA 4M00A 2E9WA 1BGXH 3MUHL 3O6LL 1I9RL 5KSBF 2H8PA 4HQQL 4J4PC 2PO6C 1EEZB 3HC4H 4WWKA 3E8UH 5T3ZL 4LSQH 3H9SD 4JKMA 1C16A 1QKZL 2AJYH 1J0ZA 4FZEH 4PJDA 1MJUH 4A2MA 4EN3D 1Q0XH 4PJXE 2CXKA 2G2RB 5BS0B 3C09C 4Z95H 3MRCB 4IIQA 4CKVX 4S1RL 1MFAL 2C9AA 1P1ZA 5AUMB 2AGJL 4PG9A 5F9JB 1X5JA 3ARVA 3BPNB 2XKUA 3MGOB 5C71A 1F58L 1GYAA 4KI1A 4URTB 3DNKA 3QEUA 1P84J 3MOAL 4DZ8A 1RJYB 1W8OA 4NQDB 2AJVH 2OK0L 2O5XH 2Q87A 2D4FA 4JHAL 5HYEA 2VJXA 4XGZA 1T1YB 3GSOA 5AZ2H 2YBRB 1ZGLB 1D5XB 4Y2DB 3HCVA 1YY8B 3G6AB 5FF6A 4PJFA 4KK5C 3MCLL 3QHZH 1ZSDB 5C0CA 2ED9A 5F7KC 3TA3D 4X99B 3MCKA 1U8JB 2IJ0C 3CJJA 5EOQH 5C8JB 4PYHA 1YEFL 4PJIE 4R26L 4UNUA 1QBLH 3F58H 2IG2L 3GJFH 4GS7C 3VXMD 2AJZB 1NBZB 2ATKB 4JY6A 3VW3L 2BRRL 3BGMB 1CIDA 3R06A 2P5WE 4DKDC 4JDZA 4KRLB 2Z91A 1TETH 1K3ZA 1X6LA 1T21A 3QQ9D 4YC2B 2V17L 1IEBA 4U7MA 4TTDC 4G6KL 5SX4H 1J0HA 1H3PH 1UH3A 3OKNB 1FVEB 4LSPH 4OLVH 5F88A 5JW4Q 3PWPB 4DUXA 1GH7A 1AE6L 4LP5A 1CLZL 3MV9E 5CCKH 4PB0L 2UUDK 1Q9LB 4FQXA 1S7VB 4ZPVA 1VGKB 3QUXB 1II4E 5HDLA 1A0QL 2DQUH 4IS6B 5C2BH 5DJZA 4LCCB 4FQCL 5C0RH 5JOEA 1J1OH 3OKKB 5F6IC 1JNHB 2FWOB 2IBZY 4LLAA 4LGRB 3VA6A 4F80A 1LO2L 5C0DA 2P44B 4LSRH 4R0LB 1TZIA 4KMQA 2DQTL 3AS2A 3RIFF 1ZKAA 1QFWL 3FKUS 1QBBA 1A64A 3WS3B 4JFQA 1BFOB 1CICA 5D70H 2Y6SC 3C2AH 3EW3B 1ZHBA 5I1EL 3NOIA 5DJ8B 2HFGH 3VMNA 2HLAB 3MSPA 3QUMH 1HYSD 1BWWA 2VLRE 1ZHNB 2H1PL 1JGUL 4MA3B 1J5OH 2ZCKH 1A3LH 2CDFA 4LRNL 5TE6H 2OTWB 8FABB 4U7SA 3GMNA 2XKSA 5EU4B 2A73A 4NQVB 3AAZA 3HS0A 4TSCH 1N59B 3TYGL 3BDXA 2JJSA 3EBAA 1NBYB 3CXHK 3RA7H 4ELMA 1HHHB 3EDEA 2NY7H 3ELAT 1YMMB 5HVFB 4XNUH 5ITFB 3ILQC 2ATPA 4X5XB 5D96C 3TT1H 3IU3A 3LDBB 2VDPH 1FCCA 5CILH 1GSMA 5SWSD 4LASH 1CTNA 2VL5B 4Y88A 3GNMH 1XIWA 4L8DB 3S4SB 1INEH 1CS6A 1S7XB 3OAZH 5INDB 1VACA 2V7HB 2FEDD 3KXFB 2XA8L 4FG6D 1S9KC 5KTEH 1HILB 1B3JA 1IBGH 1PG7L 3L9RB 1UCBH 4UIKH 1NANI 3H8NA 3E3QE 3BDYH 1EHLH 3O3EA 3WO3B 4X7SL 3HNTL 1S5HB 4XWGH 5EBMB 1IGCL 2PCPA 2EYTA 5C9JB 1LK2B 4P5TD 1O7VA 1SBBA 5MEND 3ZDZF 1CF8L 1CXEA 3H9SE 3DSNA 4UQ3A 4QOKA 4JHBA 4TSBL 5DURD 3SBWA 5ECJE 3TESA 5DVMA 2ZUQB 1YY9C 2HVKB 3QXVA 4CDGC 1G7MA 3BN9D 3GJFA 4ZPTA 5D2NC 1WCBB 2I07A 3N1MC 1KT2B 4G6JH 1GC1L 1RURL 4L8BA 3DX9B 5J6HA 3G5VB 1RU9H 1FGVL 1NCCH 3ESVF 3Q0HA 1TCMA 2CQVA 1AR1D 4H1LH 2DLEA 5A43C 1OARH 2PYFB 3GSNB 3BT2H 1FIGH 5JQHC 5HYSB 2WINB 2VAJA 3GSVA 2ADGB 2FEEI 3CSBA 4OD3L 3KPNA 1NFDA 4J6RH 2F8XC 5C6TL 1YEHH 4FP8L 3SDAC 3RL2A 4YQXL 1X44A 4L4TE 1KG0B 4Y5VC 4OF7A 3ARGB 3OKDA 1ULVA 4X6DA 1T3FB 1MJ8L 4XP9L 4F15C 5D1XD 1K4DB 1UWGL 4EJ1C 4JKPH 5BMFL 4IDLA 1QHPA 1JPSL 3UO1L 3QHFH 1BEYL 4F3FB 2IH1A 1UB5B 4YHIA 3VXME 4M8QA 3OGCB 1JWMA 3L7FB 3HAEG 1U8OA 4ZS7L 3DUSA 4OGXL 4X0KA 1VEPA 2F74A 4K7PX 4ALAL 1GXEA 3G5XB 2VXVH 1FYTD 4YE4L 3SE8H 4DCQA 1C5CL 3PWNB 4WTZA 5GSVA 1JPTH 3QUMA 4O51B 1CDCA 4K23L 2NXZC 2V2TB 3O11B 2IF7A 3LSOA 1AP2A 3SGEI 4WI7A 4R4NC 1WICA 5IJKA 1DBMH 4JFPB 4PJIB 2E9BA 5I1GL 3HHRB 1KCSH 5DWUL 3AMLA 4LKXA 5EORL 2FGZA 4AL8H 3K0WA 1EVUA 4FFWC 2YPKA 1DQLL 1IZKA 5K9OB 4JFDB 5IF0A 4PRPD 2GT9A 5HDBF 3KLAA 1FN4B 4M1CD 3MNZB 5SX5K 1LO4H 5DK3A 3MO1A 1YN6B 4WU7A 1C12A 2R2BA 2Z92A 3PP3K 2ZSWA 4JPIB 4WTZG 4BFIA 2X1XR 3U82B 3KPMA 4IIQC 4GRWF 5E56A 2CUMA 3MBXL 5EZIH 1U8QB 4BYHA 1PKOA 4X4XA 1ADQL 1RZKC 3EYVA 4PS4H 4KQ3L 3DRTA 3S34L 3SGJC 1MCSA 1PZ5A 5HJ3B 3AU1A 1UA6L 2F53A 3RWJB 4MJID 5KVEH 5BJTB 4NKDB 5L2KD 3O8XC 1A6VL 1KB9J 2DN7A 3DGGA 1WQVT 1NEZB 1P4BH 2QHRL 4M4PA 4DVBA 1BBJB 3CCHA 4OLUL 4RGNC 2XTJD 1RIHH 3DRQB 1P5UA 1TVHB 4PTUA 2B4CL 5BV7H 5D9SA 2IGFL 1MHPL 1AXTH 1OWRM 1U8KB 1CLOH 1PLGH 3VGGA 5SWSE 3MRMA 1H3UA 1JPGA 3OKLB 4XZUB 4Q6IA 35C8H 3VXTB 4G9FB 4Y16B 2Y7QA 3DI3B 3NH7H 5I8CB 4QLRA 4L29A 1H0DA 1EDQA 1HHIA 1S9XA 4IMLB 1YPZA 1TPXB 1Z5LA 1ZLSH 3LD8B 5DJDA 4D94A 4JAMB 1MLCA 2DM7A 5C0EB 5E2UH 3VMOA 3V5KB 4G6AC 4FQXC 4GAYB 3O4OC 1CE1L 4I8DA 3RDTA 3U9PL 4QO1A 2MJWA 3P3YA 3LIZH 2ZUUA 3DMMD 5MENE 1QO3B 2BNRE 4U1MB 1IJ9A 1KCVH 3VH8G 4C83B 4D0DB 3HLAB 3MJGX 4OCSL 5DD3L 1QRNB 4CU8A 2K3TA 5CMAA 4KI5F 3ZO0A 2BMKB 1MCQA 4YHYB 2GTWB 3K80A 4P2QB 3TN0B 5IT2H 4N8VG 1JMZA 3RNKA 5ADOL 3OX8B 1A9BA 3OKOA 3QUKB 4CU7A 3V4PH 1CICC 1A1NB 3G9VA 1JZ3A 1X5HA 3MACL 2ADIB 4EDXA 5EFIA 5A3IC 3QIWD 1KIQB 1T5WB 4PUBH 1MCHA 3U2SA 1I8LA 4AMKL 1RUPH 4L5FL 1EXUB 1U8NA 3CFKA 1BBDH 3H9SB 5GPRA 1G7QB 5TGBA 2HG5A 1HSAA 2DQEH 5K9QI 4CNIB 4OZIE 2B0SL 4OUUB 2DLHA 2WV3A 2FHBA 4QNPE 2IC2A 2ITDA 2AK4E 5LAXB 2VL4A 3RVXD 1CWVA 4M48H 4D3CH 2EDDA 1M4KA 1YEIL 4W81A 4V2BA 3TYFB 4LAQH 5F9WC 1K5NB 4EI6A 4L8CA 4PJ5A 5HHOB 4HKBA 3BH9B 4XP6L 1UWXH 3V6OE 4PJ7B 5E8NA 1DQTA 2H2SC 3OF6D 1WIUA 4MA8L 1TJIL 3QIUD 4GKNA 2B5IC 2QQKL 1JWSB 1Z9LA 4NN5C 1OVZA 2H32H 1F6LL 1FYTE 3IETB 2VKWA 1ZV5A 3F6LA 4WV1B 5HYQA 1NLDH 1GZPA 4HS6B 5DSCA 5B8CA 3A6BH 1ONQA 1ZOXA 1GHFL 5H2BB 3VXNA 4RFNB 2DWEB 2FBJH 2X1WL 3MA9H 5CEXB 2GSGB 3KS0H 1KIPA 2XKNA 4F7EA 4XNZB 4N8PA 1ETZB 2BHZA 4LPCA 4Z78A 2O61B 2VAAB 3RFZC 3D1MC 2H26B 1GOGA 2OQJA 2BC4B 2IH3A 3FQXB 4DVRH 4K7PY 2AEQH 4M62L 4OLXL 5FYKH 4BUGA 4LBEB 4XP1L 4ODVH 2DDQL 2JCCB 1FNEB 5TQ2L 3V6ZB 1I3VA 4M6NL 1EPFA 3CU7A 5EDXA 5E4EB 4OQ1A 1DQML 1U8LA 1MRCH 5TDNB 2H6PA 3DARA 4F7TB 4BZ2L 4PY8J 3OR7B 1QR1B 3HC3L 3OAUL 4HJ0D 5DHVB 3BKYH 4ONGL 3HR5B 3JSSA 3W82A 4LSTL 4KJQC 3AS3A 1MJ7H 3RX8A 4FXKA 5C0IA 5DHYB 4EIGB 4MJIE 5GGSB 1ZEAL 1MFCL 5L2KE 4Z7OF 4M02A 2A74A 4ERSH 4AYFA 3BSZH 3HFML 3EOTH 3C9NA 1OAZH 2D7PA 3QUYA 1ZVHA 4X9BA 5HTSA 3VG9B 3D39D 1HEZB 1I1FA 4R3SB 1FL5A 2XTJE 4CN6A 1FV1A 5F7FA 3MA7B 2OI9B 5HPMA 1OAQL 4GMSH 3IDUA 1LDPH 4PRBA 3Q48A 4OGAC 1R3KA 2NX5A 4UV7L 4R4BB 1EMTL 5I74C 1FO0B 4U1LA 1JNJA 2GTZB 1BOGB 5E5RB 4F7MB 1J1XL 1JGVL 4Z0XA 1PYWA 1T1XA 1U8PB 3KPRA 1JJUA 4WEMB 1TTGA 4P99A 4LVNC 4MNGA 4U1IA 3P9MB 1FFPB 2J8HA 4FMFA 3W9EB 2NMSA 2QADD 5IJKC 5D1ZD 2IQ9H 2Q8BL 1EEUA 1IKFH 4OD2B 3AXLA 3SGDI 4ONOA 1V3LA 3IXAB 4HH9A 2YD5A 2BJMH 1GIGL 5H37H 1A6TA 1PKQB 2VZTA 2KZ1B 3CVIH 2BXYA 3TO4D 5EBLA 1QNZL 5BW7A 4Y5XB 1NC2D 1M6OB 1BF8A 3PGDB 3MBEB 4JM4L 3FCTA 3S5LA 3WLWD 3DOSA 2XY1A 3Q6FA 1B6UA 1NAKH 1T03H 2CIIA 1FC2D 2WSKA 3F7RA 1D7FA 3QNXB 5KANG 3JVGA 2I24N 4OIAA 2H32A 1RUMH 1UGNA 3HUJB 5KSUB 3NIGE 1FZJA 1SBSL 1WTGT 3L3DA 3ARDD 2Y36H 2AABL 4KK9C 4P5TB 3UCRA 4UINL 1HI6A 4U1JB 3ALXA 5C0FA 5JQ6L 4X7CC 4XC3L 1FPTH 5HHVH 1XAUA 5DURB 5KJRH 2N56A 3GK8L 5LBSL 1IZJA 2JIXD 3KJ6L 1NCDL 3NCCB 4M6OH 1MIEL 4FXLA 4UT9H 1IRAY 3S5LG 2C4XA 4NHCL 3T04D 1VA9A 4TNVK 3UZEA 3D3VD 2IALB 1L6ZA 1PX4A 4ZFZA 3V52H 1EFXA 2XNAB 4Z7WB 3RQ3A 1DVFD 3VG0L 1HXYA 1XCTB 5MEQA 5IOPA 1VADA 2K7PA 4Q6IC 2EDNA 1NUGA 4KUZL 3LZFL 4F33A 3EHBD 4PJIF 5CGMA 1S7TB 1CFVL 3LN4A 5IHZB 3U1SH 2R69H 4N0RA 3OTTA 1VEOA 3ZE1E 3R8BB 2Z0BA 3FT2B 1R3JB 4M3JA 5IMMA 3IDNA 3P4LA 5HI3D 1NDMA 4XVJH 3RZCD 3B3IA 4S1QL 3QCUL 2ZNXA 2NXYC 3MRFA 3MRDA 3RDTC 5I1CH 3VFWB 1C1EL 4DGYL 1RHHA 3BZFB 1OF2B 1N0XH 2NLJA 1ZE3C 4PJCB 5JHDD 2EIZA 1IEAB 1DLHB 3D2UA 3D69B 5GJTH 2ZNWA 2MKLC 4JJ5B 5M94B 4Z7UA 5JDSB 1EO8H 5ADPL 4WO4A 3C6LD 4MCZB 4MSWA 1FBIH 3QDHA 1FDLH 3T0EA 2APXA 3W0WB 3INUL 2A9NH 5IFHL 1UJTA 2OR9L 3MRJB 5I19L 3WHXA 2ICEB 3QO0B 3LKNB 3RNQB 3ARTA 3VGAB 3GSQA 2DI9A 5J12C 4FFVD 1I8LC 4O02H 2NYYD 4LRIA 2WWKT 4Q0XL 3PF2A 2EDHA 1W72B 1J05A 3KPLA 2NW2A 1PQZB 1IC4L 4PRPB 1A1MB 4M5YH 5I71B 1DBAL 3B43A 3QIBA 5HGAA 3WIIL 4PG2C 4L8SA 2VIRA 1YEDB 2LTQC 1DUZB 1OHQA 1A4KB 3D39E 3N0PB 4PRNA 4X5WB 4YHNA 1BOYA 3STLB 3QULB 1E27B 4LHJB 4P2OB 4WENB 3GBNL 1NJ9A 4YNYA 3VFUA 1B0GA 3JTTA 2CMRH 4LHUB 3ZDYF 3O2DH 1NL0H 2APBA 3CPLB 2VXQH 2Q86A 3KPPB 3IF1B 2HKFL 4G5ZL 4HJJH 3TBWA 4Z76A 2AW2A 2R0ZL 3BE1H 3IDXH 2DQDL 2GAZB 4AT6A 4LLMB 4AQ1B 3MUY1 1MCBA 1I7TB 2NZIA 5DJ6A 4ZFFA 3DX7B 5B8CC 1MF2L 4G42B 4NRYB 5L2KB 1YEEH 4KVCH 2YD4A 1IKNA 1XH3B 4APQA 2XOTA 2M8XA 2R2EB 2IADB 4GAJH 5JW4N 2N7BA 5J13C 2QSVA 4P57B 2W65A 5C6PB 3TFKD 4OFDA 3WO4C 1BQLH 1ZWIB 2HT2C 4XCYA 2NY4C 5DJCB 5IW1A 2YWZA 3H0TA 1J0KA 2W92A 2G5RA 3MNVB 5EO0A 1FJ1A 1Q9OA 1R3HA 3TNNA 1W8NA 1NFIA 4MXVE 3MMEA 1GRWA 1UB6A 4U2YA 2FECI 2XZCH 2AJSL 3ARED 3PIQA 4KJWD 2XI9A 2X6MA 2YPLA 2EYRB 1U8HB 4NO3A 2NZ9C 4C4KT 4MA1C 1N3NB 4BFEA 2V5RA 5JR1H 4Y5YB 2VZ1A 1JN6A 4M03A 4XBEL 5E7BA 5FO7B 1RZ7H 2J8UA 1IL1A 5CGTA 2R2HA 3TWCL 3P30H 2G75B 3PHQA 1DDHB 1G7PA 1FE8H 4D9QE 3ROLA 2WZPD 2YN5A 3VFTA 4F8TA 1LVEA 2OR8A 4PJ7F 5LGJB 2FH8A 1X3DA 3RPKA 4LSDA 4NGHL 4HC1L 1ORSA 4CADA 3D3VE 3MLSH 4DJMA 4KHXL 5HVHC 4N0YL 4B5EA 1V7MH 1T6WA 5D7JA 4FZ8L 2XXMB 3HI5H 1T20B 3QIWB 1BVZA 3IFPB 4JQXA 1CG9B 32C2A 3EKCA 3MGAA 3SCMB 3TVMB 1S7QA 3QRGH 5DRWA 4MJ5B 1D5MA 5ISZA 3I85A 1RUKL 4R90L 5FYLH 4YBLB 1E28A 3CFEA 3MRQA 3SE4A 3EOAB 3DWTA 4AY0A 3EGSB 3LKSB 3QFJA 3VFMB 1FFOA 1QFUH 3O4LA 3WXWH 2FD6L 2R0LH 2BNQA 4K3DH 3BESR 4QKXB 1EGJA 3EOYG 3EJZD 5T5NG 2HLFC 3MRNA 3ULVD 4LCYB 5JHDE 3QIUB 3HRZA 5HVWA 2RHEA 4IRSC 5BW7C 5T33H 5DUBB 4HKXB 1OAUH 2VWEC 3E0GA 3QEQB 3DYOA 3IB4A 5I73C 2QSQA 3CFCH 1NMCB 3VI4F 4QTHA 5DMIH 2YPVH 1I9IL 3O2DA 4NKMB 5MI0C 4AQOA 1URLA 4LDEB 3SDXA 4YHKL 4NOFA 4PJEE 3JVGC 3DXAA 4G8GA 4ZUVA 2BVOB 4HZAA 1DQJB 3TBTB 4QXTA 1A7PH 2DB8A 3PABA 1RZJH 5TE7L 1NC4B 4M93B 4R97B 3W2DL 2WQ8A 4L3CB 4UI2A 1J0IA 2FATL 5E6ID 3LEVH 3P4OB 3V7MA 5ENWA 3ARBA 4MX7A 4HD9A 3WJJC 3KPQB 2PTTA 3M1BA 4GRLA 2LU3A 5C9KA 1QFPA 3JWDC 4NWTH 2WBJD 5HDOA 4XH2A 4ZUWA 1CGSL 3BZ4B 2HMID 9CGTA 5C08B 3TV3L 3U46B 1XT5A 1KB5B 2W9LA 4UB0H 3NACH 1JGLH 4O4YH 4XPTH 4ZTPH 3CSPA 4LEXL 5J3HD 4HWEL 3SDCC 4NNPL 5F89A 5A1AA 1OP5H 4JG1H 5DR5H 5IVXE 4M7JH 3VFNB 2IAMB 5CD5C 1CLYL 1L0YA 2HRPH 5C0NC 4N1EA 2VQTA 5L0QB 2PXYD 3CUPB 4ZS6D 5IIEB 3LPFA 3ZSSA 2ADJB 5L8JB 2C5DC 5JLZA 4I2XE 2W59A 4P46B 3MRHB 3LQAC 5D5MA 1LP9A 2EXYC 4ODUB 3UX9B 1RJZA 2VLLB 3ZTJH 4D9LL 2E7CA 5HHQA 3S88L 1AGDB 3SY0A 4OZGA 3HUJF 5F44A 1G1YA 1T0PB 3MRGA 3SDDA 2XN9A 5T1KA 4WO4C 3LKPB 3O45A 2FJFB 5DGRA 3U36B 4YDIH 2DQGH 3T0EC 4D0CB 4TVPH 1L7TL 2HFTA 1DBKH 1G9ML 4A6YB 5TF1H 1A2YB 4XX1G 5D1ZB 4NYLA 1KTLA 1LD9B 5ITBL 3OKMA 4G7YL 1F11A 4GFTB 3IAQA 4LRIC 1A22B 3C8HA 5DMYA 4KUCD 3FO1A 4JVPA 1NC2B 2ZUVA 3FT4A 4NO5B 1I7ZA 1I1RA 3QIBC 2FIRT 5L7XL 1HH9A 1XGQA 1F6FB 4XC1H 3A67H 2Y4SA 2Z9TA 1BJ8A 1FZKA 2YUZA 3U30B 4X9IA 4HUUA 2CK2A 4DK3A 3ZE2E 2AXJA 4LARH 1A6AB 2XV6B 3MODL 4QNPF 1C5DB 2G60H 4I18B 2YC1B 4MS8D 4R2GD 2XWBA 3DYMA 3UTSD 3VDAA 2EDQA 1G6RL 1JWUA 4IRJB 4WI5A 5TPWL 5E24E 2Y5TB 3O2VH 4GMTL 2X09A 3CNKA 5I8KL 2HFEB 3FQNA 4BK4A 3VRLE 3VXPB 2JIXB 2FL5A 4CW1B 2Q8AH 2DI7A 1WBXB 1IKNC 1KJ2B 4P4KB 5DK2B 1FAIH 1FVDB 4X7DC 2E6PA 3NFSH 1H9VA 4RX4D 5C2UB 3D3VB 1J8HD 5C0BD 4CVWA 3W81A 1QSEA 4WU5A 1RUAL 1PD6A 4JN2B 1CD8A 5JW4R 5IFJB 2Z35A 4XI5C 3RJDA 3MRLA 5F7DB 3ULVE 3VFVA 2CXGA 1DVFB 1NMBL 4Y1AD 2DQIH 5HGHA 1CZ8H 4DK6A 4M1GH 5GS0C 1NGZA 3ULUC 1U42A 4GW5A 4K3EH 2Y5EA 4WWKB 5TE4L 4WW2A 3V6BR 4AIOA 3S35X 1C16B 4NCC1 1Q9KA 3BKCH 1T0NA 1I1CA 2A0LD 2NY3D 2OLDA 3N85L 3SE3A 4RAHA 1J1PL 2F54A 4PJDB 4C55A 2BDNH 2OJZH 3D85D 4FXGB 2EDLA 1KLUA 4FHBD 3N9GL 4UDTA 4DN4L 5E8EA 1MQKL 4UOW1 1P1ZB 3J8F7 3OR6B 4ODSH 3C8DA 4J3OC 2CPCA 4PG9B 4AG4H 3CC5A 4OCWL 1MLBA 3OL2A 4U7KA 2O5YH 4MJ2A 3S8WA 4TNVF 2VDNH 4ZSOE 3O2WH 3DX6A 4PLJD 1I4FA 3NCJH 4H0HB 4HWUA 1BREA 3SJVB 1Q72H 4L3AA 2HTLD 4LVEA 4E5XA 3LKQB 2FIKA 1CFSA 2ICWA 3TBYA 5INCB 2XQYK 3I3EA 3CDFA 1IGFH 5D7JC 3PJSA 4G9DA 4XNMB 3MCKB 1KN2H 4JQXC 3OXRB 3P11L 4TSAL 5DUML 1CGTA 3QH3A 4XPHL 1T4KB 4JR9H 1HIML 4P23D 3WNLA 1G1CA 3BWUC 5GZND 3AMKA 2Z91B 2B8OT 4CGTA 1QTYT 4NZRH 2X89A 3SE9H 5C09D 3ARPA 3BW9A 4L3EA 2FX7L 5KSVB 3SE4C 1YJDC 1AI1H 4MNQA 1AKJA 4FQHA 1IEBB 1LO3L 4OFYD 5FGSA 5KSBA 4JB9H 2NY6B 3O6FA 2NY2B 2Q1EA 3HNSH 5F88B 4JG0L 5C0AB 3GI9H 2LVEA 1N64H 2WMPA 3RVVD 5DDHB 5DC9B 2HJLB 4DOHE 7CGTA 2H2PC 1S9VB 3D0VA 5J1AB 2R29H 5B3JE 4FS0A 4NPYA 2V5SA 1AQDA 4ZPVB 3KPOB 3OAYH 3BUYA 4P59H 4ZOBA 3IJHA 1IQWL 4RDQG 4DEPC 1LILA 3NFNB 4LOUD 1CGYA 1OGAA 3P0VH 5CEYB 1KEML 3UJIH 4NQEB 4PJ8D 4G6FD 1XCQB 4XMKL 1WAAF 4N9GA 4NJAL 3TCLA 1MCWW 4E9LA 3UPRA 3TBSB 1BFTA 3I9GH 2R1YA 4JFQB 4UU9B 4AIZA 3HZKB 1NAML 1D3CA 2VSDA 5F6HI 1OSPL 1RIVH 3ARBC 4YHML 2IAND 5IJVA 2I60H 3EJYD 4XHJD 4JY5H 4WGWB 4PPTA 1A9EA 5IM7B 1OB1A 2C26A 1QA9A 3HE6B 3GMNB 2ORBL 2P43B 4Z7NE 3DVNA 5ALBL 3S98A 3MLXH 2EYSA 3AAZB 3HS0B 5GS1B 5FKPB 1NBVL 4HGWB 2YA1A 3FOLA 4OCXL 4QYOA 3L3JA 5KN5A 2J7LA 2NTSP 2LV4A 3ARXA 1D6EA 1E6OH 5EG6C 2A77L 4CVZA 4QRPD 3NIDE 5LQBH 3VDBA 3UTSE 1KEGL 1S9YA 2VITA 3WXVL 4YFDB 5KANI 1WGOA 2ATPB 1N8ZA 2F19H 5J9PA 3W5MA 4EVNB 1XIWB 5KOVC 4KHTL 2X4NA 3VI3E 4TNWF 2VXSH 4KKBD 4KQ4L 1VACB 1M7DA 1PSKH 4IBLT 1BPVA 3K7UA 4K7PL 5EO9A 4Q9QH 3SKJH 2HFFB 1UACH 1DEEB 4OB5L 4WUUD 5GRWA 3VCLB 1A5FL 2ESVD 5GRXG 1H5BA 2D3VA 3WD5H 1LWRA 3DVIA 4Y1AE 5T1MA 2VLJB 3ZE1F 3HKFA 2WBWB 4JFED 1OTSC 2MHAA 4GSDL 3VXQB 1SEBA 3O6ML 4PRIE 5DVKA 4HT1L 3BZEA 5B21A 3RZWA 4UQ3B 3SQOH 1F4HA 4YBQD 4RIRA 4XTRD 5T1LA 4PIRF 4L9DA 5CJOL 3D6GA 4DTGL 5LGHL 2V7NA 5ESAB 4XAKD 43C9A 4R7DB 1BX2A 1J18A 1AGEA 4L8BB 2MMXA 1TJHL 5F70A 3WIHL 3BIBX 5J6HB 2J6EL 1TFHA 4L1HA 3PL6A 1KFAH 3JXAA 3DETD 3F65A 3QDMD 2XRAH 2ZCHH 2EDKA 1RZIB 2CKBH 5I1IL 1TQBC 3BISA 4ZYKA 3C5ZA 4BFBD 4P2RA 2YZ1A 4YDKH 3D0LB 1F13A 3S96A 3RL2B 4DKFH 3H3KA 3B5TA 4NRZA 3OKDB 3X3FL 1BZ9A 3I6KA 5F97E 5C86A 3ILPA 4JM2D 4M6MH 4GRWH 4QCIB 2AEIT 5SWZD 2W60A 1HINH 5FDWA 3DROB 4YEFA 4YHIB 1UXSA 2MCPH 4FFZH 2VOTA 2VABA 3C60D 5F96H 4Z7QE 1KPRA 1EA9C 1GGTA 4XVTH 4P3CH 3DUSB 3U0TA 1RZJC 1GZQA 5C09E 1X5GA 5FYKU 3V0VA 1MQ8A 5JW3H 3PQYE 3Q2CA 3C08L 2X4QA 5CJXA 1K4CA 2RCSH 4P9ML 2R4RL 4X83A 1QSZA 3VWJA 5L6YL 3UTTB 4U6XA 3QUMB 3OJVC 5ABDE 3I84A 1KIRA 1Z6JT 3GKZA 4LVNB 3MJ9L 2RFXA 3RGHA 3QWOB 3UTQA 2BY3A 3BFOA 4Q58C 1CFQB 4K2UL 2RJMA 3NTCH 1K6QL 1BM3H 3EFFA 2B1AL 4WW2C 2G5BB 1VPOH 5HI5C 1U2CA 4L9LB 3VRIB 5IF0B 1XGPB 3SE3C 1K3IA 4JCMA 5JZ7C 1M05A 2GT9B 3LB6C 3BEWA 2DQJL 4HMEA 3MO1B 3LEYH 3WHE0 1C12B 2ZJSL 4XPGH 2PXYB 4ZQKA 1B4JH 3KPMB 4J4PD 2PO6D 3WV0A 3WKML 4EI5D 1EV2E 1OPGL 1A6ZB 3PDDA 5JXEA 3TPUA 1QHOA 2IANE 4YHPA 3QI9C 2UV3A 3P2TA 4TVSa 3IDJB 5IBLD 5ICZA 2X4RA 1U3HC 3DRTB 1L7IL 2B7DT 2GJ6D 2FLBT 5EU6A 3VGEA 4MD0A 1PZ5B 2R23A 1OT2A 4ZUTA 1HH6B 3DGGB 2W0LA 3BKJH 5BZWA 4PRHD 4OD1L 4KVNL 5B22A 4DVBB 1IC5H 2DKSA 1H8OA 2OMBA 3VE0A 4RWYH 4QRPE 4XMLH 4X4ZA 3MX0A 3UDWA 4UUJB 5IMOB 3GMMA 4HPOL 2QQNL 4PJBB 5SV3A 1AH1A 3MNWA 4N8CH 4ONHA 1T1WA 2WNGA 4KK5D 2R56H 4H1LB 5EU5B 4JRXA 2GCYA 1FZOA 3C5SB 4D2NA 1U58B 3RUGE 4U1GC 1S9XB 2CKBA 4JFZH 4P3DA 4GBXA 4NCDA 4UILL 2ZUYA 2ESVE 2YKLH 3MJ7B 1S7RA 5CIPB 5IG7A 4X9HA 5K9KB 2FX8L 3EYSH 5HYJD 3I3BA 4R2GB 5IVZA 2D9QB 3JUZA 1HHGB 2YMXH 4JPKL 4JN1H 4JFEE 5IGXH 1A3QA 1BVKA 4NFDA 4TTDD 3CZFB 3QDJB 4HXAH 3VXSA 1G9NH 4OCRH 2ID5A 5CMAB 2Y07L 3P0GB 4NNXA 4GG8B 4BQ8A 3B9KD 1J8HB 2O26U 5EU3A 5C0BB 3RTQD 2BSSA 2FH6A 4JDTH 5CSZA 3U7WL 1YUHB 1Z3GH 3HE7D 4EOWH 1A9BB 3OKOB 1MCCA 3GHBL 3BD4A 1H3XA 2Q6WB 4PJEF 5EFIB 3QDME 3D18B 5J12B 1JNLL 3BHBA 3SDYL 3U2SB 4MAYD 5JW5A 5T5FH 1U8NB 4ODWA 4P4RA 4BSVB 5TGBB 5SWQA 2HG5B 3PWLA 4MJ6A 3QDGA 1T7ZA 1T89A 4O2EA 5FHBL 5IR1A 4MZ2A 2Y6SD 2ITDB 1YMHA 1I9JL 3O0RL 3BEVA 1I9RH 3WUWA 4WRLA 4HQQH 5D1QB 5CAYB 4XNQB 3QEGL 4FQ1L 1SJHB 4PJ5B 5T3ZH 1EEZA 1WCQA 4HKBB 4NIKB 4MMZC 1QKZH 5IEHB 4LCWD 4CMHB 2PETA 4GKNB 4OSUH 4JVWA 4CAGA 4MD4A 4WI9A 4RRPG 1X5IA 1BJMA 1YC7A 3MXVL 3VWKB 1JGEB 3KR3H 3UJJL 4KY1L 4JHWL 4KV5F 1ONQB 5F1NA 1BD2D 4S1RH 1W0WB 2G2RA 5BS0A 5FUOH 5IBUB 3MRCA 4TUOA 5AUMA 3X14A 5F9JA 3MZGB 2HH0L 3MGOA 3MOAH 2KZWA 1KIPB 5HPOA 4Z78B 4XCEB 1F97A 1RJYA 4C56B 4NQDA 4JHAH 1ZLWK 1T2QL 1JYWA 1T1YA 4HIHB 1P4LA 5C09B 1G7JA 1RMFH 2YBRA 4XWOC 1D5XA 1ZGLA 3G6AA 4ETYA 2UUDH 5BV7B 1K8DB 2P5EA 4MQTB 4KRPC 1SEQH 1DEDA 1ZSDA 1TTUA 4NKOB 4E0RB 4JQVA 1U8JA 2BK8A 4EUPG 2XXCB 5KS9E 4HUMB 2H6PB 4MMXC 3PL6C 4HFUH 2BRRH 2J2ZA 4XNXL 3UZQA 3QISA 2DQHL 2AJZA 2ATKA 5E8OA 2KQNA 3BGMA 4N5ED 3OXSA 1PAMA 3VRJA 3C5ZC 1YY9D 2AP2A 2GJ6E 2V17H 1FL3A 2HTKC 1TENA 4QGYA 5GISL 1I8IA 3NPSB 4I0PB 3GSNH 2GUOB 3OKNA 2C3WA 3JUYA 4PJ8B 1FVEA 2A74B 1AE6H 3GIVB 2QQLL 3C9NB 4PRHE 3QUYB 2FX9L 4HW6A 5JPMB 4PB0H 1HDMB 1WV7T 1CN4A 1TLKA 4Y4HA 5DD0L 1FL5B 4UAOC 1Q9LA 3GSRB 1FV1B 1S7VA 1F45A 3QUXA 4FQCH 2IANB 4IS6A 3H42L 4LCCA 1YEJH 3IXTA 3WE6B 2GFBA 5AWNL 2BVPB 3ZHKA 2AXGB 2AJ3A 1LO2H 2I25N 5CJXC 3FRUB 3U4AA 4E41D 2FWOA 1YZZA 1A7QL 1PYWB 3MGTA 2DQTH 3LPGA 3CVHB 5E5MB 1QFWH 2DS4A 4U1IB 4YH6A 3WS3A 5ACLA 5I1EH 1BFOA 4OCYH 5I9QC 5CJ5A 2X41A 5HYJE 1JZ5A 3AB0C 1FORL 5DRZA 2C3VA 4L4VD 1JZ7A 1ZHNA 4MA3A 1QR4A 4Z7VE 1BQHG 3X3GH 3U83A 2OTWA 8FABA 1EUUA 5IWLA 3JWNC 3TYGH 3JWOH 5EU4A 3ULVF 2NXZD 4NQVA 1N59A 4U49A 2APTA 4R4ND 1KPUB 4FQ2L 5TFSH 2E9JA 2CUIA 3FOMA 4OTXL 4P5MB 4WUUB 4LAJH 1BJ1J 3UYOD 2H32B 1SJEB 5JXEC 1YMMA 2DBLH 2X4SB 4FFWD 3PWVA 4UT7L 4X5XA 3LMJH 4KDTA 2XTLA 5IVNA 1WK0A 2VL5A 1A8JH 4JREC 1HI6B 1WJ3A 3MLUH 4CVXA 1S7XA 3EDKA 5INDA 2V7HA 2XA8H 5H94A 5T3XD 2VZOA 3KXFA 1VCAA 2PUQT 5ALCL 1ACZA 1EIBA 1HILA 2NW3B 3T0VA 3BO8B 3L9RA 2VXUL 4U6VL 4X7SH 5A16B 1IGCH 3UC0H 3NA9L 3UDWC 1JMXA 3HMXL 5FOJA 1CF8H 4FFYL 4LCWE 3NAAL 4TSBH 3GMRB 3O8XD 4OI9A 1U6AL 1QVOB 2HVKA 3S4SG 1J86A 1GGCL 3RAJL 1RURH 1WCBA 1R5IB 1BD2E 4GBXC 1KT2A 4RGND 3WFDH 4H26B 4ODTH 3G5VA 4JZNA 4CVUA 3IDNB 1FNSL 4EBQL 3P77B 5SWZB 3IS0X 3X12B 2PYFA 3GSNA 1EK3A 4LVHB 1RHHB 5L9DL 3MYJA 1QZ1A 4DUWA 4OD3H 5CKAA 1IC1A 5HYSA 1B6DA 4X8JA 2CO6B 3WSQH 2VDOL 2VQUA 4YQXH 1Y6NR 1KJ3L 4HAFA 1KB9K 4PJHE 1KG0A 1MJ8H 1LE5A 3ARGA 4XP9H 1T3FA 1I3RA 1UWGH 5I76B 3RHWK 2VLMD 5K59F 3MRPA 2MNUA 4G6AD 4FQXD 1QSFE 1K4DA 5F93C 5BMFH 1UM5L 4NRXB 4NUJA 5FM5O 3LS5L 5D7LD 3WHXB 4YHZH 4F3FA 1FQ9C 1UB5A 1WFUA 3O3BA 3N1QC 4ZS7H 3OGCA 3GSQB 3L7FA 5SX5H 1IVLA 1KXQE 1KLGA 1ND0B 4ALAH 3PP3H 5FO8B 5D2NE 4LEOB 1NGPL 1EEYA 3G5XA 3REVB 1J05B 3F62A 5K9JL 5FGCE 4K23H 3PWNA 2P42B 4PJBF 4L8SB 2VIRB 4MHHI 2AS5M 3NZ8A 3O11A 3ZDXF 4PRNB 3BWAB 3LVEA 5KS9B 1E4WL 1NJ9B 4G3YL 4JFPA 1B0GB 4PJIA 5DWUH 5EC2B 4EI5B 2NTFA 4PJGE 5EORH 1F2QA 5CJBA 4QHKJ 1DQLH 4ZNEE 3SGKA 1AD0B 1WIOA 2YUXA 1P4IH 5K9OA 4JFDA 5FYJE 3K1KC 4XP4L 4NM4H 3NIDF 3BX7C 3KLSA 1JBJA 1FN4A 2NY5C 3MNZA 4DN3L 1OAYL 1YN6A 4IJ3B 3MBXH 4OZFG 4APQB 4GRMB 4K8RD 4Z77B 1CD0A 4ZNCD 2H2SD 4KI5C 4HLZG 1MHHB 2W65B 5I8EB 4NO0D 3S34H 4XCYB 3PDOA 1AO7B 5IW1B 3ZKXB 4FQQA 1OP9A 1UG9A 3H0TB 4ZUSA 3OB0K 1MCOL 1U3ZA 1S7WA 1UA6H 2QKIA 1Q9OB 1R3HB 2HJKA 1NFIB 4H88L 4Y2DC 4Y4FD 3RWJA 3MMEB 5BJTA 2HWZL 2CGRH 2QHRH 1X5ZA 2DD8L 1ZS8B 3PIQB 1NEZA 5J57B 4JQVC 2YPLB 5C7XL 3WFEL 2IGFH 2VDQH 4LIQH 4XBPB 1I3GL 1TVHA 4JPWL 5HYJB 3WLBA 3QXAB 4KXZI 4QOKD 1U8KA 4U4BA 2D7OA 2J4WH 3FQWA 2OM5A 3O3DB 2X70A 3C5JA 2QSCL 4YC2C 3WJLC 3VXTA 4G9FA 4UMGA 5IQ7L 4J3SA 3QRFM 2FLRT 1CGVA 2BVQA 4KGLA 2A2QT 3ZZ1A 5DHVH 5T3XE 3VFTB 1S78D 3B9KB 3RTQB 2FO4A 5F3BB 4HKZA 4JAMA 5C0EA 4AEHL 4KMTL 3U9PH 1G9NC 4CADB 2Z31B 1QBMH 4QHKI 5DF0A 4KJQD 3QUXC 4BKLB 1QG3A 5FYJL 2W9EL 3CLEL 1QO3A 4U1MA 4LCCC 3KVQA 4KJPD 1GGBL 4C83A 4PJFE 4D0DA 2C1OA 1HKLH 2DTML 32C2B 3HLAA 4MAYB 4XPBL 4I48A 1I7UB 4R96B 5C0CE 2BZDA 5JTWA 2BMKA 1CE6B 4R0LC 4U0QB 1D5MB 2GTWA 4P2QA 3TN0A 1ZA3B 1P6AB 4RGNE 3N50A 4Z7QF 1E28B 2I9LB 3OX8A 3QUKA 4NSKB 1A1NA 2W91A 4OGAD 5EU7C 1RK1B 2BNQB 2WAHA 5I0ZA 4CBPA 3SKOA 5BRZD 1KIQA 1CR9L 4OFKA 2XZZA 3MRNB 1EXUA 3QNYB 1VERA 3HRZB 2YUVA 3H9SA 5IWLC 4K3JL 2B0SH 1G7QA 1R3IH 3CLFH 2DM3A 4M61A 4M5ZL 4OUUA 5EUKA 1YYLL 4KTDL 1WF5A 4QTHB 2BOBA 4EN3A 3HRPA 1MCWM 2VLME 5FUCC 1G0YR 3SDXB 4M3KB 3UTZB 3HI6L 3DXAB 5D7LE 5LCVH 4ZUVB 4RISL 3VXOB 3TYFA 2OL3L 1K5NA 4MA8H 4QXTB 4BA8A 3BH9A 1VKXA 4YWGL 3LDBC 4NM8L 4KDTC 2JELL 3EYUL 3D9AL 5T3XL 1Z9OA 1Q9WB 2VDKL 5D7KD 3CX5K 1F4AA 3GHEL 4GH7B 1GCFA 4WV1A 3OJDA 3B9DA 1GHFH 5DMGD 3FB5B 4WHYH 4HAGA 1JK8B 1RZKL 3M1BB 1HQ4A 5EB9A 4GRLB 4PJAE 2RQ8A 5I16B 1JZ8A 2N4IA 3TA3A 1OD7A 4KK9D 5CEXA 3X17A 1J9CT 4H20L 4ZUWB 2AEPL 1ETZA 2BRQA 3B2VH 4LQFL 1NEUA 3VXMA 2VAAA 5HHMD 2YS4A 4N9OB 2F53D 2H26A 2BC4A 4ZO6A 4M62H 5GRUL 5GZOC 1OD9A 4QRQA 5D8JL 4XP1H 2DDQH 2ZUQC 4NC1C 2A83A 2E7BA 5TQ2H 1UH4A 2A6KB 4ELME 3DI2B 1KCUL 1AJ7L 1FNEA 5IHLB 5HGBA 4XT1C 5DA4A 1DQDH 4PFEA 4TUJB 2WK2A 4BZ2H 5TDNA 3NCFB 4RMRA 4WW1B 4JVUA 3KGRA 3V0WL 1QR1A 5DHVA 4WTWA 1MH5A 4LSTH 3QXUA 4XNYL 2J88L 4NN6B 3HR5A 1AQKH 3RUGF 2P1YA 5JLZB 1ZTXL 4OCMC 2NY0B 2A1WL 1ZEAH 5HHQB 1MFCH 1RJZB 4PREB 1CDUA 4HDIA 5DHYA 3ARGC 2ZWLT 5GGSA 4OZGB 4E41B 3B9AA 5GIRB 5K93A 3O3AA 4HS8L 1SM3L 5HY9A 3SDDB 5T1KB 4JO1L 4PGJA 2EDTA 2NXYD 4X80L 3RDTD 4S1SH 4QHNB 3IFOA 4ORZC 3ZYZA 1HEZA 4R3SA 3B2UC 1YEKH 4PGEB 2DIBA 1IGMH 1OAQH 2IWGA 3F6IA 4XCCL 3MA7A 1F4YH 1KTLB 2Z4QA 1KENL 1F11B 4QOKE 1LEIB 5EPMB 5EWIL 4L4VB 2Q3ZA 1EMTH 4R9HA 1F4WL 1N26A 1HOCB 2FECL 2X4OB 4R4BA 1J1XH