1NLUA

Pseudomonas sedolisin (serine-carboxyl proteinase) complexed with two molecules of pseudo-iodotyrostatin
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
368
structure length
368
Chain Sequence
b'GTAKGHNPTEFPTIYDASSAPTAANTTVGIITIGGVSQTLQDLQQFTSANGLASVNTQTIQTGSSNGDYSDDQQGQGEWDLDSQSIVGSAGGAVQQLLFYMADQSASGNTGLTQAFNQAVSDNVAKVINVSLGWCEADANADGTLQAEDRIFATAAAQGQTFSVSSGDEGVYECNNRGYPDGSTYSVSWPASSPNVIAVGGTTLYTTSAGAYSNETVWNEGLDSNGKLWATGGGYSVYESKPSWQSVVSGTPGRRLLPDISFDAAQGTGALIYNYGQLQQIGGTSLASPIFVGLWARLQSANSNSLGFPAASFYSAISSTPSLVHDVKSGNNGYGGYGYNAGTGWDYPTGWGSLDIAKLSAYIRSNGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEDOLISIN
molecule tags Hydrolase/hydrolase inhibitor
source organism Pseudomonas sp.
publication title Two inhibitor molecules bound in the active site of Pseudomonas sedolisin: a model for the bi-product complex following cleavage of a peptide substrate.
pubmed doi rcsb
total genus 136
structure length 368
sequence length 368
ec nomenclature ec 3.4.21.100: Sedolisin.
pdb deposition date 2003-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1nluA00
2SECE 4KPGA 5FAXA 1EA7A 1SBCA 1WMFA 1WVMA 2PWBA 3DVSX 3I2YX 2W2QA 1SBHA 3UNXA 3QFHA 3GCWA 3L1KA 1NLUA 1V6CA 1OT5A 5AVJA 1WSDA 1Y33E 1GTG1 3DWEX 4YN3A 5B1DA 3A3NA 1Y3BE 2P4EA 1MEEA 1TK2A 3BX1A 2W2NA 1BH6A 1EGQA 1BFKA 1SBTA 1S2NA 1SCJA 1T1GA 2ID8A 3EIFA 1PFGA 5SICE 1PTKA 1R0RE 1SN7A 4C3VA 3I37X 1SIOA 2HPZA 1SUBA 2PWAA 5AVKA 5I9SA 2ST1A 2PRKA 3BGOS 3TECE 4MZDA 3DE0X 5ARBA 2Z2XA 1SIBE 1SCAA 2PMWB 3LXUX 1SCBA 4WOCA 5AMXA 2SICE 3DW1X 1AU9A 1DUIA 1Y1KE 1C9MA 3WIVA 1ST3A 1KDVA 1NDQA 4H6XA 3DVRX 1SBNE 5B1EA 5JXHA 1YJAA 2Z30A 1Y4AE 4KG7A 1TO1E 1Y34E 2ZRQA 5ARDA 4CG0A 1YJBA 4FONA 1ST2A 4BWGA 1CNMA 4M1ZA 1AK9A 3DE1X 2DUJA 1C9NA 1WMEA 4GI3A 1DBIA 4ZOQI 4RYDA 1Y3CE 4NE9A 1TECE 1TMGE 2ZWPA 3QMPA 4B5LA 1HT3A 3TI9A 2IY9A 2Z57A 4H6WA 4NE7A 5JXIA 3EDYA 1T1EA 1SUAA 3D9QX 1AF4A 3Q40A 3QTLA 5ARCA 2QTWB 2DP4E 3LPDA 1BE6A 3OSZA 4H6VA 3VSBA 1MPTA 2V8BA 5FFNA 1TM1E 1GT91 3F49S 1YJCA 3DE3X 3P5BA 3DE4X 1IAVA 1SIUA 1R64A 1TM5E 2Z56A 4DZTA 2SBTA 4Z2AA 1GA4A 3A3PA 3GCXA 1Y3DE 5CW1A 1CSEE 4AKTA 5JMOA 3T41A 5FBZA 1Q5PA 2PKCA 1GTL1 1LW6E 1UBNA 1V5IA 2SNIE 2W2PA 2XTJA 1GTJ1 4NMXB 1GNSA 3WHIA 1GNVA 2X8JA 4DJ5X 1PJ8A 1VSBA 1P8JA 3ZXXA 1KE2A 1OYOA 3VHQA 2E1PA 4OMDA 1R6VA 1SUCA 2WUWE 3DYBA 1JEAA 3DDZX 3WIUA 4CFYA 5JXGA 1IC6A 1SPBS 2PQ2A 4WOBA 1AV7A 4DWWA 4AKSA 2Z2ZA 1Y3FE 3CO0S 1BFUA 1BJRE 2X8JB 3H42B 5AQEA 5JXJA 2PYZA 3DE6X 1SUPA 2IXTA 3D43A 1YU6A 2Z58A 3HJRA 1SUDA 2WUVA 3PTLA 3TI7A 1GCIA 1NDUA 2W2MA 4JP8A 4OV6B 3DVQX 1KDZA 4C3UA 4CFZA 1TM7E 2HD4A 1SVNA 2WV7A 3DE7X 3LPCA 1KE1A 3SICE 3I34X 3SQOA 4LVOA 3GT4A 1AH2A 1Y48E 1P7WA 1TO2E 4HX2A 1TM4E 3VV3A 3VV2A 1C3LA 1SUEA 2GKOA 1S02A 1OYVA 3F7OA 1BE8A 1SH7A 3PRKE 4HVLA 1ZVJA 4OMCA 1SELA 3LPAA 1WMDA 4J94A 2B6NA 3A3OA 1Y9ZA 1T1IA 3DE5X 1A2QA 3I30X 2DQKA 2ZWOA 1AVTA 2XRMA 2ID4A 3GT3A 1SCDA 3CNQS 3DW3X 1S01A 1GA6A 2TECE 1C9JA 2Z2YA 3ZXYA 1SBIA 1PEKE 4LVNA 3WQBA 2WWTA 5K7SA 4K8RB 1TM3E 2G4VA 3F7MA 3VTAA 1AQNA 3AJ8A 1KDYA 1Y4DE 3AFGA 3BPSA 3Q5GA 1P7VA 1XF1A 2W2OA 3DE2X 1THMA 4KB5A 4ZARA 1GA1A 3AJ9A 1ZVKA 4I0WB 3EE6A 3VYVA 1SCNE
chains in the Genus database with same CATH superfamily
1D1QA 1LDNA 1OH8A 1XNHA 2JGEA 1IQUA 1O9HA 4HN9A 2VJPA 1RCTE 3DHYA 4PM4A 1ZM7A 3BWMA 3EPRA 2AE1A 2QMZA 3OPMA 4NYIR 1ITZA 4DXDA 2XGSA 1Q21A 5I9MA 1IK6A 1MA3A 1O6FA 1E2DA 1P2VA 2QG6A 2VJBA 3FBGA 3P0RA 4OL9A 3PKZA 4EPXA 1UANA 3B51X 3K4PA 3OEYA 3TRKA 4C7OB 2AXEA 4CIXA 1GXSA 4D3FA 4O3MA 2C61A 4ZVNA 1WU7A 2Q9CA 3DOOA 3U4CA 4DR7B 2P9CA 3FF4A 3K0EA 4FNGA 2WILA 1R1DA 5TX7A 4EB6A 4D4LA 4DCVA 1NR1A 2DFLA 5LA6F 4IM7A 1QHEA 1GGKA 2HTFA 1EK2A 2EXXA 3B6JA 4EBBA 4EIWA 1QH8B 1FLAA 2C1XA 4LTNA 1JRLA 3IUJA 1N5KA 2CK3A 5JAHA 2MSNA 3C87A 3KJZA 4BZXA 5LUBA 4HDNA 2WTMA 2H4ZA 2EYQA 4BO9A 1UPUA 4EYGA 1T29A 1UM9B 2DBYA 2C8VA 2WQZA 3QPWA 4TQAA 1H2BA 3IKMB 3KUKA 3LECA 4YAKA 1FEZA 1Z6TA 2DT5A 2ZKLA 4OQXA 2QLJA 1T2DA 5L95A 4RZ2A 3X2FA 2F8MA 1RADA 3PZRA 5G1NA 1ZESA 3SHVA 3TD2A 4QPPA 3ZHQA 3LA6A 1KQFA 4C2UA 3JARB 1TM5E 2PX4A 4XLZA 3AH8A 4RTRA 3NP7A 1KBOA 5TC4A 3SNHA 1L4UA 1V8OA 1YOVA 5ALSA 4ZVSA 4CIVA 5AI8A 3CKYA 2JGNA 5B57C 2YWHA 1GNVA 3DAYA 3HXMA 4JLBA 4D8XA 5GV7A 4ML3A 3HCFA 1EDEA 5JNSA 1N7GA 4P3KA 4CW7A 3O3NB 1QH9A 2E6KA 2GYWA 1DXOA 3PX3A 4DEYA 5FWYA 3SS7X 2WJHA 4PONA 1M5UA 4RY9A 2HMWA 5FBHA 5L4LA 3JQFC 3P9YA 2XUKA 3AVVA 1U0NA 4RA9B 3N53A 2C2OA 4A10A 3FJ1A 3LPNA 4KI7A 3ZE9A 4YIHA 4B43A 1NKTA 1WQ3A 1FVHA 2XVAA 1J2RA 4QODA 1HL7A 1K88A 1AM4D 3OP4A 4KXQA 3OU6A 3RK4A 4B79A 2E37A 1NPYA 2GM5A 5F21A 3GYGA 4DMGA 1QS0A 3ETDA 3PNQA 2GM9A 3T1TA 3B13B 1MB0A 1EAMA 4FYYA 3ZCQA 2BMAA 2VJCA 3TYXA 3TIXB 1Z0ZA 3OZXA 2TECE 4L4ZA 3QG1A 4MWZA 3ZY3A 4TM7A 1W581 3ER9A 3RADC 1U2PA 2FFBA 2W93A 4DE5A 1BD4A 4EF6A 5IP5A 1OKKD 2ECPA 2PVSA 3U3JA 4BKOA 4X1IA 1SEVA 5G1OA 3JPYA 2P0YA 3BRCA 2AC2A 1F9AA 5AYVA 4JSYA 4W1RA 4B3BA 1HYGA 1BU5A 2IH2A 1CR1A 2A78A 5EUMA 1R8XA 2CY0A 4BDTA 1ZMTA 1GDTA 4ZI5A 2C97A 3T3IA 3O90A 2LRHA 3CH4B 2PUCA 2NZWA 3DLPX 1J8FA 4IDCA 1VLVA 2F9MA 4JVOA 4GSLA 2FN8A 3IOCA 3N0WA 1QU2A 3IAXA 3IS3A 5FBKA 1RHJA 5FPKA 3L7YA 5KOYA 4EFDA 4RQAA 3IAS6 1X8LA 2GHTA 3UJBA 5BR1A 4Z9FA 3DMPA 3RD5A 3CNBA 4UMFA 5BUQA 3GMIA 4KO8A 5KYTA 1U5AA 5FJJA 2ZZNA 2D4HA 2B0CA 1CLUA 1M7GA 2FSUA 4U7GA 5FEMA 3TCNA 2WT9A 4I9FA 5ICEA 1I7NA 2A5LA 5F7OA 1FW8A 3KAQA 4WOCA 3OSUA 3P9PA 4KYIB 1R6AA 4P36A 1QORA 3ESAA 1CQIB 4D5EA 1XDGA 3K9HA 5DX8A 1HEUA 1W0KD 4Y2PA 3MWEA 4PC7A 3R3XA 4V0RA 1UPBA 4G1MB 4I8XA 4YP5A 2R62A 3RJ5A 3H87A 4OAOA 4FYMA 2C1ZA 4HQ0A 2CZQA 2EAUA 2M9MA 2PH1A 3UHOA 4A8JA 4F84A 5CBKA 1ZWLA 2ZWMA 4JL6A 1SBYA 3OCZA 2PUFA 2VHJA 3UOAB 3L7CA 1TAGA 2XE7A 4NWIA 1JDBC 1B14A 2XNSA 2ZBGA 4DY6A 4EVIA 5BXYA 3NWOA 3RGGA 4CL8A 2JLCA 3KOOA 1KP2A 1XRJA 4QPJC 3GH1A 3DEKA 1Z06A 1ZCJA 2H5LA 1XKTA 4OQ4A 4UCQA 3LSTA 5K0TA 4H1TA 1NV9A 3BE5A 4O59O 3RS9A 4BP3A 4H7KA 2NUTA 4MVJP 1G2PA 3CUWA 3QSGA 1PT7A 2C4TA 2NU7A 4J75A 4YP1A 3SQLA 3TQHA 1YVPA 4BU0A 2AQKA 4PZZA 4KQEA 1CIPA 4H4DA 3UPUA 3OTQA 4LNUB 4IQ0A 3VNUA 4QPZA 3ZE6A 1HLDA 1XXHE 4DLUA 4FE3A 4K0KB 3TKYA 5C31A 1NJ5A 4MVJH 2QUBA 3M4XA 2BKAA 1T5OA 4PIVA 1SKAA 1DLIA 2CL5A 1XZHA 1RQPA 3AU8A 1MW9X 1O0CA 3CS3A 2O8FA 1HYEA 3K09C 3P5SA 5AI6A 4IUBS 1RKXA 4J0CA 2G40A 2IPNA 4Q1EA 3DDUA 4TYQA 5KYUA 1DWOA 4CT0A 1ISPA 5JAOA 3FNHA 1F06A 2AK3A 5EYPA 5HFJA 3HDVA 1SCUB 1TW3A 3U7QA 2ZSAA 4EMTA 5F4ZA 5JYEA 1Z8DA 3VUEA 2M32A 5IM4F 2O5CA 3WKAA 5JQWA 1I13A 1L7PA 4XI9A 2HHHB 5REQA 5SYNA 1IPEA 2QP9X 3Q6MA 4C4OA 3BMCB 5CBPA 4F60A 2D5CA 4GSYA 3KAKA 4UNPA 4NNPA 3T35A 2YWFA 1TLFA 3WJ1A 3MS2A 4BGEA 1U63A 5CHYA 1F7UA 4JCCA 4OFWA 4YK7A 3GJZA 2YDXA 2WIAA 3TQTA 4LXQA 1S89A 1YB6A 4ZI7B 3FFTA 3FPEA 1TM3E 1WG8A 4L4YA 4NCAA 3BHJA 1AQNA 4INOA 3BXFA 3FUUA 3NQ41 3W8EA 2X86A 4TUYB 1GLVA 1BWSA 2B1QA 1XKXA 2WJJA 1THGA 2Z8ZA 4QQNA 3L1JA 1JHYA 1KHHA 2OO7A 3IE0A 1TJPB 2HEGA 2HSZA 1WZIA 3DOEA 3BL6A 1NSFA 2G7ZA 3GP3A 4R9VA 4UFPA 4XYMA 3ZWQA 4OX9B 4GLJA 5LCXA 1EB8A 3HDYA 1Q1GA 1KY5A 2PZMA 4EY8A 3HDGA 3PDWA 5DNDA 2FMIA 1VGQA 5F35A 3SX0A 3HB0A 3WL3A 1B00A 1JPVA 2IIBA 3KR2A 3N3BC 1VSTA 3CRNA 4Y2QA 5FA8A 3AM1A 5D3QA 1Y33E 2A35A 3RAEC 2R8BA 1WMBA 4IRUB 5EKUA 2O3QA 5HM6A 2O8EA 4AZWA 2A1TR 9LDTA 3MGCA 4PTYA 2JLYA 5KMGA 2G9NA 3BFPA 2ZXFA 1YHYA 2GCPA 2IOQA 2MU1A 2RHGB 4JBNA 2H2FA 1R4MB 4UE6A 2FW9A 2PMBA 4JNKA 4KMSA 2CT8A 4KQHA 4N82A 5ARBA 4HQFA 2CK3D 1K8ZB 3QM1A 3D31A 4RJJA 1O9GA 4RS3A 1P4GA 1ST3A 2C03A 2J4FA 4JP3A 3DD1A 4HSGA 5B1EA 3BZWA 1KMQA 1WOYA 3UCXA 1TM2A 3DZ8A 3GROA 4OOFA 1ADBA 3RIGA 5A6VA 1Z5NA 1WCV1 1EFAA 2D3WA 1ML3A 1K7EB 2V5VA 1CUDA 5D1NA 1DFIA 2NVUB 2H6EA 3ROKA 2WJ6A 1XTZA 3UENA 3ZE1B 2JW5A 4F4UA 5EJ8A 2ZWPA 2PUDA 4ND6A 2PKQO 5HEKA 2Z2JA 4PZDA 2R6AA 3ONWA 3BQ9A 3HK2A 2YYAA 3Q5DA 4P98A 1T43A 2V0GA 4YDSA 2VJNA 4Z99A 2V54A 2V7QA 1SRRA 1IWBB 2OEPA 3EW9A 2L19A 2P7HA 1EK5A 1PDVA 1WY7A 2QHXA 3PWZA 3LYUA 5SY6A 3NC0C 3NGMA 2PJUA 3Q2KA 3EFEA 3IOEA 4KXYA 1UBNA 4FSDA 4ILEA 5A4FS 3LWZA 2B61A 1MGOA 4TZTA 5FT9A 1I9CA 2C95A 3FUWA 3L4KA 3U31A 2JH3A 3DS8A 4DLRA 5C37A 3I0MA 1GZDA 2VZEA 3GFOA 2GJ9A 5AKJA 1L7XA 2I6GA 4MUFA 2QE6A 5JW6A 5T4HA 2HWYA 1QG6A 4Y2HA 2EQ5A 4DWWA 5EJMA 1VXOA 1ZC3A 3RBZA 3E3MA 2XB2A 2YY5A 2WFMA 1S8NA 1VIYA 3QVSA 5NLLA 2P68A 4FB4A 1LRKA 5HKBA 4A6DA 1NJFA 3K0AA 3B1WA 4V3CA 3E7WA 1GFWA 1XZFA 3IQGX 3E18A 1PV4A 2WJPA 2XMCA 4L0CA 5K8UA 1JIUA 1OV6A 1ESDA 1UBLS 3OJOA 3EWIA 4KAXA 1YJ5A 1Z74A 1S02A 1Z0AA 4DLSA 2X9VA 3EGCA 3ZIAA 5TY0A 4RJLA 1CEXA 3OT5A 1QH0A 5H3HA 2OWEA 1DKOA 3D2AA 1AA6A 1H1TA 3FJOA 4RZQA 4B3GA 4Z49A 5AVYA 2Q5HA 4X71A 3UAVA 3OZCA 3LOPA 4H16A 1PEKE 5DSXA 5IWCA 1HKUA 2P9TA 2R1VB 2B35A 3NU1A 3GFPA 4EDFA 4IIDA 3PGA1 5ALOA 3EVEA 3NHAA 3ODGA 3GJXC 1RYMA 2P6MA 4GP9A 1D7AA 5BVGA 2H5IA 1YZLA 2A67A 4MI6A 2X4DA 1A5SB 3JQDA 3ZS8A 3D6FA 1FP7A 4IHKA 4O25A 2G80A 2F8LA 3K9LA 3EXIB 1KFJB 4NYJQ 4D4IA 4M9RA 5EPEA 1GXSB 4ZWNA 4XARA 1SC1A 4FOLA 1RWVA 3PT9A 1XL0A 3DJFA 3DOUA 3LCUA 5E0OA 4ZTBA 1CD5A 2ON6A 2J9FA 3GDOA 2D1TA 2JFWA 2P9QA 1TQDA 2IYQA 3O2QB 5DISB 3SM3A 5I01A 3LBHA 3CC8A 1JKMA 1VG8A 1GPUA 1SXJA 1TD9A 4Q3NA 2ZZKA 3CX4A 1G8SA 1UF9A 1VGVA 3C5HA 1NR5A 2NZUG 3B1VA 1Q2UA 1LTHR 1DQPA 3DKVA 4S3MA 4Q9LA 4EZEA 1YVDA 5BN5A 1M9NA 2VUHB 1ECGA 1GARA 4NAUA 2C8KA 1GN8A 4Z3DA 1NGSA 2ERXA 4JMPA 4D96A 5CK5A 3SZGA 2CE7A 3KEFA 2OORC 1ODIA 4X8OA 3BIWA 2G6BA 2HY7A 4Z4QA 5DV9A 2OFOA 1VMIA 3CB4A 4BO8A 4D9GA 1F3LA 1XQ9A 2DY1A 3BCUA 3KQLA 1RTTA 3JARA 1WIWA 4EA7A 5J23A 1UKVY 1EQUA 1U8XX 1D04A 1JTEA 4JJ7A 4JEHA 4I8DA 1ZCFA 3DZIA 2PGOA 3LX4A 1KYVA 3QYJA 1C41A 4K9NA 4NS1A 4PCVA 5B3KA 1N2JA 3AM5A 2OV8A 4YCLA 2GXUA 5FPHA 3N1UA 3ZTWA 2MR5A 4C20A 4GOKA 1OAOA 2H31A 1OBFO 1JP7A 5E9JA 1LNSA 1IBMB 1TQ4A 3A3PA 1XEXA 1T3LA 1MB2A 4JKYA 2YMPA 3V7NA 3W5SA 1D0VA 2VNIA 2WSYB 3V8EA 4EJ2A 2IWHA 5IVHA 5IC6A 1Z0IA 2ZRFA 1JEOA 5TQ2A 3L6DA 2EDAA 2FQ1A 2ZUWA 1ZUWA 4ZRNA 4LFCB 1R50A 1GPWB 1R6VA 5HOQA 3BSYA 3ZJYA 2C5FA 2WMYA 2WWIA 4KIGA 3LT2A 2QKYA 1G8MA 5AXAA 4B74A 4D4MA 1JQKA 1NYTA 1UOQA 2JJ2D 3PR2B 5IKPA 3AV3A 3EBLA 2HJSA 1N57A 3CINA 4LJ4A 1PJ2A 2XAUA 3V1LA 1OVMA 1W88B 3QF7A 4F4JA 1H5NA 4WH0A 2CGEA 2NAFA 4CQJA 4XPIA 3D7NA 4Q9KA 4YX9A 4FMDF 4ARSA 3KOZA 3LIPA 3SSAA 3SSOA 1CY4A 2G88A 3GEGA 5IEJA 3NUQA 4R5HA 4A27A 4C6HA 3O3CA 2OOSA 1P5FA 5CVDA 2D2XA 1XO1A 2WFLB 3MRVA 2X8LA 1YZ3A 3HJNA 4N8DA 4BTEA 4CKBB 4CHTA 3NORA 5FULA 1K7FB 2O2DA 5HCUA 4OIFA 5FBLB 4YRMA 1FDIA 3HVRA 4JBXA 2L18A 1T10A 2REQB 5CCXA 1V9SA 1HXHA 3NHUA 4DMRA 1RIIA 5KYXB 3GMSA 4L16A 1YRAA 1YMUA 1HTTA 1HQKA 2PLAA 4GXTA 1EVYA 1YR6A 4IIXA 3ZYCA 4YMHA 2WG2A 1Z36A 1Q1EA 5DNYB 9GPBA 2D2IA 4WXHA 3Q0IA 2JBAB 4PANA 2ZROA 3OF5A 2WBLC 2OZKA 4YROA 5TF0A 4S0XA 2PIAA 4IAOA 1NN3A 2EDCA 4JGBA 1C81A 5LPNA 5JTUA 2X23A 4OPMA 2AVNA 1J49A 2YC4C 4MB6A 2EIXA 1N5DA 1Z2OX 5IUKC 5EIBD 2CEKA 1CZOA 1WSBA 2EEPA 3TQIA 3VU1A 1UBCA 3LS2A 1YR9A 2B37A 2UKDA 2F62A 3QHQA 4UM9B 2MJLA 3Q2IA 3DSRA 4PSVA 3V42A 5CDGA 4PS1A 1TU4A 4AQDA 3OHSX 2G6TA 2Q6LA 4YWJA 5BMVA 2OWDA 1YDEA 1ZAKA 1X1QA 3C3KA 2GEDA 2C42A 3EZYA 1XBTA 3L4BC 4ZCMA 3O7WA 4LHEA 3ETLA 2QQGA 3R7BA 1VFNA 3K0CA 3CTPA 3H3JA 4B1FA 4ETNA 2IJGX 2XNDA 2PL3A 5IMSA 3A26A 3RCBA 4DB4A 3VZDA 3I9KA 2O0HA 1QHSA 2Q2OA 3KPWA 4M76B 4U00A 5J1TB 3CVUA 3DF9A 3LDHA 3IT1A 1JLMA 2GN8A 4HUQA 1YULA 4YLYA 5EJGA 3G8BA 1N4AA 4CKCA 2B2NA 4AKHA 4I4TF 1D03A 4PSCA 3DBLB 2BTQB 2Z6VA 3L7BA 5J3JA 4N4AA 3JS5A 3MJTA 3X1DA 3G49A 3RUFA 3OCXA 1EFPB 3QZUA 4EF4A 1JI3A 5BW6B 3THXA 3IH5A 3VKGA 2PO5A 1FTNA 4RMIA 3JASB 4LUCA 3KQKA 4C6TA 5JXHA 3PUKA 4JV5B 1KBQA 4FP9A 1Z7GA 5FR1A 5BY2A 4I4CA 4BUZA 4KO1S 1TX4B 4FJ0A 3W8NA 1PJRA 4TTVA 1Y5IA 1F12A 3L7JA 4DS3A 4GEGA 1R0WA 2EQAA 3WLEA 2ONYA 5TNXA 3DDHA 1KWGA 4YMUA 1YQXA 2ZXUA 3LTNC 2HSJA 2O2CA 5JSUA 3BE6A 1C4KA 3CEHA 1QVRA 2CV2A 2QX9A 1XD9A 2IHZA 2FR8A 5DI3B 2D06A 4L5YA 3ZBTA 2M1ZA 4YBRA 5A5EA 1JJAA 3FLBA 3RS3A 1AKNA 1EWKA 2WYVA 2H1HA 3P4YA 4HB3A 2FUG1 4B85A 2H08A 5REQB 1G5RA 2GILA 3WOHA 3LA8A 2IWRA 2AG6A 3PFCA 1QHHB 3AONB 3I34X 4M60A 2ISCA 5JVDA 3GARA 3HSSA 4MOWA 1PD0A 4ISBA 3ACDA 1W73A 2O8BB 1SKQA 3MQ4A 3K6JA 4UOQA 5AK5A 1YBMA 3SYNA 5GZ1A 4GECA 3KB1A 5DHAA 3GEMA 4ZC1A 5HF9A 4C4RA 4C0JA 4ZANA 3HPRA 2Z6UA 1E2MA 1YCFA 4TZKA 4MEJA 2J41A 1WPRA 3ZGNA 4QPNA 3A9RA 1TFRA 4W5HA 4CDMA 1G0NA 5T4EA 5FUBA 2C77A 3FKSA 3PYLA 5BRNA 1JT9A 2KW5A 4L07A 1ICEA 1LBEA 5H83A 3T7EA 1ZLXA 3AJ8A 5EFOA 3A9VA 4XWYA 4R8VA 3OUZA 2ZVQX 4S1PA 1JDJA 3AJ9A 3NTQA 4NBLA 5DFAA 1RP7A 5DNWA 1FRQA 3ZWOA 4YV7A 1Z0UA 2JK0A 1GUDA 4IZIA 3MUNA 4J0KA 4ZT3A 2J0UA 3FHTA 3IAM6 4PZ0A 3R41A 1SHLA 2HWKA 3HM9A 2HO4A 3L0ZA 1V6CA 1PI3A 2AMVA 2FNAA 1DV1A 3I64A 4J03A 4D8UA 4MQ4A 3TX2A 2WHEA 3VNAA 4BNZA 2WQ7A 1T5BA 2XTMA 4E4RA 2AWNA 4DMKA 3O2NA 1II9A 1EEHA 1QYXA 2HSDA 3D6TB 3QEKA 5J2TB 3U3MA 4KQ2A 3FOWA 1JVSA 5T3YA 2QBYB 3C3AA 3EZ2A 4BLSA 1RXYA 1CR4A 3Q0EA 4MVJF 6GPBA 5JPCA 2FMTA 1R8JA 2Q9AA 2Y77A 3ADOA 3MLBA 4IKPA 5L9AA 4FC7A 3EGOA 1CY2A 1SXJC 3HKDA 4K2AA 2QSZA 2DR3A 3HKCB 1EDZA 4RHXA 4L9RA 3L9WA 4RPIA 2QNRA 1Y6QA 1PHRA 4BFXA 4OHXA 4I5IA 3F0TA 4C43A 2BMEA 3A6JA 3FDFA 4TT3D 1HE3A 2P1ZA 2P4SA 2XQJA 3MF4A 1DIHA 2HT6A 3B20A 3PR1A 1ONOA 4HDSA 1H5QA 4LJ9A 1ZVVA 1JZSA 5KVQA 2SKEA 4P86A 3GJ5A 4GNKA 1SB8A 2HU2A 2O06A 3K96A 2GPNA 3LJKA 3PXXA 3TLBA 5JANA 1C7RA 3Q6IA 5HDBB 2GNPA 4O5AA 4B84A 4AG3A 3U48A 1UWLA 2WYOA 3QTLA 4LDJA 1XTUA 2AFHE 1E89A 3ZCSA 5KNCA 3GMDA 1LW7A 2EFEB 1M5TA 1BXZA 2C7VA 4E2XA 1UAYA 1LNQA 2XCIA 3MUEA 5HIAA 3IXQA 3G1WA 3IP5A 5IAOA 1W93A 1A88A 5E2AA 4NH0A 5ABPA 1U7ZA 4PVDA 2XTJA 3UATA 3MM4A 2WA2A 2QZSA 1YVUA 3LDAA 1TI7A 4IQGA 4ZOLF 3C8ZA 1QP0A 2NMVA 2OQRA 2IOYA 2X0RA 2RH4A 2ZJ8A 4I55A 4JOSA 4M4SA 4E31A 2GOYA 4O08A 1YOVB 4PX2A 4ND1A 1W46A 3COPA 4OH1A 4Q9IA 3TFWA 2NSJA 5LZ9A 3W3AA 5KSOA 5ELLA 4LFAB 5JS1A 1SC9A 3NR2A 5I7FA 3QU9A 5EXXA 3L3BA 5C1DA 1OLUB 2JA2A 5KU7A 2JGDA 2B9VA 2ZB2A 3V1TC 3L8YA 1QAOA 1GNLA 2YL2A 2FN4A 4U5XA 1Q0HA 2H16A 2R48A 3HB1A 4Y1RB 1C14A 1LFDB 5FWYB 3R5TA 4MSUA 3BH0A 3ULKA 3JD4A 3TG8A 4DEVA 1C0IA 2H65A 1MTOA 2WF7A 1CS0B 5K3CA 1IXYA 2OD7A 4TMFA 1ZK2A 3TW6A 1ODLA 2IL1A 1T6XA 2E3JA 1IXRC 2FEKA 3DVAB 5BYJA 4ALNA 5BSGA 3X1MA 3O83A 4OP3A 4ZCSA 1R0SA 3DLBA 1ZRMA 3KSZO 1HG0A 2I55A 4Y1EA 3W9UA 4BMNA 4EJSA 3SF0A 3FWHA 2OD2A 3GU3A 2IUTA 2ZJAA 4C7KA 3E7PA 1AKTA 4E1AA 4FZJA 4JELA 2NZVG 4TGLA 4NBKA 1PP4A 1YZGA 2H1VA 5AJYA 3MN1A 1SIWA 4LSMA 3H65A 3MMXA 2OO3A 1W1IA 3HFRA 4KREA 2CNWD 1EZZA 3V34A 3B36A 3PUVA 3O93A 4KVGA 4F6RA 4A23A 4HLCA 2CZCA 3OCVA 1FTWA 1I1OA 2OCXA 3BGIA 3DOHA 2NO6A 1T15A 3SOPA 3DAHA 4KXVA 1KK2A 4TSFD 3JVIA 1NBHA 2PRSA 4ZK6A 4AMVA 4MYSA 2PGLA 3PFGA 3GLSA 4L6IA 4UCXA 2O2GA 2IV7A 3AG6A 1HWYA 2VP2A 1QYVA 4RA6A 3IPLA 3NV7A 3R8CA 3ROMA 3UGKA 4H4CA 5I3ZA 1HZZA 1R6UA 1IAQA 2XITA 1GPMA 1GV1A 1U1DA 3PNOA 3VTKA 4J91A 1RE0A 5HILA 3AF6A 3BXGA 4NARA 1ZGGA 3AZOA 1NW8A 2NU9B 3W2HA 1C1DA 2OCYC 3L84A 4EG1A 3I6BA 1QQ7A 5BOSA 1N3BA 2OYCA 3WJ2A 4CV1A 2IOHA 4P4UA 1I3MA 5KTOA 4J1TC 1Z6QA 4H7PA 3FZGA 4DWOA 1KDTA 2OLJA 2O2YA 5A9RA 3F3YA 2IIPA 1YJBA 5JV5A 3U3KA 3TRDA 1JHAA 1USVA 2FA9A 2OR3A 4G3XA 4KGVA 1NXXA 4L5IA 4CQNA 1SUFA 3OP1A 3Q7SA 3R3VA 5E6RA 1F8YA 1SO8A 2XY4A 2L0XA 3M6XA 3O82A 4LPSA 1SNYA 1V9LA 3MK31 3EGIA 4G5SA 4H6WA 1G66A 2VP9A 7AT1A 4FSXA 4PQRA 1EGMB 1F2DA 1KGSA 1UJCA 4KJZA 2YMMA 2CB0A 2BUCA 1A95A 3IJ5A 2H1CA 5AJZA 4ZAZA 4EYQA 4ER0A 2I1VB 4X62B 3O8LA 1U5CA 3GCXA 3M33A 2EX1A 3PNSA 1R3UA 1Z4KA 3TBFA 3RE1A 1VKJA 2Q6IA 2CDRA 1G3RA 3L8FA 4FB5A 4ZOCA 2HH9A 5ILOA 1F2TA 1GG9A 2NU6A 5D3MB 3UMYA 2FSPA 3DCJA 3S70A 3MRSA 4KE8A 3UHJA 1I2DA 3QF4A 4B33A 1VDZA 4OLAA 1K08A 1HURA 2HEIA 2JRLA 3ESRA 4CT5A 1PDWA 3DEFA 3IEIA 3AT1A 4NFSA 4W1QA 4GWKA 4U9UA 1M33A 5BSHA 1NI4A 3DNPA 3A4IA 5D2CA 5ITWA 1JHUA 1EX6A 1F4LA 1HE8B 1TJ3A 3Q7EA 4K87A 1UR5A 3AUXA 3PBKA 1HE5A 2C82A 2MMGA 2EU8A 4WKGA 3AOGA 3TDMA 3C3PA 4UZSA 3BJZA 4D43A 1UJ5A 4JLMA 2W2LA 2AEJA 1LA2A 2G67A 3SXPA 3EPLA 3R6LA 4Q4HA 3OG9A 2ZDGA 4JLKA 3N0VA 4IZHA 1GZ7A 4Q47A 1FFSA 4WD3A 1PZEA 4TXHA 5LDDC 2LIPA 2YXNA 3IP8A 2Q4RA 1EZ4A 4CEIB 4CMHA 3TD6A 5DP2A 2IUFA 2XJ9A 3IURA 4MROA 3GOHA 1WKCA 3ONFA 3RARA 5EZYA 3B7PA 4PGFA 5I9LA 2VDWB 2A7XA 1CNEA 3G68A 3LKDA 3QK7A 4LCJA 3KV3O 4Z1MD 2FG5A 2W2OA 4IS2A 1RYBA 1U90A 4LZOA 4XEUA 3CZCA 4BUCA 1GDDA 2OXFA 2P0AA 1J2TA 3HXTA 3T7RA 4LYFA 5DN9A 4L74A 1QQAA 2CD7A 2QTGA 1E4YA 1B0ZA 5IT0A 1VG0B 3S5UA 4Y8VA 5JDIA 2ZIWB 4PRLA 4WWHA 4XB6B 3A6KA 3R7WB 3ITDA 4TMWA 3CLHA 3EVTA 4Z7JA 3AQ4A 4MITA 2H1IA 3CPEA 4LJRA 1NT2A 3ABQB 5CDUA 1FX0B 3N2EA 2Q3LA 1VMKA 4HPXB 1NNI1 3AHIA 1PTKA 1DLJA 4FEYA 4UD6A 4V1CA 4C1NA 4DFDA 3I9V1 2GRAA 4UMEA 5CYPA 1D1SA 2BV3A 4WGGA 3UKOA 2XXAA 4ACAA 4MZDA 4WZAE 4UAJA 3HM2A 5LQAA 5H8WA 4G07A 5BSMA 2PSEA 1P9NA 3GXBA 1B76A 2IU0A 4YYEA 3IEXA 1HY3A 2LZ0A 3GEIA 2REOA 4B6EA 2FE4A 4PICA 4YQYA 2C7RA 1QAQA 2GVZC 2X13A 4IIFA 4TMZA 5DXFA 2VT3A 3EZLA 1N1MA 2W11A 4B4WA 1PFWA 5CX1B 4HLUC 3N0TA 2AA3A 3VYTB 2YINC 4DANA 1ND5A 2D1YA 2IOFK 1D7OA 2Y1DA 4IOKA 1HT3A 2W6JD 3KYDA 1PTJC 1E2NA 3HRIA 3FNBA 3REQA 4LGYA 3VHLB 2O1XA 4U7HA 1ZRHA 1M2KA 4QQ8A 1QZUA 4C0KA 3I9V6 4GR4A 3KT0A 3EK2A 3HI4A 2AG5A 3WHKA 1UEJA 3G6WA 1GZVA 2AR0A 1QIKA 3NHSA 3P5BA 5DP1A 3IOYA 3TKAA 3X1XA 5A1JA 2FSGA 4AS1A 3W2FA 3TPCA 1G3MA 3U4MA 1NBEA 1JB9A 1K3FA 2EJUA 3HG7A 4IXMA 1JALA 1KAHA 1PJZA 2E1RA 2WTNA 2RGGA 1ZFNA 3C3EA 4J16A 1EBBA 2QZJA 3PEWA 2ADFA 1R18A 3FOZA 1B3RA 2BFAA 5HQ3A 1AN0A 4BLWA 2WMNB 1MC1A 2WSBA 2HTEA 3GLFA 4FR2A 3PGXA 1RXCA 1JT2A 5FBQB 3FHJA 1N2BA 1NUHA 4UBLA 1P2BA 2OCPA 3GCZA 1DFGA 4ZXFA 2W70A 2J3LA 3HWX1 2GESA 2HF9A 4MWBA 4RPLA 3M70A 1GJRA 3N9IA 1PDOA 3ELUA 3VPBA 5LWHA 1DC5A 1DOAA 1GCIA 2ZRDA 1XPOA 3I6MA 4CL2A 1YFLA 2JHCA 3AB8A 1WQ1R 1Y6JA 3C6XA 3DE7X 3F8SA 3CZAA 3MBIA 3N2LA 3PC8A 3PQEA 3T0GA 3TSOA 1N5LA 1JYSA 3PWKA 1H4VB 3UH0A 1RM4A 4QG3A 3WL4A 4RTOA 1WZNA 4M1YA 4XFDA 3HUDA 2EJVA 3WLAA 3LZCA 1IJEA 1AJEA 1RR6A 1Z13A 2WM3A 1A2OA 1Z3CA 3E9NA 3PD1A 3W7VA 3DR5A 4RUKA 1L4LA 3RKUA 1GHTA 5C7YA 1R8YA 2JKZA 3DAPA 3PEVA 4KXFB 2VF4X 1T36A 1ARZA 2EC5A 2ID4A 1SCDA 3ANXA 3ECSA 1Q14A 1OBHA 1SQ6A 3AUKA 4YV2A 1ORHA 3VKFA 3H1GA 3ZHVA 1MO3A 4R0VA 4KR3A 4IX1A 2QROA 5CNKA 5C8VA 3UUEA 3RU7A 2P75A 1Z38A 1OTHA 3WTBA 5LMCA 4H2DA 2FPKA 2J3DA 3D6JA 2C83A 2VNAA 1N2SA 2M2IA 3GGJA 2CCJA 2ZU6A 1DO2A 4JQCA 5DBHX 2COUA 3WBBA 1BDHA 1VSVA 4IICA 5MDHA 1YRQA 2PA3A 1Z17A 4KXWA 3C6BA 3MOGA 1E64A 3ZD7A 5AR1A 4C1BA 3D5QA 2W58A 4CETA 2WW8A 1M76A 5FOUA 1VI2A 1UKEA 2VDMB 3ZC3A 2G76A 4EKIA 4F8YA 2V0CA 4WK0B 2PSFA 1E7YA 4LE2A 3BD7A 3F6BX 3EIOA 2VN8A 2J5QA 3N7UA 1NUQA 2W22A 2WKWA 3NAGA 3VM6A 5AVKA 4J3JA 2E49A 1W5FA 3FYCA 4YRDA 4ENUA 3TECE 4NYIQ 2VNSA 4RK1A 4DZZA 2B30A 1E94E 1L9KA 4KLNA 1AU9A 1O0BA 4WKNA 4UTPA 2OL4A 3AM4A 4A0RA 1P9WA 1GAEO 4UCFA 5K5EA 4IDQA 4RVDA 2B99A 4QYMA 2XVYA 2GN4A 5AW0A 2ZRQA 1SVMA 3T5CA 2FMFA 3DWFA 2YOFA 3E9MA 1FFXB 2H57A 4PGAA 2MMCA 4WLOA 5DEOA 2B98A 1T2EA 1K4YA 5DX0A 4UKDA 1NBMD 4GZLA 2ZITA 5B4TA 2FEAA 5K99A 5BN4A 5LA6A 1UT8A 1Y3CE 4NL4H 1IIBA 2ICAA 3AMVA 3RT7A 5JYBA 1UQRA 4PEVA 1DG3A 3PNMA 4URXR 1X1TA 4C4SA 2UUBB 2QUIA 1QHYA 3HADA 2JJ1A 3ROEA 1AA9A 2NIPA 2PWPA 2YWCA 3EISA 3JR7A 2V1XA 4Y2RA 1KSGA 3ZDXB 2D62A 4YRAA 3FYSA 2GJSA 1ZZGA 3K8ZA 2P2YA 3ORRA 1L9XA 2WE7A 2X9QA 2QZZA 1P4SA 4BU1A 2CHQA 4IDNA 3HO6A 2QTAA 3ZHTA 4DJ5X 4Q4CA 1PZNA 4E5UA 5C52B 3WRVA 2DEUA 2MYUA 2CUNA 4LF6B 2OCBA 1TKRA 2JI9A 2UUPA 1YZYA 4ZQEA 1U5BB 1XQYA 4ZVUA 4GBGA 5LU9A 1KJQA 3AR2A 3AR5A 5IM4A 1F3OA 5LMNB 3UJ8A 3OCJA 3CO0S 4EGAA 2M1XA 3MILA 1K66A 1SUPA 2EG5A 5DN6A 3ISVA 5HIMA 2NU8B 1K68A 1DQYA 4OTZA 2Q2VA 2I2XB 4GC5A 4EHKA 1BX1A 2WAAA 4BRWA 1RHRA 5CA1A 4HX2A 3ESXA 4LJAA 4LECA 5E8JA 3RRJA 4MS1B 5U1PA 4Q4JA 4DRYA 1QPBA 5EWMB 2AYZA 1KEVA 3TAXA 4F8JA 2QYOA 3I04M 3ZTTA 1VE3A 1NRWA 1YDHA 1X7DA 3FMFA 3F78A 2PXAA 3FRHA 1JXMA 3DZDA 5I7EA 3RWOA 2G9QA 1VKHA 2IXFA 3P52A 5CH8A 3NHBA 3SE0A 5DTQA 5IZ4A 1AXRA 2PTHA 3LV8A 1D2MA 1PGOA 1A71A 2EX4A 3RUIA 3EDOA 3M5PA 3FPJA 1VHWA 4CLOB 4BN5A 4UUQA 3BPSA 3EXHC 2BMDA 3O75A 3X3HA 3WK6A 1GA1A 1GG2A 3VC7A 2BGKA 3H4IA 2CLHB 4HQOA 4F0JA 5AKYA 2JAOA 3KELA 1EFTA 3LL7A 3LZDA 5M2QA 1QIHA 2BDEA 4UNNA 2QSYA 3B3QA 4KR2A 1WVMA 1G6OA 4HRVA 4EEXA 3T1VA 1JFFB 5TQJA 2WTUA 3K53A 4YXWD 1KI6A 2FB9A 2HMAA 1SVKA 1KJ9A 3NOVA 4O6VA 5G02A 1N6NA 3FPLA 1OI3A 5H4GA 3WYGA 3AHJA 2W6ID 4M2LA 3FAZA 1ZH2A 5KPDA 4INZA 2ATCA 2ZE6A 4FNOA 2RJOA 1PWHA 5HF5A 9MHTA 2KLHA 4RMJA 5INTA 2FZ4A 1MJFA 5KJ6A 1E4EA 3RH0A 3OQOA 1MJ5A 1UBGA 3VR2D 5F9FA 4R1OA 1JHQA 1K8RA 2O23A 4HADA 1I36A 5BMVB 1J9ZA 3OZUA 2C7BA 4U0KA 5KNDD 1KAGA 1J0BA 1KJZA 4QUBA 4OJNA 4XOIA 4N7MA 4DSOA 2HGZA 1X9GA 5K0GA 4FYHA 2A88A 2IDJA 1O95C 4LSZA 5G0VA 2GFQA 2FGKA 5L3SB 2PS1A 3V8BA 4EG4A 4ZI2A 1AD2A 1A9OA 1SVWA 1Z0DA 3VU0A 2YHAA 4F9GA 5A4JA 4KR6A 1O94C 3AHHA 1N3LA 5SY4A 2CZGA 3KZMA 4HUQB 4UBIA 3T38A 3KM0A 3RVOA 3EGDB 1UM9A 1BE6A 3E3NA 3KB6A 1UXKA 3JALB 4QBGB 3IMFA 2HF7A 3ESZA 5EVJA 4DCMA 3GAMA 1FNNA 2Z56A 3HBLA 2DPLA 2ZWAA 3HZOA 4RQBA 3ZE0B 1USIA 3VU3A 4L85A 5KPJA 5JARA 1A27A 1XZCA 4C6TB 4ITUA 2B7LA 3O38A 3PCTA 4Y98A 3TQCA 2IYTA 2VYFA 4GUAA 2UVDA 2PNJA 4X1YA 3ZY5A 4CODB 4ER3A 2ZU0C 4WOBA 2NNWB 4W5WA 3PKJA 5JS7A 4XGQA 3F47A 1K7YA 3JZIA 3H42B 1Y98A 3L8HA 1DWUA 1EFRD 2PFGA 5IJXA 2ZIXB 4QXAA 1TU0A 3TI7A 3VHXA 4EW2A 4F8EA 5BNTA 5KWIA 3AL0C 1QGUA 2RSLA 2CMKA 3VZSA 5AUOB 2ZYSA 2CHGA 3SLKA 4U9IS 3HFSA 2P2GA 4JA0A 1EG7A 5C1BA 1F6WA 2RK6A 4RTKA 2DHQA 2YC2C 3WIBA 4CR8A 3GRUA 4WCFB 4XCQA 5CDYA 1O08A 5AVQA 3TJZA 4G5YA 1U31A 4KFCA 3FNEA 3NDJA 3B8EA 3IGFA 2WJZB 5TPWB 3V4LA 3E48A 1AIPA 1GQ2A 4XM2A 2ZRPA 1BZYA 2EKLA 4GPBA 2BISA 3NX4A 4FX2A 4JODA 4HG2A 3KDPA 5DM4A 1OFVA 4ENVA 2D3TA 4RFLA 4IH9A 1G60A 2JCBA 2ARKA 3DW3X 3VSEA 5DIZA 3Q8MA 2VAVA 1ZGCA 3GN2A 2J6HA 4YCJA 5FWAA 4LGVA 1PFUA 2DLNA 1NURA 1NVDA 4G1BA 3TDKA 2CXUA 2JGAA 4REQB 1F0YA 2A9KA 2WIFA 3G7SA 2PXCA 1TF2A 3GJ6A 4HDOB 1NVFA 1CE8B 4C0AC 4LOAA 3JQ8A 4XD7D 1IDOA 4C0SA 2EZ4A 4OBWA 1UIRA 5BUCA 4X1IB 3JYLA 5T64A 4C22A 5L53A 2I65A 2Q0SA 4M1SA 4Q5IA 4TWZA 2FWJA 1QHGA 5K0LA 4BP9A 1JAHA 4EG3A 4B0PA 1OU4A 2IX9A 3CRMA 3HUTA 3MHPA 4MWGA 2EJTA 4Q16A 1YJ8A 3GT0A 3KSDO 4LRXA 4P9NA 4V2IA 3LUBA 4YAJA 2C3UA 3A3YA 4QHSA 4XWTA 1Y89A 5CFMA 3JXEA 5L45A 4RFSB 4G25A 3PUHA 2OQIA 2FW7A 1QIFA 2ZI7A 3QVWA 2ZP1A 3WRYC 5IG2A 1VCMA 1M2VA 1XA4A 3QBVA 1APBA 2ZB8A 3NH6A 3UYKA 4WJKB 2Q5IA 1FBNA 2BVNA 1VSUA 4WRRA 2Z30A 2ILTA 3FNIA 3CTMA 1Z3IX 5GONF 2IHVA 1C50A 1ETHA 2ES4A 3FI9A 3PJFA 3UKJA 4DVGA 3GFFA 1OYYA 4V39A 2K7ZA 4WN3A 3TQRA 1FTSA 1CQIA 4JJ4A 3T94A 2G3YA 3B3FA 2Z43A 2DTEA 1VJ0A 2WJWA 3WK5A 3WWOA 3L1UA 5CJPA 3PXAA 1MHPA 1XCJA 4A8JB 2DP4E 2YH2A 5E4TA 1OTXA 1JG3A 1FU8A 4ZYTA 4IJ6A 5LDGA 5IJ9A 2I7DA 3FZNA 5LZ7A 4HY3A 5HQ3B 4Q1VA 3G6KA 1IJFA 5I3CA 3K9WA 5M3BA 1ZXLA 3ABRB 4KHZA 3OQHA 4K6HA 4EJFA 3VH2A 2AXQA 3P4UA 1IY1A 1ODKA 4Q7QA 1TTPB 2RBKA 3A2NA 3ETJA 4G23A 4N8SA 1VSBA 2YRXA 1KE2A 1Z0FA 1E8MA 1Q74A 4JP5A 4JFRA 3L8CA 2QPAA 1A69A 3GLUA 2C7OA 3PFWO 4BP8A 2RHRA 5E4FA 5AQEA 1K97A 3OECA 4FFDA 5CVJA 1WE2A 4JT4A 4WXPA 2OP0A 3B5EA 1G5HA 2IYNA 3EHEA 2H85A 5G0WA 3W9YA 4JROA 3RNLA 1OY1A 1V4BA 4BX8A 4JC0A 2IU6A 5DJ5A 3I1IA 1IVSA 2ZUVA 4MPDA 3MWJA 3GVXA 1JMKC 5CVUA 1Q0ZA 4O4LB 4DSAA 2D0OB 2VQ3A 2W8BB 4J90A 3GPBA 3HJBA 4MPPA 4H1UA 4Y1RA 1GQOA 5GOZA 4D9NA 5HOEA 5I45A 2PX8A 3JQGA 4A15A 3TXAA 1N6OA 3OQVA 1RJ9B 5AIAA 2WWWA 3SIWA 3UJCA 4BTLA 2L2QA 4FUQA 1CP2A 4D8TA 1YD7A 3NHRA 3F6CA 4IZ6A 2PNFA 2I29A 3KKEA 4KBFA 3SHTA 3N2GB 2WWGA 2YMQA 2G07A 3HKEA 3UJDA 1T9BA 1ULHA 4WERA 2BGMA 1ZZEA 4OIMA 2OKGA 4UU1A 5EGSA 2H7YA 4N1AA 3TK1A 4NRDA 3K1JA 3RTBA 3IKTA 1KBZA 4RQUA 5EY5B 2Y1CA 3ZS9A 2R6CA 2OMEA 1QQBA 1T4GA 3X2EA 4MW5A 4O2BA 1M8FA 2WAYA 3DLTA 2DWPA 3DBHA 1LBHA 3S0JA 3HSYA 2GQ0A 2QD3A 2Y71A 2IPOA 4PYRA 1L4GA 2ZB3A 4QT0A 1CIVA 2IXBA 2NZYA 3PZBA 4RVCA 4RY8A 4ZOAA 4C7OA 1MEJA 2XLBA 3IUNA 2C31A 1XA0A 3TVTA 3Q9SA 5AK3A 3ENVA 5ED0A 3VOTA 4GMKA 4R0NA 3TMYA 5BYKA 1U99A 3MCZA 2X3UA 4K6OA 5TEVA 2EBHX 3U1TA 3BD6A 5JCPA 3D0OA 1WMAA 2PLNA 3ENWA 3PV0A 3ZI4A 1KRXA 1V8BA 1FXWA 1Z22A 4CU2A 4Q4AA 4TYYA 1MIOA 4NMWA 3O26A 4GGOA 3JQ9C 1U28A 1P1RA 3BOSA 4FCVA 2XBLA 1F51E 2RHWA 1UP4A 2EV9A 1C1DB 1VI6A 1TIPA 1KEPA 2PX3A 2ZSBA 1K9SA 3TTVA 2DSTA 3T7TA 3CJRA 2CVZA 1MRZA 4NONA 4ES6A 3O92A 2AF4C 2FP4B 4MRMB 4ZQFA 6NULA 3V7UA 4NV3A 1VPWA 1WV1A 4BECA 3HJCA 5AJHA 1W44A 3Q3GE 4BAZA 2YYZA 1PGQA 1HE4A 1U0GA 5JZBA 3JWIA 2PMDA 3K5IA 4MGIR 1NBME 5FL3A 2AJTA 5CDFA 2NTNA 3F6SA 4B17A 1TIKA 3MXOA 1ESNA 4HFMA 5KC9A 2JRCA 3SXUB 1YBAA 1NRXA 3I8SA 4MR8A 5C5EA 3A9TA 2FW6A 2I1LA 4F11A 3IBTA 2G1JA 1XQXA 4WX2B 4OQZA 3R0IA 5BSVA 3PXCX 3Q7TA 2QRZA 3WAKA 3ANYB 1ZM4A 5DHFA 1XOIA 1YQUA 3HBFA 2IU3A 3H75A 5AO9A 4DILA 4FCCA 1DTEA 1O5IA 2PS3A 1E5DA 2Q21A 4Q12A 2I2BA 1IY8A 1QHHA 2LDBA 3QLVC 4BLUA 5H5JA 4UTRA 1V7ZA 2XPCA 4HATA 3QFCA 5FPYA 3L6UA 1NBOA 2I3GA 1TQ8A 3TCXB 1P9OA 3ETGA 3MYRA 3M4YA 2J8ZA 2L17A 2X5JO 1V11B 1NVUQ 1GAXA 2RBGA 4GE3A 1K92A 3QPCA 3NJ8A 3DFKA 3QE0A 2X7HA 4L78A 4NCIA 3U4DA 5IDQA 5BN3A 1PR4A 3H83A 2R751 4I08A 4BNDA 4U6QA 1YRHA 1H8HA 4BNXA 2DOKA 1U2DC 2ZJ1A 2Y93A 4G0YA 5DE3A 1CJBA 2XQVA 1NMQA 2YVUA 5KNBA 3GJ3A 2YWJA 3K4QA 5KI6A 3ONEA 5F5XA 3TXYA 3SNKA 4N5LA 5HHTA 3DFUA 1AVTA 2XRMA 1ZEMA 4J8PA 4YR9A 4QG7A 5BV7A 3O8CA 1VL5A 4BLTA 4KX5A 3DT9A 1EGVB 3NYIA 2VA8A 3A6HA 4H15A 3EPJA 3O4IA 3LUKA 4WXRA 3E4DA 1VMDA 5K6TA 5LMUB 1U1EA 4QIHA 2B9EA 3KVRA 3M5CA 3QI2A 4CMKA 1SHTX 4P93A 4PLCA 5TJHA 3L7IA 1L5ZA 1BTOA 2JLBA 4N5MA 1IZYA 5EXPA 3OQ1A 2R1VA 1ZI8A 4O0LA 1RYFA 1XZAA 3A6ZA 4NECA 2OC9A 5F2NA 2JCGA 2VBCA 1KR2A 5ES4B 1JQJC 1Y4UA 4FGZA 3E0XA 1E4EB 3FFWA 4PXAA 2AC4A 2Y1OA 3U5TA 2GAAA 3F3SA 3QXJA 4LYEA 3T7KA 4B83A 2R97A 4EHIA 1I0ZA 1IEQA 2PEYA 2W37A 1R6DA 2FX2A 2XUQA 3E53A 4LBYA 4LJSA 3WYCA 2PBFA 3W5DA 1IUPA 3MJEA 3ELDA 4QDXA 4KPFC 5PGMA 2NXEA 3VJMA 4D0NA 1KJJA 2VRCA 4XLTA 3MTGA 3BTVA 4G0NA 3CH6A 3DE0X 3FYTA 1KZYC 2PN1A 1JIIA 1K8QA 1V1RB 1FX0A 2V96A 5K3EA 1XFAA 2G0TA 2PFSA 2H17A 4RE6A 4O3FA 2ONJA 2BKEA 3ST7A 1ZI6A 4Q7LA 5G3ZA 1QCCA 1SXJB 2FLWA 3DL0A 1Q50A 1T4BA 1YE8A 2VSOA 2VO1A 3L8ZA 5AHXA 4E15A 4EPWA 1WBJB 2WZQA 4ESEA 1FS6A 1TUEA 1TVMA 4WMLA 4YCBA 4Z3OA 1Z6XA 4NC9A 5T4FA 5AWFC 5B7GA 1GCUA 1JWLA 1IM5A 1NULA 2DCUA 3A04A 4KFSA 2ZQYA 1DZ3A 2V1UA 1QU3A 1WXDA 1B1CA 1DRWA 1TLTA 3R6WA 1XU4A 2NSDA 1K4KA 1S2OA 1FS5A 1W5AA 3LYHA 3DTTA 4MVYA 2ZTVA 2AOVA 4LJ6A 2PANA 1VZ3A 2VPPA 5LOVA 2CNKA 2NO1A 1UBOS 4RIEA 4KZKA 2L69A 1YZFA 2OYSA 1OLSB 2X19A 3BGSA 3EMBA 4WGFA 4CGYA 3K6SA 3C98A 2AJLI 4YRTA 3QQ5A 2W90A 4GKAA 2NWQA 2C7QA 4V0NA 4TLLB 4ZDKA 5I9NA 3IVRA 1PJ8A 4HGZA 4NKRA 4BX2A 2R8OA 1XNGA 2ZYGA 2QUKA 4KWIA 4X90A 4EF5A 1QGUB 1P0PA 2G5GX 4F4CA 2H54A 1JILA 2A30A 2Z3VA 2H59A 4KLZA 4WFJA 1Y7TA 1ZISA 3KFLA 2CD9A 3HGQA 3SU8A 1EJ6A 5FEUA 1IN8A 1FC0A 2JH9A 3OCWA 5DH9A 5F78A 3B6KA 5KKCA 5TPWA 4HK4A 1U4SA 4DUZB 4WVFA 3OKAA 4KV9A 1HETA 2BI7A 1FDSA 3LUGA 1QO7A 2VK2A 1N6KA 1QKJA 2Y2VA 4PX3A 1SOUA 3F46A 4ESHA 1NJGA 5KNDH 1BE8A 1KFEB 4P80A 3ZHXA 2ZANA 1QONA 4QL3A 3HN7A 4DNXA 1WP4A 2WWXA 5C3MA 4AZSA 3DE5X 2WG0A 2YRWA 1H85A 1A82A 1SHJA 5IHPA 1EE9A 5BSFA 1RBQA 4H35A 3D6VA 4IILA 1Q95A 4HDAA 3WK7A 2P2CA 4YI3A 1MB4A 2PBZA 2XODA 1ESMA 2HJGA 1NVGA 2A3RA 2UZAA 2V8OA 3GGOA 4EH1A 4UM9D 4BMCA 2HBQA 4LN1A 5LIPA 5I7UA 3L0IB 4F5ZA 5HBRA 2YBDA 4TS9A 4A16A 3JY6A 2Y0PA 1LVGA 4K6FA 3UK7A 5SV2A 3P2JA 3RVSA 1HNNA 4BE4A 1MA0A 2E4WA 3DQPA 1TZBA 4RVNA 1CTQA 2HBZA 3M2TA 4U2FA 2VF8A 3EIHA 4P33A 5T4BA 5IAKA 1JEDA 4OQEA 2BGUA 1CRWG 5F5NA 2BOVA 4QBIA 1T2CA 3RV4A 1J6UA 3GCWA 8OHMA 3NVKI 4REMA 1G5FA 4QXMA 1ADFA 5M04A 4GG1A 5JZSA 1Z07A 2PV7A 3O03A 4MRPA 2RDMA 1CR6A 1M2VB 1CY1A 2AFIB 4IVRA 5DGHA 2V7VA 3UCEA 1ZVQA 1N9ZA 1YS4A 1X8KA 3EH1A 1U0TA 1GQFA 1S9DA 4IG4A 4MYHA 3WX0A 4R68A 1K6EA 2I2CA 4MPJA 2IYZA 3N2IA 3VOBA 4HUJA 4WBNB 5KQMA 3U7HB 4BZQA 1RKVA 2X2EA 2GN0A 3IDSA 1YS6A 3LNTA 2Q8NA 3NTXA 3ANNA 4L27A 4PR3A 5A3VA 4IINA 1Z4LA 1JG2A 4WNYA 2WSLA 3OZVA 3FE2A 1USUA 1E8NA 2QV0A 4DLKA 4DR5B 3B9PA 3K9FC 2P6NA 1PG2A 2DUJA 3UWOA 3ZHZA 3OOEA 2JFPA 1FOEB 5KOHA 5DF1A 5C81A 2R00C 1NP7A 3ROGA 3SF8B 5C32A 4YV1A 4HLNA 4FD3A 3HN2A 3VVMA 4IOLA 5B3JA 1ZWKA 4E6PA 5LR6A 1KO7A 2XZLA 5J4HA 3B9BA 2HNBA 3NYQA 5FFNA 4AO7A 3BICA 4HI0E 1F2TB 1Q0LA 2B8JA 5D3MA 4K81B 3ZUGA 1E1LA 1R64A 3ZJVA 1X7XB 2H2DA 2VYCA 1KI1A 1U7PA 2VSFA 3RSHA 3ZU6A 1UZAA 5KEIA 4HQKA 5L6LB 5I47A 3B2EA 1JR6A 1S2IA 2QS9A 2W2LD 4Z0HO 1LDYA 4ZFNA 2IZ0A 1UJ2A 1IRXA 2DPGA 1DRKA 1XC7A 2BL4A 4NU5A 4UJ3A 5BQPA 4DOMA 1QTNA 4CNBA 6REQA 2FZWA 2ORED 1E1YA 5E0KB 3CZ5A 1NOKA 4DMUB 1NW9B 1K6MA 3UPTA 1L7RA 4LF4B 3AIOA 3AFMA 3IDFA 4RK0A 2ZKIA 4TVKA 1W5SA 1PE0A 3RVJA 5CT4A 4F6CA 3CWZA 4ZZIA 5DXAA 4DVJA 1I7LA 2XI4A 2AD5A 4O4LA 5TXGA 4DMHA 1E2LA 4R2KA 3UK6A 1JR4A 4TRRA 1ZBDA 3EXEA 3AFHA 3D6AA 4IGKA 2N1BA 5HUQA 2BF7A 2Q0QA 2QN1A 4LF5B 4CEIA 3C7DB 4YJ2A 1JAXA 5LQKA 2YW2A 4LISA 3ZGZA 1LEHA 4MJLA 4LDPA 1Z83A 4GLFA 1YZTA 2QD4A 3G1UA 4WUTA 3PX2A 3EMVA 3GB9A 4GX1A 4O0MA 2I6UA 2E85A 4OBBA 5CT6A 1K27A 2D1FA 2OHOA 1YB5A 3F7TA 5JPIA 4KMRA 2AEEA 4C76A 4HYYA 4AF7A 3HC7A 5L7WA 2VJAA 2V6GA 1DZIA 1XMIA 2WYUA 2DKNA 4WLVA 3RVMA 3HHEA 5TT0A 4X61A 1JEQA 2Z8YM 3VZQA 1EXVA 3NYWA 3ZGXA 2GN2A 1NL3A 3I73A 1SJ9A 2PG3A 2QRUA 5AKZA 2QQEA 4IIUA 3GFGA 1N32B 3H5WA 1I2BA 1QO0A 4QUEA 3TLKA 4P2BA 5ICMA 2X0DA 2QLFA 3I3SR 2D13A 2RGCA 3LOUA 3VFDA 4BFTA 3WB1A 1ZUHA 3TQQA 5LN1A 3GDFA 4MDYA 1U9IA 4UTNA 4FOOA 4MRVA 3MJHA 2K87A 4MEBA 2RFLA 1GZ6A 4RPHA 1P5ZB 1XCMA 1SHZA 1M2OB 4G4SO 4QUJA 1UFKA 2FHPA 3E1SA 3G5MA 5JD3A 1C7EA 1RRGA 2IZ7A 3ENQA 3NTRA 3SZMA 3PWTA 3P19A 2O7RA 3T6KA 3MWGA 4HNGA 5FUVA 4PFJA 1U8UA 2QAGB 2CDBA 1SIOA 4QAJA 1L7MA 1IOLA 2MR6A 5DTEA 3O2SB 4WTOA 4P5DA 1PJQA 1Z15A 4MVJM 3KXPA 3QYFA 4OHOA 2ONCA 4MS3A 3TDNA 4TKVB 4IRMA 4JJKA 3B48A 4BVHA 3G9QA 2VOEA 2OPBA 2E5LB 3BXZA 2WTBA 3GBPA 3QLJA 4G1UC 2JLRA 1ST2A 4MKGA 2RCNA 2XA9A 3I8XA 4MUEA 3FMOB 4L8VA 3H5TA 3WGLA 4EA6A 1BGVA 1NF2A 1P9LA 1VYUA 3DMNA 3MMZA 4X1OA 3RFUA 1X2EA 1TLLA 2IY7A 5C5IA 4GBJA 1E7MA 3SJ7A 1KKLA 1X42A 2WSSD 4H60A 4XCVA 2QQ0A 4GLLA 3H04A 1XZJA 5ARCA 4DPMA 4OHWA 2ATEA 1O6BA 1FRNA 3C8MA 3LUFA 1J06A 1ENYA 2AX3A 5ADHA 5JWOA 5LNK6 1K89A 1XSEA 1GT91 3I0NA 1O89A 3R3UA 3R5FA 4X1KB 3F2VA 3OO0A 2GAJA 2C2YA 3B8HA 1JDUA 1STOA 3Q41A 1G3UA 5THQA 2JJ1D 4NG4A 2H1OA 5FI3A 3ZLUA 4EHBA 1Z0SA 3KXLA 1G55A 4XYEA 2OD9A 1DIAA 2PRJA 4WLEA 4Y6QA 1GCGA 1YUNA 1Z37A 2XGOA 3CY6A 1NXOA 2X2OA 1BWRA 4FI3C 5BQXA 3KJHA 4HLUA 5JCOC 2W4IA 3I42A 1OXVA 5AM5A 3SX4A 1XEAA 1ULSA 3AWDA 2XX3A 2O50A 1CJTC 3L7KA 1A8UA 3WLMA 4MAMA 2PY6A 3I9MA 4XX1A 2IV3A 3QEAZ 3I2FA 3OVMA 4KYVA 4YJ3A 3RSLA 5DEIA 4KQ9A 3MB8A 4QJ4A 5JHGB 3FCXA 1P77A 3TKLA 3UAGA 3LHIA 2XYVA 3D02A 5KOJA 1N77A 1GP2A 4RLFA 3JATA 1SUWA 2YICA 3UJPA 1WB5A 4OB8A 5FUXA 5CGZA 1KEWA 1KZGB 5G1PA 3T7JA 5K6RA 1A04A 2WFAA 3UUFA 4TV9B 2DR2A 2M6SA 3C16C 1Z25A 1KMHB 3E58A 5T41A 4IFTA 10MHA 2HLHA 3C6YA 3IQHX 4Y6GB 1RPJA 3FLAA 4GRAA 4RKYA 1BMTA 2AOTA 3HCOA 1XAHA 4G0WA 4V0LA 3ZCRA 3EUAA 2HBYA 1SBQA 3D8HA 3JVDA 4U39A 4XIGS 4J49A 3NUGA 3LVRE 1YK0A 4BCBA 3B53X 2ZJFA 1SQ5A 2DBQA 2GXSA 2IA5A 2ZBQA 3NTOA 5CHEA 2NPOA 4YMIA 5FUYA 5C51B 3HJFA 2J59A 3C3WA 1KMNA 5HR5A 5TS2A 5ITSA 1N33B 1SKMA 1UJ6A 1UCFA 3E3AA 3H4VA 3IAEA 3C1AA 4DCTA 3KR0A 3AB7A 1Z4JA 4IV5A 5GZ3A 3ADCA 3U4IA 1H05A 4KIFA 4YLGA 3L6EA 1Z47A 4OK5A 3IUYA 3FDZA 4BGIA 4CF4A 4KITB 3D59A 5E1DA 3PHCA 4OFXA 4TLEA 3HI6A 5KYYB 4JLPA 2XCOA 4P31A 4D8YA 1GZSA 1PLLA 1Y9AA 2PGAA 3I04A 3TWOA 2MT9A 1S2MA 4GGMX 5AM2A 3U16A 2W2NA 4DMCA 1NE2A 4PYIA 4IGEA 4AO8A 1YR3A 4A8HA 3FPBA 3IQIX 5BQ5A 4QUAA 2DPXA 5I9SA 2ZAOA 3GT7A 3EIWA 2PUJA 4ZVTA 1NVWQ 3BGOS 2JC3A 2JLQA 3DL7A 4ZCLA 4ARZB 3D3WA 1YVRA 4X8MA 4C2BA 2XUIA 4WDQA 2PMEA 4CF3A 1R5NA 2J4DA 4GYKA 5AJVB 2A0UA 2E4XA 3ZDQA 4H1WA 3OEHD 2ZRGA 1P1CA 3E82A 4E2WA 2QVBA 4EAAA 1ADYA 2INGX 3D4BA 3SFZA 4EPVA 2AMFA 1FLDA 5HYVA 3BGWA 4MR9A 3MPOA 2P3QA 2ZCUA 1DBSA 1HLPA 5CT5A 3DBRA 1DBIA 3TN7A 1FP6A 4PQYA 1CX9B 5AJXA 2D6FA 5A0VA 3F1LA 1OWNA 3KKPA 3CZPA 3C3CA 3E1KA 4OKIA 2JB9A 2XB8A 2YCBA 4I4NA 5CT9A 1MG5A 4ONEA 3ZN2A 2ZRIA 3TLCA 4NPAA 4Q6WA 3HYRA 3RVRA 5GJCA 2GK3A 2BR3A 5BWMA 1A8QA 2NOAA 4R81A 1GNRA 1X86B 3D5EA 4OREX 3TIIA 2P62A 3UFXB 1RI1A 1UK7A 1U5BA 5ADUS 5KYGA 3ROXA 2X9LA 1P73A 1D2RA 1UXOA 2FSVC 3GMTA 1RAGA 3IILA 1I7PA 1TJ4A 1P8JA 3P0FA 3V8NA 2QLMA 4IW3B 4P7FA 4U2GA 4S04A 3GGCA 5L3RA 3IR5A 2NU8A 3OH8A 2BM9A 2GSWA 1JEYA 3K73O 2HK9A 1EXNA 1LCIA 1IPHA 5A4IS 1AUPA 4KQJA 2NU6B 3SEZA 1I0LA 2IHBA 5KTYA 2YUIA 4DA7A 1Q3HA 1RMTA 3MT8A 1N9KA 1NUPA 1OIWA 3BREA 3KS9A 4RMHA 3UB2A 1EPUA 4ND4A 1EFRA 5TS3A 5K2OA 2YN0A 5B3AA 1SURA 2BBWA 3E03A 1MABB 1WPXA 5ELMA 1Y48E 3D0QA 3GJ4A 5ALKA 3T99A 1C1HA 2AN3A 3PUXA 2W0MA 2IHJA 3AJRA 2HUPA 2O2XA 5HWSA 1OZ0A 2VF2A 1AQJA 4B4KA 3L40A 2PIDA 1A96A 1P0QA 3A3OA 3ADBA 3SMQA 1L5WA 3ZEAA 4CLOA 2W6OA 2XCLA 4Z4FA 4KIJA 2JIDA 2QSJA 4G8JA 2WYHA 4Q1DA 1ICIA 3J7AC 2YY7A 4YNBA 2XT0A 3EQZA 4KR9A 4EUKA 4I4LA 3VC1A 4C05A 5JRJA 4QUDA 1MQ9A 1ZOOA 4HEA6 4KE9A 5DSTA 1NQOA 1SB9A 3L8DA 1M2WA 1JFFA 1N5MA 1XTTA 2VTKA 2ZBRA 3QWIA 3ASUA 4AUEA 2FEOA 3BWCA 1M2GA 5U4QA 2PRIA 4Q3CA 5IPFA 1CETA 2HB6A 4BNUA 1QDLB 4KWTA 1WHTA 2ENUA 1SXJD 16PKA 3HACA 3MCTA 1Y1RA 4US1R 2XA2A 4RTLA 1ZK0A 4MUGA 1ATIA 1FMCA 2A9OA 4BZPA 3SIXA 1LJLA 4PAWA 2W48A 9LDBA 3AF4A 3ELYA 1FYFA 1R5OA 4Q3KA 4YRIA 3DC2A 4FEEA 4YP0A 5FNVF 3PIRA 2E4ZA 2FSSA 3X1KA 4CEHA 4K9KA 4NYMQ 3TW4A 3A6LA 4Q7EA 2EW8A 2DQ4A 1WP9A 4H9GA 4XCXA 3TJRA 3ZVNA 1GD1O 2YIVX 1R0CA 1L1FA 3ZOZA 2HWXA 3LXUX 2ZYAA 1U02A 5DLEA 2GJAA 1V25A 1NJ2A 1Z6ZA 3O8QB 3EVFA 5FP0A 3W3ZB 4XB1A 2LBPA 5JOQA 1K1EA 2ISQA 5L3SA 3EVNA 2XXAB 3ZW9A 1EDBA 3LY8A 4NTZA 3LF2A 3NHFA 4EO9A 4GU5A 4LK2A 2WIGA 3BSSA 3ZWNA 2HN9A 1W30A 2I8AA 4BO0A 2UYYA 3EYWA 3C2QA 2HRRA 2XDAA 1HA3A 2BUAA 4ITRC 4BX0A 4BVBA 1US8B 5EUQB 4BNFA 4EUEA 2XRYA 4G1FA 4Y2YA 5EMJA 3MVEA 3X1ZA 4A4DA 1EVZA 2VYNA 3BH7A 3M6UA 1FMLA 1G20A 2F43A 2ZJ7A 3KLMX 1DAHA 2I3ZA 1G2QA 4EITA 1NYLA 2XMGA 1SVLA 3HU3A 4II7A 3GQVA 4CR6A 1HM5A 1PYDA 3G7UA 4MVJD 2VKQA 1X1RA 3DBVO 4M0PA 5ALFA 2BM0A 4JITA 1R4AA 1Y9JA 4CE6A 1EMDA 3PQ8A 2YOHA 3RYFB 3T06B 2ODEA 4R1MA 2PUEA 2ZIXA 3AL3A 2PS9A 4N0QA 4BNHA 3HJTA 3DDZX 4P0PB 1E2UA 1UBSB 4MK4A 4IV0A 4L4UA 3NP9A 3Q88A 3IAAA 4RSGA 4YVFA 3UJAA 4GKBA 2VHWA 1CJKC 1M34E 2O20A 2UZ0A 4Y6OA 1ZMRA 3LE8A 2C98A 3MCVA 3R3JA 2UVQA 2YIDA 1OJLA 1ZONA 2N47A 2G4CA 4IVQA 4QRHA 1WEHA 5FO1A 1CC1S 4XYGA 3S2UA 3ZU4A 4E7PA 1Y4SA 2I1QA 4GX5A 4ND2A 4ARCA 2O1SA 2ZG6A 2AOWA 4YIKA 2R8PA 2ONKA 3COVA 3CR8A 1X8JA 4OF4A 3SS8A 3K1ZA 3NVAA 2ADOA 2QR2A 3SMVA 1NPTO 1DQZA 1X38A 4RK7A 5B6JA 5IW8A 2C3OA 3X1JA 3WIEA 2HBRA 2V6JA 3I58A 2NW6A 1G5TA 1AF7A 2BEKA 5JS8A 5K3BA 1T2UA 4BFWA 3WRWA 1GU1A 2NG1A 3GELA 3SQDA 5GAJA 1HI9A 2RK3A 2Z2YA 1I2MA 1RRMA 4JXJA 1N2ZA 1OFUA 4DCCA 2B3TA 1D4AA 1GV0A 3GDHA 2BFDB 2VPIA 1FU4A 5LXTB 1N7HA 1CBUA 1SKYE 1DAPA 2D1QA 2QDXA 3D1VA 3G79A 1ZU5A 2W83A 4RJKA 1I8TA 2RI6A 3IMKA 3JYQA 1V8PA 2IYOA 3K0HA 5D3ZA 4UNRA 1T2NA 5ESRA 1E58A 5L51A 2I4RA 5KVAA 4D9MA 3CO5A 1N75A 2O3UA 1ZOPA 2PU7A 3QX7A 4XDHA 5CIQA 1C8KA 1YZQA 1YAHA 4FD2A 4RFSA 1E2IA 1UWCA 4I4TA 3GLGA 4ZVLA 3HBMA 4GM1A 4Y2XA 1SCJA 1IJKA 2BRUC 1C1YA 4TKVA 4G0VA 4O4JA 2QR5A 2EP5A 2ZJOA 1HOXA 4H6PA 5LJIA 4QD3A 2AN5A 1L7EA 5FTKA 1FXSA 3M3PA 5I9BA 4WOJA 2YZKA 4TUYF 5J5AA 4I50B 2JL1A 4EELA 4R71A 2H7CA 3IDQA 5EL0A 3VZBA 4YAIA 1O97D 2ID9A 3D4NA 2E5FA 2ZRNA 3GRAA 3OPXA 2WKSA 3VYWA 2AXNA 4MO9A 3JD3A 2CMFA 2J5XA 4MB0A 2COKA 4BE7B 2ZTMA 1IHDA 1QQ5A 3N7AA 4AU1A 2WG1A 1ZHHA 2XWSA 5CFPA 3WLIA 4ND8B 1UIMA 2QVGA 1V1RA 1P0FA 1AK9A 1R88A 2Y6VA 1DRVA 1EWVA 1QDUA 3ODPA 5E1MA 2A9QA 1SK8A 1QRDA 3B38A 3RGWS 2GHIA 1TF7A 4DG8A 3Q87B 2FCRA 2J46A 3ROFA 1FX1A 2RJ3A 1J97A 2H9AA 5DM0A 3MSCA 5HE9A 1W25A 5FWXA 3TW8B 1AMUA 1VXRA 1SZJG 2YKGA 1G4AE 5EIHA 2LCQA 1Z82A 4N03A 4AJHA 2ZW9A 1W0JD 2NT4A 2Q5JA 3H11B 4GPAA 1TNDA 4G41A 4NK5A 4AJOA 4LRUA 4P4GA 5FBRB 4RENA 3W7AA 4BV8A 2BJHA 4JIGA 5F23A 3UJ7A 4TYWA 4Z51A 6ABPA 3X2SA 5B1IA 1PJBA 4RGYA 2PQ6A 4W5TA 2BZGA 2I66A 2R6ZA 4LYAA 3CG0A 4B76A 5ICSA 2FK7A 4IDPA 4CFYA 3W5IA 1IZ7A 3BHIA 3L43A 4X84A 2WU1A 4MCHA 1NJ6A 4YDQA 5JEEA 1PBNA 2QGZA 1PT6A 5BV8A 3ED1A 2GX6A 1GPH1 2GERA 1JFLA 4X93A 2ZYTX 4OUKX 3UMGA 2GM4A 3N5CA 1Q77A 5EJ9A 3I4LA 4KNWA 1IXSB 4D5GA 1D5CA 2AMJA 2VT6A 1P1JA 2ZSJA 1KZHA 4CPDA 4CLRA 5TGTA 2X5OA 1FYVA 2I7VA 2QPOA 2YJ6A 2Y1WA 3VH1A 1FNSA 2AXPA 4CM7A 2I2FA 3IR6A 1A76A 4OQLA 1YU9A 2FN3A 2ILVA 4JCOA 4ZJZA 4D4GA 3CHYA 5CPBA 2H1LA 3C7KA 3P27A 3KKNA 1OYWA 3QU2A 5FBWB 3PRYA 5IVKA 5AI5A 1R5JA 2A0KA 4HC4A 2H2WA 2Q1XA 2R65A 3OT4A 3BDAA 3ONVA 4P2GA 2HCTA 4QUKA 5K1ZA 2BEJA 3GWGA 3P2YA 3UVEA 2FUEA 1UBFA 3FETA 1A4RA 1RPTA 4ZOBA 3OBIA 1VPLA 3D1LA 1SQ0A 1EFVA 2H9YA 3M9WA 4II3A 3UY4A 4EB0A 2QPTA 1WCXA 3I0ZA 3AETB 1B3BA 3C0KA 3Q8XB 5KX5F 3KSUA 1E1CB 1ZN2A 1ES9A 3BK1A 3FOAA 3L2OB 4IUYA 3W4KA 3OQMA 3KTFA 2JGKA 1CUZA 1CT9A 4R31A 2ISSD 1AQIA 3ZX5A 4B0OA 4E2FA 5KTPA 3WL7A 2NLOA 3O9ZA 4ZEOA 3CVWA 1I94B 3GNTA 1FMFA 2BEUB 4OB6A 1DAIA 3KD3A 4ARZA 2JPDA 3MOSA 4LHSA 2CHFA 1F4VA 5KO2A 1HNXB 1OH6A 5K05A 2JKVA 4EVRA 3PE6A 2Q1WA 3UH1A 1EUQA 3ME5A 3DFZA 3BYZA 5DGXA 3ND6A 2OBNA 4XUCA 1BA2A 3PFIA 4YRFA 3RFTA 4OI4A 3SFTA 4F12A 3FPAA 2AUTA 3B85A 3KQMA 4PO1A 4ZO4A 2W2KA 1KYXA 2OQVA 1M3SA 4H7JA 2BMVA 4YC7A 3B3GA 3AR9A 1R6TA 4RY0A 2I4MA 3HSKA 4F3CA 3KHSA 4O2AB 5JUWA 1DEAA 1LLFA 4KDRA 4OBEA 3ZW7A 1XMVA 3ZYZA 3GR6A 1AC5A 3UJ9A 1VP3A 3NGXA 4GI3A 3K6KA 5IABA 2ZRKA 4HVAA 1W34A 4JYPA 1VPDA 2V9PA 5DVZA 1C0EA 1ODFA 2EL9A 2DBRA 1QSGA 3W8FA 2EQBA 2IEGA 2RGXA 4CM8A 5I8PA 5AVOA 4JGIA 3TTYA 1U9JA 4BO2A 2H1WA 5B5SA 2Q0XA 4AQYB 2VLBA 3JQRA 5HQTA 3CX3A 5DTRA 2HCJB 2XE8A 3R7AA 5TQ2B 3AVYA 4CM1A 3ZZTA 2ZAYA 3OIDA 4R7ZA 1AY0A 5LB2A 1L4FA 1REQA 3SF8A 4HQRA 1EQ2A 1C29B 2IP1A 2OV6A 3KJXA 4CMJA 5K8JB 3BTOA 5FO0A 3LC7O 4ZICA 4EA8A 1KI3A 4PLPA 4RGQA 4RKRA 3INGA 4IDOA 4K2HA 3WHIA 4N7JA 2VTVA 1IQPA 2X1VA 1RYHA 2HPAA 3OWHA 4PFKA 4X00A 4DBLC 1BMQA 2VH2A 1HYHA 4Z5XA 2QB5A 3ITKA 2QMUA 4I1RA 3ZJ4A 1DPGA 4LXTA 3L1VA 4AXXA 4OLHA 1VYVA 3K6RA 1MABA 3LLSA 5KIAA 3FSJX 4B3RB 5JJCA 2D59A 4HO1X 2PXHA 5J40A 3VKHA 1YK1A 3M7IA 4OGLA 4I46A 3COZA 4AYXA 1Z0JA 2EX0A 4RK6A 5IAEA 1XKLA 1DNPA 4U7JA 3WK9A 3V6LA 3ZDYB 2VI5A 4B81A 4MRSA 4AZVA 2I6SA 1KVRA 1RWBA 2IODA 2E4YA 3S6JA 1V48A 4ZKEA 3RYIB 1PRYA 1YJXA 1JIVA 2QVLA 4HH0A 1U7XA 1M1UA 1IHXA 1UXHA 2HCFA 4MS4A 4UAGA 5HZGA 1L5SA 2ZI4A 4YJ2B 1TZKA 1V71A 3V4PB 1Z5OA 2Y1KA 1WB6A 2ODPA 1L3BA 3I2JA 4HH3C 4KE7A 4ZHQF 2XQFA 4RTMA 2V65A 5IF9A 5CM9C 2QRPA 4ECEA 4K8RB 1NW5A 4PY2A 5JJLA 1RAFA 1NXVA 3GY0A 1IEXA 2ORYA 3K72B 1O5OA 3O0DA 4X45A 4AJ9A 4Z4CA 2ZTSA 3MFQA 3OIVA 3RREA 2H2AA 1KEUA 4BNGA 5K6AA 2GKGA 3AI1A 4OK3A 2P9YA 2AZMA 1Y8QB 3NRCA 1ISGA 1RI4A 3PKIA 4FKZA 1TUBA 1V3QE 1X7YB 4L9AA 2YRFA 2CW5A 3MUFA 4R2HA 4HV4A 2D00A 3EDCA 5L4SA 4FDTA 3IEUA 4AY3A 5J4LA 2C2KA 1P17A 2I33A 4BO3A 2PZ8A 4UU8A 3W7BA 1G1AA 1LSSA 3FB1A 1AZWA 3GVPA 1G59A 1PBTA 5HG0A 3RG8A 3HBAA 3RVNA 4X20A 1U9YA 1SXJE 3EIFA 5HK9A 5K0CA 3RIHA 4CFSA 1CJCA 3DLIA 3WLKX 3TZBA 5T7BA 2I2WA 4MKXA 1TEHA 4F9TA 3O8QA 4L0DA 1ZG3A 4C7BA 2TMYA 1H2EA 4K26A 3DBIA 4N3NA 3AVTA 3KJFA 4JHXA 5AXCA 1DS6A 1JMYA 4RANA 1DRJA 1E9VA 4X6UA 1UFOA 3KFXA 2RHCA 5DNEA 2B1GA 2ZZMA 2O3SA 1XNQB 5HJ7A 1M2EA 4FEGA 1CFZA 4H27A 4HZUB 5C4GB 3QOWA 3WL8A 1KARA 3B70A 2VYQA 3CRZA 1GSOA 1ZVMA 2FPSA 5EKXA 1RYDA 4B35A 2R0QC 3PGMA 3GHHA 1QQ6A 1T3GA 1TXGA 2IXGA 2JJYA 3COSA 2AI1A 2AUNA 3IP3A 2ORWA 1ZIXA 4Q9NA 5DYIA 4L5CA 1NXTA 4ZU6X 5LB4A 1XJ5A 4CCYB 3LCJA 4U02A 3OZBA 2IY9A 2Q7DA 4CN8A 2ZYUX 2V9ZA 2GPWA 2QEQA 2WOOA 1T1EA 2V7PA 1V1MB 3K9QO 2GCOA 3OX1A 3WL5A 3VBEA 4UU0A 3GJYA 5E8RA 3RYFA 2BD0A 3ND7A 4GRDA 2A92A 2O8DA 5GQSA 2JH8A 1GKIA 1OX6A 4D25A 3GUCA 2BMJA 4LC0A 3WC4A 3HO1A 5JYDA 4X1KA 2B25A 1KOGA 2XMRA 5EWJB 4PN3A 5EJEA 5D84A 1VP9A 1V3TA 4EATA 1W8DA 3DOCA 3N2KB 5BWBA 5DRTA 1O54A 2J6BA 4GOOD 5F2OA 1FP1D 5JXGA 1PVOA 3IQWA 2HRZA 2BWJA 4GQAA 3L6BA 3FBWA 3RTEA 4M7PA 1E3EA 5H3CA 3TLAA 1VRVA 1JHZA 4KMOA 2HQBA 1AK2A 1BO6A 4HAUA 3BFXA 4G4GA 1ZH0A 1BMFD 3MAGA 1ZOSA 2R8EA 1ACJA 2K2QB 3TUZC 2G1KA 1NUTA 1YSCA 2R6JA 2FRVA 1XZDA 3CLKA 3QENA 4M22A 1T0UA 3MJVA 4G0MA 3VO9A 3BS4A 3S68A 1DSSG 3FG9A 2I87A 4ZHQA 1SUEA 2BYTA 4L8YA 4X0EA 1YACA 1D9XA 1XZIA 2FEXA 1K2WA 5KOJB 3ASVA 3AYXB 3BERA 1OVGA 4UXIA 3FFXA 4HGQA 4AI6A 1LSUA 2AX4A 3BAFA 1GOTA 2AKYA 4YAUA 1X94A 4EW1A 5LXTA 4FDLA 2CFRA 1UJBA 5TARA 1TEVA 5J2UA 1BGWA 1PO7A 3GLHE 1WM1A 2DLCX 1I4TD 1ISMA 1CY7A 3PVSA 3WI7A 1EVKA 1UDXA 2HRCA 4Q9HA 3ZIDA 2N46A 3MS7A 2WD7B 3ZQ4A 3KT8A 3WMEA 4EVQA 3CLRD 1ORRA 1KQNA 4ZARA 5K0EA 4PNHA 1GPNA 3P2KA 3V8QA 3IALA 3VQTA 4D3ZA 4Q3OA 3EE6A 3MTDA 3BD9A 4FFSA 2OK8A 3KQQA 4GC9A 4XZ3A 2BSQA 1AKWA 1F4PA 4G97A 5B30A 3LQFA 1PS8A 3WG9A 2WTEA 3HE3A 4NLLA 3WNVA 4D0SA 3F97A 4GP6A 3FCYA 3RBXA 5D5HA 1YASA 3CMMA 5ENZA 3ZNPA 2FFJA 3STUA 4HMOA 1HG1A 1G9TA 1M2JA 1V16A 3LD9A 3IDOA 4PRZA 5B2EA 2HLDA 3ROQA 3C5WP 3UB4A 3C5EA 4WBNA 1W7AA 2ASEA 2PR2A 3FDZB 4IYJA 3DAGA 3UXYA 2XZOA 3M3DA 4OHMA 1L1QA 4O2BB 4LQCA 1E69A 5I4IA 3EFOA 5IJ0A 2JFNA 4KLAA 1VLJA 3NO4A 1I3LA 2H2HA 2YWXA 3FHOA 4ND8A 4FFBB 1JJVA 2ZM6B 4MV0A 2QXTA 4LTMA 2EHJA 3LFUA 5IJWA 2AJDA 2LD4A 3DEHA 4KH1A 1U8AA 1NY5A 1XPRA 4KG7A 1JHPA 1GAQA 2A6PA 2O8CA 1F2UB 6YASA 1PJCA 2BFMA 5MGNA 3TW8A 1G7SA 1IBCA 3PA6A 4GOMD 1HEYA 3PYXA 4QPDA 1PFVA 4Z2YA 1OOEA 2D5LA 3PGVA 1QG0A 1ZGAA 2DULA 4MMZB 4FK8A 4UTZA 2QY9A 4B82A 1Z35A 4QOIA 5AVTA 3R5KA 1G4HA 2J33A 2V7QD 2JG3A 1K86A 2NU7B 2PSJA 4KRGA 2JLVA 1KVQA 2NYRA 2QTWB 2WSSA 4UD2A 3BJRA 2F6RA 4GQIA 1VIVA 2JHFA 2EFYA 1IOWA 3K8YA 6REQB 2HLNA 1PLKA 4XGKA 2REXB 3I4CA 1K3UB 1HT1E 1W87A 4FMPA 1BKDR 1YOBA 5EWLB 3JZAA 4HXFB 4NDAA 4D02A 5AHKA 2NUAA 1CP3A 4JDUA 4MZXA 4S12A 4QGGA 3QITA 1DJQA 2GARA 1HV8A 3GEDA 4NOKA