1NLVG

Crystal structure of dictyostelium discoideum actin complexed with ca atp and human gelsolin segment 1
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
123
structure length
123
Chain Sequence
VEHPEFLKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Non-Vertebrate Actin: Implications For The ATP Hydrolytic Mechanism
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Actin
total genus 41
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2003-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1nlvG00
3EG9A 2QTVA 5KYWA 1M2VB 1Q8GA 3EFOA 3FG6A 2W0IA 1Q8XA 3A5NS 2LLFA 3A5LS 5KYXB 1D4XG 1EQYS 4PKHB 1P8XA 2LJ8A 3CJCG 1COFA 3EFOB 2NUTB 3L50A 4PKIG 2HD7A 1RGIG 3CIPG 4Z94G 5KYUB 1PCXA 2XF1A 1PD0A 5KYYB 3TU5B 3CI5G 1JHWA 1AK7A 5L6WC 1UDMA 1X67A 2FF6G 4CBWG 3EH1A 1V6FA 3EGXA 1VKKA 2VIKA 5IVUA 4CBUG 1TMWA 2L72A 3FFNA 3EH2A 2LXXA 1KCQA 2MP4A 1YVNG 2FF3A 1TVJA 1H1VG 4KEEA 1ESVS 1WFSA 3EGXB 2NUPA 1WM4A 2NUPB 4S10C 4CBXG 1T3XA 2FGHA 3A5MS 1NPHA 1F7SA 1QPVA 5KYNA 4KEFA 2FH4A 1HQZ1 2FH1A 5FAFA 5KYYA 1P8ZG 5HVKD 1YAGG 2I2QA 1J72A 2VILA 4PKGG 4BEX1 5FAEA 1MDUA 5DD2A 1WNJA 1D0NA 1AHQA 5A1MA 1AK6A 1SVRA 2XFAA 1CFYA 3EGDA 5KYWB 2D8BA 2VACA 3EGDB 2NUTA 2FH2A 1M2OA 3A5OS 3Q2BA 3FG7A 5KYXA 1CNUA 1SVQA 1VFQA 1PD1A 3DAWB 1NMDG 2FH3A 2MOTA 1NM1G 1C0GS 1M2VA 5HVKB 4JD2H 1T3YA 1SVYA 1T44G 3EG9B 3FFKA 3CJBG 5KYUA 2KVKA 4KEDA 1DEJS 1T2LA 1M4JA 1NLVG 2MV2A 4LIZA 1C0FS
chains in the Genus database with same CATH superfamily
3EG9A 2QTVA 5KYWA 1M2VB 1Q8GA 3EFOA 3FG6A 2W0IA 1Q8XA 3A5NS 2LLFA 3A5LS 5KYXB 1D4XG 1EQYS 4PKHB 1P8XA 2LJ8A 3CJCG 1COFA 3EFOB 2NUTB 3L50A 4PKIG 2HD7A 1RGIG 3CIPG 4Z94G 5KYUB 1PCXA 2XF1A 1PD0A 5KYYB 3TU5B 3CI5G 1JHWA 1AK7A 3DA7A 5L6WC 1UDMA 1X67A 2FF6G 4CBWG 3EH1A 1V6FA 3EGXA 1VKKA 2VIKA 5IVUA 4CBUG 1TMWA 2L72A 3FFNA 3EH2A 2LXXA 1KCQA 2MP4A 1YVNG 2FF3A 1TVJA 1H1VG 4KEEA 1ESVS 1WFSA 3EGXB 2NUPA 1WM4A 2NUPB 4S10C 4CBXG 1T3XA 2FGHA 3A5MS 1NPHA 1F7SA 1QPVA 5KYNA 4KEFA 2FH4A 1HQZ1 2FH1A 5FAFA 5KYYA 1P8ZG 5HVKD 1YAGG 2I2QA 1J72A 2VILA 4PKGG 4BEX1 5FAEA 1MDUA 5DD2A 1WNJA 1D0NA 1AHQA 5A1MA 1AK6A 1SVRA 2XFAA 1CFYA 3EGDA 5KYWB 2D8BA 2VACA 3EGDB 2NUTA 2FH2A 1M2OA 3A5OS 3Q2BA 3FG7A 5KYXA 1CNUA 1SVQA 1VFQA 1PD1A 3DAWB 1NMDG 2FH3A 2MOTA 1NM1G 1C0GS 1M2VA 5HVKB 4JD2H 1T3YA 1SVYA 1T44G 3EG9B 3FFKA 3CJBG 5KYUA 2KVKA 4KEDA 1DEJS 1T2LA 1M4JA 1NLVG 2MV2A 4LIZA 1C0FS
chains in the Genus database with same CATH topology
3EG9A 2QTVA 5KYWA 1M2VB 1Q8GA 3EFOA 3FG6A 2W0IA 1Q8XA 3A5NS 2LLFA 3A5LS 5KYXB 1D4XG 1EQYS 4PKHB 1P8XA 2LJ8A 3CJCG 1COFA 3EFOB 2NUTB 3L50A 4PKIG 2HD7A 1RGIG 3CIPG 4Z94G 5KYUB 1PCXA 2XF1A 1PD0A 5KYYB 3TU5B 3CI5G 1JHWA 1AK7A 3DA7A 5L6WC 1UDMA 1X67A 2FF6G 4CBWG 3EH1A 1V6FA 3EGXA 1VKKA 2VIKA 5IVUA 4CBUG 1TMWA 2L72A 3FFNA 3EH2A 2LXXA 1KCQA 2MP4A 1YVNG 2FF3A 1TVJA 1H1VG 4KEEA 1ESVS 1WFSA 3EGXB 2NUPA 1WM4A 2NUPB 4S10C 4CBXG 1T3XA 2FGHA 3A5MS 1NPHA 1F7SA 1QPVA 5KYNA 4KEFA 2FH4A 1HQZ1 2FH1A 5FAFA 5KYYA 1P8ZG 5HVKD 1YAGG 2I2QA 1J72A 2VILA 4PKGG 4BEX1 5FAEA 1MDUA 5DD2A 1WNJA 1D0NA 1AHQA 5A1MA 1AK6A 1SVRA 2XFAA 1CFYA 3EGDA 5KYWB 2D8BA 2VACA 3EGDB 2NUTA 2FH2A 1M2OA 3A5OS 3Q2BA 3FG7A 5KYXA 1CNUA 1SVQA 1VFQA 1PD1A 3DAWB 1NMDG 2FH3A 2MOTA 1NM1G 1C0GS 1M2VA 5HVKB 4JD2H 1T3YA 1SVYA 1T44G 3EG9B 3FFKA 3CJBG 5KYUA 2KVKA 4KEDA 1DEJS 1T2LA 1M4JA 1NLVG 2MV2A 4LIZA 1C0FS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG9 A;  2QTV A;  5KYW A;  1M2V B;  1Q8G A;  3EFO A;  3FG6 A;  2W0I A;  1Q8X A;  3A5N S;  2LLF A;  3A5L S;  5KYX B;  1D4X G;  1EQY S;  4PKH B;  1P8X A;  2LJ8 A;  3CJC G;  1COF A;  3EFO B;  2NUT B;  3L50 A;  4PKI G;  2HD7 A;  1RGI G;  3CIP G;  4Z94 G;  5KYU B;  1PCX A;  2XF1 A;  1PD0 A;  5KYY B;  3TU5 B;  3CI5 G;  1JHW A;  1AK7 A;  5L6W C;  1UDM A;  1X67 A;  2FF6 G;  4CBW G;  3EH1 A;  1V6F A;  3EGX A;  1VKK A;  2VIK A;  5IVU A;  4CBU G;  1TMW A;  2L72 A;  3FFN A;  3EH2 A;  2LXX A;  1KCQ A;  2MP4 A;  1YVN G;  2FF3 A;  1TVJ A;  1H1V G;  4KEE A;  1ESV S;  1WFS A;  3EGX B;  2NUP A;  1WM4 A;  2NUP B;  4S10 C;  4CBX G;  1T3X A;  2FGH A;  3A5M S;  1NPH A;  1F7S A;  1QPV A;  5KYN A;  4KEF A;  2FH4 A;  1HQZ 1;  2FH1 A;  5FAF A;  5KYY A;  1P8Z G;  5HVK D;  1YAG G;  2I2Q A;  1J72 A;  2VIL A;  4PKG G;  4BEX 1;  5FAE A;  1MDU A;  5DD2 A;  1WNJ A;  1D0N A;  1AHQ A;  5A1M A;  1AK6 A;  1SVR A;  2XFA A;  1CFY A;  3EGD A;  5KYW B;  2D8B A;  2VAC A;  3EGD B;  2NUT A;  2FH2 A;  1M2O A;  3A5O S;  3Q2B A;  3FG7 A;  5KYX A;  1CNU A;  1SVQ A;  1VFQ A;  1PD1 A;  3DAW B;  1NMD G;  2FH3 A;  2MOT A;  1NM1 G;  1C0G S;  1M2V A;  5HVK B;  4JD2 H;  1T3Y A;  1SVY A;  1T44 G;  3EG9 B;  3FFK A;  3CJB G;  5KYU A;  2KVK A;  4KED A;  1DEJ S;  1T2L A;  1M4J A;  1NLV G;  2MV2 A;  4LIZ A;  1C0F S; 
#chains in the Genus database with same CATH topology
 3EG9 A;  2QTV A;  5KYW A;  1M2V B;  1Q8G A;  3EFO A;  3FG6 A;  2W0I A;  1Q8X A;  3A5N S;  2LLF A;  3A5L S;  5KYX B;  1D4X G;  1EQY S;  4PKH B;  1P8X A;  2LJ8 A;  3CJC G;  1COF A;  3EFO B;  2NUT B;  3L50 A;  4PKI G;  2HD7 A;  1RGI G;  3CIP G;  4Z94 G;  5KYU B;  1PCX A;  2XF1 A;  1PD0 A;  5KYY B;  3TU5 B;  3CI5 G;  1JHW A;  1AK7 A;  3DA7 A;  5L6W C;  1UDM A;  1X67 A;  2FF6 G;  4CBW G;  3EH1 A;  1V6F A;  3EGX A;  1VKK A;  2VIK A;  5IVU A;  4CBU G;  1TMW A;  2L72 A;  3FFN A;  3EH2 A;  2LXX A;  1KCQ A;  2MP4 A;  1YVN G;  2FF3 A;  1TVJ A;  1H1V G;  4KEE A;  1ESV S;  1WFS A;  3EGX B;  2NUP A;  1WM4 A;  2NUP B;  4S10 C;  4CBX G;  1T3X A;  2FGH A;  3A5M S;  1NPH A;  1F7S A;  1QPV A;  5KYN A;  4KEF A;  2FH4 A;  1HQZ 1;  2FH1 A;  5FAF A;  5KYY A;  1P8Z G;  5HVK D;  1YAG G;  2I2Q A;  1J72 A;  2VIL A;  4PKG G;  4BEX 1;  5FAE A;  1MDU A;  5DD2 A;  1WNJ A;  1D0N A;  1AHQ A;  5A1M A;  1AK6 A;  1SVR A;  2XFA A;  1CFY A;  3EGD A;  5KYW B;  2D8B A;  2VAC A;  3EGD B;  2NUT A;  2FH2 A;  1M2O A;  3A5O S;  3Q2B A;  3FG7 A;  5KYX A;  1CNU A;  1SVQ A;  1VFQ A;  1PD1 A;  3DAW B;  1NMD G;  2FH3 A;  2MOT A;  1NM1 G;  1C0G S;  1M2V A;  5HVK B;  4JD2 H;  1T3Y A;  1SVY A;  1T44 G;  3EG9 B;  3FFK A;  3CJB G;  5KYU A;  2KVK A;  4KED A;  1DEJ S;  1T2L A;  1M4J A;  1NLV G;  2MV2 A;  4LIZ A;  1C0F S; 
#chains in the Genus database with same CATH homology
 3EG9 A;  2QTV A;  5KYW A;  1M2V B;  1Q8G A;  3EFO A;  3FG6 A;  2W0I A;  1Q8X A;  3A5N S;  2LLF A;  3A5L S;  5KYX B;  1D4X G;  1EQY S;  4PKH B;  1P8X A;  2LJ8 A;  3CJC G;  1COF A;  3EFO B;  2NUT B;  3L50 A;  4PKI G;  2HD7 A;  1RGI G;  3CIP G;  4Z94 G;  5KYU B;  1PCX A;  2XF1 A;  1PD0 A;  5KYY B;  3TU5 B;  3CI5 G;  1JHW A;  1AK7 A;  3DA7 A;  5L6W C;  1UDM A;  1X67 A;  2FF6 G;  4CBW G;  3EH1 A;  1V6F A;  3EGX A;  1VKK A;  2VIK A;  5IVU A;  4CBU G;  1TMW A;  2L72 A;  3FFN A;  3EH2 A;  2LXX A;  1KCQ A;  2MP4 A;  1YVN G;  2FF3 A;  1TVJ A;  1H1V G;  4KEE A;  1ESV S;  1WFS A;  3EGX B;  2NUP A;  1WM4 A;  2NUP B;  4S10 C;  4CBX G;  1T3X A;  2FGH A;  3A5M S;  1NPH A;  1F7S A;  1QPV A;  5KYN A;  4KEF A;  2FH4 A;  1HQZ 1;  2FH1 A;  5FAF A;  5KYY A;  1P8Z G;  5HVK D;  1YAG G;  2I2Q A;  1J72 A;  2VIL A;  4PKG G;  4BEX 1;  5FAE A;  1MDU A;  5DD2 A;  1WNJ A;  1D0N A;  1AHQ A;  5A1M A;  1AK6 A;  1SVR A;  2XFA A;  1CFY A;  3EGD A;  5KYW B;  2D8B A;  2VAC A;  3EGD B;  2NUT A;  2FH2 A;  1M2O A;  3A5O S;  3Q2B A;  3FG7 A;  5KYX A;  1CNU A;  1SVQ A;  1VFQ A;  1PD1 A;  3DAW B;  1NMD G;  2FH3 A;  2MOT A;  1NM1 G;  1C0G S;  1M2V A;  5HVK B;  4JD2 H;  1T3Y A;  1SVY A;  1T44 G;  3EG9 B;  3FFK A;  3CJB G;  5KYU A;  2KVK A;  4KED A;  1DEJ S;  1T2L A;  1M4J A;  1NLV G;  2MV2 A;  4LIZ A;  1C0F S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...