1NLXA

Crystal structure of phl p 6, a major timothy grass pollen allergen co-crystallized with zinc
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
104
structure length
104
Chain Sequence
ATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADAVSKAPQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pollen allergen Phl p 6
publication title Crystal Structure oh Phl p 6, a major timothy grass pollen allergen co-crystallized with Zinc
rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 40
structure length 104
sequence length 104
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature
pdb deposition date 2003-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.320 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Group V grass pollen allergen 1nlxA00
2M64A 1L3PA 1NLXA
chains in the Genus database with same CATH superfamily
2QTVA 4JKVA 1GQAA 2I15A 1WWPA 4C3EA 3TOMA 2H8AA 3B0VC 3TOLA 1YYXA 1IW7F 2EPMX 2ZXWC 3H2VA 4DOZA 3IEEA 5KYWA 3WAQA 4I1MA 2ETSA 3AGTA 3NMIA 3DE8A 4N06A 3EFOB 1NLXA 2XL6A 4N6CA 3W8HA 3EGXB 4PJLA 3U8PA 3WG7C 1M6TA 3K1IC 3TD7A 2R7OA 4XPWA 1TFOB 3RFYA 3T4RA 5L0DA 3DKAA 1PD1A 1YARO 2CW0F 2IBFA 2QLAA 3AGUA 1ZHYA 4MVSA 3V5XA 4CX9A 1LM3B 2FGYA 4IARA 2H7OA 5BQGA 3W2WA 3CAXA 4YT2A 2FFHA 2WL8A 1L3PA 3GODA 2RSEB 2HS5A 2Y3HA 4BJ5C 3Q6NA 2WZFA 2NPUA 1BR1A 4X0RA 4ANJA 1F1MA 1HMDA 1M2VA 2YQYA 3SXYA 2HUJA 1XWJA 2J45A 2HJ3A 2PP4A 4YL3A 2V26A 4JE9A 3EH1A 3I5PA 3NG1A 1E83A 1HW2A 2KYHA 5E2QA 1ZHTA 5B1AC 3AG4C 2G3KA 1R4TA 4ER9A 2DGJA 1OXBA 2L9JA 5JS5A 3MYIA 5B1BC 3EH2A 2OEXA 2Q3TA 2UUHA 2MYSA 4BJ6A 5L0JA 4OD5A 3HNIA 3DZAA 3T6GB 4IGGA 1NG1A 4MS2A 4IAOA 1SZIA 1VLSA 3GEIA 3RW0A 4GEHA 3SNHA 1L7CA 2V3CC 1Z6AA 1D0ZA 1JAFA 1QQ3A 3TJ6A 5JVEA 3FDQA 3GORA 3IQ6A 4XEKA 2CDQA 2IOQA 4JEBA 2NUPB 1MMNA 2W45A 4J32B 2VASA 3WODF 4JIOA 2ASRA 1TWAA 2J0WA 3JYYA 4LDRA 3DE9A 4O6NA 3RF3A 4Q4ZF 1FFHA 1WOLA 4R32A 3IQCA 4DRHB 5FZTA 1A7VA 3AG3C 3K7DA 1ZW3A 5F28E 1RMVA 4O6MA 4CBEA 3LESA 3ABLC 3EHMA 4PFOA 2D5RB 1IZMA 3LLKA 3QVZA 4MW3A 4I1OB 4U9DA 1E86A 4G7HF 3FVYA 2E87A 1UG7A 3L34A 4OIOF 2XLVA 1Z3IX 3C7JA 4RDAA 3TK0A 4EIYA 3ZTZA 3E70C 5L0FA 2R05A 3PHF2 2JD3A 1T6QA 3EPVA 3ECSA 3R2PA 4G0HA 3JZ0A 4PR9A 1NSGB 1ZZPA 3VRCA 4JTDB 3ZWIA 1MMDA 1VB5A 2KJGA 3DD7A 3C8GB 2OCCC 3KL4A 3QMKA 4K1OA 3SYNA 5JUAA 2R7RA 3QW0A 3EZHA 5HV9A 4BJ5A 2GWWA 4EBJA 3Q7GA 3ASNC 4PACA 2B0HA 3K66A 2H7VC 1OW7A 2Z15A 1TWHA 1JR8A 1E85A 2BC5A 1OQCA 3E9VA 3KH2A 2XS1A 2VC9A 2QNLA 4MQ9F 3U9MA 3ZQVA 1HE1A 1VYKA 2LFDA 4JC7A 2CGEA 3OWTA 1YZCA 4YJWA 3UNGC 4YT8A 3AQCA 1CGME 5L3VA 2Q9AA 1WGWA 5A6BA 1RJ9B 1E2XA 3MFNA 2AWYA 3L1MA 1KNYA 1LI7A 3C8GA 3GM1A 4H54A 3SP1A 1T9KA 2Y3BA 3MBGA 4U5DE 4BG0A 4PK4A 2HSQA 5IY5C 3Q7LA 4N4WA 1GS9A 2GAQA 3IQ5A 4MTOA 3EG9A 1Q0MA 1U6HA 1D0XA 4WABA 3L8IA 4XWJA 3WHNA 4XPXA 5A6BD 3C8GD 3MX3A 2D4UA 1EKYA 4DBQA 2ZD9A 3T6BA 2H7BA 1LS1A 3LEVA 1YLMA 3G50A 4ONSA 5D91A 2GFHA 2CNWA 3G4ZA 3LJBA 2Y69C 5AC4A 5DS4A 3KKBA 5L0HA 4EBKA 3NKEA 2A69F 3MLGA 1T01A 4NTAA 4CJGA 3N2ZB 4ZLCA 5B3SC 1QZXA 2LK4A 5BQHA 1D0YA 1FMVA 3RQEA 3V7OA 3SXKA 3NYMA 4BEMJ 1Q0KA 2YZSA 1H9GA 2YL7A 5BUOA 4MVUA 1VK5A 2JPUA 4B6IA 5JT4A 4CS7A 3C18A 2LP4A 4K7BA 5JP7A 3VAYA 4MVMA 3ABMC 3C8ZA 3GWNA 4D4XA 1ZYRF 2Y39A 4QDLA 2TMVP 2PF4E 2XL4A 5KYUB 3K33A 4E0IA 1HE9A 3NKDA 4EWCA 4MVQA 1RKEB 2HSBA 2ZXRA 3FAJA 2R7QA 2YRFA 3ZC4A 3B0UX 1AUEA 1T6IA 2XLOA 4W8PA 2VH3A 2BL2A 1ST6A 4Z9IA 2HZ8A 3AOUA 2FAPB 3KMIA 5FCLA 2QUPA 4JCZA 1QPUA 4PJMA 2DYRC 3QZCA 4CSAC 2EPNA 4CS9A 3JRMO 3T6JA 3HNJA 4W8KA 4Z9HA 2F22A 4NCQA 1OW6A 2PX3A 3M15A 1G5ZA 1AVOB 3EFOA 1UFBA 2WVNA 3EGXA 4LDKA 3ZDLA 4O79A 4FAPB 3UR3C 1O5HA 3M79A 4G7ZF 3OEOA 1BZ4A 2VCCA 2MHRA 3SZRA 2G62A 2QE9A 3S0XA 3FHDA 5B3IA 4C7OB 1ZHXA 2AU5A 1JOGA 3IPMO 3UMHA 2KQ9A 1OCRC 4Q7CA 4U9EA 4K0DA 2AWCA 2I8BA 2ZXOA 1MMAA 5DQZA 3PDMP 2KGOA 2C04A 4E0HA 5A6AA 2YEVA 3O55A 1GM5A 4DBRA 4F4BA 2A1DD 3F46A 1HW1A 5E3AA 3JT1A 1QSPA 3Q6MA 2R02A 2NSGA 4Z9JA 3J06A 5TJ5E 3SXZA 3U3FA 2NG1A 1DOWA 4AE4B 4H4KC 3UGPA 1YVIA 1OXKA 3DJNB 2OJQA 3JTLO 3X2QC 2R7UA 1FR0A 3AJMA 1TR2A 2CCYA 3EHNA 3NRHA 4A4AA 1U0BB 4L6RA 2X0CA 5DS5A 3H2UA 1WTYA 1CPQA 3ATPA 3G4XA 1I5NA 2OQMA 3A9CA 3QW1A 1ZHWA 1O87A 1JMWA 2WZGA 2W4MA 4MW8A 3B9QA 1BBHA 1Q0GA 2XM0A 3UMIA 4G78A 1OW8A 4AL0A 2PNOA 2ZPAA 2KK1A 5L0GA 4BJ1A 1C17M 4MVOA 1T5OA 3VM6A 2YL1A 3RKOF 1RCPA 3K1IA 1G4US 4C3DA 2NUPA 3EZIA 3DM9B 4O7GA 4YK5A 4RD9A 3RH3A 4CDAA 1FTSA 3CSKA 1TQGA 4I3MA 4XLPF 4CDYA 1FAPB 1H9TA 2A6EF 2J7PD 2J8WA 4DJ9A 3BRJA 2L7AA 2R25A 2LQGA 5T1DB 4CSAA 2R03A 1K04A 4NTFA 5KYNA 1V74B 1KTMA 3JCUQ 2J9UA 1QLEC 1YA7O 2YKZA 4MTGA 3DAFA 3US6A 5A69A 5DS6A 1BR2A 4CS8C 2EINC 3AQBA 1BR4A 5L0CA 3LNRA 3DWWA 1PCXA 3HJCA 3GEEA 1I4YA 1XZQA 1ORJA 3KPHA 3S28A 5GPGB 3L0IA 2VCAA 3RYLA 4FESA 2UUIA 4OINF 3W2VA 2J9BA 2NUTB 1S05A 2EPLX 2BE5F 4J7TA 3U8VA 4E7SA 1BDJB 2M4EA 4U5GA 2OU6A 4OIPF 4HFKB 1SR2A 3T9OA 2A6HF 256BA 1I4ZA 2A0BA 3HNLA 2OOCA 3LAYA 1JPJA 5E33A 4D4NA 2OJED 2XSEA 3GANA 3BEHA 3ZTMA 1CPRA 2J9WA 4YWQA 4QI2A 1LIHA 2IXPA 3DJUB 3B71A 3V5YA 4JW1A 4JTAB 4EKWA 5KYXB 2M64A 1G8XA 4XPYA 4MVRA 1V54C 2XLEA 3GM2A 2HMQA 3FOOA 5COMA 5E3CA 3NDBB 3HKKA 4P9TA 2Q9BA 2WZLA 4HE8D 1RJ9A 4NC3A 4RBNA 1LVKA 5A6JA 4WGYA 3LNMB 2WVQA 2OKUA 4U5FE 1PV3A 2XL8A 3U2MA 4FWVA 1A0BA 1A7DA 4E7ZA 1NU7D 1MNDA 4N6HA 5CIVA 1VTMP 1VOMA 1YJGA 3LUTB 3M4CA 5BQIA 3ZIBA 3ZG1A 1FNTc 3F47A 2AP3A 2GDCA 3O39A 2Q7RA 2J46A 3ZVRA 1OCCC 3UMKA 3ASOC 5L0IA 2YWAA 4MVZA 4YL0A 5D92A 1PD0A 2DYSC 5A6KA 1LKXA 3LEOA 1Y6DA 4PJNA 1CGNA 3CZ6A 5KYWB 2YLDA 2YHSA 3JYHA 4KNWA 4YL1A 2Q00A 4IWBA 1LPEA 5JSLA 2XXAB 2Y3DA 4OIQF 2R7VA 4JJFA 1N1CA 5DVWA 1K05A 2KNHA 4JJGA 4DRJB 1Y4CA 1ORSC 1TWGA 5T3WA 4CS8A 1XZPA 3IQTA 1D1CA 1Q0DA 4AL1A 2WVOA 3B0PA 1YAUO 3C63A 2R7WA 2W9YA 1VMAA 2LCHA 1Z5ZA 4HEAJ 3S84A 1QKRA 1U89A 4JURI 1ZU5A 3I4UA 2YLGA 4NTBA 1C02A 4EHPA 2Y3GA 3RIPA 4CJOA 1GGQA 5F5HA 1NFOA 2IXOA 1HY5A 1WATA 1NZEA 3ITFA 2KC3A 3GM3A 4GYTA 4ULVA 5KYUA 5DQTA 1M2VB 2G3VA 2J9VA 1LE4A 3O6XA 3DI5A 2O9XA 2Q4FA 3A11A 3NMJA 3GWLA 1ZVZA 1H6GA 1RKEA 2IXMA 4NQFA 4BPMA 5JLIA 1NU9C 2QY9A 3DMDA 2LFFA 3RVZA 3M1CB 1OCOC 2P61A 4O6YA 4OD4A 1NFNA 4XQ1A 3S9OA 3U2LA 5DLJA 4BEJA 4CIPA 2OEVA 2Q9CA 3N0TA 2HKVA 4P9FA 3X1OA 3I5QA 4AK9A 5HSWA 1J8YF 4IAQA 3R7CA 3FXHA 2HV6A 3UGOA 1YZAA 2XRHA 1M57C 1MQVA 4DVYP 3KYJA 4JTCB 5EGYA 2XLMA 1MMGA 2OG2A 3HNKA 4Q5SF 1ZHZA 2LD6A 1D1AA 2ZXPA 3ABKC 3SEOA 4NY3A 1D1BA 4BJTA 3VF0A 3K6BA 1O3UA 2A0UA 2PBEA 2DB4A 3KYIA 4ULWA 1EI7A 2IM8A 1QVXA 4JEAA 4P6IC 2VCBA 4LDQA 3ZSUA 1OR2A 2YL3A 1TFKB 3JRTA 4HFFB 4C7OA 3QVYA 5F5FA 5AGFA 1JPNA 1J8MF 2KW3C 2HFIA 3NMKA 5KYYB 4AX2A 3QTHA 4J7YA 1TWCA 3LS0A 4KC9A 4XTKA 1Z7Qc 3RQGA 1NBBA 4IJJA 3LLIA 3U5SA 2JX0A 2EIJC 1WN0A 2XM4A 4IB4A 2L6FA 2ICWG 2J7PA 4KI2A 2EIMC 5COGA 3JSEO 3TJ5A 5COFA 4OIRF 1TKNA 2LIGA 1T6UA 4ZLDA 1SF8A 2A68F 4CDVA 3FAPB 4KNVA 4JRZA 3EGDB 1V55C 1APCA 1AEPA 1Z23A 2HV7A 2EILC 2KSFA 3CEXA 2DI3A 3FMSA 2L6GA 1K40A 1OCZC 3LS1A 4LLCA 1A41A 4E18A 1HMOA 2YL0A 5KYYA 2X51A 1ORYA 3DXJF 2YLIA 5CI8A 2R7XA 2XLHA 3S90A 1RKCA 4PJJA 4CIHA 3U3BA 1CGOA 3PMRA 2R7TA 4LLEA 3U9JA 4YT4A 2J0XA 2PFDA 4J30B 4YT5A 1OR3A 1SMYF 1VYIA 2R9RB 1M2OA 3EQLF 1Z63A 1JRAA 5K0IA 3POVA 4QI0A 3NYLA 4XLNF 2LSEA 3EGDA 1V4AA 4JVSA 1SYQA 2P0NA 4WGZA 3FOPA 4I44A 4M63A 1FMWA 4PFPA 4E17A 2R7SA 2RD9A 3S27A 2IYLD 1EQ1A 5L3QA 1FFTC 4FX5A 1LE2A 1R5ID 2HJMA 2YVKA 3PCVA 4LERA 2W4BA 3EG9B 3M4BA 4MTFA 4U5BE 4YN0B 1RXQA 4DXWA 2XLWA 5AC5A 4DRIB 3CQZA 4AE4A 1Q0FA 2P1AA 3W4YA 3L8JA 2CYDA 1W2WA 3TQOA 1YA9A 1H7IA 1YYJA 2MWQA 4IRUA 2NUTA 5EHHA 4CS9C 3IHUA 1DOVA 4DVZA 3AG2C 3HTKC 1EA8A 2P6VA 3HLZA 2EPOA 1WASA 3O10A 3K1HA 3DM5A 3AG1C 2VB6A 4EUKB 4KBLA 4EBBA 3N24A 1E84A 4LACB 2XS8A 5KYXA 4U5EE 4C3BA 3SXMA 3DAGA 3EJNA 2L81A 3TULA 3U0CA 4JCHA 5EK0A 2PX0A 4MNDA 3JSZA 2XXAA 1VLTA 1ZU4A 3MYFA 2GA0A 3VYWA 2C03A 2WB7A 3NYJA 3GEHA 4BJ6C 5JRAA 4U5HA 1MNEA 3RQFA 1KU2A 1M56C 2HMZA 2AVKA 3C62A 2XLDA 5T3TA 3S29A 3W8IA 2B0JA 3ZQYA 1S7ZA 3OA1A 1A7EA 2EPKX 2P7VA 4WJ0A 1OKKA 2NSFA 4XEFA 3RVYA 2CNWD 2L6HA 4UDVA 1ZW2A 5CI9A 1LS4A 4A2NB 1YDIA 1LI5A 4G7OF 2EIKC 4JZAA 3V5ZA 2IXNA 1C03A 4U5CE 1B68A 1G4WR 3B29A 3H65A 1OKKD 4XEVA 4GQHA
chains in the Genus database with same CATH topology
2M64A 1L3PA 1NLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M64 A;  1L3P A;  1NLX A; 
#chains in the Genus database with same CATH topology
 2QTV A;  4JKV A;  1GQA A;  2I15 A;  1WWP A;  4C3E A;  3TOM A;  2H8A A;  3B0V C;  3TOL A;  1YYX A;  1IW7 F;  2EPM X;  2ZXW C;  3H2V A;  4DOZ A;  3IEE A;  5KYW A;  3WAQ A;  4I1M A;  2ETS A;  3AGT A;  3NMI A;  3DE8 A;  4N06 A;  3EFO B;  1NLX A;  2XL6 A;  4N6C A;  3W8H A;  3EGX B;  4PJL A;  3U8P A;  3WG7 C;  1M6T A;  3K1I C;  3TD7 A;  2R7O A;  4XPW A;  1TFO B;  3RFY A;  3T4R A;  5L0D A;  3DKA A;  1PD1 A;  1YAR O;  2CW0 F;  2IBF A;  2QLA A;  3AGU A;  1ZHY A;  4MVS A;  3V5X A;  4CX9 A;  1LM3 B;  2FGY A;  4IAR A;  2H7O A;  5BQG A;  3W2W A;  3CAX A;  4YT2 A;  2FFH A;  2WL8 A;  1L3P A;  3GOD A;  2RSE B;  2HS5 A;  2Y3H A;  4BJ5 C;  3Q6N A;  2WZF A;  2NPU A;  1BR1 A;  4X0R A;  4ANJ A;  1F1M A;  1HMD A;  1M2V A;  2YQY A;  3SXY A;  2HUJ A;  1XWJ A;  2J45 A;  2HJ3 A;  2PP4 A;  4YL3 A;  2V26 A;  4JE9 A;  3EH1 A;  3I5P A;  3NG1 A;  1E83 A;  1HW2 A;  2KYH A;  5E2Q A;  1ZHT A;  5B1A C;  3AG4 C;  2G3K A;  1R4T A;  4ER9 A;  2DGJ A;  1OXB A;  2L9J A;  5JS5 A;  3MYI A;  5B1B C;  3EH2 A;  2OEX A;  2Q3T A;  2UUH A;  2MYS A;  4BJ6 A;  5L0J A;  4OD5 A;  3HNI A;  3DZA A;  3T6G B;  4IGG A;  1NG1 A;  4MS2 A;  4IAO A;  1SZI A;  1VLS A;  3GEI A;  3RW0 A;  4GEH A;  3SNH A;  1L7C A;  2V3C C;  1Z6A A;  1D0Z A;  1JAF A;  1QQ3 A;  3TJ6 A;  5JVE A;  3FDQ A;  3GOR A;  3IQ6 A;  4XEK A;  2CDQ A;  2IOQ A;  4JEB A;  2NUP B;  1MMN A;  2W45 A;  4J32 B;  2VAS A;  3WOD F;  4JIO A;  2ASR A;  1TWA A;  2J0W A;  3JYY A;  4LDR A;  3DE9 A;  4O6N A;  3RF3 A;  4Q4Z F;  1FFH A;  1WOL A;  4R32 A;  3IQC A;  4DRH B;  5FZT A;  1A7V A;  3AG3 C;  3K7D A;  1ZW3 A;  5F28 E;  1RMV A;  4O6M A;  4CBE A;  3LES A;  3ABL C;  3EHM A;  4PFO A;  2D5R B;  1IZM A;  3LLK A;  3QVZ A;  4MW3 A;  4I1O B;  4U9D A;  1E86 A;  4G7H F;  3FVY A;  2E87 A;  1UG7 A;  3L34 A;  4OIO F;  2XLV A;  1Z3I X;  3C7J A;  4RDA A;  3TK0 A;  4EIY A;  3ZTZ A;  3E70 C;  5L0F A;  2R05 A;  3PHF 2;  2JD3 A;  1T6Q A;  3EPV A;  3ECS A;  3R2P A;  4G0H A;  3JZ0 A;  4PR9 A;  1NSG B;  1ZZP A;  3VRC A;  4JTD B;  3ZWI A;  1MMD A;  1VB5 A;  2KJG A;  3DD7 A;  3C8G B;  2OCC C;  3KL4 A;  3QMK A;  4K1O A;  3SYN A;  5JUA A;  2R7R A;  3QW0 A;  3EZH A;  5HV9 A;  4BJ5 A;  2GWW A;  4EBJ A;  3Q7G A;  3ASN C;  4PAC A;  2B0H A;  3K66 A;  2H7V C;  1OW7 A;  2Z15 A;  1TWH A;  1JR8 A;  1E85 A;  2BC5 A;  1OQC A;  3E9V A;  3KH2 A;  2XS1 A;  2VC9 A;  2QNL A;  4MQ9 F;  3U9M A;  3ZQV A;  1HE1 A;  1VYK A;  2LFD A;  4JC7 A;  2CGE A;  3OWT A;  1YZC A;  4YJW A;  3UNG C;  4YT8 A;  3AQC A;  1CGM E;  5L3V A;  2Q9A A;  1WGW A;  5A6B A;  1RJ9 B;  1E2X A;  3MFN A;  2AWY A;  3L1M A;  1KNY A;  1LI7 A;  3C8G A;  3GM1 A;  4H54 A;  3SP1 A;  1T9K A;  2Y3B A;  3MBG A;  4U5D E;  4BG0 A;  4PK4 A;  2HSQ A;  5IY5 C;  3Q7L A;  4N4W A;  1GS9 A;  2GAQ A;  3IQ5 A;  4MTO A;  3EG9 A;  1Q0M A;  1U6H A;  1D0X A;  4WAB A;  3L8I A;  4XWJ A;  3WHN A;  4XPX A;  5A6B D;  3C8G D;  3MX3 A;  2D4U A;  1EKY A;  4DBQ A;  2ZD9 A;  3T6B A;  2H7B A;  1LS1 A;  3LEV A;  1YLM A;  3G50 A;  4ONS A;  5D91 A;  2GFH A;  2CNW A;  3G4Z A;  3LJB A;  2Y69 C;  5AC4 A;  5DS4 A;  3KKB A;  5L0H A;  4EBK A;  3NKE A;  2A69 F;  3MLG A;  1T01 A;  4NTA A;  4CJG A;  3N2Z B;  4ZLC A;  5B3S C;  1QZX A;  2LK4 A;  5BQH A;  1D0Y A;  1FMV A;  3RQE A;  3V7O A;  3SXK A;  3NYM A;  4BEM J;  1Q0K A;  2YZS A;  1H9G A;  2YL7 A;  5BUO A;  4MVU A;  1VK5 A;  2JPU A;  4B6I A;  5JT4 A;  4CS7 A;  3C18 A;  2LP4 A;  4K7B A;  5JP7 A;  3VAY A;  4MVM A;  3ABM C;  3C8Z A;  3GWN A;  4D4X A;  1ZYR F;  2Y39 A;  4QDL A;  2TMV P;  2PF4 E;  2XL4 A;  5KYU B;  3K33 A;  4E0I A;  1HE9 A;  3NKD A;  4EWC A;  4MVQ A;  1RKE B;  2HSB A;  2ZXR A;  3FAJ A;  2R7Q A;  2YRF A;  3ZC4 A;  3B0U X;  1AUE A;  1T6I A;  2XLO A;  4W8P A;  2VH3 A;  2BL2 A;  1ST6 A;  4Z9I A;  2HZ8 A;  3AOU A;  2FAP B;  3KMI A;  5FCL A;  2QUP A;  4JCZ A;  1QPU A;  4PJM A;  2DYR C;  3QZC A;  4CSA C;  2EPN A;  4CS9 A;  3JRM O;  3T6J A;  3HNJ A;  4W8K A;  4Z9H A;  2F22 A;  4NCQ A;  1OW6 A;  2PX3 A;  3M15 A;  1G5Z A;  1AVO B;  3EFO A;  1UFB A;  2WVN A;  3EGX A;  4LDK A;  3ZDL A;  4O79 A;  4FAP B;  3UR3 C;  1O5H A;  3M79 A;  4G7Z F;  3OEO A;  1BZ4 A;  2VCC A;  2MHR A;  3SZR A;  2G62 A;  2QE9 A;  3S0X A;  3FHD A;  5B3I A;  4C7O B;  1ZHX A;  2AU5 A;  1JOG A;  3IPM O;  3UMH A;  2KQ9 A;  1OCR C;  4Q7C A;  4U9E A;  4K0D A;  2AWC A;  2I8B A;  2ZXO A;  1MMA A;  5DQZ A;  3PDM P;  2KGO A;  2C04 A;  4E0H A;  5A6A A;  2YEV A;  3O55 A;  1GM5 A;  4DBR A;  4F4B A;  2A1D D;  3F46 A;  1HW1 A;  5E3A A;  3JT1 A;  1QSP A;  3Q6M A;  2R02 A;  2NSG A;  4Z9J A;  3J06 A;  5TJ5 E;  3SXZ A;  3U3F A;  2NG1 A;  1DOW A;  4AE4 B;  4H4K C;  3UGP A;  1YVI A;  1OXK A;  3DJN B;  2OJQ A;  3JTL O;  3X2Q C;  2R7U A;  1FR0 A;  3AJM A;  1TR2 A;  2CCY A;  3EHN A;  3NRH A;  4A4A A;  1U0B B;  4L6R A;  2X0C A;  5DS5 A;  3H2U A;  1WTY A;  1CPQ A;  3ATP A;  3G4X A;  1I5N A;  2OQM A;  3A9C A;  3QW1 A;  1ZHW A;  1O87 A;  1JMW A;  2WZG A;  2W4M A;  4MW8 A;  3B9Q A;  1BBH A;  1Q0G A;  2XM0 A;  3UMI A;  4G78 A;  1OW8 A;  4AL0 A;  2PNO A;  2ZPA A;  2KK1 A;  5L0G A;  4BJ1 A;  1C17 M;  4MVO A;  1T5O A;  3VM6 A;  2YL1 A;  3RKO F;  1RCP A;  3K1I A;  1G4U S;  4C3D A;  2NUP A;  3EZI A;  3DM9 B;  4O7G A;  4YK5 A;  4RD9 A;  3RH3 A;  4CDA A;  1FTS A;  3CSK A;  1TQG A;  4I3M A;  4XLP F;  4CDY A;  1FAP B;  1H9T A;  2A6E F;  2J7P D;  2J8W A;  4DJ9 A;  3BRJ A;  2L7A A;  2R25 A;  2LQG A;  5T1D B;  4CSA A;  2R03 A;  1K04 A;  4NTF A;  5KYN A;  1V74 B;  1KTM A;  3JCU Q;  2J9U A;  1QLE C;  1YA7 O;  2YKZ A;  4MTG A;  3DAF A;  3US6 A;  5A69 A;  5DS6 A;  1BR2 A;  4CS8 C;  2EIN C;  3AQB A;  1BR4 A;  5L0C A;  3LNR A;  3DWW A;  1PCX A;  3HJC A;  3GEE A;  1I4Y A;  1XZQ A;  1ORJ A;  3KPH A;  3S28 A;  5GPG B;  3L0I A;  2VCA A;  3RYL A;  4FES A;  2UUI A;  4OIN F;  3W2V A;  2J9B A;  2NUT B;  1S05 A;  2EPL X;  2BE5 F;  4J7T A;  3U8V A;  4E7S A;  1BDJ B;  2M4E A;  4U5G A;  2OU6 A;  4OIP F;  4HFK B;  1SR2 A;  3T9O A;  2A6H F;  256B A;  1I4Z A;  2A0B A;  3HNL A;  2OOC A;  3LAY A;  1JPJ A;  5E33 A;  4D4N A;  2OJE D;  2XSE A;  3GAN A;  3BEH A;  3ZTM A;  1CPR A;  2J9W A;  4YWQ A;  4QI2 A;  1LIH A;  2IXP A;  3DJU B;  3B71 A;  3V5Y A;  4JW1 A;  4JTA B;  4EKW A;  5KYX B;  2M64 A;  1G8X A;  4XPY A;  4MVR A;  1V54 C;  2XLE A;  3GM2 A;  2HMQ A;  3FOO A;  5COM A;  5E3C A;  3NDB B;  3HKK A;  4P9T A;  2Q9B A;  2WZL A;  4HE8 D;  1RJ9 A;  4NC3 A;  4RBN A;  1LVK A;  5A6J A;  4WGY A;  3LNM B;  2WVQ A;  2OKU A;  4U5F E;  1PV3 A;  2XL8 A;  3U2M A;  4FWV A;  1A0B A;  1A7D A;  4E7Z A;  1NU7 D;  1MND A;  4N6H A;  5CIV A;  1VTM P;  1VOM A;  1YJG A;  3LUT B;  3M4C A;  5BQI A;  3ZIB A;  3ZG1 A;  1FNT c;  3F47 A;  2AP3 A;  2GDC A;  3O39 A;  2Q7R A;  2J46 A;  3ZVR A;  1OCC C;  3UMK A;  3ASO C;  5L0I A;  2YWA A;  4MVZ A;  4YL0 A;  5D92 A;  1PD0 A;  2DYS C;  5A6K A;  1LKX A;  3LEO A;  1Y6D A;  4PJN A;  1CGN A;  3CZ6 A;  5KYW B;  2YLD A;  2YHS A;  3JYH A;  4KNW A;  4YL1 A;  2Q00 A;  4IWB A;  1LPE A;  5JSL A;  2XXA B;  2Y3D A;  4OIQ F;  2R7V A;  4JJF A;  1N1C A;  5DVW A;  1K05 A;  2KNH A;  4JJG A;  4DRJ B;  1Y4C A;  1ORS C;  1TWG A;  5T3W A;  4CS8 A;  1XZP A;  3IQT A;  1D1C A;  1Q0D A;  4AL1 A;  2WVO A;  3B0P A;  1YAU O;  3C63 A;  2R7W A;  2W9Y A;  1VMA A;  2LCH A;  1Z5Z A;  4HEA J;  3S84 A;  1QKR A;  1U89 A;  4JUR I;  1ZU5 A;  3I4U A;  2YLG A;  4NTB A;  1C02 A;  4EHP A;  2Y3G A;  3RIP A;  4CJO A;  1GGQ A;  5F5H A;  1NFO A;  2IXO A;  1HY5 A;  1WAT A;  1NZE A;  3ITF A;  2KC3 A;  3GM3 A;  4GYT A;  4ULV A;  5KYU A;  5DQT A;  1M2V B;  2G3V A;  2J9V A;  1LE4 A;  3O6X A;  3DI5 A;  2O9X A;  2Q4F A;  3A11 A;  3NMJ A;  3GWL A;  1ZVZ A;  1H6G A;  1RKE A;  2IXM A;  4NQF A;  4BPM A;  5JLI A;  1NU9 C;  2QY9 A;  3DMD A;  2LFF A;  3RVZ A;  3M1C B;  1OCO C;  2P61 A;  4O6Y A;  4OD4 A;  1NFN A;  4XQ1 A;  3S9O A;  3U2L A;  5DLJ A;  4BEJ A;  4CIP A;  2OEV A;  2Q9C A;  3N0T A;  2HKV A;  4P9F A;  3X1O A;  3I5Q A;  4AK9 A;  5HSW A;  1J8Y F;  4IAQ A;  3R7C A;  3FXH A;  2HV6 A;  3UGO A;  1YZA A;  2XRH A;  1M57 C;  1MQV A;  4DVY P;  3KYJ A;  4JTC B;  5EGY A;  2XLM A;  1MMG A;  2OG2 A;  3HNK A;  4Q5S F;  1ZHZ A;  2LD6 A;  1D1A A;  2ZXP A;  3ABK C;  3SEO A;  4NY3 A;  1D1B A;  4BJT A;  3VF0 A;  3K6B A;  1O3U A;  2A0U A;  2PBE A;  2DB4 A;  3KYI A;  4ULW A;  1EI7 A;  2IM8 A;  1QVX A;  4JEA A;  4P6I C;  2VCB A;  4LDQ A;  3ZSU A;  1OR2 A;  2YL3 A;  1TFK B;  3JRT A;  4HFF B;  4C7O A;  3QVY A;  5F5F A;  5AGF A;  1JPN A;  1J8M F;  2KW3 C;  2HFI A;  3NMK A;  5KYY B;  4AX2 A;  3QTH A;  4J7Y A;  1TWC A;  3LS0 A;  4KC9 A;  4XTK A;  1Z7Q c;  3RQG A;  1NBB A;  4IJJ A;  3LLI A;  3U5S A;  2JX0 A;  2EIJ C;  1WN0 A;  2XM4 A;  4IB4 A;  2L6F A;  2ICW G;  2J7P A;  4KI2 A;  2EIM C;  5COG A;  3JSE O;  3TJ5 A;  5COF A;  4OIR F;  1TKN A;  2LIG A;  1T6U A;  4ZLD A;  1SF8 A;  2A68 F;  4CDV A;  3FAP B;  4KNV A;  4JRZ A;  3EGD B;  1V55 C;  1APC A;  1AEP A;  1Z23 A;  2HV7 A;  2EIL C;  2KSF A;  3CEX A;  2DI3 A;  3FMS A;  2L6G A;  1K40 A;  1OCZ C;  3LS1 A;  4LLC A;  1A41 A;  4E18 A;  1HMO A;  2YL0 A;  5KYY A;  2X51 A;  1ORY A;  3DXJ F;  2YLI A;  5CI8 A;  2R7X A;  2XLH A;  3S90 A;  1RKC A;  4PJJ A;  4CIH A;  3U3B A;  1CGO A;  3PMR A;  2R7T A;  4LLE A;  3U9J A;  4YT4 A;  2J0X A;  2PFD A;  4J30 B;  4YT5 A;  1OR3 A;  1SMY F;  1VYI A;  2R9R B;  1M2O A;  3EQL F;  1Z63 A;  1JRA A;  5K0I A;  3POV A;  4QI0 A;  3NYL A;  4XLN F;  2LSE A;  3EGD A;  1V4A A;  4JVS A;  1SYQ A;  2P0N A;  4WGZ A;  3FOP A;  4I44 A;  4M63 A;  1FMW A;  4PFP A;  4E17 A;  2R7S A;  2RD9 A;  3S27 A;  2IYL D;  1EQ1 A;  5L3Q A;  1FFT C;  4FX5 A;  1LE2 A;  1R5I D;  2HJM A;  2YVK A;  3PCV A;  4LER A;  2W4B A;  3EG9 B;  3M4B A;  4MTF A;  4U5B E;  4YN0 B;  1RXQ A;  4DXW A;  2XLW A;  5AC5 A;  4DRI B;  3CQZ A;  4AE4 A;  1Q0F A;  2P1A A;  3W4Y A;  3L8J A;  2CYD A;  1W2W A;  3TQO A;  1YA9 A;  1H7I A;  1YYJ A;  2MWQ A;  4IRU A;  2NUT A;  5EHH A;  4CS9 C;  3IHU A;  1DOV A;  4DVZ A;  3AG2 C;  3HTK C;  1EA8 A;  2P6V A;  3HLZ A;  2EPO A;  1WAS A;  3O10 A;  3K1H A;  3DM5 A;  3AG1 C;  2VB6 A;  4EUK B;  4KBL A;  4EBB A;  3N24 A;  1E84 A;  4LAC B;  2XS8 A;  5KYX A;  4U5E E;  4C3B A;  3SXM A;  3DAG A;  3EJN A;  2L81 A;  3TUL A;  3U0C A;  4JCH A;  5EK0 A;  2PX0 A;  4MND A;  3JSZ A;  2XXA A;  1VLT A;  1ZU4 A;  3MYF A;  2GA0 A;  3VYW A;  2C03 A;  2WB7 A;  3NYJ A;  3GEH A;  4BJ6 C;  5JRA A;  4U5H A;  1MNE A;  3RQF A;  1KU2 A;  1M56 C;  2HMZ A;  2AVK A;  3C62 A;  2XLD A;  5T3T A;  3S29 A;  3W8I A;  2B0J A;  3ZQY A;  1S7Z A;  3OA1 A;  1A7E A;  2EPK X;  2P7V A;  4WJ0 A;  1OKK A;  2NSF A;  4XEF A;  3RVY A;  2CNW D;  2L6H A;  4UDV A;  1ZW2 A;  5CI9 A;  1LS4 A;  4A2N B;  1YDI A;  1LI5 A;  4G7O F;  2EIK C;  4JZA A;  3V5Z A;  2IXN A;  1C03 A;  4U5C E;  1B68 A;  1G4W R;  3B29 A;  3H65 A;  1OKK D;  4XEV A;  4GQH A; 
#chains in the Genus database with same CATH homology
 2M64 A;  1L3P A;  1NLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...