1NM5C

R. rubrum transhydrogenase (di.q132n)2(diii)1 asymmetric complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
174
Chain Sequence
SVKAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glutamine 132 in the NAD(H)-binding component of proton-translocating transhydrogenase tethers the nucleotides before hydride transfer.
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Oxidoreductase
molecule keywords NAD(P) transhydrogenase subunit alpha part 1
total genus 49
structure length 174
sequence length 174
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2003-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1nm5C00
1QPBA 1YHZA 1M2GA 1YI0A 1YNOA 3ZGVA 5EJMA 5K2OA 2WVGA 3CLUD 5DEIA 1Z8NA 3EY9A 5K6TA 4MPJA 4IAOA 4GP9A 2JIBA 4BN4A 4J1TC 4BUZA 5MGNA 4BVHA 5BWLA 4FZ3A 5DGDA 2NYRA 2OO5C 4GM4A 4O8ZA 1YBHA 3ZGOA 4TWJA 4BVFA 1UPAA 2Q29A 4Y6QA 1Q14A 3FZNA 4JU8A 4RJJA 4L3OA 4V1CB 2JI6A 5K3SA 1Q17A 1EFPA 4KGDA 1T9DA 3HWWA 4K9MA 2B4YA 1UPBA 4ZZIA 1PI3A 3JWPA 2AG1A 3GLSA 4Q9DA 4K9PA 2C31A 2BRUC 4K9KA 1XLTC 2JI8A 4BVGA 2HJHA 3CLTD 4QPZA 1ICIA 1UPCA 2FN3A 1YC5A 1V5FA 1T9BA 4FEGA 4X3PA 1U2GC 1Q6ZA 1U2DC 4UTRA 1OVMA 2Q27A 3CLSD 1U31A 3LQ1A 1DJLA 1OZFA 4JD5A 1PNOA 3U3DA 4HDAA 2X7JA 4IF6A 4JUBA 4RMGA 5FEMA 2VK8A 4K9QA 2WVHA 4D5GA 5MFZA 1SZCA 2AG0A 2EZ8A 1PYDA 2PANA 4R8MA 4BV2A 2H59A 5EJ8A 1ZPDA 3GLUA 5IMSA 4GPEA 4C7BA 4JT9A 4GG1A 1Q1AA 2FSVC 2PGOA 1D4OA 5D7NA 2VBGA 4UUBA 1S7GA 2JLCA 4UU7A 1M2NA 2JI9A 4JU9A 1EFVA 3F6BX 1NM5C 4RJIA 4G1CA 1M2JA 1S5PA 1YTLA 2EZUA 1OZGA 1PO7A 3D4BA 3CLRD 3IAFA 1M2KA 1PTJC 3PDHA 1PNQA 2QQFA 3GLRA 4GM1A 3F6EX 2H2FA 1V5EA 3E9YA 2VK1A 5BWOA 2H4JA 2V3WA 3IAEA 4MPPA 3PKIA 5MF6A 2EZ9A 4UTNA 2UZ1B 1BFDA 1O96B 3EYAA 3OE1A 4F56A 5K6RA 4F4UA 2VK4A 4K9OA 5EJ5A 1YI1A 4C78A 1T9AA 4BVEA 2H4HA 2UZ1A 1V5GA 4JSRA 4JUFA 3U31A 5EJ7A 2QQGA 1O97D 4BN5A 1YC2A 2OD9A 2H2GA 2H4FA 2IHVA 4FVTA 1PVDA 3EA4A 1U28C 5AHKA 3ZG6A 4JUDX 4RJKA 3D81A 2DJIA 4UTZA 1M2HA 1HZZC 4ZP1A 1POWA 2FRDC 4D5EA 4UUAA 4TWIA 1JSCA 4BVBA 4V1CI 4X3OA 5EJ6A 4FEEA 2Q5LA 2VJYA 2FWNA 2OD2A 5EJ4A 2Q5JA 2JLAA 4MZXA 2IHTA 3GLTA 5EJAA 4BV3A 5MFPA 2W93A 4QELA 1N0HA 4K9NA 1E3TA 1T9CA 3RIGA 4GM0A 4JT8A 2WVAA 1MA3A 2NXWA 2FR8C 1Y9DA 4Y6OA 2IHUA 2PGNA 4J16C 4JUCA 4JUAA 4UU8A 5EJ9A 2OD7A 1MCZA 4KPUA 4RMIA 2OORC 3CF4G 2JI7A 4L2IA 5DGTA 2A1UA 5FYQA 5BWNA 1POXA 2H2DA 3FSJX 1YHYA 2H2HA 4COKA 3FLMA 1PT9A 3JR3A 4UTXA 2A1TR 2Q5OA 4V1CA 4I5IA 4RMHA 1SZDA 4IG9A 2EZTA 1J8FA 3D7KA 4Y6LA 3HWX1 4KXQA 1OZHA 2VBFA 3PKJA 2Q5QA 4MPRA 4RMJA 2Q28A 4MQ5A 4UTVA 2H2IA 3RIYA 3K35A 4HD8A 2EZ4A 2VBIA 4K9LA 4QQ8A
chains in the Genus database with same CATH superfamily
2I2CA 1OC4A 1JP7A 3C3XA 3RLIA 1Z8NA 3IFSA 4BFLA 4RTSA 3VR2A 3IHLA 3TL2A 4QFDA 3NBKA 3IKVA 2VAWA 5KAMA 1AS3A 2QVXX 3HC7A 1BDHA 4PC3A 1UBKS 1I36A 3AVXA 3R9XB 5A5EA 5I9IA 3R9WA 5KZMB 2YYZA 3HDVA 1N2XA 4WD3A 3MUEA 1XZQA 3FDIA 2O7VA 1JDZA 3IELA 1YIDA 5IC6A 4E94A 2ZIXA 5HDBB 1H3FA 3MGCA 4PF1A 1EVYA 2J4CA 1P2FA 1UKEA 1JXMA 1TXGA 4Y9UA 4KFUA 4E11A 1HG1A 2HRZA 2G40A 2ZT7A 2I3BA 3U09A 2PFKA 4NL4H 2AKEA 2IY7A 4MRMB 3D3KA 1P6UA 4HGYA 5LN1A 1Z7BA 2PM8A 5IAKA 3DAFA 4J0EA 3EASA 2GBCA 1OFVA 4QUBA 3H1EA 4DY6A 1I4OA 4HDAA 5DNCA 3ET5A 3I3OA 3SJUA 4KP7A 4BDSA 1O8BA 4C1NA 3HU5A 3AJ8A 2GK3A 1TQ6A 5ALWA 4V39A 2BE7A 3LTEA 1X9GA 3DMNA 3E3AA 3C6KA 3Q4GA 1E8MA 2IDMA 3CT4A 3KEGA 3L4BC 4U2FA 2IP1A 3D31A 2Q9UA 2XD4A 4INPA 4CIYA 3UK1A 4X7MA 5CEFA 3HXTA 2X9GA 1GTZA 2E4YA 3A6FA 4X84A 3ZHRA 4PN7A 3V32A 3NBQA 5HFAA 2XB8A 4BVGA 2IE8A 1XZMA 2Y1OA 3PPWA 1VYVA 3TLAA 2XCRB 2EGGA 1HDEA 1DIBA 4QU5A 1KVTA 3CHYA 4MULA 1TKRA 2VKQA 2HIHA 3C8MA 4RK4A 5CD9A 5KYXA 1HORA 1J97A 2XCQA 3JD1A 3RH0A 1PJRA 3SE0A 3E0XA 1Y8RA 1NI5A 2AMVA 4Q9LA 4MUJA 2QJOA 5EMMA 3TH5A 1DC5A 5DNDA 2G04A 3RSGA 2ONYA 1QP0A 1YGYA 1C9KA 1PR3A 4WN9A 1KY2A 3U31A 1JDJA 5I7RA 4OCZA 2J5QA 2QN8A 1F7VA 3IAS6 1E2KA 4LYGA 2HT1A 2J3EA 1H1LB 1OX6A 4UBJA 1U28C 3B51X 4CPDA 4GX5A 1EP3B 2OHHA 4JZKA 1AMUA 3ANNA 3JU3A 4BO9A 3NWJA 1TM7E 5J2UA 3WNBA 1MOPA 4I1SA 1PL7A 4QIHA 1T1JA 2WF7A 3O9MA 2MSCB 5CB6A 3ZD6A 3H1AA 3V00A 3SY8A 3BIOA 1NAIA 2YY7A 1AT1A 1CDEA 3WTBA 4F06A 2BFNA 2WP0A 3CBQA 4PR3A 4CIXA 1U2QA 2QI9F 2PZ8A 4QEDA 4S1NA 1U98A 4MW4A 3AUYA 1DCMA 1QS0A 2ZUCA 3MGKA 3LX5A 1PTKA 1SUPA 5B6JA 5AVWA 4J07A 4ND7A 1HE5A 3O95A 4WZZA 1L4BA 5EWJB 2SCUA 1IH8A 4DVJA 3G9TA 1SCKA 5SICE 1RWWA 3UWSA 2E4WA 3MAAC 2QMHA 1DBQA 1QVAA 1TM4E 2W5UA 5DM1A 5C0OE 3U3ZA 1A9RA 5LJIA 1XTKA 3I39X 4R1NA 5HJ2A 2JCXA 3OTWA 4CM4B 4HO1X 5HM6A 1AHNA 4MS4B 3Q40A 1B3BA 1QK5A 4WTOA 4RGQA 4TKVB 3R3JA 3PFFA 4TUYB 3LWBA 4LJ4A 1E9SA 3JQBC 2Z95A 4R8VA 1ZD3A 1XTPA 2QVYX 3BE6A 3D4IA 1TX4B 2Q0HA 2VYNA 2VJLA 1TUGA 3PUXA 3UQYS 1FZTA 2MR5A 3JD3A 3ASUA 1K8RA 1NBAA 5FD8A 4EFLA 1BYIA 1FFAA 1OU0A 4L0CA 5ITSA 3K96A 5KHLB 3LLUA 4BB0A 3NNDA 4FONA 4W5RA 4JJKA 4U8GA 5E3HA 2RB4A 1O03A 3E9DA 1Q50A 3VX3A 3W7VA 4D3SA 2GJAA 3DSRA 5DCWA 1B93A 1VCOA 4A0GA 1J9GA 3FPBA 1U0LA 4EY7A 1T6NA 2DUJA 3RODA 3BKWA 1SD1A 3B1JA 5E7JA 3ZJYA 3W5DA 1J49A 1WSWA 1TFUA 1Z5WA 4EG0A 4QBGB 2PYZA 2VZ8A 3VYVA 3G82C 4IUYA 3ZHZA 3GFGA 5CMLA 1QIKA 2R11A 2Z9CA 1W35A 5IWAB 2OV8A 3KXPA 3EWAA 5COQA 1SQ0A 2F59A 5E9AA 3WR5A 3ZD9A 1NC1A 1DLIA 2C42A 3DV9A 2VR1A 1SA0B 3GEHA 4JI8B 5AMXA 3OC6A 4I9GA 1X7ZB 1NF2A 3C6MA 3F3MA 4R8MA 4S1PA 4IP0A 5AKYA 1SBQA 2A57A 1Z17A 4NP6A 3JASB 1HL3A 3AR4A 1JQDA 1O87A 1DAFA 3NM6B 4IIFA 4MIYA 3UJCA 1TK9A 2GN9A 2O48X 1JXOA 1PYOA 1AVTA 3C2QA 4X3CA 2BTOA 3P2EA 2AJBA 1E2HA 5BPFA 5K09A 2IKQA 2WWWA 3CPHA 5GJWC 3PA6A 2OGZA 1CNFA 3WHLA 4CM4A 3M2PA 5CEEA 4ZQGA 1ARZA 4R2XA 1SAYA 2CFIA 3SYMA 1KHTA 3A37A 4Y2QA 4HRAA 4CDGA 2HY7A 2XTMA 1RYNA 1DXOA 4ASUD 5JDCA 1ES9A 1D1QA 2QQ5A 4Y3UA 3GGJA 2WTNA 2WLSA 1I4WA 1QCZA 5L4LA 1Z06A 3PEYA 1ABEA 3BG5A 5DW0A 4D9GA 3BREA 2GBLA 3I4FA 1E9AA 4TZ0A 3AXTA 4BE9A 4EP1A 4ZANA 2FFQA 2O1SA 5FPYA 1C0EA 5KYUA 3C7KA 1JDSA 1L3IA 1T3ZA 1TQ4A 3KJNA 3NHRA 5EMNA 5LDHA 5H0IA 2F1OA 3AF1A 4P7BA 3LNCA 2CLCX 2NGRA 5B37A 2J41A 3U0VA 3TQHA 1RWNA 4LRYA 1P19A 1PSZA 1JYSA 3QH4A 1TM5E 5G02A 3WHIA 4R2HA 4E70A 4ED9A 2ETVA 2FWNA 3AF3A 3TUIC 3NIBA 4GSLA 2EF1A 2WE8A 2H5JA 2C9CA 5F3DA 4NBKA 3CRMA 4GRAA 5BT9A 3JARB 2E4VA 1A4XA 4LQDA 2FU5C 3ZCUA 1US8B 4HT3B 3LBAA 3FFBA 4K1XA 1WEHA 4HN4B 2NO9A 2VAVA 1QRDA 4JJ4A 4AJ9A 2KBEA 2J1LA 9MHTA 3BK7A 1W87A 4PFSA 2H6EA 3GQBB 4A2WA 4G5OA 1RVV1 1S8NA 4WCFC 2OHVA 3T3EA 4KQIA 4UDOA 3ICEA 5CCEA 3PVZA 2AZMA 4FK8A 3QLEA 1W75A 3TFOA 4MVJA 3CQ9A 4OQXA 3KUCA 3N2IA 3FDXA 3TWOA 3WB9A 3IP6A 1Z75A 2N1BA 3LUPA 4UUOA 3K16A 4D9EA 1Y7HA 3ZJ4A 1JAZA 1X15A 2GN6A 5IDQA 1NVGA 2Q3FA 4E1VA 3PUHA 4EHHA 2GLTA 2PTHA 3BJMA 2CXPA 1GSAA 4C4PA 1H2BA 1ULBA 1V1RB 2ODNA 4ZEVA 3K94A 3AF2A 1I2ZA 1V9LA 1CUBA 1X80B 2DKFA 1Y3FE 4TUYA 4M1KA 4C7VA 3PFNA 4O4IB 3PFHA 4BVHA 1EJ6A 1PV2A 1PHPA 4DSOA 3ZCQA 5JS1A 5HP4A 3MZ0A 1NN1A 4NK4A 3RRYA 4DV1B 1A5TA 5JS7A 2UYGA 4CCYA 1AKVA 1I1HA 2DY1A 3U3OA 2JASA 4US1R 4K46A 2DP4E 3AKYA 5H3CA 5JSHA 3PDIB 2JKZA 5IDVA 2PJDA 3AONB 2O5VA 5DYGA 2VZLA 3KDPA 3SFTA 5KQSA 2ICAA 1GRNA 2F3PA 4D0SA 2NMVA 4CR6A 3M5DA 3COVA 4AJEA 1G64A 3HJHA 4YYZA 2Z6UA 2QUIA 1N3YA 5HS6A 4MP8A 1L5YA 3JAKB 4H0FA 3VQTA 2QUAA 4ZC1A 3CTPA 3B5JA 2GZ1A 4MPDA 5FQOA 2JH9A 3SYTA 4PC7A 2AN9A 1O5TA 4ZU6X 4CTMA 2JLCA 5JAIA 1QIIA 1HZZA 1DDOA 5AVKA 1EFVA 1JL3A 4M9SA 1EE2A 1H85A 4O2BF 1Z7WA 4ZC8A 3RJ5A 4OLHA 1NF9A 2NQTA 9ABPA 3R5JA 4J8PA 4L57A 1UBGA 3EIWA 4DA0A 5KNCH 5F98A 2W71A 2JNWA 4ZWNA 5IRCD 1Q2XA 1H8HA 4QASA 2XUIA 5JNWA 1T43A 2GBLC 4KWHA 4NCAA 1U9CA 4O3MA 2W6ZA 4S2EA 1G4HA 2I29A 1RIFA 2A1IA 2ILTA 3LQ4A 3ZTYA 4DYVA 3OE4A 1T1RA 2WSIA 2HBZA 3K72B 1U0RA 3T34A 4HLCA 3VU9B 4FB4A 5A6SA 5LZ9A 2VQEB 1Y6GA 3AQIA 4N9QA 5C4MA 4MHTA 2JG3A 5F1OA 1Z2DA 2Z83A 3VOBA 3WADA 1V8BA 4N7JA 2FB9A 4L5CA 4GMHA 1XZHA 3QVMA 3L4KA 1F06A 3DAGA 4K8OA 2QV7A 2VJDA 3S27A 1UH5A 1Y0BA 2O8FB 3ZKWA 2APJA 5KYYA 4D0GA 4ARIA 3OCYA 4N5HX 5CG1A 3FSGD 3QBJA 5JYBA 1E3WA 3U7RA 5IHPA 4QE3A 4XWAA 2FWBA 4KN9S 4E5DA 1QYRA 4B3DA 1H2ZA 1IY8A 2X7HA 3L0YA 3O8OA 5HA5A 3YASA 3S8EA 3SC2B 2AXPA 2UYYA 3MTIA 4GPTA 2DT5A 2VATA 5I9MA 2Q3BA 3B2EA 3QXCA 1NIJA 1TEZA 3T3PB 4AJHA 1RJFA 4DRZA 1XJ0A 3SS8A 3OMWA 3T9AA 4P4UA 4EZEA 3UMBA 4QGSA 1IUKA 4Y2XA 4M9ZA 4EABA 3KT3A 5TNXA 2QGZA 2PXCA 4TMWA 2IOHA 4V0LA 1JJ7A 1C3OA 1C1DB 1T0BA 3C24A 4TQUS 5B2EA 3A4LA 4WBNF 3THXB 3IP3A 2VP2A 2VJNA 2H7XA 4Y2HA 4XCXA 3TM4A 1U2RA 3EXAA 4D8UA 3IC5A 5LQRA 1AJEA 3AM1A 5AM0A 3OBIA 2XJ9A 1Q20A 3KQLA 1CRPA 2X15A 3DVLA 1JLKA 5T4EA 4UVGA 1VMEA 3L7BA 2AI1A 3FUXA 3KXLA 4OKSA 3HM2A 3KKOA 3MJCA 3OICA 4FQ7A 1CVIA 4H60A 5F1PA 2CBGA 4CLRA 2NPOA 3D8HA 3PITA 2VWQA 4M36A 4MVJE 1DC6A 1KZ1A 3GY0A 4GPZA 2OBNA 1TM1E 3LFTA 4MYDA 1DWPA 1NVEA 3ZV3A 2HB6A 1JIKA 4WDRA 4YAWA 1YQWA 2QPTA 3I58A 2LKCA 4WLVA 1VDZA 4BZWA 2UVPB 1E5QA 3SBEA 2GM4A 3FHCB 4YECA 4EJSB 3DLTA 4ZAFA 1P0FA 2FPGA 2J09A 4BNWA 1DIOB 4AS1A 1D9XA 4F5DA 1UXOA 4PGAA 3NHBA 4PHFA 2AYZA 1ZONA 2RHMA 2X0KA 4BEJA 4HH1A 2IXDA 2CJFA 2ZR0A 3G0CA 3IOEA 5KNDD 1MEOA 1Q0UA 2D5LA 3ODPA 3F5SA 3M2TA 2DE0X 3MWEB 4PZ0A 3FNHA 1DQYA 1G3QA 2J0VA 3H18A 4YRKA 3NOXA 2X7JA 3VGPA 3F8TA 5JCXA 2G5TA 1BE6A 1T3TA 2QTAA 4QUKA 1ISJA 4I2VA 2O8NA 1GNLA 3DCYA 3JPWA 3PRKE 1I14A 1F38A 2IU3A 3HU2A 5JNLA 1V1RA 3EZ6A 3T7DA 4EG7A 1ZVVA 1ONBA 2BVNA 3DAHA 1XJ5A 1ULHA 3DOUA 5D2CA 3R9IA 5HUJA 3ISVA 4MLDA 4ZCLA 1Q3KA 1U28A 3N86A 4QICA 2QIOA 4HFNA 3DVQX 4BUCA 4ZQFA 3GGCA 5BQFA 2GT1A 3PIDA 4TTAA 5BVHA 1Z47A 3RKUA 1D09A 2UKDA 1G21B 2OCLA 4E32A 1LF5A 1TADA 2YNMD 2J3MA 3TW8B 3KELA 3BEOA 2QGFA 3DOCA 3EGIA 3GQBA 4FGLA 4RAOA 4X6UA 1XU4A 4YN3A 2YIDA 1L5KA 1QR6A 3O31A 2P3QA 2IOFK 2ORYA 3RFXA 1XZDA 1U9JA 2GBGA 4EGJA 2W9XA 2XE4A 1EGHA 3E5HA 4GD3Q 2H8GA 2WJIA 2B0CA 3ICCA 2HM7A 2RJNA 3IP9A 3FFAA 5ANRB 1MHTA 4OOFA 2ZR9A 2HL6A 2VPPA 3E9MA 4U7GA 5BUSA 10MHA 2CJWA 1YL6A 1A97A 2NSHA 2XA2A 3DPSA 4RJKA 3ADDA 5IBCA 4BX3A 1POWA 3QXJA 3MOSA 4BMPB 3RS3A 1R12A 4OYHA 4OHCA 1PYGA 3ND8A 5DX1A 2BFMA 1BDMA 3I9OA 4S05A 1ATIA 1GYPA 1ZLXA 4J75A 4JAVC 4LK3A 4EKDA 3NASA 2W6NA 1QIHA 1GUAA 5EHIA 3KFVA 1LBIA 3NAGA 3GLFE 1PG0A 4WOJA 4EYEA 5FV4A 3SD7A 2LUOA 3NTQA 3CMCO 2ZYTX 2XQKA 4B6FA 5JYDA 2AXEA 1LBEA 4LUCA 3KQMA 5ECDA 3PDIA 4L9WA 3AYZB 3VPSA 1EQUA 1K97A 2VDVE 1Z07A 1RPAA 4CFZA 2R8XA 4F6CA 3V8BA 2GFHA 1USWA 1E1LA 1Z73A 4POOA 4N7BA 3M9XA 1NLYA 1KYZA 2HLNA 3CKLA 3ZE1B 3ZVRA 1M7GA 1N6HA 2G07A 1Z5OA 4KDFA 4KG7A 3L6RA 1IBRA 4LHYA 4YROA 3KOUA 2Y0EA 4P4SB 4HDCA 1OT5A 3CONA 3L7KA 2Z1MA 3VVBA 1M8GA 1TLTA 5MN5A 4PM4A 1P1KA 4CIWA 1Z5NA 4LWPA 5ALQA 3O21A 4A2CA 5GADl 3TB6A 4WKPA 1DIRA 1M10A 1OYWA 2PA0A 1IL0A 2A0KA 4X6LA 5BVGB 4AP5A 2VDKB 4NEQA 1EA5A 4BPRA 1RRVA 2G5CA 5EHQA 5H7XA 3K0BA 3EVCA 3IE2A 4J0GA 1RXYA 2C83A 2ET6A 1VYHA 1QIEA 2NV0A 2QM0A 2XTNA 4MVCA 3VHXA 4C4RA 3ZDBA 4TXMA 4KGDA 4D8YA 4Q05A 2CVFA 2NUAA 1WNTA 4AFNA 3TIGA 4DT1A 3E9QA 4YFYA 4CYMA 1W581 2BFBA 2QTGA 3ZVNA 4ZAVA 2ZTHA 4FW9A 1XJCA 2ZAYA 4MOWA 4FEGA 3W1VA 1P7CA 3C1OA 2IEZA 4XUDA 2I2AA 2PYIA 2TYSB 2Z5FA 3C43A 5DVZA 5H5JA 5BR8B 1PFKA 4LMRA 3NEPX 3QMVA 4RMGA 3RAJA 1OTXA 3KR0A 4DRXB 3GIDA 2CL6X 7AT1A 1EAMA 3QBEA 5T3UA 3LD9A 3I1YA 2XRYA 4PLVA 4WWHA 3V6LA 4EIWA 1EDDA 4LFAB 2J3QA 3EXHB 4GKAA 5KOHA 3RJ9A 1TYAE 2CGEA 5J1SB 2QMQA 4B6PA 3CINA 2D5IA 2WNIA 1R8QA 3UGJA 1NNUA 2C04A 1BMDA 1U7TA 2VNSA 1YR8A 3JQGB 5K0CA 5IT9A 1ZEMA 2CVZA 4KR7A 1WUIS 1VSQA 1PNQA 1EP1B 4US2R 4A92A 2WHXA 4GKKB 1T9GS 1XG5A 2ZB2A 2CCJA 3C3BA 4AAYA 1GGFA 2OESA 2VDWA 3KYCA 3BMQA 3JSAA 3LHIA 3V1UA 1M76A 4QSHA 3FTFA 3O4GA 3OG9A 2E7ZA 4IO0A 3U0BA 5ALTA 4URXR 4EVRA 1Q95A 1AQ6A 3CU5A 5TPWB 3F74A 2P35A 5I9SA 4O2AB 5JJKA 3KUDA 5DYTA 3DFUA 1ZW1A 1AMNA 5JSZB 4FN5A 3ZIAA 3OT1B 4XUGB 2PH5A 5BSRA 1PVDA 3SJZA 3D6HA 4KJXA 1YZTA 3NI2A 4IHQA 1Q84A 1L4MA 3AIIA 1WOMA 3CIFA 3P9CA 1RJDA 2EAUA 4RF4A 5TF4A 1NLMA 5DNAA 1T2NA 5DX0A 4IHJA 2PUEA 5REQA 3N6RA 5A3JA 4XB2A 4DC1A 2B98A 2WMYA 2C54A 2ACVA 4M7WA 3ZS9A 2AYYA 2WU8A 2W93A 2UZ4A 1GNRA 1U5CA 3OJLA 2BFDA 4PG7A 3KSRA 2C4WA 2XOKA 1EZ1A 1ZBDA 4MUNA 1EUCB 5AW7A 3AM3A 3WNDA 3MQ4A 3V1NA 1IJEA 4WFIA 3ZE8A 1VE1A 1GRCA 4CNBA 1I1OA 2BONA 1B6SA 2PD4A 2QRKA 1K8QA 2NOAA 4GLJA 1P8AA 4GPAA 3R8XA 5IDWA 1DX4A 3NDBB 2QM7A 2X0NA 3EDRA 1W4BA 1WABA 1KZYC 3H7IA 4NJEB 3WL6A 1V3TA 1K6MA 1ZH6A 3I2FA 1OI4A 4W82A 4Q9IA 4C4SA 4FDMA 3RVPA 1NVUQ 3WWOA 1HLPA 2H17A 2PV0A 4UQLA 3DKKA 1R6VA 2AQ8A 5F7OA 1UWVA 1GQRA 1WSBA 2HXSA 1V4NA 3LSTA 1U7WA 4FSXA 1CUJA 2P8JA 4NYJR 5P21A 2OYRA 5TJHA 1G21E 5DK4A 1F2UA 2AMFA 3CW8X 4IH9A 3H6KA 3T9EA 1L4FA 1X9HA 1KGSA 2HJRA 2PUVA 1OFTA 3HPRA 3IT1A 3QY9A 4JKYA 1G20A 4N7RA 3VPDA 1R88A 3W2TA 1XTSA 4BGVA 3I72A 1XRLA 3HBLA 2Q2NA 4RSRA 3WZ2A 4Q15A 3WGQA 4GM4A 1O89A 2V45A 4OIMA 3BH7A 2WUFA 3HSKA 1FQJA 5B5SA 3HUDA 1UZMA 2HPHA 4RHTA 4DB4A 3DXYA 2CDCA 6ABPA 3UCFA 5EYPB 1ONOA 3T3OA 3ML1A 4K3UA 1EUDB 1L2TA 2FOLA 2FPGB 4ZICA 2WU1A 3G9ZA 5BWCA 2BF7A 3AJDA 3I32A 2NZXA 3DB1A 4ND8B 4TM8A 2GVZC 4XKJA 1JEYB 1J90A 2ZP1A 4IVNA 4U7HA 3EDYA 3LRTA 4OKIA 3DOJA 5IAAA 2QG4A 3WGKA 1QV9A 1SO8A 3LFUA 4C4XA 1H2XA 2NT3A 1OIVA 1K75A 1SG6A 3FF1A 2NVOA 1IN1A 4QXQA 5FI5A 1W4AA 1P1FA 1UJ6A 3VDNB 4DIDA 4HF7A 3LIIA 1Z68A 2HJ9A 4AKTA 4CMEA 2R1VB 2WV7A 3LFHA 2LV8A 1NNSA 1T10A 5CU7A 1KZ6A 1MR3F 3PB3A 3RASA 5DYNA 1DMRA 1PW5A 1C7FA 5C7LO 4I50B 4GQBA 3OO0A 4PX2A 2O8FA 1XEFA 1A4UA 1IQPA 1UBFA 1XIVA 3W4IA 4BLSA 1HPLA 4BWYA 3SM3A 2OCXA 3HEBA 2VOJA 4GLBA 4WLFA 3EEIA 3CCBA 1CQJA 3DOEA 2FH5B 2UZ0A 3FNQA 3AHEA 3LXXA 4MGKR 5EA2A 1XD8A 1BS9A 2EDCA 5SV2A 1VA5A 4L07A 3PGA1 5BSKA 2FLVA 5DP1A 4FSHA 5DXAA 2VPQA 1YA4A 5EKXA 1GZ4A 4JSRA 4OU5A 3U40A 3E3LA 3M49A 1VJTA 2BW0A 3KJHA 2CLEB 3IXMA 2C2XA 4FVTA 4IX1A 4MV5A 4DNFA 1FDRA 2WJ4A 5A04A 3GPBA 3VPGA 4CL8A 1N6PA 1UBOS 4J0JA 4R8RA 3KP1A 5I3ZA 1L4UA 4OAPA 2C78A 1SU4A 1ETHA 1L5OA 3V3KA 3BHIA 1XHEA 2J32A 3U4AA 4W7SA 3O4HA 2NXJA 1MLDA 2VP0A 4V0QA 1GCGA 1DZ3A 1SM4A 1T5DX 4X94A 3V1TC 5LKAA 5MFPA 4KDRA 3AFIA 4OB8A 5FUWA 1T2AA 1XZKA 1Y89A 3STXA 4DLTA 4Z0HO 2AK2A 5E4JA 5K7SA 3V4RA 1G9TA 2VJPA 3D3WA 2ZSDA 4QUJA 2QM3A 4DLSA 1LBSA 2WJ6A 5EGSA 4N4AA 3BSWA 1BTOA 1OFGA 1P6XA 2QZ4A 2Z9BA 4JASB 4QFMA 4UE6A 1JR3E 2ZIXB 1CJSA 3NPAA 1DAOA 1KY4A 1Y63A 3FDJA 2WWVD 2VZ0A 2BLNA 2WMOB 2ZS8A 4HWPA 2ZU0C 3HYTA 4XGRA 1CNEA 5JZVA 4N41A 1SZDA 1XZIA 2W2OA 3AEUA 4PLCA 2IU4A 4R2KA 4W5OA 1SZPA 2C29D 2XCOA 5FR2A 5MN6A 2ALJA 1H0SA 3BERA 3ORQA 3QYFA 2H1IA 3LP6A 1WUYA 5A4FS 4FXPA 5HSGA 4ZEXA 3B1WA 4PO8A 4X7RA 5LB4A 2YQ4A 1OLUA 4C2AA 3SBXA 1TVKA 3OM8A 1G7CA 4MV1A 2H0RA 4QTYA 3AESB 3OO1A 4YASA 1E2UA 4BLWA 4RENA 3AZOA 2DM6A 4CVNA 3AUSA 3BZUA 4CKXA 4A16A 5TMBA 2ZJ5A 4G84A 1BH6A 2FF7A 2PL3A 4E4RA 3KWMA 4FJ2A 3RYIA 2IH4A 1UKYA 1WVIA 2REQB 4PQYA 3RFFA 4XD2A 5DZSA 1UJCA 2RSLA 4ZO8A 5BRJA 1ESMA 1U80A 3PNYA 3U37A 1Q3HA 1ZC4A 4LYFA 1G20E 2HMTA 5AIAA 2A5JA 2R85A 4URYR 2B4RO 4YRIA 3JRXA 2AZDA 1YA6A 3LWDA 4L5BA 4ALMA 1NJ6A 2P0EA 1M2OB 5AH0A 4WHMA 4LJRA 5IJ9B 4DJFC 4IZHA 2QNRA 3GT0A 3WXBA 3J81A 2H2AA 2DF8A 2YZNA 5BSHA 1WXGA 3DAPA 3N59A 3PEEA 3GJ8A 4IYRA 5CYFA 5HKAA 3WLAA 4YXWA 4QSMA 4YPFA 3KDSE 5PNTA 3RGGA 5AM5A 2BP7B 2WG1A 5DNEA 1Z34A 5CM9C 3EGVA 4JU9A 3GJQA 4EJFA 5IABA 4AS3A 4FMPA 1S2NA 3L6DA 1NURA 4F4JA 3TSOA 2BM9A 5LOVB 2DR2A 4R1PA 2OXFA 1X87A 4AI6A 2IODA 1RJEA 4U7WA 4LTMA 2WWYA 2RBEA 2A0YA 2VHEA 2ZLBA 1GGJA 3T7AA 3TSCA 4BL5A 2ODWA 5TJ9A 4ON9A 1WQ3A 2ZT8A 1JQJC 1SCNE 5EEHA 3ZY6A 3LZDA 4MYRA 2EEPA 1J24A 4L9RA 4RYDA 4YC7A 3IBYA 3V48A 1VL6A 2NYAA 3RWMB 2Y68A 1FJGB 1T9GR 4C04A 3IBSA 4JLMA 1K0FA 3C8DA 2JI4A 2NXCA 3G8CA 4E7OA 3KOYA 4MWZA 1TT5A 5K3AA 1V2GA 1GA4A 4MJXA 2YWGA 3AP2A 3WGYA 4ZCRA 3FPAA 2XZLA 2G9NA 5ED4A 4JBIA 3VVMA 5AOVA 1L5SA 4C0AC 5EJAA 2DWQA 3A1FA 4JQYA 4MWTA 4O1IA 1R6AA 1AD2A 3IVCA 4JITA 3WP0A 5DP2A 1JW9B 4D0NA 1Y1RA 3FKQA 1L7DA 3LX4A 4J7UA 3GC6A 2W70A 3ORRA 1QUEA 3V2IA 2PN1A 2IUUA 2C4KA 3W4JA 4D82A 1NASA 1YZHA 1U0FA 4LI0A 3PI7A 3KETA 1KOFA 1ID8A 3SNKA 2YIJA 1R27A 3QE0A 1Y6JA 4D9FA 1J2TA 2RC6A 2YWFA 2F3SA 2PKQO 1HKHA 1PT5A 5CA0A 4B6EA 4GYJA 3T15A 3O8QA 3I5YA 2H51A 4AYTA 2AZTA 1BA2A 4ROTA 3JQBA 4CCAA 4CL2A 3DVSX 1DE0A 1P5RA 3I34X 5HNKA 4TTRA 2K7ZA 4EJSC 3GG9A 3CJRA 2ZE5A 1SQFA 3DDZX 1NR5A 4QDZA 3UT0A 4I1VA 4D8XA 4UTVA 2IX3A 2W8BA 1KJYA 1JVSA 1NRJB 4RFLA 3EZ7A 2IVFA 3P0IA 2B99A 1R0BA 1AV7A 3F2VA 4KE6A 4Y98A 4B8ZA 3VYTB 2NLOA 1WVMA 3SVLA 2RHWA 5DM0A 2CV2A 4YRCA 4C14A 2FZVA 2QMOA 3OFVA 1FCJA 1ADFA 3RD5A 3RQIA 1SCBA 4ZO7A 4A91A 3BTSA 1BXRB 2OR3A 1F6WA 3O8BA 4FMBB 4PRLA 2Y1XA 4CIAA 4RJJA 8ABPA 3OWOA 2K2WA 1M73E 4UEOA 1E1RA 1H5UA 5LYJA 5BMOA 2YXEA 1EFPA 5IC4A 1GUDA 4PLHA 4ZCMA 1WWKA 4EJ2A 1HR0B 1QYXA 2Q1YA 1NOKA 4CLOB 1QDUA 4TL7A 1SHJA 4R0MA 3MJRA 4M55A 3ITDA 1HYGA 4UNSA 1QH0A 1SULA 3EDCA 1GLGA 1D5WA 1H0RA 3NQ41 1Q77A 2JF0A 5AM4A 3DCIA 3G6WA 4YMSA 5BV8A 2EU8A 1OTHA 1EBFA 2VIIA 3OEWA 1J25A 1FRQA 1QFZA 1VOTA 1WA5A 5EL0A 4OHOA 3GAFA 1ACMA 2P3LA 1SN7A 3ORYA 4Q93A 3SQDA 2GPTA 3SDSA 4QYXA 3W3AA 2COKA 1BWSA 1M34B 1BN7A 1VSUA 1ZQ1A 1P77A 1T5LA 2Y3IA 3E2PA 3G89A 3HWSA 3MQ2A 5ALMA 1I3OA 5G0WA 3QYAA 4ZVSA 1XMPA 5LA6F 4F93B 3CISA 2YZGA 1CUWA 1TVCA 2ZJ1A 1O95A 3A1SA 2ZYHA 3DPIA 2JA2A 2FVYA 4TLMB 5EHNA 4UU7A 1I94B 4IICA 1PO7A 2HF9A 5EE3A 5THQA 1ZR2A 4C6RA 2NTNA 3V2UA 4DE5A 1CF2O 3SSOA 5A4AA 5FHRA 3W1EA 2CJWB 1GZ6A 4AWXA 4DA6A 1M1YE 3LDGA 5CT4A 5JJIA 1Z6ZA 2EZ9A 4B7AA 1GTSA 1GL9B 2IUTA 1KKLA 3Q7SA 4J29A 2DWPA 3WL7A 1U7PA 4Z49A 4FYPA 4PPFA 4UQPA 5DHTA 4E4YA 3VSDA 5TF0A 2O1EA 4EJ6A 5LXTF 3TS1A 2FSFA 2ORIA 1P4AA 2C4NA 2FJUA 3VAAA 5EJ7A 1UFOA 4ARVA 3NHMA 3P26A 1B43A 2IOQA 1E2MA 3ROMA 3IAAA 3AHIA 1VHDA 3FJOA 1OFIA 2VJKA 3L43A 1R66A 2V6MA 4Y1RB 1H8EA 2GJ8A 4FR5A 4MRSA 5L53A 3NDPA 4GVXA 4L4ZA 5B1IA 3G2JA 3UOGA 1QO0D 1AB6A 1U2EA 5BR4A 2IH5A 2C95A 3OPXA 5C4GB 5BOVA 3BWXA 2FEKA 1NL3A 2JGDB 3CX8A 4ILEA 5KNBH 5J2TB 1H1TA 1Z33A 2YIVX 3REOA 1EUZA 2EL9A 4NZZA 2L69A 3VC3A 4BO7A 2FP4B 1X1CA 3ZDZB 4CV1A 4DWWA 3RIXA 2FWJA 3OPVA 4X00A 4BEBA 5A06A 3F2IA 1SHKA 1E1CB 1HEYA 3M1IA 5G4KB 1QB8A 3BWVA 5BN1A 5KQPA 4KWIA 2PIDA 1ZK1A 4L5YA 1DU4A 4XB6B 5CLLA 1S2LA 1BWQA 4BASA 3S28A 5B2FA 1DJOA 1SQGA 2P4HX 4EW3A 5GONB 2X40A 3NCHA 1OBFO 1YO6A 3SKXA 2IS6A 1F9AA 3NALA 3GFFA 3P0JA 1J8YF 1JDBB 4HLDA 4PLGA 2AZXA 2G1JA 2FEPA 5FBRB 4FS3A 4URHA 1IBMB 5HKOA 4B76A 1M6NA 1EDZA 2OUKA 2BHNA 4YRAA 4N54A 1P5HA 1ZN8A 3K9QO 5D1HA 2QTHA 3EZLA 4HNSA 4JP2A 4Y2VA 3A6LA 3A6HA 4I36A 4BBPA 1OLUB 3HN7A 2EQBA 2W2LA 3KWLA 3F8SA 4FDAA 4P32A 5IVKA 3LHKA 1VIVA 2Q4TA 3NNSA 3IHTA 3PC8C 1VJDA 3IERA 4C88A 4TLDA 4M8KA 4URZR 3P27A 3FPHA 4JY7A 1WMEA 4QD3A 1JHPA 2IYTA 3MWDA 4LSZA 2C98A 2GDJA 2YNMA 1SCJA 3G2MA 2AOXA 1WETA 4NFYA 5LD2B 3JWPA 4L5IA 4KR3A 2OSVA 5D6NA 3RIHA 1IN8A 2PQ0A 3PNPA 3SF8B 3VOTA 1WZIA 3C3JA 3QHAA 3S44A 3L77A 4FHDA 3WGLA 1IWPB 1NP3A 2NP6A 4Z51A 3KE9A 3FTCA 3H2BA 3QMMA 4JWKA 3D8UA 1EGMB 4FQ5A 3TIVA 4WOCA 3EISA 4YJFA 3A1EA 4JYZA 2D3TA 1FX1A 2XNDD 4QM7A 3HDGA 1RZUA 1B0UA 3Q5DA 3V1MA 1PRYA 1U1CA 2JGIA 5BQXA 5T4BA 4P82A 4O63O 3H8JA 2AGVA 1QIGA 1GARA 1JMVA 1LRKA 2AT1A 4V24A 3ZUGA 3B12A 1I13A 4GMXA 1NTOA 4D8WA 3FE2A 3MWFA 3RWBA 1NJSA 3PPIA 4CUJA 1GDTA 3DL7A 4AVYA 1AK2A 1K7FB 1E8DA 3L6CA 4KK3A 1F0PA 1ZM7A 5BXYA 3O4VA 1IEXA 4Q37A 3AIOA 5EESA 2A9QA 3P1JA 1T25A 3V7UA 1I1NA 1SXGA 1AKMA 3VC2A 1LLUA 4B3CA 1THGA 1SUFA 2HLPA 3D8NA 3GNQA 2W2KB 1JZQA 1KQFA 5CDFE 4TLBA 2CJPA 2PUCA 2YNMC 3QK7A 3Q41A 4MB0A 1AO0A 5KKNB 3IQZA 4RTOA 1HRDA 3PKZA 1EWVA 4F3YA 5L9AA 1KXJA 4C7MA 4V1CI 2DBVO 3FBTA 4W9MC 3FD8A 2B92A 3G0BA 3S8YA 2OQ2A 3WKEA 3BAFA 3WLKX 3BORA 3L1IA 1TUIA 4KUHA 3BVPA 5JWOA 3W5CA 1AKWA 1EJ2A 3DFIA 1O77A 1XN1A 4RO0A 3NHWA 1NJ8A 1KEVA 3DL4A 3OJOA 2F90A 1U8TA 3QVTA 2AHRA 4HQOA 5AT1A 3WRXA 1ZJ6A 4KHZA 2PGNA 2H08A 2YUIA 1NW5A 2B5WA 4FEAA 4QHTA 1XTVA 4CLOA 3T9DA 3DP9A 3CUYA 1EB8A 2QRVB 4BRUA 3F7MA 1FFGA 1Z5UA 3HJFA 2Q3JA 1CJMA 2IHZA 2BH9A 3D7KA 1AO3A 1TYDE 3HVRA 2I62A 5L51A 3MCUA 5JNVA 5AUOB 3STVA 1G59A 3NT2A 2H3EA 3VU0A 3HVIA 5KU7A 3UN1A 4Y0VA 1OU4A 5TS2A 2GYWA 2HRQA 5AESA 4GWKA 5T67A 4JX8A 1Y1PA 2GN0A 3KJQA 3EE6A 4LDZA 4WL0A 1EE9A 2UYHA 1FSPA 1D4FA 1T8YA 3TMKA 3PTAA 3D43A 1LJUA 3CZPA 1FFXA 3PPXA 2E48A 3QKRA 4I4TA 4HDNB 4MV7A 4P54A 3VH2A 4H27A 3UMJA 1IYZA 1SC6A 5J4YA 2HPVA 1E92A 1GU1A 3R76A 4IGEA 1A8UA 4M1MA 2ERYA 1JHUA 2PWAA 1QC5B 2XTZA 3Q0TA 3M6XA 4KMRA 2ISQA 3OCXA 5EJGA 3W5UA 1MV5A 3RANA 5JZOA 5AI9A 1YFLA 3E8XA 1TF5A 2OXRA 2R96A 3OT5A 3RVNA 3OEYA 1IZ7A 2MR6A 3H9JA 5CA0F 4WQMA 1OPXA 5KSOA 1Z45A 4P3OA 5JMOA 5KNBA 1IJBA 3WYBA 5CEJA 3PNKA 1NPYA 3WWCA 4HDNA 4RPJA 1EEHA 2BI8A 4L27A 5EEGA 4JVSB 1YACA 1Z4PX 1QFJA 4LMAA 5DXJA 2QN3A 1KC3A 1OLOA 3B6JA 3COSA 3AR5A 1X7YB 4CQLA 4R2IA 1EMDA 2X13A 2R6AA 2JCBA 3DTYA 3LT4A 3RUCA 1D04A 2ZITA 4ZDIA 4BNDB 1DEHA 2BSXA 3SOZA 1KR2A 3NPMA 4HYTA 3ZWDA 3WWEA 3B1ZA 3F1KA 1C4OA 2VLIA 4NYJQ 4EVSA 4DY4A 3E9RA 1NJ2A 5G41A 1NR7A 4EL0A 1TA9A 1E1NA 1MEEA 3D4BA 5EQFA 2R8PA 4AURA 4GM1A 4EUFA 4MIOA 3G2QA 4PSDA 2WHPB 4XR4A 1X42A 4EOGA 3R8FA 4UJ3A 4EY5A 2C97A 3SG0A 4LJSA 5FLKA 1SD5A 2C3MA 3B60A 1A7KA 3DXXA 1FNBA 2X2EA 3EAQA 3TNJA 1DX9A 2FJ0A 2BELA 1A1SA 1TK2A 3O7MA 4QXOA 1WAMA 2FWMX 3ZIAD 3AZPA 5AFSA 4HSGA 4AWBA 1JSZA 3TLGA 3L7IA 4L8WB 3HXLA 4IOJA 3B2NA 4JEIA 2L19A 3AEYA 3GDHA 2NZUG 5EXDA 4R1QA 4ZP1A 2QAJA 1KEEB 1E96A 2QIPA 5F1YA 3UPTA 2K7FA 3CVYA 3PC4A 9LDTA 3N0RA 3QVVA 4D3YA 2PGAA 3MBKA 3KKQA 1UANA 1PK7A 3ZV5A 3ZJTA 1BGWA 2R86A 1UDXA 4ZAWA 1XMIA 1L4KA 1E4EB 3EVEA 3PLNA 3R6TA 4II7A 3UTCA 2BFWA 1E66A 4XPIA 2F43A 3O82A 2H1LA 2WAOA 4GOMD 3AFGA 4D4GA 1WUHS 1LBQA 4RMNA 3FLAA 3PEWA 2QR2A 3HYRA 3PXBA 1QMGA 5DWQA 3TRJA 2C2HA 3OEED 5KTSA 1KI7A 4E07A 5B12A 1Y1QA 4BNLA 4YEDA 3A27A 2VHUA 2VQ6A 3MILA 1LJ8A 4BQSA 4W5JA 1L7MA 5EE5B 4AP6A 3ZHQA 3JQ7B 3PJFA 3U44B 2OM2A 2P5UA 3THYB 3DXFA 2MU1A 2KM1A 3FR7A 4WLOA 4BYGA 5B3JA 4L02A 2MTBA 3UAYA 5C8YA 2QXTA 2GEBA 4GVLA 3CEPB 3K5IA 3QNUA 2GAJA 2QRLA 1P5ZB 1HNXB 2X1MA 2Y1WA 5CYPA 1F60A 3I62A 3F6CA 4W99A 3ZVLA 5JLJA 1FJ2A 2YV5A 2FOIA 1XKQA 4GI2A 4IIJB 1JDTA 3IUJA 3HRIA 2HLDA 4DMMA 3DDCA 3QNWA 4DLXA 4CF7A 3GRRA 2F9FA 3HJRA 4DQKA 4RFSB 2JGMA 1T15A 5B7PA 1JEQA 3CEHA 3C8UA 4R0NA 3IODA 5NULA 2A0FA 1XL0A 3IOBA 4BFUA 1LS1A 3OP1A 2WUWE 3AI2A 1C9DB 1GG8A 2IKSA 2B4TO 2KSQA 1C7QA 5ED0A 4E2XA 4EB8A 2W6IA 3OA2A 1YOVA 3NETA 3TPCA 1WM1A 5FUQA 3LQQA 2B4QA 1UQUA 4JMLA 1ZITA 1CE8A 1JDBC 2EW2A 3E6AA 3LG2A 1KFEB 3NTVA 1OKKD 4Y9SA 3V97A 3D3WB 4YHHB 1XR3A 4DLUA 4CHTA 3KSZO 1GILA 4OREX 4Q16A 2CFRA 2OCYC 4C20A 1SB9A 1UBSB 4C7OB 3RWOA 1F1BA 4RV5A 1IBSA 1OX4A 1RYHA 4M0DA 4KXYA 4MWGA 3K6SB 1BN6A 1YJQA 5AK6A 4LC1A 4ZT6A 3VU3A 3GEBA 3VJLA 1AK9A 2VPXA 4QVGA 2H18A 4Z3KA 5DFAA 5JYCA 4HN9A 4OO3A 2I80A 3JQ8A 5JJ5A 1IVYA 1HG0A 1XVUA 4IKEA 3OOHA 1MJGA 3DTVD 1VQ1A 1QHHB 5AKXA 4OK6A 3DZJA 4KR9A 1F6DA 2JCYA 3RHZA 3TYXA 2G4LA 3VPBA 4G0PA 3RT9A 5JE8A 1G1AA 5K01A 4M7OA 4B7CA 2ZWPA 4BO1A 2J4DA 2FFRA 3WIBA 2VRWA 1PL0A 2CJXA 3A7DA 2VXCA 5G4KA 4A3SA 1RRCA 4LYAA 4OBEA 3CO5A 1M6WA 4HNUA 2Y0DA 1ORIA 1MXHA 3K4HA 4J9VA 4P2BA 2GI4A 2FX5A 2QDKA 2C1XA 1TD9A 3GA0A 1UT6A 4HZIA 5AW6A 5EHXA 1TJNA 1Y33E 3D3JA 2VH2A 4DIOA 3QE4A 1VCNA 1GCIA 1I3KA 2H4FA 2H4YA 4KAXA 5HCUA 3RC7A 5IJWA 1D7AA 4PPNA 1FP7A 2G25A 3TLGB 1M1NA 2HUPA 2Q4DA 2E0IA 1IHUA 1O57A 4JFRA 4OP1A 1U2SA 4TN5A 1SUCA 4CL3A 4EDHA 1EX9A 5ELXA 1SQ5A 4DSAA 4OX9Y 1BQ4A 3L7OA 4O4HB 4QEZA 4WVFA 3MPOA 2FE1A 5D1NA 5EERA 4HGPA 3HADA 3STYA 2Z43A 1CK4A 1CUDA 3MW8A 2PUFA 3DE3X 5LWHA 8MHTA 1HDRA 2D0IA 2QGNA 3NAMA 2I8CA 2WUDA 4F3CA 4Z7JA 4J4BA 4Z4FA 5BUZA 1MU0A 5FLEX 3UPUA 4KPUA 2JD1A 4DA8A 2PG3A 1UJ5A 2RGBA 2VHTA 2JGFA 5MGBA 3KD3A 4AK9A 3KU1A 4ITVA 3HE3A 4P92A 2YOHA 4NESA 3U80A 3L8ZA 3AWDA 2XHZA 2OVBA 3RRFA 1KK1A 5I8PA 2W8ZA 1UKZA 2HIAA 3VYRB 2PZJA 1S8FA 2JCGA 5ER6A 1BG6A 2BF4A 4BJ3A 4DM3A 3B5EA 4ZIRB 2AJDA 2YMMA 1NHGA 4DUPA 3R3VA 5LR6A 4QYTA 3ZZ0A 4QO7A 3L7CA 3ZVMA 1TMYA 1QVWA 4JA0A 2X0EA 3U3DA 1PZGA 1RLOA 1T8TA 1YDGA 4HOYA 5ETJA 5JASA 2WVGA 1NNI1 2WJGA 3LY8A 4N3AA 3RBXA 2RHJA 3SS7X 3WJAA 4RJ2A 2AIRA 2R00C 4EMUA 4DB2A 2Q3CA 1B2RA 1R6DA 2DRIA 4BMVA 4Z4QA 1YAHA 2AVDA 1B0PA 5FPSA 5IMBA 1GIAA 5FBWB 3DKVA 2BGIA 2EBHX 4BNIA 4URUR 2RGWA 3TKLA 4E33A 1L5FA 2XMQA 3ESYA 4QRHA 4YDSA 4NWIA 2P67A 2GF2A 2RGDA 3FA2A 4HFJA 4F91B 1FL9A 4NK5A 3NC4A 3VR5A 4G5FA 1E6EA 1PFWA 4Q3AA 1G8PA 4RHCA 5FR1A 1ADGA 4TWZA 4JYAB 2O8CA 1SC3A 2CB0A 3WQHA 4B35A 4Y9DA 3TQRA 5CH5A 3F5FA 2IY8A 4S24A 4CJXA 1HFWA 4JDPA 5J5AA 1A96A 4UNQA 1XU7A 1OBHA 2CVQA 2WYVA 3IQXA 4UNPA 1N92A 2O2GA 4R0VA 1VCIA 1FUUA 1W30A 1T8UA 2AV6A 2FY8A 5REQB 4B3TB 1JH9A 5HEKA 3TPFA 3AX6A 2XYRA 2BGGA 5AKKA 1IN7A 1OWNA 1ZJ5A 2H07A 2H1OA 1GQFA 3C3EA 3SZ3A 3U39A 4UHDA 2WM3A 1HDCA 3WQQA 1Y34E 2IXTA 2TMKA 3DBLA 2JFQA 2CL0X 3GZJA 2PFSA 4KE9A 3L92A 2DCUA 2XDQB 4I46A 4YUXA 1VGVA 1QM5A 2PBZA 3D2BA 2F1RA 4XVCA 2EKQA 2J9RA 2WJYA 3IMFA 3TRKA 5E2AA 2C00A 3O8DA 4I5GA 2HA5A 2B61A 2UZ1B 1W93A 3FN4A 2D7JA 4BQOA 2WEKA 3FYSA 4K3VA 4KXUA 4DWJA 4YAKA 2DPXA 2OILA 2BCEA 1JIQA 1G5IA 5DRYA 3FYUB 4GMGA 4CDNA 1I9CA 3ZGXA 3TIIA 5JNRA 4K2AA 1R5JA 2G06A 4G8JA 2DLNA 3ZCRA 2GNOA 2UUPA 3K09C 4DTIA 2AL7A 1JQLB 1F5SA 2ZJ4A 5SY4A 5A1TA 2J31A 4HBZA 1OAOC 4PZYA 1BGVA 3DGEC 2QG9A 4KPEC 4D9HA 2YMPA 4F12A 2CBXA 3E22B 1SOAA 1VL1A 3CR7A 3OJCA 4FEEA 1P73A 5F3WB 3NVKI 5AO9A 2PBLA 3R0VA 4ZOEA 5HK8A 4KVFA 3I1IA 1BHSA 4JVLA 1R18A 3SJ7A 1PSWA 2GLUA 3OH8A 3ZXXA 3HJCA 2YIMA 4YRJA 3PLRA 3L6OO 4WEQA 4CF5A 2W6PA 2ZREA 3NDIA 2HWWA 2YV4A 4Q3BA 3Q88A 3EG9A 4EY3A 1RCTE 5EJ9A 1G6KA 2ZWIA 1M33A 1ORTA 2ECKA 3COWA 4KQGA 1UPFA 4PLFA 4GE0A 1SKQA 1J0DA 3H9QA 1ZH4A 2EX0A 1NVMB 1I3NA 2J59A 1UJNA 4WE3A 3RUAA 1G66A 3HV0A 3FSGA 4G9EA 4ONEA 2O2DA 2JJQA 2WIKA 2YZKA 1LBTA 4IJUA 2WJVA 1EFDN 3N2GA 5LOVA 2H11A 1ZQ9A 2JK1A 4W6ZA 4XM2A 2PUJA 3T5TA 4NABA 1OZHA 1VC2A 2BFCB 2QLTA 2WD9A 4EHFA 1K2VN 4MQ5A 3FNRA 2DKOA 4IS3A 2B37A 2ZRPA 3UB4A 4OXQA 1XQ1A 2B78A 4RL4A 2HMVA 3GPCA 3TI9A 3PX3A 2CMHA 4IAOA 4LNUB 1ILWA 1Q11A 4TMXA 1GDHA 2XMGA 3MEQA 1GGMA 3DMFA 3KZ1E 2YS6A 3QLVA 4R84A 3L9XA 4PYOA 2JEOA 3QELB 2J3JA 3V1KA 4QKQA 2YJ5A 3U7EB 1R9NA 3E5MA 2QN9A 521PA 3H17A 3VR5H 4PWZA 1P31A 1E89A 2SKCA 4RNDB 2PRSA 1YZVA 4FCCA 1M6EX 3R4CA 3U81A 5KVSA 3IPCA 4GC9A 4C6SA 3Q2IA 2NXEA 5JS6A 3GLSA 1QNLA 4MPTA 2Q5CA 4ARZB 1DO8A 3M6FA 1IXYA 4MUGA 1Y98A 2BGNA 1ODJA 1X70A 3EFBA 5AXDA 3DFZA 4QJ4A 1YC5A 4UTRA 4TLAA 2REXB 2W6CX 4GICA 4LHXA 3CR8A 3BGVA 4WGFA 1NYTA 2ENUA 3PHHA 4RHFA 3ICVA 4P53A 1LFDB 7MHTA 1ISGA 2NZ8A 3CV3A 4BGUA 5B3JC 2EJBA 3AU8A 2POQX 5K4GA 1M1XB 1CW2B 3QVKA 1HSOA 2MINB 2HDOA 4L15A 2I6QA 1ZK4A 1VTKA 4MQFB 2XB2A 2AZ4A 1MB0A 3AVQA 5EZSA 2YL2A 4ZVLA 2BMAA 1I0IA 3JD2A 1SB8A 1VRCA 1Y3BE 2GPAA 2YMLA 3NM5A 5JNSA 1HTBA 4RY8A 3PDHA 4ZI7F 3JV7A 3IYLW 3TUZC 2QYSA 4MQ6A 3ULKA 1K27A 4BP1A 4CI0B 1Q44A 1BE8A 4RM2A 4D4JA 4BKQA 4OMUA 4IDFA 2OZEA 3GK3A 2Q5FA 4Q3OA 2QMZA 2AN1A 2J87A 3DDUA 2YX1A 1CY0A 1S2DA 1AKEA 1RKXA 1XNHA 2WFAA 4O3FA 4P1ZA 1C4XA 4PINA 5IKPA 4MRAA 1TUBA 3AR9A 1C7RA 3H4TA 5L7WA 2FN4A 4PHTA 4ZOBA 3VUEA 5HRCA 1FXUA 4NBWA 2V7XA 2COUA 2OAQ1 5IVDA 4KQFA 2RONA 1N32B 1QMPA 4BS9A 3GV0A 3FWNA 2HQBA 2WM2A 1HQDA 1OWMA 2BT4A 3N2KA 3NRCA 1JFTA 1Q19A 5FAXA 2XWQA 1XA3A 2YH2A 1N6NA 4QFCA 1UT5A 5TARA 3EXHA 3OZGA 4QELA 4Q0MA 5A71A 5CAEA 1NT4A 1P4GA 821PA 5ICFA 1M8PA 2WC1A 4RXUA 2PWZA 3E3MA 3GDFA 1FYFA 3UKOA 4HWGA 5B7NA 5K8JB 4X66B 3V34A 3UJNA 4MLPA 5ARDA 4L2IA 1UKVY 2F9LA 2VT7A 2FMTA 4J4HA 1IY1A 3K53A 1A5ZA 2I55A 3H2JA 3IUNA 4ZJYA 4XA8A 5JBNA 4Q4DA 5C8YF 1OX5A 5ALDA 1UCFA 4MDYA 4CMGA 3COJA 2OYSA 4UU1A 4Y6LA 1BU5A 3OPQA 3ZTTA 2IIBA 2YJ6A 1D7OA 5JW6A 2DU8A 1DDGA 4HDKA 3UWDA 2Q8QA 3QIAA 5DBIA 5TQJA 5IUKC 5JMWA 4HN2A 4K6OA 1OQAA 2VBIA 2VTBB 4HNAA 1U4SA 1XZAA 3T3GA 1NY6A 1B0ZA 2PV7A 1ZDMA 2V7TA 4RV9A 2GGSA 3WNVA 2VDNB 2OMKA 1S96A 2ZCJA 2VF2A 4YCLA 3QY0A 4KN6A 3U7FB 5H82A 1FNMA 3UGQA 4ZJPA 4RFVA 2ACWA 3GUYA 4OMCA 4U6NA 2BGTA 2W6ID 1RXEA 2CFCA 3BBLA 2NVBA 1C9EA 2Q41A 2EFDB 5EIBD 1U2TA 1FB5A 1PJCA 3GWZA 4TKVA 2AK3A 5JECA 3ZV4A 2YHIB 3ABRB 2YXNA 3AW8A 3PZRA 2WOOA 3DAYA 1NQWA 3LYAA 3M4JA 3WB0A 3EF1A 3M3HA 2HC9A 1AQUA 5GMOA 4BX0A 4DPMA 5CFNA 2WUGA 4QARA 3UMFA 2ZJYA 1KAQA 4KFCA 2JVIA 3QPUA 4H7EA 3TECE 4HRVA 4GGOA 5JFTA 1RABA 2IL1A 1RVDA 2YZ2A 3P20A 3VH3A 4EG5A 5LVAA 4H4EA 2O8DA 5CCXA 4ZQCB 4QVKA 2G5PA 3UFBA 3ZKWB 4O4IA 4C01A 1PUJA 1R0YA 2BHTA 1GITA 1SBCA 4KOAA 4R9RA 5K6TA 2BBOA 3P9XA 4LVNA 2W0MA 3L4JA 3GZNA 2Y1KA 4FMDB 4GPIB 3AY7A 3IR5A 5AKIA 2ZPTX 3ETJA 1N6RA 3TKAA 3L8MA 3TM5A 4N3BA 2R62A 2P78A 3FTQA 3JQ7A 3U3XA 3LX6A 4WXPA 4Y1EA 1ZBQA 1KDOA 3PUJA 1I7QB 4DLWA 2NADA 1GRRA 2YV1A 3ZE6A 2VF7A 4J76A 3S7ZA 4JNKA 4EHBA 3VU9A 1GNSA 2GPSA 4P7FA 5F5XA 4BQNA 4OHXA 5C51B 2QD2A 1UZAA 4BRSA 3BZBA 4PLWA 2F43B 3K9CA 1E1CA 4MYSA 3RUIA 2FZLA 2P5TB 2QRPA 4ZZ3A 4DW8A 5FYDA 3WKBA 3NWPA 5F5NA 4YRDA 4JB3A 3RI3A 3EEFA 3FYHA 2HRDA 3NXSA 1T5IA 4AG6A 1CEEA 4KLNA 3QNMA 3KOXA 1GPLA 2OFWA 4C06A 2ZRJA 4LZJA 1N1GA 3ETCA 3T52A 2A7QA 2HHLA 4AULA 4YDRA 3CVUA 3L02A 3ZDYB 4KHPB 4U7PB 2FZCA 5HIMA 3ZNQA 2Q5JA 2FFHA 4OLAA 3EQ6A 4C4OA 1XKLA 1C1HA 2WTBA 3SKYA 5CCBA 3BXFA 1I3LA 3KPVA 2NUTA 2VYND 4G01B 1BOFA 4QECA 4RF2A 1V47A 2QENA 1N3BA 1DQRA 5TT1A 2PUBA 4QC2A 1Q0TA 1GPKA 1MA3A 1W88A 2ECOA 5G0TA 1KQ3A 1JAXA 1HE2A 2I3AA 1JKFA 4U2KA 3PNVA 3AVPA 2NSLA 3ZCPA 4BC0A 4D96A 1NJFA 4RVCA 4W5HA 2DZDA 1QQ6A 4Q7EA 4WZAB 3ZZUA 3KSBC 1AS2A 1KGDA 1V7PC 1ZU5A 2HSEA 4EY8A 1I5EA 2Q1TA 3ONWA 4Y0NA 1XT6A 1X7XB 2FSIA 1YCHA 2XT0A 3OQ6A 2P2DA 3LPMA 3WLTA 2LIPA 2D5CA 4RF5A 2DBZA 4HAIA 3RS9A 1PUIA 2R2GA 5CBPB 2J3LA 1T4DA 2Q4BA 2R8BA 2WQ6A 3RQSA 2Q28A 4F6RB 2PTGA 2VAXA 1V16A 3T5GA 1JR2A 4C6TB 5ERGB 3VZCA 1KI6A 2PD3A 3F5DA 4PYNA 3ZGVA 4XRGA 4HUJA 1QORA 4AJIA 1LDMA 5IXJA 4ZHQA 4L95C 5JBIA 1KP2A 2BIFA 1OX4B 1VKRA 2IHKA 2J0UA 3CX3A 4TVKA 1SWVA 3OWXA 2DYKA 2PMKA 1TIPA 2H1HA 1QRUA 4IHJF 4EZBA 3A0UA 1KH1A 3C8ZA 2Z0MA 3H6GA 3D1JA 3KSDO 3ZHCA 4I1RA 3KZCA 1V95A 4QDUA 5AJYA 4UAJA 3OIYA 1L5QA 1Y3IA 1WMAA 2IBMA 4LDQA 3C48A 5IARA 3V7YA 3CUEF 3JD4A 3PQEA 3AGQA 1TVKB 4MQBA 4NC9A 1OLSA 5E9QA 4C2BA 4FHZA 4B3IA 3QSYA 2FTKE 3C5HA 2X4GA 1ZD4A 4C0JA 3LUHA 2YJTD 3TRDA 1CF4A 2I2XB 2P2GA 1GV0A 3F9CA 1FYVA 2Q7DA 4KWCA 5AW1A 1UK9A 1EM8B 2J9ZB 1DP4A 4MGYR 3T5PA 3RRNA 3DE2X 3EARA 4AX4A 3A6PC 3SR3A 3L3BA 1F20A 5B3KA 2RAVA 1DS6A 1MX5A 1J21A 3DBRB 1QTNA 2CLMB 4TT3A 1NX9A 1KA9H 1MN6A 2GEKA 2MDTA 3BHNA 1ULTA 5EVJA 5BQ3A 2ST1A 1D2HA 3C41J 3MHPA 4B4WA 1O54A 4E5KA 3IHWA 2R5WA 2HWKA 1ORRA 2GARA 1CETA 2GHIA 1JE1A 4U3JA 5ECWA 2VP4A 3FVVA 1P81A 5CURA 4BFWA 4X45A 3IBTA 4PG5A 3ZX4A 3QWFA 9ATCA 1U1EA 4BBAA 5TLSA 1T2FA 4A5OA 1D5CA 3KKKA 3OLYA 5F1KA 3OLZA 4G5QA 2WF9A 4MHOA 4OI0A 4LOJA 3QOXA 4DQ0A 3IAEA 5J4KA 4F6LA 3GQVA 2CKMA 3OQPA 2FW1A 1SXJD 2VHXA 1RIIA 3WWYA 1R0KA 2V8OA 5BSTA 3ZUPA 4ZTZB 3IV6A 3VR2D 3WLHA 4OQPA 2NZVG 4B45A 1Z4OA 4OHMA 5BOSB 3DEYX 5IUJC 4ZVPA 1QKKA 4N8EA 3WFIA 4WJLA 3RAGA 2FLWA 3GGSA 1KS9A 3GVXA 1TO6A 1XEWY 1XYGA 2GA8A 1RMQA 2CXTA 3I09A 4UUQA 5D51S 1ZOOA 4BDTA 1YIAA 4D2IA 4AZ0B 4F4CA 1YJBA 4XWGA 1P9NA 2YDYA 5I5GA 1V8DA 4JXKA 2ZM6B 1W4CA 3QF4A 4UHEA 1SXHA 2ZUBA 3NYQA 4N0PA 2HIGA 3ITNA 2ZIZA 3VAZA 1ZZGA 4Y7CA 5FKJA 4B4DA 1K6JA 3ITKA 1L7QA 3L40A 3Q9SA 1R74A 1PF7E 2QJRA 2VL7A 3A6KA 3BKXA 2KHZA 5JD3A 3PCRB 3RS7A 1IPFA 1YI8A 3OLQA 2YXBA 3GJ3A 1N8NA 1XRQA 4WINA 3NT4A 4U5QA 1KAOA 1T6YA 1RRFA 2HMUA 1VYUA 2ROQA 2P0YA 2E6UX 3EGDB 1CLEA 1LW6E 2H2HA 3HVHA 1TB4A 3PA8A 4NS4A 4BGEA 1DKPA 2OLJA 2DC1A 1AZLA 1EVLA 4B6RA 4E5UA 3UFXA 4XJXA 4F9TA 3HGTA 5ARBA 3MMPA 4V1CA 2I87A 3FX2A 1V11B 2H85A 4L4UA 2DQYA 4LJAA 2LPMA 1ZHHA 2ZS9A 1JQAA 4NBRA 4GP6A 4KXMA 1V1JA 2J5BA 3UXEA 5K8TA 2PL9A 3NEAA 1MDFA 2R79A 1G9SA 1R16A 1FNNA 2EHDA 2FZKA 4NCXA 1UBTS 2QL5A 1O0BA 3CEJA 1OXSC 4ADSG 3LYUA 4CQMD 1P7VA 1EZ4A 1RI1A 1OLSB 2OORA 3DFMA 4YVFA 5TXGA 5CT6A 1NBME 1FFSA 3DKPA 2WTAA 3L41A 5DISB 5FNVB 1JFRA 3UMRA 1RQNA 4PRZA 5K99A 3QYPA 2HMAA 4WZAE 1ZVMA 3HVJA 2XE7A 4L8GA 1CY8A 3NHKA 5EN4A 1G5RA 1YA8A 3MFQA 4YUWA 3QTBA 5IXSA 3BILA 4CDRA 1CERA 1MEJA 1RHJA 1T35A 1FXSA 1T9DA 3CVXA 5F35A 1R5OA 1A7UA 2AX4A 3O7WA 4F1JA 3PHIA 4I81A 2X5KO 1BWRA 2WABA 2ZVJA 3AFMA 5EKSA 1OAOA 1QAMA 5TRTA 5CNMA 4DR6B 3G2LA 2P6PA 4GP7A 2P9BA 4F2PA 4K6MA 5ISMA 1HRKA 3CXRA 2JANA 2Q27A 5IC5A 4D6PA 1Z62A 4JYMA 1U8AA 5AYVA 3HO1A 1TJ3A 3OCUA 3OURA 3ABOB 4F6RA 1XTRA 2ZYIA 4N5NA 5GZ6A 1PYDA 4G25A 5F9MA 4HG2A 2O9JA 2AFIA 5J2UB 2O2SA 1C0IA 3GXBA 4C7BA 1SCIA 1I7PA 1T13A 5C7OO 5L4SA 2REOA 3AF4A 3OOWA 1P75A 3ROQA 2IXGA 2ZRKA 4ZYWA 2PUGA 1ODCA 3DVRX 4IEFB 1JWBB 5LQAA 3GMTA 2XAUA 3L93A 1SEPA 1V3QE 4OXYA 5M04A 1C1DA 5JD6A 1IUOA 3THXA 1M5UA 3OEHA 1R8XA 2EP5A 2A9PA 5BR1A 2NO6A 2Y4OA 2O2EA 3W0LB 4WEOA 1V5EA 4YO7A 3VPFA 4CEHA 2FMUA 4MR7A 1SURA 3MWYW 4KI7A 3B5IA 2IZ7A 1PFVA 1BX1A 5LC1A 4W1RA 3SQXA 4NU5A 4NBVA 3O2SB 1E5LA 1ZKDA 2VP3A 3EZGA 3GJZA 1W5BA 3O8OB 4N01A 1LC3A 2DUNA 2V6JA 5IH7A 3KO8A 3IULA 4WUVA 2CUNA 2R4TA 4OYLA 5CM8B 1CJKC 3ZU2A 3WP1B 1P9RA 1SVSA 3PR1A 1UIRA 2F00A 5DTEA 3ZZTA 5I9LA 3GA5A 2V5VA 1NA5A 3MAJA 3CB4A 5FAKA 5IJAA 2JS7A 4YJ2F 4EKGA 1RJ9B 1SRQA 1ODTC 1URPA 4U63A 2NW6A 3T0FA 1LK5A 2ZRHA 2GZ2A 3PICA 3QX7A 4F60A 4DA4A 1W19A 3KYCB 1BKDR 2BR3A 2DH5A 4JI1B 3UMSA 1V6SA 4R1SA 1HYHA 1MB2A 1R3DA 2QQ0A 3TE6A 3JWJA 1D1PA 3WWZA 1Y9DA 3P0HA 4ZVNA 1FC0A 2ZIEA 5CVJA 1HL7A 4FCVA 4JI4B 2XDYA 5D8DA 3I9FA 5DTIA 3NWOA 5DNUA 4FI3C 2RH5A 4RZSA 4KH0A 2D2VA 2HT6A 2E4ZA 3USCS 1MG5A 2NWQA 2O59A 4PZUA 3Q7TA 5IF9A 3TOXA 4PNPA 2ASEA 4CGYA 3M83A 3MJHA 4A5SA 1Z39A 4BOYA 1Z63A 2WA2A 4Z2YA 3R9KA 1YKFA 3TBFA 2VWHA 3WK8A 1F8UA 1BE1A 3SXPA 3Q8KA 3EFOB 1JDUA 3NVMB 3SQOA 1TJYA 2B1IA 2CT8A 1KXZA 4ND6A 1A5BB 1L0BA 4GP9A 5TGDA 3LMKA 4QPPA 1R4MB 2IYSA 3ZDRA 1XX6A 1RPTA 4EECA 4O8ZA 1MTOA 2GJSA 4EB6A 1WXFA 1YULA 3ZDQA 2GLXA 3K0CC 5ERXA 2YHIA 2QWXA 4DARA 1LX7A 2D5AA 4IKOA 1N6IA 3ES9A 2XWSA 2D5BA 4LDPA 5EPOA 5K3SA 1Z16A 3BICA 1A9PA 4F3RA 4BKUA 3LPAA 1PDOA 2CVHA 4D45A 1VLLA 1X77A 1SBIA 3GT7A 1WDTA 5C53B 3NJRA 1KPIA 3IBGA 4DANA 2J9YB 4JC0A 4OM7A 1EFCA 3QOYA 3G8DA 1EXMA 1FLVA 1TCBA 1GYRA 3IUEA 3JVIA 2NVUA 3E1GA 4FFVA 4RZHA 5AWFC 1XF9A 3SMQA 4HNAB 1B8OA 5JROA 1T36A 1NVVQ 5EG5A 1KARA 5I9BA 3UHFA 3IPRA 4K0RA 3IUSA 4L9AA 1TO1E 3TQIA 4LJ5A 1U8XX 2GPWA 3P8ZA 1OI7A 4AN0A 1NI3A 3FI9A 3G85A 1QFXA 1R10A 2RB5A 1RYBA 4RK0A 3K30A 3NBYC 1U5BA 1Y1LA 4Q9JA 5BQOA 4F21A 2Q2VA 4ZO4A 1CC1S 1DQNA 1PVOA 4MRNA 2ZE8A 3OVMA 4U9IS 3C6BA 2EX4A 1TLFA 2EZUA 1CZRA 4B6OA 4OI1A 1M7BA 2FE4A 2EV9A 2JFUA 4LC9A 4JGGA 4OH1A 1Z82A 1GSOA 1E99A 4E6PA 1U63A 3OE1A 1RP1A 2BZGA 4JEMA 2ZBQA 3F4LA 2X41A 3CUVA 3R23A 4ZQBA 1GTG1 5K51A 1VG0B 1SUDA 3ONVA 2X0DA 2F8SA 2YUTA 1LVGA 3WIOA 3WC4A 1RWPA 2VYQA 3QG1A 5FNVF 4HSEA 3DTNA 1ORHA 5EE0A 4ZTBA 3OF3A 1CB0A 3OQOA 1EIWA 2A14A 3O84A 3QLUC 4OXRA 4N6NA 5CDYA 1Y9ZA 1FTWA 2XQVA 3GLHE 3VNQA 1BO6A 2BKEA 2PWPA 1UMKA 2DBRA 3S2FA 2PU7A 1C3VA 2ODQA 3SDBA 4ZMRA 2WHRA 5EKTA 2PO7A 3G2PA 2XB4A 4LG1A 4LXXA 4EPTA 1SXJE 3BIWA 1KIMA 5KX5A 1LZLA 5DIFA 4CLXA 1PR9A 1X1SA 1FQKA 3OF5A 1DSSG 4OLJA 3HCOA 4OUDA 2AD5A 5JLAA 2EBFX 1IOVA 1GZ3A 2WG0A 2YQ5A 3FFXA 4EAQA 1KP3A 4NR0A 2A0WA 2C8KA 2JK0A 4F1KA 1VPEA 3EWSA 3O8RA 3HSYA 3FB4A 3KG2A 2XYPA 4UTXA 3CZCA 3RSQA 2V6IA 3H9BA 2QU7A 1PNRA 4MHSA 2VJOA 3GJTA 4PAMA 3HCBA 5KQGA 5A0TA 1RFGE 3M6VA 2ZJ3A 3QA9A 4XGNA 4RSMA 4A6DA 5B3AA 3UMCA 3OU2A 2PVSA 2ZJ2A 5CYOA 1CZOA 2GTHA 3ZE9A 5C8ZA 1EHIA 1J39A 5IW8A 2D1YA 1LY1A 1ITZA 5KCMA 4DCMA 4E1AA 5ICMA 4Q1DA 3DYVA 2HZBA 1SCQA 2ZAIA 4LPSA 2C9ZA 1CFJA 4LE0A 3W78A 5KMGA 4EENA 5LXTA 3WGGA 4JOCA 3DBRA 1NTRA 2CYAA 2RI1A 3NUZA 5EHZA 2DOKA 2BKLA 1T4GA 2FPPA 2OUIA 3GFSA 2PX0A 4IJ6A 1R4MA 4UFOA 3NMUF 3KZMA 2F3UA 1GN9A 3N6VA 5A4KA 2WHEA 4YRZA 3PJEA 5T5QA 1J0BA 4DV7B 3EQ7A 5SYAA 1VLMA 2JH8A 1VJ0A 1S2MA 2PH7A 2XTAA 3L1UA 3LBNA 4RVOA 5F78A 3Q3HA 1AK1A 4DM7A 5KYKA 5GV8A 2DBQA 1TTHA 3M5CA 4KITB 1KMMA 5AICA 3TK1A 5DW3A 5T8KA 3WLMA 2CUZA 2HEIA 1QBGA 4BRWA 1XRSB 4D26A 1UP7A 4RX1A 2D0DA 1H6CA 1TKAA 3SEQA 2GZAA 5LYJB 2AA3A 3HKCB 1Q7TA 3EGWA 4DMRA 2RH4A 4NG5A 2B36A 3EXG2 5I51A 2Q1SA 2NU8A 2AXNA 3TXAA 2BFDB 1VHWA 5HPYB 4OTZA 3I04M 2XZTA 3WAKA 4H1UA 4XGKA 4EA6A 2XZOA 1TGVA 5B2ZA 3RAFC 1X7WA 2E55A 3RYHB 3WGNA 3L1HA 5E9WA 2PGJA 3QFRA 5KQMA 3AVTA 4IFIA 3LPCA 4KFRA 4G1UC 4MKGA 4I1IA 2XNSA 4KYVA 3QI7A 3KYBA 2E1RA 2VJMB 1J42A 1NC3A 3N2GB 2CSXA 1N5MA 3TB4A 2DERA 1ML4A 3TXYA 1QP7A 2GRUA 3LDAA 4AXXA 3T9FA 1TAHA 1WJGA 5B3LA 1L7PA 1RACA 3OHSX 3HL4A 2OG2A 1OZGA 4J6EA 3ZE0B 2BCGY 4NV0A 5BMVB 1U6IA 5C3MA 1YZNA 1XBTA 3HCEA 3P45A 1MP0A 2J9FB 2X14A 1J70A 3NT5A 4PFJA 3U7QB 4F92B 3RYCA 4JXZA 3A06A 3OM0A 3Q0EA 3JX9A 3BXXA 3I6MA 4IQGA 4PEVA 3ICPA 4LYEA 1F12A 2KYRA 5BR7A 4H15A 1QU3A 3DVAA 3PX2A 3KB2A 2WY2D 1I2AA 3WA6A 2FYTA 1YQGA 2YYSA 1K66A 3C7DB 4ZREA 1E1MA 4NAHA 4B6JA 1AGXA 2D06A 1VG9B 1YCGA 1XJQA 4GI7A 4XQ9A 4HXGA 4H77A 2R48A 1ZZEA 2J30A 4UXIA 1PEYA 1MVOA 3QHPA 1OWLA 2V6FA 4LNHA 1O4VA 1K63A 1GAXA 2D1FA 3DZ8A 1BXGB 3FVTA 2VA8A 1GTMA 1F0YA 3BIXA 3R3YA 3M4XA 2VTVA 1VHLA 3PTZA 4J1QA 4HB2A 5K4HA 3OKAA 3FUTA 1X7YA 3DC2A 4ZEOA 4K5QA 3AF6A 1N5DA 3PVCA 4MK4A 2YWEA 4FDVA 1BW9B 1YK1A 3CLRC 4E4TA 5BXQC 1TQ2A 3FAZA 2QQEA 4UU0A 2ZQZA 1HQCA 3QUSA 5C32A 4FYVA 4LJLA 4Q1BA 3QIVA 4BVLA 3WNCA 5E8RA 4U2EA 4BKPA 1MXFA 3RABA 3N2LA 2O05A 5I8ZA 1CHDA 1WZUA 3CRVA 2Z6QA 2NQ8A 1JHMA 3BGOS 2HNBA 1ZEJA 4BHTA 4YY3B 3NBXX 3WBKA 5AOAA 2H92A 1WXIA 1WZNA 1BVUA 2C5FA 3EULA 4L8LA 1OR8A 3PZBA 3HKBB 4I66A 2GBIA 4M0PA 4WBNB 5FNVA 1K6IA 1GZSA 3INRA 4CEIB 4G1EB 3LY7A 2ZI5A 3EIFA 5EIOA 1KS2A 3N0VA 3HB0A 16PKA 1KEPA 2G82A 2R97A 3R3XA 5F21A 3NUQA 4L3OA 1Y82A 2XQIA 3IDOA 4MICA 4FGWA 2J8ZA 3CLSC 3OUTA 1FK8A 5AJZA 4DS3A 1XVTA 3E27A 3L46A 2IEDA 5BSGA 2CEAA 1VXRA 4C76A 1AY0A 3AINA 4HB4A 2JFHA 4NAUA 2W7TA 4XVHA 1YRHA 2HLHA 3RSZA 1G7SA 2ZI9A 1IXZA 1FRVA 3CPEA 2E3JA 3GG2A 2E85A 1Y1TA 5JJCA 4C03A 4MI9A 3SOPA 3GEEA 1JJVA 3OPNA 4CLRB 3CKYA 3BMCA 4GKVA 3BZWA 5K3EA 1CQZA 1IZ8A 4Q7MB 4AICA 3GX1A 2Y1GA 1WXWA 4I6JA 4MROA 2ODPA 2HADA 1NQVA 3DH0A 3O03A 3TLZA 2A5YB 2D74A 3LYLA 1C4WA 4MS3B 2JI9A 4K6KA 2QBYB 1UOOA 2HSJA 4TT3D 3RYFA 3WSWA 1C7JA 3RTBA 3AFHA 3AEUB 1C3OB 4ZQIA 3K9WA 2J6HA 3V8RA 1E7WA 1YR9A 3R0IA 4AZ0A 3PC3A 4J0IA 1JXAA 3GEMA 4M1EA 3VR3D 3W7BA 4ZKEA 4V2IA 3N0TA 4G0QA 1E1KA 4PO3X 4V0SA 3NHPA 2Z1DA 4UMVA 3VYSB 1AA6A 1JKIA 5FJIA 3D6NB 3LW7A 3WLQA 2A3NA 3JWHA 3P9RA 4EX7A 4PV7A 1T9AA 3K32A 4Y1RA 3ROGA 1COZA 4EH1A 2WIFA 1WXDA 1RS0A 1DKLA 2JAQA 1B6RA 3P9YA 1PGNA 1P60A 2DFTA 1XDDA 3WDSA 4CBVA 2X0JA 3KOWA 1FDIA 2XB6A 4IIXA 4DV3B 3PWTA 3L0ZA 5ALEA 2ODEA 3JWIA 2FK7A 1NBOA 5G2OA 5C7YA 1K7CA 3ZYCA 1MOZA 3R5SA 4I50A 2G08A 2C7BA 1EFAA 3RIMA 2YFHA 3CUUA 4YDQA 1J7KA 3MCWA 4YRRA 4GX0A 3K31A 1VPWA 2VH1A 3IQGX 1PEDA 1Q1BA 3D4LA 2GFIA 3B8HA 1XQXA 2I54A 2YDXA 4YLGA 1KMHA 2JLQA 5NLLA 2Z1NA 4BO3A 5A9RA 1COWA 3ADPA 1HFJA 4H7JA 1UDRA 4LGYA 1T9KA 3R7SA 3IPLA 1JDPA 1PZFA 3AUFA 4NH0A 1P2SA 1GAWA 2F6RA 2HF8A 2RHGB 4LOKA 4PW0A 3V6MA 3CNEA 3V80A 4AJNA 5HOQA 5KYTA 4C4ZA 5BN4A 2XE6A 2JIPA 3L8EA 1K3TA 1UXKA 2ZYVX 4JWTA 3WWPA 2RKOA 2B0JA 5K20A 1V1MB 4OFXA 5E1BA 3PNLA 4KV7A 1N78A 1XZCA 1T3LA 4L6IA 4WI1A 2UAGA 1JAHA 1I7LA 3HG7A 4RK5A 1XI2A 1KDTA 3OOYA 4RY0A 3A9TA 4MCAA 2YJNA 3EPLA 1CUUA 1AG9A 3M3DA 1YRAA 4X95A 4JZYA 2H16A 1HDIA 4IVRA 3ABIA 3I9LA 3L18A 3QMWA 2JIBA 3R3UA 2VUHB 1OAAA 4J1TC 3EGOA 2QL6A 3P2JA 1UMBA 2L18A 1BKYA 2LIVA 3CH5A 1AF7A 1UPAA 3I9KA 2O06A 3FZNA 3LHFA 1DAPA 2I8AA 1EFRD 3ZXYA 4I0WB 4RVNA 3G2KA 4D42A 1MGOA 4ZOLA 5WRFA 1L4HA 4IVPA 4EW1A 2W6JA 2GUGA 2FG5A 1GHTA 1Z5GA 3REQB 1E32A 4L16A 4LTDA 4Z9AA 1DKNA 4D3ZA 3BFXA 1VE9A 3MINB 5FI1B 2I9PA 4F97A 4UHBA 2NPIA 3CLTD 2A8YA 2WU0A 2FR1A 3PE3A 4JK3A 5IJXA 2VNJA 4LJ8A 3VHRA 4JI2B 1ZD2P 4CMEC 2XBMA 4XJSA 5DBOA 3S2UA 3HN6A 3LUJA 2KBFA 1MO3A 4AF8A 2NZWA 2WILA 5JCJD 3CLHA 3QXHA 5FEMA 4B71A 4HAVA 2BI7A 2C9YA 2NPFA 1S3GA 2QVLA 5EZ6B 4HDRB 3W2IA 1WHTB 4IPTA 1QYDA 5C35A 1MVLA 3EYWA 1QFSA 1RBYA 2IITA 2VBGA 5C8DA 2VWGA 1RXVA 3KLPX 2EW8A 3WBFA 2O2YA 2QR5A 3JY6A 2X5OA 5EZ5A 1FLAA 5EOVA 3K05A 4GWGA 1ENOA 1JR3D 1P2GA 5JSQA 3A11A 5IPFA 3D6TB 4BO0A 4OUDB 5TMPA 1PVVA 1JEEA 2FZEA 1T6BY 1XC7A 2QMEA 3SF0A 2W2XA 4NBNA 3ZHYA 2ZRIA 4LQLA 4R98A 1T9ZA 1NI4B 4JP5A 1S8OA 2A1TS 2FEOA 1ZMBA 3LQ2A 4CM7A 5JYEA 2O54A 1CRZA 1H66A 4E30A 2H4HA 1KVUA 3IDSA 1G8AA 1CEQA 2HRCA 3BRQA 4B3XA 3KFLA 1CUVA 1E69A 1PJSA 2GN2A 4YAEA 2RK4A 4IV5A 3OKFA 2G9ZA 4QPCA 4RK6A 4KN8A 2WHYA 1XEAA 2PSJA 2JLBA 4EHDA 4PZPA 3CJTA 3DTVA 1TJPB 3QEMA 1GQSA 1L7XA 2FDXA 3F9IA 4QBTA 5KSPA 2C5BA 2RGGA 1O9BA 2QMYA 3AHCA 4W8OA 4PLYA 1P4JA 1YR2A 1KPGA 1KDZA 2WJHA 1BQEA 2FSGA 3DD5A 4ISCA 4JP1A 2YW9A 8ADHA 1A0OA 3TDKA 2FQWA 1EP9A 2HJGA 3UMGA 1NGSA 1GL7A 4XAQA 3UKDA 3B13B 4DCOA 2CNDA 2ID4A 3IVRA 2BEJA 2V7QD 2BHLA 2YVLA 2IHJA 1DIGA 3TNDA 4EHIA 3VPCA 2P5YA 2NO7A 3O93A 2P9CA 4DMKA 4UVEA 4G5SA 2W2NA 3N2NA 1DMSA 1PNTA 1Q22A 3OMLA 2XAAA 3WGHA 1COWD 4RHYA 4AJLA 4BB5A 4TTIA 3VHXB 3A4NA 3JZAA 1NW8A 4J49A 1X80A 1GNPA 2BMEA 3AO0B 3MGGA 1XLWA 2PS9A 1EINA 1GO2A 3OUUA 3AOEA 1U5AA 3OQNA 4AB1A 4QFBA 3VV3A 2ZE6A 1N3LA 5MGNA 3D6AA 1USIA 4H6PA 4LTNA 4QOIA 2OO5C 2RIPA 1SU8A 3PD1A 3OM1A 1HDXA 4IIJA 1I10A 1NUAA 2V7UA 4U5XA 2ONJA 4DLPA 5B4VA 3HDTA 4DLVA 3WZMA 5BT8A 1SVIA 4XQ0A 1I4EB 4XX0A 1IEVA 1NW7A 4GBED 3K8QA 3W6ZA 1KDYA 2GO1A 4ALKA 3CSDA 3JQEA 2EC5A 1TEHA 4X44A 5AVYA 3CBGA 3H5NA 2GM9A 3IVXA 3TSZA 3PQDA 2E49A 2AE1A 3WK4A 3DF9A 1FTNA 3OLCX 4P4GA 4PQFA 2QL7A 5EJFA 3PLAE 4YRTA 3EX7C