1NM5C

R. rubrum transhydrogenase (di.q132n)2(diii)1 asymmetric complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
174
Chain Sequence
SVKAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P) transhydrogenase subunit alpha part 1
publication title Glutamine 132 in the NAD(H)-binding component of proton-translocating transhydrogenase tethers the nucleotides before hydride transfer.
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Oxidoreductase
total genus 49
structure length 174
sequence length 174
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2003-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1nm5C00
4Q9DA 3EY9A 4GP9A 4TWIA 4X3PA 3U31A 2JI9A 5K6TA 2H2IA 4L2IA 1OVMA 4BV2A 1PTJC 2FRDC 3FSJX 4QPZA 2EZTA 2FN3A 3CLTD 3CLSD 1BFDA 2JLAA 4K9NA 4JUFA 5EJMA 4C78A 1PVDA 3FZNA 2AG0A 1M2JA 2BRUC 2VK1A 2NYRA 2JI8A 5K6RA 3GLTA 3EA4A 4FEGA 4JT9A 4FZ3A 1V5FA 2FWNA 4JU8A 1PNQA 1Z8NA 2VBFA 1S5PA 4J1TC 4BVHA 2A1UA 1N0HA 4Y6OA 2H4JA 4GM1A 3ZGOA 3CLUD 5BWOA 4GM4A 3JR3A 2QQFA 4BV3A 1J8FA 3RIGA 2H59A 1XLTC 1JSCA 4GPEA 2IHVA 2Q28A 3F6EX 2B4YA 1OZFA 1O96B 5K2OA 1V5GA 3RIYA 2FSVC 3F6BX 1EFPA 4K9KA 2NXWA 4K9QA 3OE1A 3D4BA 4JUAA 1DJLA 2VK8A 1YC5A 2OO5C 4BVEA 3JWPA 4RMJA 1HZZC 4MPPA 2JI6A 2V3WA 1PI3A 4J16C 1EFVA 4O8ZA 4MPJA 3HWWA 5BWLA 1OZHA 1YHZA 2JIBA 2AG1A 2EZ8A 3GLSA 4UUAA 2EZ9A 4RMIA 1Y9DA 1M2GA 1M2KA 5IMSA 1O97D 4BUZA 2C31A 4JUBA 4RMHA 4L3OA 3EYAA 4QELA 4BVFA 1POXA 1YI1A 5EJ9A 2PGOA 3E9YA 4D5GA 1SZDA 5EJ4A 1YC2A 4UU7A 1U2DC 1UPCA 5AHKA 3ZGVA 2EZUA 4FEEA 3D7KA 3PKJA 2OORC 2Q5JA 2UZ1A 1Q1AA 2A1TR 2FR8C 5DGTA 4BVGA 5EJ8A 4X3OA 3D81A 4Y6QA 4HDAA 1U31A 2IHTA 4UTVA 4FVTA 4GG1A 4UTZA 1M2HA 3IAFA 1T9CA 5MFPA 1PYDA 3PKIA 4IAOA 1T9BA 3GLUA 4UTNA 4UTRA 2UZ1B 3IAEA 4F56A 1V5EA 1YNOA 1D4OA 2H4HA 1Q14A 1NM5C 2H2FA 2H2GA 2JI7A 2PANA 5MF6A 4RJIA 1PO7A 5DGDA 5MGNA 4JUDX 5FYQA 2QQGA 1YHYA 4Y6LA 1Q17A 5EJ7A 4BN5A 1UPBA 2DJIA 4F4UA 1POWA 4K9OA 4RJKA 1ZPDA 1M2NA 4RMGA 2OD2A 2JLCA 1YBHA 3LQ1A 2Q5OA 4IG9A 1T9DA 5BWNA 3GLRA 3K35A 3CLRD 1QPBA 4RJJA 4JSRA 2EZ4A 1UPAA 3U3DA 4KGDA 4V1CA 2IHUA 4G1CA 2Q27A 1S7GA 4ZZIA 1ICIA 2W93A 4TWJA 4K9LA 4MQ5A 1MCZA 4C7BA 4COKA 3HWX1 4MZXA 2VK4A 2H2HA 4JD5A 1SZCA 4KPUA 2WVGA 2Q5LA 5EJ5A 1T9AA 4V1CB 5MFZA 3ZG6A 4ZP1A 4D5EA 5FEMA 2WVHA 4K9MA 4V1CI 4BN4A 5EJ6A 2X7JA 5K3SA 4BVBA 1YI0A 2Q5QA 4R8MA 2HJHA 1PT9A 1YTLA 4GM0A 4HD8A 4I5IA 1Q6ZA 4MPRA 4K9PA 3CF4G 3FLMA 3PDHA 1OZGA 2Q29A 2H2DA 2H4FA 4UTXA 2OD9A 4JT8A 4KXQA 4UUBA 4QQ8A 5DEIA 5D7NA 4UU8A 1E3TA 1PNOA 5EJAA 2VBGA 2VBIA 1U28C 2VJYA 4IF6A 4JU9A 1U2GC 2WVAA 2PGNA 2OD7A 1MA3A 4JUCA
chains in the Genus database with same CATH superfamily
3QEJA 3ACCA 4E88A 4RX1A 4MV3A 4GE3A 3RHTA 1FRVA 3L92A 4IHJB 2V4UA 7ADHA 3CFYA 5DT2A 2PAAA 2DHRA 3H5AA 4I9NA 4CF5A 4S05A 4BZXA 5ICGA 2OILA 3F1KA 3ZWQA 5TC4A 2BLNA 2RH5A 2K87A 3AR3A 4HHEA 5AI5A 2QL6A 1ZR4A 3KJQA 1WZ2A 4CVNA 1N9GB 2EZTA 5CT4A 2YIJA 2RH4A 5TMBA 5AJHA 4Z9YA 4FI3F 2IY8A 4X71A 4GLLA 3GOQA 2EGUA 1JDBB 1UC8A 3MHPA 4FP9A 3T7DA 5F2NA 4LJKA 2X7XA 4YRGA 2BCGY 1DDOA 2O54A 5BN5B 1VKOA 3EG5A 4DYVA 2JDID 2QD3A 4B87A 3U9LA 1Y1QA 3CWZA 1HR0B 1TPYA 4IWXA 1TZMA 4RNDB 4AZ0A 1N34B 2DT5A 1JPUA 1NW9B 3BE5A 2F59A 3BH0A 3EXIA 2YJ6A 3M5DA 4CTJA 3MWGA 3S8EA 2OAP1 5E9AA 2XHEA 4CR7A 1TYZA 2QMUA 4IXDA 1PEDA 3FUWA 1IZYA 1ENZA 1V5FA 2H7XA 4FZ3A 1JJAA 4JBGA 2WAAA 3HCCA 3E03A 1O96A 1G20B 3A0RB 5KQRA 5CCEA 2FPIA 4RZQA 4GICA 1GQFA 3WJ2A 4B6GA 3GBPA 4MW1A 1SHKA 3CB4A 2VBFA 3A1EA 3EXG2 4A5SA 1B74A 2YXDA 4B7ZA 3ZU6A 1DG1G 3ICEA 4HYTA 3L84A 2C1ZA 3RVQA 3RSZA 4ZGWA 2AW5A 1I3CA 1SJ9A 5A06A 4Q3CA 3FJ1A 4KPGA 3NUGA 4ZU6X 4G24A 5J9FA 1GA1A 1DLIA 1LJLA 3ENZA 3QWHA 3LOQA 4LDQA 4V0ME 4DIOA 1AE1A 5K6AC 3M7IA 3ORFA 4I1PA 3JR3A 5AK0A 1X8LA 2ZOSA 4HTFA 3ESAA 1SCKA 1UDCA 5BOSA 3PTZA 3NCHA 5DBHX 3ZW9A 4CM9A 4ZYLA 5GVRA 4GP7A 1R9MA 2X42A 2ZUVA 1FNCA 2CD9A 1ABBA 4AKSA 4EJFA 1SKYB 4EGFA 2WMDA 5IVDA 2JFXA 1SMKA 4P9NA 1CF2O 3TF5A 2QKYA 4QLAA 4QPPA 3UPTA 1G64A 4LF9B 1YE8A 2FKAA 5BVHA 3UK2A 2DHQA 1TADA 2Z3WA 1R10A 4Q3BA 5T8KC 3EIHA 3UWMA 3DVLA 2GZDA 1N5KA 1VECA 4OHUA 2R6R1 5AI8A 4BGVA 3DL2A 1SBZA 1YZVA 4Q4LA 4BMVA 1II0A 1QS0A 4O2AF 2ON6A 4DIKA 3HBAA 3U16A 2IHYA 2AMVA 4L9WA 1QX4A 1EDZA 2IU6A 3HVIA 1O6BA 1B8UA 3VR4H 2DPXA 1E7MA 4W5WA 5IP5A 4QXRA 5J2UB 2EIXA 3E9CA 3VSEA 2B36A 2PZAA 2H7YA 1FFSA 5DM1A 4LK3A 3GY0A 5SZIA 1TJYA 2V59A 2PKEA 3ZK8A 1G1AA 5F5NA 5ISMA 3Q8WA 3DVRX 3GJ3A 4UC0A 3FWYA 2ZJ3A 2M2IA 3GP8A 1TYEB 1JBEA 3JWPA 4CCSA 1AKEA 4RMJA 1SCUA 3IQHX 1RJ9B 1XHEA 4AJ4A 2WZBA 3LF2A 1CIPA 2BFBA 5CX1A 2DERA 2ZT8A 1VJRA 2AE1A 4R3NA 5SY4A 1EJ0A 5H68A 1DX6A 1RHMA 1U4NA 2CDAA 2VSYA 4I4TB 5T67A 4OHBA 3UW1A 1NXVA 3WIEA 4R1MA 1PL0A 2QLNA 1C7EA 5EN4A 3RRFA 2FMUA 5EIHA 2XZOA 3JQ8B 1GNRA 3E5NA 1ILEA 3DA8A 4P58A 5E4FA 5JHHB 3IP9A 1AGRA 4KO4S 4R9UC 2IH5A 4BKMA 2JA1A 1FVXA 1CY2A 1C3OB 3VPFA 3C3AA 1VP9A 1BYIA 1CJKC 1R9NA 1ZITA 2QD2A 3MJEA 4KVGA 2I9PA 3Q3VA 5DASA 2ZITA 2IV7A 2J9ZB 5KTRA 1MB9A 1G3RA 5L6MB 3IE1A 4X0EA 1NYQA 3RVJA 2J9GA 1XFAA 1E5XA 4B3DA 1TZBA 2CL7X 3K9CA 4H0NA 2INGX 2J5XA 5CNIA 4Y9UA 3KPYA 4D4JA 5EWLB 1I2CA 1GTL1 4ENUA 1WHTB 3EZNA 3DKRA 2V6FA 4II3A 1K6MA 5FLKA 1J8DA 2QTLA 4CIAA 2XEDA 1J23A 1CJBA 4OY3A 3SXUA 2AYXA 4IJUA 3OZDA 5AI4A 1EIWA 2C8VA 3RWMB 2ZYVX 2FLVA 1M2VB 4B3TB 1OWNA 3EZXA 4U7WA 4A82A 3VU3A 3K20A 3LX8A 2AZ4A 4BMPB 2OV3A 5FOVA 4DR1B 3GGJA 4S1NA 1OX5A 1J07A 2NQ2C 2BEKA 4G37A 4DA8A 3S1AA 3A8TA 4V03A 4JMLA 4MVJM 1M1ZA 4HXFB 2ZYHA 3N2KA 3JYLA 3ZE1B 1POXA 4HDKB 1YJ5A 3OI7A 3PFCA 3ZWBA 1K5PA 2VP5A 4H59A 4LSMA 5FI3A 2IE8A 3DG9A 3DNMA 1USUA 5YASA 4D5GA 2XNJA 4KU4A 3DMNA 3VZBA 3FLAA 3LY8A 3M3HA 4P4SA 2YHUA 1NV9A 3V7YA 2ZUWA 1UJ2A 2RHJA 3OZ7A 4KLAA 3VKHA 2ZTVA 3H5RA 3MJ4A 3FX2A 1G2IA 1UPCA 2IOQA 2OZPA 3HU2A 3RAPR 2DB3A 1Z6AA 3ABRB 1P4HA 3L1KA 5LWQA 2OGTA 4M87A 1NQUA 2JD2A 3AUUA 3LP6A 1S9HA 2QY6A 1FJXA 5DHAA 5LJLA 1T3ZA 1DBPA 4Y2QA 1Q1AA 4LRSB 4EHNA 2PMBA 5BSGA 1R7RA 2BC9A 3CUUA 3P52A 4PGFA 2ENUA 3IMCA 3R3WA 4MQEA 4ND4A 3JVUA 1VKRA 1XELA 2PX4A 3JQFC 2R62A 5CVUA 2AEJA 3CZQA 2P1ZA 4MR7B 4BRSA 3IIKA 4DA7A 3H1BA 2QYOA 2X8JA 3P2YA 3QVSA 2VP3A 5AVVA 1LK0A 1VE6A 1XDBA 1C30A 3I2GA 3TRFA 1Q0PA 5L4NA 3BTOA 1BOFA 1EUDB 4W99A 3AQIA 2C92A 4WXHA 5KAPA 4RTJA 1KAEA 1OA0A 1RXEA 2CVHA 3BE6A 1KZ4A 4L5YA 4PIVA 3QKTA 4UUOA 4RSHA 4MWDA 2DFPA 1T9CA 5AK4A 1COZA 4AI6A 4MO9A 2EJVA 1G3QA 3PCXA 3QXXA 5K0LA 2W0SA 4PZ9A 1UZMA 3GCWA 3O8QB 4JFRA 1L8QA 4XTRA 3DAOA 4XUCA 5LMUB 1EEHA 2I99A 1XN4A 1MENA 1BA3A 4KTTE 4UCXA 5IJ0A 4OXXA 1CT9A 1XP8A 2QR5A 3GDOA 2CD7A 1F2UA 1B3RA 1MW9X 2FWPA 3R6TA 4FT4A 5G4KB 2OHIA 4QJ5A 1RLUA 4F4CA 2JK0A 1NONA 1ISRA 1M1YE 4GGMX 1K27A 1BN6A 5CVCA 1IN7A 4DLYA 1A77A 1F0PA 1VPLA 1YB2A 4MLDA 2VHXA 4W6ZA 1KMMA 5F12A 4DCGA 4WEOA 4WCDA 4BMXA 6NULA 1OGJA 1Z2NX 5C4GB 1JEQB 3I72A 4IJQA 1RXWA 1QIDA 2AFHE 5GZ1A 4TROA 3KJEA 4Q37A 3NHZA 2YN2A 4GE0A 3PXBA 4O08A 4Q3AA 5E8RA 1WPRA 1GY8A 4J0QA 4UTOA 4AJIA 2I4RA 3FTEA 2JI7A 3P4XA 1L4HA 1QMPA 4C88A 4B33A 5B55A 4JJIA 5CJPA 4HGPA 1GTVA 1W0JD 2PANA 4MEJA 4ZPXA 5DX0A 2B8TA 1YVEI 2NM0A 2ZW9A 5HTKA 1IBMB 3F67A 4NCKA 1ORIA 2ZJ7A 4PZ0A 2JAXA 2OHOA 3A6HA 3L8MA 1KDVA 1F4PA 5G41A 2W11A 4RGQA 2IV3A 4UOEA 4QEZA 2C7RA 4ENRA 2Q62A 1DAGA 2IKQA 3NVAA 3PVCA 4PYMA 4JOSA 3SR0A 1TM1E 1OTYA 3IEKA 5KOJB 3Q7IA 1WCV1 3NDBB 2IIVA 3MTDA 4NZPA 2C2ZA 3I0NA 4BBJA 4OSPA 5CCBA 1W96A 2QT1A 4U4AA 4DDHA 2FZCA 5C32A 2H1VA 3OM9A 1STOA 2BFMA 3OZXA 1MNQA 2CMHA 4V0KA 3ETEA 1NR1A 4R9SA 4UHHA 3VVLA 4ALJA 3I3OA 2WWXA 3N6RA 4EKYA 1TU4A 2AC2A 4GZ3A 3EHDA 4AULA 1UQRA 3ZVRA 4L28A 5TF0A 1XEXA 1JVNA 2GTIA 5ALJA 1CFJA 5EKTA 2WJAA 2XXJA 2ZQYA 2ZSFA 5TPZD 2XGJA 2A5JA 4HX5A 3H13A 3NH9A 2HC9A 2I6GA 1GUAA 3IKMB 4JJKA 2QVLA 4B81A 4EPXA 1XNRB 3V32A 2FX2A 3PC8C 1N2CA 3L6DA 1VMAA 3PQ8A 4IDCA 5ES4B 3FBWA 5L3QB 4TXNA 5IVKA 4L9RA 3JYPA 3ZGYA 5B7PA 3O4HA 3OKPA 5COQA 5DGHA 5KHAA 4C3VA 2ZQ5A 2P4QA 3MTJA 1G9XA 1RU3A 1SU4A 2A1TS 1NLZA 4URUR 1OGIA 3FGOA 4LYEA 4H6VA 5K0TA 3EPKA 4HSEA 2YFKA 3UJDA 2GM5A 1P5JA 1VGVA 4LI3X 2K2QB 3BHMA 4FIZA 1HYHA 2QVZX 1MTOA 4UPDA 4JSRA 5C35A 3EPJA 5KKNB 4QARA 5B1IA 3U3DA 3EXFB 3KQUA 3PQCA 4ARVA 4UM9D 4UEWA 2QXYA 1GQQA 4RAOA 1IY9A 3M2PA 2BELA 2XCQA 1YS6A 3M33A 4NZNA 4WESB 3UAWA 3UH1A 3I1FA 3LWDA 1S89A 5IC5A 4TRJA 3WHPA 1JWAB 4N5IX 3K09C 2Z83A 1D0SA 1MIOA 2ZAIA 3IOEA 5FLXA 2D2FA 1DIGA 3FETA 3BRWD 5HUQA 4RH1A 4GNKA 4NDAA 2JZNA 1JXQA 1KWKA 3CIFA 4YJGB 1AXEA 1XVTA 3ZD8A 3HXMA 4YJ2A 2O2EA 3C3WA 4G56A 4GF5A 4JQSA 1HYBA 4LHZA 5LM3A 2ZR7A 4LRTB 3VTZA 2Q3FA 4TZTA 2OCBA 5DYGA 1V43A 3IO3A 4QA9A 4UHDA 3UUWA 2YYAA 3W6PA 2DPLA 2PKXA 4EA8A 4XWKA 2D13A 4QOJA 3V8VA 4BC1A 2H1FA 1EDOA 5A5EA 5K3OA 4H7FA 5JPIA 5LIPA 4JIMA 4DUPA 1R74A 4F45A 1CQJB 1T6NA 1PN3A 4L0CA 1GPDG 3PNVA 2ATEA 3JALA 3UW3A 2NZWA 2WJIA 1HZJA 3KYDB 1WDWB 3AK4A 4GMFA 4Q7KA 3UWSA 3GZNA 4BNJA 4YV7A 2I7TA 2VF2A 4RKYA 4F2GA 2WM3A 4LBZA 1XRNA 4YXWD 1UBHS 5HCNA 1RFGE 2OUIA 4Z2YA 4JFAA 4DV4B 3HABA 4GOLD 4K0RA 2IYEA 2Z30A 2G9QA 4E5PA 1ZUWA 3QVOA 2J3MA 4D46A 4XEUA 3I58A 4O4LA 3RM3A 4F9GA 5JAZA 2XXBA 1TK3A 4CQLA 4OCZA 3O92A 9ATCA 1NNI1 2C7GA 5BNWA 1E9BA 1WZNA 3D6JA 3QKRA 5ALMA 5HF8A 1R9JA 5KOHA 5M29A 3ZLBA 2FE1A 2Y77A 1E5DA 1ZL2A 2BJVA 3EIQA 3LA8A 2DFVA 1SBIA 3LZDA 4KX3A 3E22B 3RCBA 3EPLA 3SYMA 1NJSA 2D5AA 4HH1A 3CE9A 1AQJA 4HZUA 4BVBA 3D7MA 4A8JB 2VDRB 3G0OA 3I2HA 1Y7LA 5H80A 5HS4A 1K7SN 3LYHA 3KXKA 2TMDA 2EHDA 1JJIA 2ANBA 2WYUA 1CSEE 2VLBA 2ZS8A 3SMVA 1QHFA 1XNGA 1YZNA 4MP8A 4OQYA 1Q83A 5DHUA 2RGBA 3SQDA 4NR0A 4EG5A 5I8ZA 2APJA 2IGTA 2NZYA 5EVCA 4BKRA 3CF4G 5TS3A 5CA1F 1PIWA 1JFVA 4UU1A 4BO1A 1ML3A 5EUBA 1U81A 1Y6QA 3TOXA 5LKAA 3TZ6A 1MQAA 4PLTA 1W2WB 3MA0A 4WZBB 4XRRA 3HLTA 5ALKA 2C2WA 1GV1A 5KQPA 2XMSA 1GAWA 1H6DA 2G5PA 1DAEA 2HU5A 2ZJ6A 1WQ1R 2V6IA 2G8LA 4F71A 2C7OA 1MF7A 1CUDA 2A58A 2WSMA 1KXJA 2Q7DA 4E51A 3I9JA 3THOA 4RVNA 2JLSA 5FUWA 3UAOA 1JQBA 1F17A 1OGYA 2WA2A 3FSEA 2UAGA 1NVXQ 1E59A 2W43A 4PX9A 5HCUA 1Q1GA 2A30A 1SXQA 3A2KA 3AUYA 1MVNA 4YJFA 3IP8A 4MNTA 1L2TA 1XEAA 2OSVA 4PG4A 3NXKA 2TYSB 2C61A 3PC6A 4LFCB 3UJ3X 4JVSB 5KVAA 4EW2A 1JHRA 4K9RA 5EJAA 4CM8A 2UZAA 1J2UA 3CB2A 4A2CA 2VBIA 2QRKA 3IKJA 2W2NA 4LC1A 1U3CA 4O5OA 3O21A 3RS5A 4EY6A 5LA6F 5TPZA 1QTNA 1DVRA 1A76A 3HO6A 1MBZA 1ST3A 4CF6A 1UBRS 2DWCA 4TLMB 4N0DA 1M6VB 3IBGA 4GI5A 5C9ZA 3O8RA 4CCAA 1QO0D 1V8ZA 4B3MB 3WYFA 5FPPA 2QJRA 1SVOA 4F9EA 3A6EA 4ARZA 1TNDA 1PQYA 2AX4A 1HGXA 3D1JA 1H0SA 2GYVA 1MT3A 5B4VA 1RAEA 1E3LA 4NWIA 3T99A 3IAXA 4IUCS 4MHSA 3ZNNA 3TPZA 1ULHA 3K31A 3L6RA 3TSYA 3PNOA 1CJMA 2RHOA 3MAAC 2X0EA 3RVMA 3TQTA 1OASA 3I5MA 1KJNA 4ZEXA 1BKYA 4H7IA 3QEOA 2WI8A 3NRJA 1JR3A 3T1YB 2RD2A 5MHTA 3NC4A 4UDYX 2HIHA 2RHMA 1M1NA 1VB3A 3A2LA 5A4IS 2W6QA 4UHFA 4QFCA 4IJVA 5LFAA 2WWVD 3OZRA 4JSYA 2ZTLA 3PEWA 5B5SA 4B8ZA 3DF7A 1HLPA 2UYYA 4CW7A 4Z0TA 1CQIA 5A0TA 5DCUA 2KLHA 4JBIA 3TFQA 3G0DA 5PGMA 4AJ1A 1SCJA 2Q1SA 2QXUA 2V7QA 3QVGB 1LS6A 4GR5A 2AJTA 4YRCA 4X6UA 3M6VA 3SU8A 2ZBPA 3NQ41 3U4MA 3GYBA 2PJUA 3I3SR 1LWNA 3WLSA 1QCYA 3F7NA 4A5OA 5HJ5A 1X1SA 3LCMA 2G08A 3QLJA 1HURA 4I5DA 3TNLA 2R8RA 1KHTA 1LI7A 3PR1A 4FHCA 4MWSA 5ED0A 3BYZA 3LWZA 1C1XB 1BQEA 2QA5A 5T3YA 2JLYA 5CB8A 3GLTA 1R6DA 2YWXA 4FI3C 4HQFA 4NRDA 3PTAA 4GKJB 1TO1E 1ORHA 1WABA 1Y5RA 1YCDA 1Q0HA 1Z4PX 2QZ9A 4AWAA 3BL8A 1ZH6A 3A6LA 3FVVA 1NM5A 5JNRA 2ZUDA 3ANLA 4LEIA 3MLAA 4YXWA 3SK0A 4E03A 2HA7A 2OGUA 2O9JA 4BNTA 1DC3A 3ER9A 1A95A 5KNCA 1RWBA 3DZGA 4Y6OA 3ZWXA 1G21B 3S8YA 3EODA 3JARA 4AC9A 2FEXA 2FEWB 5C8ZA 2OZVA 4FCCA 4EYGA 1DWQA 5FR1A 5BWOA 2VDJA 4URZR 4QGGA 1X13A 3AEQA 2GD0A 2JANA 2ZRNA 3OT4A 4JXKA 3W3AD 3H3FA 4G8DA 2J3JA 1YRAA 2ZRBA 1SC4A 4R2IA 1MDFA 1ZGAA 1Z6PA 2JGFA 2P6PA 4RHCA 2GBLC 2AI3A 5F9MA 4WL0A 1H2WA 1SG0A 2VEOA 1GAEO 2C3MA 3T9EA 2G04A 2MT9A 3FNRA 3HB7A 1OH8A 4DPMA 3K9WA 2F8LA 3OIDA 5CNMA 2CMFA 2IITA 5EWJA 5A04A 2DUJA 3ZUGA 3OD5A 1ZGCA 3AI1A 1XZEA 5D5QA 2IEGA 4AXXA 2B4YA 2HQOA 1V5IA 1ICEA 4HWTA 4FLMA 5BOVA 2ZWMA 2JFQA 5K2OA 3K15A 3RFTA 4HB4A 3PZBA 3ROQA 4R1SA 3FCOA 3V2IA 1RYDA 1M0WA 2FDRA 2IYXA 4JY7A 4X1YA 1KI1A 2NXWA 5G3YA 5E4TA 1IXSB 3T4XA 4LOHA 1R0CA 1F4LA 2BDEA 1N7HA 3KD2A 2P9CA 3VR6D 2YY7A 2O05A 4AXBA 2HU2A 3TNYA 1BGVA 2QK4A 2KLBA 4X00A 5IULC 5KOIA 1SKYE 2JAUA 2KM1A 2OV8A 5E1DA 1K9VF 2VP9A 1D4AA 1GUBA 1KXZA 3HH8A 3D4LA 4BPBA 1EX1A 2HZ7A 2R97A 3HB0A 4ML3A 1LLCA 3C3YA 1MVLA 1NW3A 2R5FA 1Z15A 4TUYF 1QYRA 3LUJA 4YMSA 3QU2A 1I4OA 3FNHA 4M9ZA 1E2BA 3BERA 1N7JA 3QOWA 3NPMA 1JDPA 5AIBA 2BT4A 1T2UA 1IN4A 4J16C 4BVLA 2PQ6A 1T5TA 3SGLA 2YX1A 1OROA 3R0VA 1C41A 4BY9E 1T15A 1U9IC 1WVMA 5C46F 2BEVB 2RHLA 1RWPA 3PT5A 5ER6A 4ZVRA 3FGZA 3FVQA 3O6VA 2XEXA 3B48A 3HFSA 2VTEA 2XKJE 4NCHA 3W5VA 4C87A 3LUPA 2V7EA 4FYKA 4OXIA 1C9EA 2NNLD 3DAFA 1YDGA 1XCPA 4QM6A 3ST7A 1ORDA 1QO0A 4KC0A 5DTMA 3KU4A 4ZCPA 4ZDJA 1ZKDA 3S44A 3PVZA 4HP8A 2C00A 2VPWA 3U44B 1G291 3Q4GA 3K9GA 3O94A 2B7LA 1C9DB 2CHQA 1ZL0A 3FB4A 2BOVA 2QMOA 3PKZA 4BX0A 3EXEA 3TJZA 1HDXA 3QEAZ 1UFRA 1VSQA 1O1YA 4RMIA 4NFYA 3CCFA 3S5JA 2CHGA 1CX9B 2VDWB 1RC0A 2XJ9A 3VDXA 2PX5A 2WF7A 1X7ZA 2ZIWB 4EB8A 2B6HA 2JEOA 4KQWA 4MSUA 1I5EA 3ENQA 2PH5A 5CP8A 3GVIA 4IHJF 3Q7EA 4D8YA 5KJ6A 4DZRA 5JS1A 2VYQA 4QG3A 2R9VA 4GEKA 4OFWA 4QDUA 1CVIA 2ONYA 1O97D 3HN7A 3OKFA 1CRPA 4K9DA 2VYCA 4UEOA 3KM0A 4I3HA 5H81A 4TV8B 4UNSA 5FDFA 2EJWA 3ZWNA 2UU9B 1UR5A 5I4KA 3P2OA 1RHKA 2AN3A 1DADA 3JZFA 3PLNA 2GEUA 1N1MA 1W4AA 2D00A 2HOQA 4JVNA 4XWAA 4YUXA 4OVKA 3V2UA 4EQ6B 2YUTA 1W5SA 2B8NA 2MU1A 1VIYA 5KNDH 5J2TB 5AR1A 2AK2A 4OK5A 5HIAA 2VBCA 2R8EA 2Q5IA 4C0HA 1IEVA 1CE8A 1D5WA 1M1UA 2FCRA 3QVXA 5EJ4A 4Q4HA 5D2CA 1IBKB 5FAKA 5FUVA 2ID8A 2XUFA 1MOQA 3IQFA 2WM8A 1G8KA 2C82A 2FETA 2ZBEA 3U13A 3F6SA 1Q1ZA 4I7EA 4J2OA 2PKCA 4DNXA 4EHHA 1ZN2A 1CC1S 1MXFA 1PK9A 3KXDA 2GA8A 5LU8A 5ALTA 5CCXA 3ZXXA 4KQIA 2OXEA 2LKDA 1NI4B 1XVUA 5TQ2B 1ZHFA 4F11A 1F8GA 2BH2A 2WKSA 2ODBA 3TVDA 2GLUA 5LIRA 2C9MA 2E4YA 4J75A 3T3NA 3MUNA 5GOTA 4Z4GA 2BJWA 3DHVA 4XLLA 3K5PA 5IU6A 2BM9A 1QDUA 2VZ8A 1A9OA 4JJFA 3TBKA 3IDQA 3BM5A 4MVWA 4UTZA 3THRA 2ZT6A 4DV7B 3G2HA 3JX9A 5TGDA 3O31A 3OTWA 1M2HA 1IJEA 2OEPA 4KBFA 2MCFA 2B5OA 2R6ZA 4RETA 5THQA 3BDAA 3ZXIA 1TT5A 2GK6A 1GDHA 3ABSB 3RH0A 1V11A 3NV9A 4YMGA 2AR0A 2QLJA 3BN3A 3FWPA 1JIUA 2J3IA 5KI6A 3G0IA 2RONA 3OEHA 3FDIA 1VJ0A 4L6CA 5KWEA 1IATA 3Q9NA 1RCTE 5KPDA 1JW9B 4IXNA 3R7FA 1Q0QA 3GAFA 2FI1A 2AJLI 3PUZA 2GBGA 4MI1A 4WLEA 4LOIA 2PRYA 5B1HA 1FFXA 1UEIA 4AX8A 4BKOA 1G4UR 1MOZA 1ZDMA 3H1AA 3PPWA 4XIFA 2A78A 3IKLA 3T5DA 2DLDA 4ZCQA 4MUHA 4U7GA 1G8AA 4W5QA 4MS4A 1LDEA 3ROFA 2B82A 3T0FA 3WJAA 5AUOB 3D0KA 3VR6A 3VR3A 1ZIYA 3R0ZA 4NJEB 2VJMA 1CUZA 5J2UF 2OCGA 2RK6A 2HJ9A 3L0ZA 3LGSA 1MB4A 1FRZA 2WJZB 4J7AA 4O02B 1OAOA 1PFKA 4PQYA 1ANKA 2XCSB 3T9DA 1J22A 1H0KA 1LPSA 1FF9A 1HO3A 3GQBB 5IARA 5TX7A 1AXRA 2O8NA 3U7EB 3HVKA 2PKRA 4EJSC 3GRFA 3VUFA 1GQYA 1YXMA 3GMTA 5T6BA 5KYKA 5GZ3A 5HIKA 3EG9B 2XT0A 1HV8A 3DMTC 3PUIA 5E0OA 3TXXA 2H2GA 3ZCSA 3KKKA 3NTVA 5HA5A 1IU9A 1NP3A 3Q3CA 2Q2WA 5DTQA 2HUNA 1MRZA 1YJQA 3FRIA 4WOKA 3UQZA 2BR3A 3FNIA 1EA7A 3R0IA 2NTYC 4GNRA 2WOJA 4I4TF 3REFA 4IV5A 4O4HB 3GUYA 4JC8A 3ZNPA 5K0EA 2Z5FA 3BEOA 2BCJQ 2ZTSA 3PFBA 4M1TA 4OK3A 1EXDA 4MW7A 2W4MA 3RT9A 1CEYA 3SKVA 3AVTA 1DKOA 1GL7A 2WTAA 4GIBA 3S99A 4DRXB 2NU7B 2FOLA 3FAZA 3AR9A 3D4OA 3FOWA 1J0CA 4MCHA 3STVA 5MN4A 2PUVA 3AB8A 3EW7A 2JGMA 3EEQA 3OY7A 3AWIA 3QJGA 1XF1A 5COBA 3T7KA 2F9FA 3V1NA 3WADA 4FFWA 5DLPA 1ADGA 2XKAA 2XI4A 2NYUA 2XQKA 4FQ5A 5DYTA 3FWNA 4Q93A 2O6HA 1ZSVA 4CF4A 2IFTA 4BP3A 2IGBA 2QP4A 4FC6A 2B35A 3OFJA 1WKBA 3EPPA 2J4DA 1E1QA 5BQFA 4D9EA 1C8KA 3FW1A 3VI3B 3O4FA 3JQAD 5JQGB 1RPZA 3BMQB 1YL6A 4TS1A 3AGQA 1RC8A 5BWBA 2FH5B 3DWIA 4JITA 1VKNA 1U1FA 2R8PA 1M5UA 1UOPA 1TM3E 2R60A 1OYYA 1RW4A 2W8BB 2ZJ0A 3BDVA 2Y6UA 2IXBA 2MSWA 5K0NA 1Y3DE 4BFCA 3HJFA 3QKSA 2QGZA 4RD4A 1M2NA 4II7A 4TL7A 5AWFC 3P9RA 5IYZA 5GQSA 4E31A 3G8YA 1K3UB 4I8XA 2EF1A 1EG7A 1V96A 2WWRA 4MW5A 2AI2A 1DPGA 3RJTA 2HD4A 3QSGA 4AM8A 3TUZC 1SC3A 1RSZA 2CNOA 5B3KA 1E32A 1SUPA 2CF5A 2JC3A 3OSUA 1GKIA 1K06A 1MJ5A 2MSDB 4KCGA 4QATA 3DOEA 3SNHA 5JFTA 1NW4A 5G0VA 2YV4A 1JFRA 4CQMD 1TVKB 3ZHOA 2ESRA 3BHIA 3E9DA 3LHKA 4H1VA 4UNQA 3HCEA 5K4GA 2I6XA 3PF8A 4J1SA 4JX9A 2IZZA 4UBJA 5DVZA 4G4SP 3KQVA 4ALMA 3G2QA 4UBIA 4FW8A 4OI2A 3ZD7A 4BEBA 1GRNA 4ZYTA 3T3OA 4QDZA 4M3NA 1ZMBA 5KPJA 2IYSA 1NXPA 3ZI7A 4RY9A 5T8KA 3DMFA 4PYJA 1NMYA 3LUCA 5A7GA 4LYJA 1L7AA 3D64A 5HBGA 3SEZA 5E6RA 2DLNA 1OVGA 4D92A 2YV2A 4MH0R 4PAGA 3DV0B 1X9GA 3EQZA 1GV0A 1QJ4A 2WICA 4HDMB 1Z38A 3ORSA 4F9FA 2O2JA 3EZ2A 1QIFA 2H1OA 1DQPA 3P0IA 2VHWA 4PNPA 2W93A 2PA0A 3C3DA 2A4KA 4UD6A 1GZUA 2YVQA 1R4MA 2BHLA 1L5SA 2HJVA 3CU5A 4EY4A 2LIPA 1V16B 3K8YA 3DE6X 3HCNA 4UJ5A 4JI1B 4DIMA 5A5VA 4M0DA 3ND8A 1BMFD 2GLTA 3IAS1 1OYWA 3SEFA 4QQFA 1NQWA 1DNPA 1K89A 1VL0A 1EFDN 1WCYA 2OPBA 2B6NA 2R1VB 4GSLA 4WNIA 1L5VA 3KJNA 2B8WA 4QVIA 1OH7A 4UPVA 1OX4B 5I6DA 4JYPA 4M83A 1BMQA 1UJMA 3IO5A 3MJTA 4DWVA 2ZDGA 1MRNA 3TI9A 1ODJA 3S2ZA 5EJ5A 4LXYA 3M6LA 3JPYA 3LCCA 5IZCA 1RXVA 1QF6A 4LKRA 3UCFA 3CVOA 4W1RA 4PZYA 3W78A 5ECGC 3VJRA 3H5TA 5ICCA 4Z0NA 5ALNA 1BHSA 1ZRHA 2QS9A 5FWXB 1MB2A 1FP1D 2OBLA 3IMFA 5LBTA 5CB4A 1S96A 1UKEA 3TIVA 2YZ2A 3HA2A 2AZTA 1H2ZA 3DVAA 3KB8A 3NBAA 1NSYA 1Z0IA 3CUTA 3IXMA 4CFSA 2IPMA 2J9FA 5EIOA 2JRLA 5ER9A 4YS6A 4F1JA 3Q2KA 2C4UA 4S04A 3AHEA 2Y93A 3KZVA 4CF7A 4Q7MB 5EIFA 3HA7A 3PB3A 1UBSB 3CZCA 5REQA 2FPWA 3X1YA 5AKGA 1H2EA 4K2HA 2ZBGA 3DWFA 3HKDA 2KYRA 4MKGA 1JG1A 1Y9ZA 1F38A 1RLIA 3I9LA 1KS9A 3GLGB 1KAGA 2QLBA 4H7PA 4RW0A 3LTEA 5K03A 2OCYC 5C1PA 4MPRA 1XA0A 4B3HA 4JGBA 1VLZA 2VJNA 4D0GA 3N5KA 1WXIA 4CCYA 3N6VA 3DFUA 3CV3A 1FB5A 2Q5CA 2IEZA 2OCPA 1SU7A 4MWBA 3VISA 2H08A 3O8DA 1XO1A 3U7IA 4E11A 4DY6A 5HOQA 2DETA 1WL8A 4UEJA 3JRXA 4UTXA 1XDSA 2C9OA 2PL1A 4PHCA 4C20A 1U0JA 2RGAA 5ARDA 1B1AA 4IDFA 2F1RA 4H9GA 2B7CA 1OI7A 3FTDA 4ZXFA 1TMGE 4ZYZA 1W36B 3NWOA 4CFYA 3M6FA 5FBVB 4QQ8A 3U4QA 1HE1C 1GVHA 3CZMA 3JQAA 4D3FA 5IXYA 4O29A 3K2QA 4LNUA 3B7GA 1BQ3A 4HAVA 1P5FA 3COPA 1NAHA 4URVR 3ZXUB 4U7JA 5BSVA 2BP7B 2YOHA 3BICA 4BO5A 3NVMB 4FZJA 1U0EA 4QPCA 4M9SA 4U1RA 3TTUA 4JOBA 1RVDA 1NNEA 1XTTA 3GJRA 2C0CA 2GUWA 4E09A 3UOGA 1BDBA 1JEOA 4EYSA 5IJ9B 5LZ2A 3QQPA 2RMKA 2Y1XA 3WV4A 2Y9PB 4MAAA 3R4VA 1RKVA 3LQ4A 4A1OA 2CJWB 5FUMA 4Q4DA 3VPXA 1Y6GA 4KHPB 2ZRLA 1WJGA 1CZLA 1WUHS 2Z1DA 3ORQA 4R3UC 5BSKA 1NUHA 5FBWB 4CQMA 5J2TA 3S2GA 2I6QA 2ZRMA 1B23P 1MZPA 3CPHA 2DWUA 3O47A 2WU8A 3TG2A 1EJBA 2IH2A 1UEXC 4LOKA 1XQWA 4HQ0A 3CH7A 3PSAA 4X6LA 2H17A 3HJNA 1HORA 4P7GA 5ERXA 5FWYB 3RANA 4K03A 3V2GA 3L02A 4GXNA 3BL6A 4NBSA 2GO1A 3GT0A 2AIRA 4CI9A 1EE2A 1Q0TA 3EEIA 3SKYA 1OXSC 3H86A 4CMAA 3B3AA 5EE5B 4YY3B 2PEZA 2YIMA 2OQRA 5DGIA 2BFFA 4I6EA 1Y5NA 2PX8A 4EPYA 5JH7B 1NG9A 4HOYA 1G7TA 1MG5A 1Z5UA 2V98A 3IUEA 4AWBA 4R0NA 1F9AA 2C5GA 5LVAA 5CYOA 3H84A 5K3EA 5LUAA 4EYOA 4QTYA 2P9JA 1OU0A 2E5WA 4BE7B 1H4SA 4OREX 2B30A 3DL0A 3DNFA 1UXIA 1Z13A 4BJ3A 3OZBA 3HR7A 4D42A 2L17A 1A8HA 4KQKA 2ZTUA 3RVNA 1TJPB 1H2XA 1X9HA 3AU9A 1SG6A 2RAPA 4BQPA 1XCJA 2GJSA 3TE7A 3GV0A 1OYOA 2V9ZA 3KLPX 2HSEA 1J0BA 3HCDA 3T7TA 2HNKA 2KHZA 2I1WA 5FL3A 2QUIA 3BILA 1XKTA 1JSXA 2RBKA 5AOBA 4BJHB 3AFOA 3LIIA 4IILA 4DBZA 2DF8A 1E2LA 3EGCA 4BVHA 4F93B 2G06A 3EFOB 1N0HA 3VNQA 2X8WA 3PFNA 3MBKA 2QE7D 4PG7A 5CVDA 2ZB4A 1YBMA 2YZNA 2QXTA 4WI1A 4Z9FA 3TSCA 5A03A 4L4YA 3LXXA 3D7RA 3OQJA 5HRAA 2IDMA 2XDAA 1FQWA 1WO8A 4BP1A 4ER3A 4LZPA 1WU7A 3IVMA 1WG8A 4FE7A 4O2BB 4C0JA 3AV0B 2HADA 1IIRA 1GA4A 1Z4QA 4DIEA 1WBDA 1C7JA 2BMJA 2FDXA 2Z2IA 4V24A 4C4SA 5K8TA 2DX7A 2DCUA 1XLTC 3OLXA 3R41A 5LKRA 2GD2A 3J7AC 2CXOA 3K73O 1JHQA 3CGGA 2VRCD 4OLBA 3LBFA 4R7ZA 1ISFA 1DUIA 1NXSA 4FDUA 2VP4A 3W5JA 2ZE7A 4RCYA 2EBUA 3EBOA 4D0SA 4IJMA 3ET4A 5KYVA 1G21E 1U04A 3DZDA 1BWQA 5KVQA 5KDDA 4MUEA 3N0RA 3LC1O 2IPNA 3BJMA 4QOSA 4TSFA 2G77B 1UK6A 1XZQA 1CG6A 1DXYA 5E3JA 2QUKA 3VQTA 4IJKA 2JHGA 4ZALA 5LJIA 3L6UA 1MH9A 2R1UA 3EDYA 1NRWA 2A9OA 4I50A 1CJUC 4JJ8A 4WFKA 4P8RA 1P8JA 2I2WA 2FQ1A 3RK4A 2C2OA 4IICA 4FN5A 1CEEA 3S1LA 2R8ZA 2YRFA 4HDOB 3GWGA 1PJLA 3C24A 2LW7A 3N7AA 3Q3EA 1E63A 1EFUA 3R09A 1U8ZA 2Z4RA 3CG0A 4PLPA 2F3TA 5IAGA 5CRIA 1I1QB 1IN8A 4LSGA 4DSTA 3MGBA 2ETXA 4AJOA 1NFFA 3V8QA 4FW9A 4K05A 1RBMA 3VVBA 4LZOA 2HPZA 1ZM2A 5C4MA 1VBMA 3TLZA 2GARA 4QFBA 4LJYA 1FBNA 1LNSA 1MOSA 5D6NA 5AXAA 2CFCA 1E0KA 2ABWA 3D43A 4FN4A 5HE9A 4QDTA 5JRJA 1L4BA 2LDBA 1DUSA 4P33A 5F5XA 3HWWA 4EGAA 3EBLA 3F5SA 5LNK1 3VDMA 4DWOA 3IFSA 1EUCB 3PIIA 3K09A 2GPBA 3W4JA 1T0UA 1JNYA 5E4YA 4C5AA 1P74A 2QSZA 5H3LA 2CNWA 2WIDA 4LVOA 1QVVA 1UDBA 2ILTA 1QGZA 5FV7A 3ZJYA 1XTKA 3A31A 1BA2A 1NVTA 2GMWA 3BWDD 3DBVO 5CYPA 5BMVA 1UJ4A 3DDSA 4NY1A 2J0UB 1ATIA 3SC3A 1QC5A 2ZQZA 1YVUA 3IV7A 1JLKA 2B98A 3CF4A 2PWZA 3AG5A 2JJYA 3DEIA 4L6AA 2YXPX 4NYIQ 5AI0A 3FCEA 2P0AA 4ZDIA 1P0IA 4ZVOA 4UMDA 3QWFA 2CN1A 1QH8A 1GUZA 4AT1A 3W0LB 1GZVA 2XODA 3LKBA 2P2ZA 4AYXA 2OGSA 4JLPA 3IAM6 1C7IA 1JYEA 3OE7D 3ZV6A 2J5KA 3FWHA 4L57A 3ESYA 3JAWB 5DKFA 3AVXA 5JLAA 1JDJA 1A88A 3R23A 5B3LA 5CG2A 1IJKA 3QWBA 2OP0A 3KJIA 5DW0A 2HCRA 4ZIRB 2V1UA 1HLDA 3NAMA 3KT8A 3WKBA 5EKUA 3DWEX 5KTKA 3R20A 1I5OA 1S2MA 4Y7CA 2A5GA 5G0WA 1EWYA 1FRQA 1V9LA 5JXIA 5C52B 4DXDA 3ZV5A 1HC7A 2C4KA 1JNXX 1YZLA 1N7GA 1SVLA 4NTZA 3SYLA 2ZPUA 4NDNE 3F2VA 1YR1A 4DLXA 4MV5A 1CCWA 3WQRA 1BYUA 2EG5A 2B7BA 4QNMA 2BKAA 4CCWA 3QE0A 4MZDA 3OIGA 5D3ZA 4M7WA 2HQSA 3HYRA 3HJCA 2Z56A 3IQIX 4QBGB 4FEEA 5EJGA 3VO9A 2FG7C 4ND1A 3WO1A 3ZS9A 3QU4A 3VZCA 4YJ3B 3ZQJA 3LA6A 3W5AA 1UP4A 4RHFA 4BBAA 1J1UA 1T4DA 1WRBA 3DO8A 3T1VA 5KWIA 4IW3B 2ET6A 5H3HA 3FYDA 1ZK2A 2ZS7A 3E8XA 4NMMA 3IUYA 3CE6A 4QJ4A 3DBIA 1RABA 4MLZA 3WFZA 1F4VA 2F8SA 1QHYA 1H69A 2OMEA 4LYHA 5DX8A 1E1MA 3C85A 2WJ4A 4U5QA 4L5CA 3D81A 1B0AA 3CR3C 4Z7NB 4R1TA 2C58A 4FK8A 2WUFA 2XBUA 3ND9A 2IHTA 4R9NA 3ZKWB 4ZU3A 2G63A 2GZ2A 2YWGA 3AFIA 4J7XA 4WKGA 4PTZA 2NZ8A 4U9IS 2A0UA 3ETGA 1XVVA 5CLFA 3R4CA 4PSCA 1LPNA 1NR5A 3HYSA 4R7TA 2V7UA 5ITWA 2M6RA 1ULAA 4NU8X 3GZ4A 3BH7A 2O5VA 3MILA 1GPMA 3B60A 1HKUA 1KU0A 2FW1A 3P8ZA 1V6AA 3EVEA 3DKVA 3GWZA 1HA3A 1SC6A 3KEOA 1T1EA 1UM9B 3N74A 2IDJA 3P26A 4FFSA 4RYDA 4X8OA 5DRYA 5KQLA 4XIGS 1BD3A 4XWWA 1T9BA 1RMQA 3GLUA 3I9V6 3V1LA 2OVBA 2TMKA 5BSMA 3COYA 2F1IA 2QP3A 5BRAA 5LYJB 1A5AB 4DXAA 2R8XA 3ICOA 4FYYA 4ZWNA 1UT8A 1E89A 1SCNE 1FTGA 5F35A 2ZUTA 5LQSA 4EKNB 3AP2A 5IAAA 3AESB 2YBDA 3JZMA 2P1DA 1KE2A 1QQ7A 1W5BA 1X8JA 2PFGA 6ABPA 4AB1A 4HKTA 5D3KA 3V8MA 1M0EA 3WVNA 4YCBA 1SC1A 1RPTA 1WAMA 4KQCA 3WKCA 3VPSA 1ZXXA 4PYNA 3R3YA 3C5VA 3HRHA 2EW8A 3A1SA 3V5NA 2GCEA 2ZE5A 1KVQA 5E2IA 1HQYE 2HA3A 1SA0B 1W1WA 3NBYC 5IM4F 2O8EB 2NX2A 3PD7A 5CYFA 2ZR0A 3JD3A 3T6KA 3FHTA 5E7IA 3CKKA 1B6SA 1ZX1A 5MF6A 3ZDXB 2XQJA 3M5PA 1L1QA 1LH0A 4O63O 5MGNA 4GWKA 1B2LA 5CHYA 1SIUA 3NDJA 2ODWA 3MWEA 2R4UA 2FVXA 3KYCA 1VZ2A 1H1LB 4ZCTA 5L4SA 4UARA 1HL3A 4DMFA 3U2QA 3CZPA 5BORA 3K2BA 1Q20A 3IMEA 3P94A 4WPGA 5A4MS 2C97A 2QIOA 4RL4A 2EU8A 3MT0A 3EYWA 1SHZA 3WK8A 2ZVQX 4ARIA 4K6FA 1C14A 1M6NA 4OU5A 2AVDA 2LV8A 5FUBA 4BIMA 3MTAA 2DVMA 2YC4C 5ALIA 3ZH2A 3BQMB 2CJXA 1IULA 3OE7A 1Z06A 1I4WA 1V0JA 4NBUA 4TXMA 2DRIA 2FPOA 2EFCB 5ETJA 1JPJA 3VA7A 1E9EA 1FFCA 3DYBA 3V1TC 1KVSA 3CYFA 1IEXA 7ABPA 1J8QA 4FS3A 1RQNA 4TV8F 4A6DA 4HUQB 1MG0A 1WMAA 5KTTA 2JLCA 2NSLA 1WD5A 5DP1A 1XD9A 5HM6A 3NAQA 4IG9A 1YZQA 2IRWA 2LBPA 5AM4A 4BLTA 1MX9A 1XAGA 3TKAA 2VQ3A 1WX1A 3K6SA 1GFZA 2A7QA 3SHOA 3UMJA 3RAJA 3T9BA 2JI4A 4D9BA 3FDFA 4INAA 2GBLA 1U1GA 1XDWA 2NZJA 4X3CA 3HDYA 3QHPA 1MTZA 1ZCBA 1XZAA 1E6LA 4G97A 3ZE8A 2ZYAA 3PUJA 5EKXA 4LMBA 4MJLA 3UAVA 2ZB8A 3CUVA 4YMWA 1G16A 2BZSA 4ASUD 1DAPA 4Y6GB 4UE2A 2JBAB 3GGPA 3EEOA 1PJQA 3TTXA 3LKZA 3MBIA 3OQ6A 4G67A 3OC6A 3BD9A 3BSYA 1N3YA 3LUDA 1LFAA 3ZQKA 5AI9A 3EASA 4OL9A 4FDTA 3FCCA 3E7XA 1BKSB 1EJ2A 1PJZA 4PLVA 2RJOA 4NU6A 1I2MA 5DXJA 2ZULA 3D3QA 4WE3A 1P1JA 3Q11A 3SNKA 5DSTA 1E4EA 1G18A 1ZM3A 5IDXA 4AY2A 3KYIB 2P4UA 2VWPA 3FZYA 5J4YA 1V47A 2BGGA 1P7PA 1C3JA 3O1IC 3Q9LA 2FB9A 1JLLA 5D5PA 4BJ6A 3UAYA 2P7HA 1GCIA 3B6KA 4M1EA 1RKBA 1PJRA 3UC9A 2CB0A 2EJCA 3DTNA 1PGJA 1QZZA 1U3UA 1S1CA 4O2RA 4JD5A 2WYWA 4OTZA 4AJLA 4YV0A 1HDEA 2IZOA 1G41A 2ARKA 4NMLA 4Q9KA 4O2AA 3BJIC 1TRHA 4QU8A 1TK9A 4YHHB 1X42A 5KQSA 3IP5A 3TZQA 1U9JA 5JD4A 3Q7RA 1P7YA 2LPMA 2DBZA 2WF8A 3K4PA 5I01A 1BX1A 5ALRA 1C81A 3KEFA 1CUFA 3QV2A 1E3WB 2CUZA 2Y9MB 3QLTA 4J16A 5GM1A 4C4RA 3T1TA 1CTQA 4LXQA 3C8ZA 4G0YA 1M7BA 1U9IA 3JQQA 3ROPA 3VM6A 5AJTA 4BNHA 4C4PA 4EUHA 4RF2A 1RWKA 2PT6A 3NNSA 3UGKA 4CRWB 4MQFA 2P8SA 3K0AA 4IGIA 1F0KA 2FF7A 4JLSA 3NIBA 5AW4A 3AQ4A 3B9PA 3QNWA 1YMQA 1WA5A 3B7WA 4WN9B 5CHEA 2WU0A 4F4DA 1OR8A 2Q1TA 3E18A 1PZXA 4OQPA 2QTHA 2RJ3A 2WU1A 4TKUA 5FF9A 1RXYA 2R2AA 3L4EA 1KYXA 4BN4A 3HG7A 1JR6A 5DK6A 3DE4X 4FD3A 1SUIA 4M54A 5K3SA 1KRHA 1JFFA 5CITA 2W71A 2BGMA 4Z4FA 1JHOA 1YS1X 2O1WA 2PU7A 4NECA 4QUDA 3ZV7A 3SC4A 1MGPA 5FOTA 2VAVA 2Q5QA 3F9IA 1KAHA 4UMVA 4ZU1X 2W2KA 2WTNA 4N6NA 5IBPA 3CVVA 2ZIXA 1MKYA 4PYOA 4GBGA 5E4JA 2ZM5A 1KDPA 1XQ9A 2CBGA 1X7WA 4V2IA 2XMZA 1V3TA 1NUAA 3GBSA 1N2EA 3CGWA 3QNMA 4E7OA 4ENQA 2QTNA 3TD6A 4JT2A 4WGFA 2BL4A 4X7MA 1GPAA 1R6XA 1V2HE 2EQAA 4RYLA 1IH8A 1X70A 2F6RA 2PSEA 1H66A 4XW2A 5TEWA 2MMGA 3RSGA 4XRGA 2CDCA 2FQXA 4M0UA 4UUPA 4JN6B 3LC2O 1ZIDA 1KH1A 3FLBA 1N2HA 1P31A 2BTQA 5BOSB 1L7RA 3LC0A 1Q3HA 3OMLA 5JE8A 3B53X 2VWHA 1FTWA 4LZJA 4JCOA 3RVSA 3LX4A 2HX1A 4RXUA 1ECBA 2CXNA 2FR1A 2V4MA 2KJQA 4W9RA 2WHXA 2X1LA 4OQNA 3WB0A 5DEIA 5EZSA 1L4NA 2XLBA 1E3TA 3CF6R 3RRZA 2HCBA 1DEOA 3GLGE 1Y9EA 5JQGF 2JD1A 2OTCA 2EKQA 4MW9A 1FP4A 4F92B 4LHEA 3KG2A 1QU2A 4JV5B 4IIBA 1AF4A 1NE2A 2X58A 3OF2A 5I8WA 1OXMA 5NULA 4F8JA 1BE8A 4TTVA 1F1BA 4JP5A 3NYIA 3Q5EA 1L5ZA 5C8YB 2XGMA 2IWHA 1NVBA 5DTIA 1E8NA 1GNLA 4IFBA 4DJEC 4CFZA 3OX1A 3UOAB 4EMUA 3LYLA 5A3SA 2WVAA 5HUJA 3ILYA 1REQB 5BNFA 1ZW1A 4A0QA 3HQ4O 1GNTA 1B8OA 3AERA 4YBRA 5GZ6A 3LLVA 3LQFA 5EQTA 1EFHA 4NMHA 5U1PA 3RLFA 5HBRA 4FEGA 4E70A 3ASVA 1PW5A 3UJAA 1BEEA 2HT6A 4X3PA 5K6TA 2QR3A 3EJWA 4RVFA 2F4NA 2O2XA 1Q19A 3N39C 5CB6A 4OQQA 3A6GA 3FSJX 1EJ6A 4NOMA 3KQOA 3KDPA 4KHZA 4E4TA 1LPMA 2BKVA 3GLHA 4Q1VA 3ZU5A 2ZI3A 3CLSD 2FGJA 1G9TA 3FPEA 3K0FB 3OQ1A 3TKYA 1DKMA 1AUQA 3QSYA 1YZUA 2F4VB 1T6XA 1OFVA 4MEBA 4Y1RA 1MH1A 4JC0A 3ZIUA 3LO5A 4YRNA 3OLQA 4FB5A 5CM2Z 3JVDA 1HDGO 1LQ2A 3PXAA 4EEKA 1ZUD1 1JG6A 4JLKA 5CT5A 4HDNA 4CZ2A 4NJOA 1ZNYA 2X5XA 3OTHA 5EHGA 1IQ0A 3NBZC 4G5SA 2QD1A 2MSNA 3UB2A 1SUWA 4EHFA 2FWNA 1LTKA 1NBAA 1LPPA 3AF4A 4TVKA 4YDQA 2GX6A 4WKCA 3IL2A 5E0KB 4BWYA 5ESDA 5LXTF 3FXAA 4ALNA 1KU6A 4EJSA 4CKZA 3T5AA 1L4KA 4MKXA 2YWBA 4H08A 3DLHA 2ZJ2A 2BSXA 1VLJA 2G1JA 3DMTA 3GFGA 1P5RA 3OG9A 3H4MA 2D2VA 2H4ZA 4MV7A 2VATA 3OJXA 5B53A 3ROEA 1KVUA 4M98A 5I47A 2P9GA 3SF8B 1U7PA 3AF5A 4MAMA 4B3BA 4MV6A 2QENA 1AHPA 2VO1A 2GNOA 3BE8A 4NYIR 2XMBA 2VS1A 2FHSA 1NLUA 2NG1A 4HV4A 4K87A 1NOKA 3CLRC 3G3EA 1L6IA 1FDVA 2HSJA 4OB8A 4ESOA 1PGNA 3G5AA 5F7OA 4PXSA 1K5HA 2NUPB 1N6KA 3MWDB 5J59A 4XJSA 1VL6A 3PS9A 4LXGA 4OP3A 2Z9BA 3KB2A 4BB6A 2W6JA 2M32A 1C8BA 3QVLA 2V0GA 2H54A 4XLZA 4E33A 3ADCA 3D02A 3F90A 1NNSA 2GBCA 2NSDA 4Q00A 5G1NA 3E8SA 4OK6A 3L7AA 1TM7E 4G5FA 2WY2D 1QHSA 4QULA 4P98A 3A32A 1ODTC 1W8DA 4S1PA 2Q28A 3O8LA 2B0JA 4P83A 1VHJA 3C8HA 3ZCQA 1WNTA 2CLOB 3B9QA 1V5GA 5KYWA 2MINA 2ZBRA 2ZAMA 4B6JA 4ZYUA 5HTOA 2ZXFA 3RIYA 5HEKA 4BNZA 1KVRA 2GRJA 4G9BA 3SDZA 3WIUA 1CUIA 2OK8A 2YYYA 1EXVA 2NO7A 4R1QA 3G0GA 1SRRA 3MYYA 4A8JC 5I7OA 1KBOA 1F8XA 2J41A 3NYQA 2FKNA 2H0RA 2Q4RA 1SELA 2XGGA 4K7JA 3UV7A 8MHTA 4ZOEA 1SCDA 4XPIA 1U9ZA 2BKLA 3S1SA 1PWHA 2EWWA 3AF3A 2G82A 2JVJA 4TWBA 2OUKA 2QF7A 2QLMA 3NHRA 3RBAA 2JAOA 4X63A 1XZ8A 5GY7A 3ZK7A 1QRTA 1EGMB 2V58A 4DILA 2HF8A 3TFOA 3BXZA 2GPJA 1YB5A 1KYVA 2DSTA 2MMCA 2OV6A 3UZUA 4TKMA 4N01A 5EAIA 3U19A 1PI3A 5ILOA 3GH1A 2CDNA 1GFSA 5CM8B 3TLKA 3PXXA 3MS4A 4CBVA 3H6GA 6ADHA 1GGNA 1Z74A 1L8XA 3S2SA 3GLFA 1V6CA 1YR2A 4XSGA 5AUQA 4AO8A 3L1IA 2CFOA 1QHXA 2MSLA 2IOFA 4YPVA 4BCDA 4KWIA 1XNJA 3LQYA 1XF9A 4CLDA 2FFBA 2VNKA 1RQPA 2WDPA 5ICFA 4LVNA 4RA9B 4BASA 2ZTHA 4NZ9A 3RUDA 5CDGA 2F17A 4OLAA 1ONPA 2IXAA 3M6MD 4ABYA 3FBTA 3TW6A 1OXTA 4Z0HO 3R5SA 3R8XA 3RUPA 4AF7A 4KL8S 3G68A 4IZOA 1KR2A 3KTOA 4FBGA 1UAGA 1VSTA 2OLKA 3D2CA 2PRSA 2F3RA 3A11A 1CNFA 1E5VA 4HK4A 4F3YA 2WK1A 4Y2JA 3BD7A 4OQZA 5KU7A 3FMGA 1NYTA 1JG4A 2OSBA 3O4GA 4RVGA 1FNNA 5GVSA 4KRYA 3KL2A 4AS1A 2WABA 3R6LA 4MW0A 5K4AA 1DQYA 1U2EA 3D31A 4B1FA 2HA6A 4E5YA 1KC3A 1XMVA 2XMQA 4HQNA 3RW9A 4LAFA 3PNQA 4PLCA 1ZKMA 3ET5A 4FM9A 2POCA 2O2SA 4ZREA 1XPOA 4FC7A 4UBLA 1N2SA 2YV1A 1LK5A 3EGDB 3FUUA 2FW6A 1EFVB 1U6KA 3LZCA 3CJTA 2Y92A 4OMUA 4TM7A 1YMVA 1M1YA 3DAGA 1IY2A 4H1UA 3BXOA 3EGIA 3H9BA 4EELA 1NJ5A 1PSDA 5CFPA 1XZDA 2D3WA 4CKWB 2J3DA 1HQCA 1IPEA 2BUBA 4ODIA 4H35A 1YI1A 2AZXA 1CHNA 3G5TA 1YS2X 2AFHA 3R5JA 1SZDA 3GP3A 5GPBA 4LMAA 2CYBA 3THYA 1YC2A 4AO6A 5JAMA 4KACA 2JZCA 4DTCA 1TCVA 2X23A 4QGBA 2JCYA 3MMZA 1TFRA 2CLSA 5J23A 2EZUA 1XAHA 1YZFA 2BUAA 5KYUA 4GECA 3U1TA 3WXMA 2VJDA 3LT0A 5B6IA 4IQ8A 5KYYA 3L8CA 3CINA 2N46A 2ZREA 1Y7TA 4YALA 2WA1A 1MFPA 1W47A 5ALUA 3KJFA 2I7CA 3LRTA 2IYZA 2P40A 2QRLA 4PBRA 1T4CA 4WXMA 3FN4A 2P3OA 3CNBA 3M6IA 1CJVC 3WFIA 4JI7B 1JZSA 4MQ4A 3DTVA 3BBPA 1FNDA 1UZUA 3GMDA 4HDAA 3WO0A 2JL1A 1TUBB 1J9GA 4FB4A 4L0DA 4IYRA 3D7SA 4O2BF 3RSLA 3E6AA 5F2EA 1T3SA 3EGXA 4OHMA 4B47A 8LDHA 1IUNA 3GU3A 2ZJ5A 2DBYA 2PYZA 3URMA 2ZANA 3Q3HA 1G0OA 3C15C 5EL0A 2AXEA 5CA1A 4UHKA 3IAFA 1MA0A 5AKEA 2CV1A 2BMDA 3RS4A 1YF3A 1MO6A 2HHCA 3NHUA 3O1JC 3U60B 2QW1A 4K2AA 4JBXA 1Z4LA 2NO4A 2WDZA 3FZGA 3RC7A 3RSQA 1UT5A 1WZEA 2C42A 2IYTA 3CH4B 2QTVB 3CNEA 4MQMA 2VDLB 3VKGA 3NIFB 1W9HA 3MQ2A 3EF3A 3KPUA 1TF2A 4MQBA 4QBHA 4BX3A 4TVSA 5CEFA 2Q2QA 3MJCA 4HFNA 4ZOLB 4WK0B 1V2GA 2AOTB 2FP4B 1QGOA 3PX7A 4M7PA 1QR6A 3ICQB 4RS4A 3AEUA 4B3IA 4EHBA 2F64A 2NVOA 4UKDA 2GAFA 1YV9A 4H6XA 2ERCA 4X61A 1EDEA 2FUKA 2JJ1D 3ESCA 3GIDA 2XUIA 2AVNA 4FDLA 1JILA 4R4JA 121PA 5I7AA 3E35A 2Y2VA 1J56A 1U1DA 2A59A 2G67A 3ITNA 4OM8A 4QXOA 4WLOA 4AJPA 3RVBA 3CW2A 1XXHB 3WAGA 1OBVA 1C3VA 2DM6A 5LA6A 1Q14A 1P9WA 3ELBA 5L95A 1V8DA 3FPGA 1U7XA 4WA7A 5ESXA 1T3HA 4OQDA 5D1NA 3ZHXA 1H0RA 1ENOA 1C1DB 2OBXA 3K3PA 4JK3A 1UADA 2M1XA 2DQ4A 3MMNA 4Y98A 2EW1A 1WB9A 2RHHA 5T3UA 4YAGA 1JB9A 5BQPA 2XXAB 3SVTA 2WE8A 4GOND 4H60A 3JVIA 2WIKA 4MS3B 3IULA 2WU4A 3OJFA 3C39A 5AHWA 1PR1A 2HLDD 1Q0RA 2R66A 3SEAA 1E61A 2I2DA 2PNFA 4JUDX 3W4IA 2NP6A 3ZTYA 2ZU0C 3DHNA 4LQLA 4KH0A 1A5SB 4RM2A 1OTHA 5AUPB 4RTMA 3WMEA 2GCNA 1MAUA 1M8GA 3SS7X 1RHRA 4AY4A 4JXXA 2P3LA 1E18A 1U99A 5HKLA 3SHFA 3OIVA 1QIGA 3G6KA 3VOAA 1S4MA 1Q17A 4F72A 1FDTA 5EJ7A 3L7BA 5ECWA 2D1RA 4JLJA 1J1IA 2WSYB 4FWBA 1TD9A 4M53A 7MHTA 1HTTA 2NLOA 4UNIA 1O5OA 4FZVA 2BGJA 4YRFA 2B3TA 1KAOA 1O8BA 1NX9A 1DXHA 2DCMA 3O93A 5JNLA 4JLNA 3PVSA 2WG1A 3W5HA 1XA4A 4RMGA 2XTMA 3I4FA 1YQTA 2HK7A 3OPXA 4NNJA 3HCWA 3UENA 4A03A 1GR0A 1L4YA 4MR9B 4B2YA 4BU0A 5E1OA 2G1UA 4NH0A 1OKKD 1NYLA 2A9FA 2C1XA 2QUZA 2QPAA 3EQ9A 3ESRA 1YBHA 4LCBA 3M0EA 1JVSA 3VHQA 5JEDA 1V37A 2WINI 3VC7A 4CR8A 4YMUA 1IK6A 3L18A 2WKQA 1SK9A 4IF4A 3T3HA 2HH9A 1I10A 1T2FA 3QE9Y 1ODFA 4KMOA 2J59A 2UYQA 4JLOA 1KTVA 2RAFA 2QRHA 4X1OA 1TVMA 4YB8A 4HNGA 3REOA 5JV5A 3SQXA 5GWXA 1NVDA 1XLTA 1XWWA 2EZ4A 3TLMA 2QUAA 3D8HA 1P80A 1G42A 1ZJ4A 1J8VA 4JZYA 4TLLB 4WLUA 4FX2A 2ZUEA 1FS6A 5AW9A 3UK6A 3Q40A 4C3OB 3ME5A 2PDAA 4B3JA 4ZT7A 4EB6B 1DZIA 4YJ3F 4CM8B 4YRQA 1WSAA 3VRHA 2KWIA 1JDTA 1YR6A 3NFRA 2FG6C 1YDFA 3UAGA 2YL2A 4E4YA 2C4WA 1X80B 2V5VA 3DULA 3DXXA 2I29A 3W5BA 1UCFA 5C1IA 4J43A 2QX4A 3BORA 4ZI7B 2COUA 1Z7GA 2R25B 1Z2AA 2NGRA 4N7JA 4TWJA 2X3FA 1NXOA 1R12A 5K0FA 1P1FA 2VQ6A 3DR5A 3AY7A 1M8JA 1L0BA 3N3BC 1LDBA 1LV8A 1YAJA 1U6IA 3O7MA 4Q66C 3Q87B 3L0OA 4N9QA 1YFJA 3QRWA 2X6RA 2XE4A 5HF6A 3C8UA 3E9ZA 5BR4A 5DI3B 2IZ6A 4BEJA 4OQEA 3ZTTA 1VL5A 2C29D 2K6GA 1BJTA 4D97A 4RIEA 2XRFA 4HDSB 1XE3A 1W34A 5AJWA 1DBQA 3PFFA 4TLEA 3NWEA 4KNWA 3VBCA 4BNMA 3LDGA 3JQ7B 1T26A 3GEDA 3DB2A 4EBFA 4EYQA 5IT4A 3MG9A 2Q0XA 1ZS9A 4MRRA 1KDRA 3RB8A 4YCMA 2SKDA 2WD7B 1A2OA 1PR5A 1U28A 2C7VA 1AURA 3GAZA 3TIGA 4AYWA 2D3TA 3BWEA 4TUYA 5ALFA 4GBED 2GSDA 2N47A 3A26A 5TEVA 3WMFA 4OJQA 4D8VA 1JDSA 2JFYA 3MAJA 4K9MA 1R88A 3AR7A 1L5FA 4Q3EA 3CLVA 3UJNA 2RG7A 2X7JA 1V1MA 4MKIA 5A4JA 2P6NA 1Q7CA 3GEIA 3L8ZA 4RHUA 3VPCA 3KE9A 1AN0A 1B0PA 3BMNA 3K9LA 1V7QA 1YI0A 4KAFA 2HJHA 1ZK0A 3BWVA 1HT0A 1U8EA 3F71A 4DREA 1YTLA 2J7PA 4UBNA 3AKCA 5TR9A 5KS2A 3THWA 1B00A 2DFTA 3G89A 1WB6A 3UYLA 1DTWA 3QUBA 2A9PA 5DWQA 5LMCA 5ED4A 1XNQB 3E82A 3PDUA 2YFQA 3R8FA 4E6PA 3C97A 4DQXA 4B6EA 7REQA 1R9GA 2OCAA 4Q1AA 4QAQA 1U2PA 1MC8A 2A4MA 3MIZA 5F51A 1A8QA 4PZPA 2BKXA 1EGQA 4RH3A 1Y3BE 2HLDA 4LCEA 2X15A 2YIVX 2AMYA 3G2NA 4JL8A 1S4QA 2HDWA 3VSCA 4BTVA 4GVPA 1TQ8A 4IHJA 2IUTA 1MX3A 2GA9A 1KZ9A 5CEEA 4Y6SA 1Y8CA 3AETB 3ZCXA 4EJ0A 2H4YA 4C7MA 1NJ8A 2Y1DA 5GAJA 3REQB 2GHIA 4L08A 4PS0A 4FFVA 1N9GA 1PT6A 3SOZA 2ZKIA 4KO1S 3PR2B 2GEVA 2QG6A 2OCLA 5EXEA 1PNOA 2YIDA 1A2KC 3WZLA 3GFOA 1CVLA 4W6QA 5G0TA 2IU3A 4WX2B 1A9TA 4PHFA 5EIBD 3WHKA 4PBTA 5BN5A 5IPFA 1TMKA 2RHGB 4JP3A 3TLBA 3ADDA 1SHTX 4WKPA 5GONB 3FWZA 2VOJA 4GGOA 2GPNA 4TYNA 3BIWA 3QQ5A 4HNRA 2J0EA 1OXUA 3ACDA 1CUEA 3FPKA 4D3XA 2QT9A 4ZMRA 1DG3A 3BWBA 1D09A 4CQJA 4ZEWA 2PUDA 4G9EA 4LIPD 3TB6A 4IMIB 4XVCA 4URYR 1X39A 4KZPA 1DHRA 4OP2A 3EAGA 3ZGXA 3HADA 1DXQA 1G20A 4RZUA 1KSHA 4YAOA 4GVLA 2X22A 4B4WA 1OFGA 2WWIA 3ZDBA 2H9AA 3OAAD 4NHOA 4RK1A 3VNSA 4EO4A 1FU7A 3BVPA 3WNBA 2WAMA 1JS1X 3O4IA 3WGYA 5B3JC 4NULA 2H06A 4BV2A 1AKUA 2AA3A 3I8SA 3K5WA 4EUEA 1N7IA 1T8WA 2AFVA 1RQ7A 4QGAA 3TEJA 1RAHA 3ZJ4A 8AT1A 2JLXA 4ZO6A 1WXEA 1BFDA 2JJ2D 4ERXA 5FR2A 4M1WA 4AG6A 5JIBA 2UXCB 5IHPA 3GNLA 5LQJA 5F9FA 3WYCA 4N7MA 3GJ0A 2C8KA 3FB1A 1R3DA 2FWJA 4D9FA 1JXAA 3EF1A 4X8MA 1W6RA 4YCNA 3NVKI 2QAGB 3RC9A 4R0VA 3WL4A 1RWVA 4XJTA 5IDWA 2HT1A 3WGIA 2BRUC 5EMHA 2RIRA 2WM9B 1RVV1 4GMXA 1Z3IX 3TEFA 2O6LA 3AFGA 5CFRA 3ZE2B 3PRYA 3M3DA 2FK7A 5AJVB 5F76A 2AJCA 2QGNA 2Z08A 3D6MA 3R7DA 1GPH1 1RCUA 4WTOA 4CF3A 1V3VA 3DBHB 1AHHA 4GWGA 3TOCA 3JWHA 1Z8NA 5JARA 2FRVA 1AUVA 3W5DA 4LGYA 4C0AC 3FDZB 1N8SA 3LW7A 4B79A 1OYVA 3Q6IA 3H6HA 3G8DA 4PIPA 3B6MA 4NKRA 2O8BB 1C7ZA 1E1NA 1HZZA 1PHRA 1QE0A 2B83A 2GAOA 2VHZA 3HJHA 2FPXA 3R77A 5K20A 5LU9A 3C5CA 3BIFA 5J2UA 4PZCA 2HJWA 2PEYA 3HFRA 2HM7A 1RJFA 1FSFA 3HWSA 3OE4A 1ZA2A 3X1MA 2YN0A 1NMXA 3GDFA 4F6CA 1UWKA 4RANA 1NRJB 4G2NA 5KNBH 1EQ2A 1QP8A 2P5TB 2N42A 1G8YA 5DBOA 3P2MA 4BV3A 3H3JA 4WACA 4CGYA 3NHLA 4DLKA 4DV1B 5D00A 1RJ9A 4KN5A 3G9TA 2Q0HA 5IXJA 1FXWF 5FH9A 4E30A 2HRZA 1H93A 1CQPA 3BE4A 3OO0A 1FP6A 3FR7A 5I9LA 3Q10A 2ZAYA 5K0CA 4I4TA 2RH9B 1P33A 3OJEA 3CZRA 4B5KA 1H42A 1FCJA 2R7NA 4EFKA 4PR0A 3OWOA 5CH5A 1XZPA 1B2RA 4R2LA 4FYJA 1ESEA 1EFRD 3JQ8A 3WGJA 2FSGA 1MX5A 1ZRSA 1PG2A 2H1HA 3SX4A 2MR6A 4KWHA 5ADHA 3FOEC 1AKMA 1DWOA 4AYTA 3LGXA 3ZWMA 4ZVLA 4X84A 2P6RA 2ETVA 4R3WA 4DLAA 1C3OA 3MGKA 3AIIA 4G9GA 5LQNA 1RI2A 4REQB 5EWJB 4C7OB 4ILKA 1E3EA 3Q9UA 2OYSA 3UJ8A 2VUSA 4TVBA 5ELMA 2OPHA 4YYEA 3U0BA 1CUJA 4ZVVA 2J45A 1P0PA 4EA7A 2PXCA 3MOGA 5I7HA 4K1LA 3N86A 4JASB 2AR7A 4ZD6A 4OQ4A 1WDKA 2Y6VA 3TMKA 5K0BA 5EWLA 2IYNA 1SCAA 3BKWA 3NATA 3SM9A 1WHTA 5GJBA 5FOXA 2C4VA 1V5WA 4GI1A 2H63A 1CJTC 3BAZA 4X65B 4Q39A 4MGHA 4H15A 1GUYA 1ACMA 3P96A 4YROA 1N0VC 4G23A 1G8PA 3P9CA 4WXYB 3VYWA 1RM3A 2QVXX 3PQ3A 4YAFA 1E1CB 4EHIA 1M2VA 3BGIA 2PXHA 2VPYA 2DECA 3PUWA 1S02A 5AK5A 1W4RA 4B6OA 5C51B 4Y2VA 1M6YA 4LK2A 5DMHA 3VX4A 3ZHCA 3HY3A 4DSZA 4OFXA 2WVJA 2XNDA 4NQRA 4ALIA 5IJZA 4IKPA 4URXR 1NLYA 1IBCA 1T2VA 3BSWA 4HDKA 2QLFA 4EATA 1MO3A 2ZK7A 3TQHA 4X7RA 5C8YF 5CTAA 3HU1A 1W36C 4NAUA 4ICIA 5DNVA 1DBSA 1V35A 2R751 4FR5A 2XQGA 5I7VA 5KYXB 3SF0A 4L5JA 1CY0A 5H83A 4ZJYA 1GUDA 1TQHA 5JJLA 4UUAA 1USWA 3QIVA 1WSBA 4IOJA 3AZOA 2XKBA 4ECAA 4AJKA 2DG2A 1O87A 3OIYA 1T29A 4WJZA 4NOJA 3CF2A 1F60A 1XDGA 1WUIS 4JNCA 4YWHA 3V4PB 5LSAA 4YXFA 1I8TA 2FZKA 3QYAA 4BVAA 1U1CA 1YGPA 4U8GA 3RUCA 3ZEAA 4GVXA 3DCJA 2HA5A 1A9YA 1GZHB 2VJPA 4WK6A 3GK3A 2ZR9A 4C89A 1J6UA 1LI5A 1XMSA 1H2BA 2JJ2A 4G84A 1LI4A 4PQGA 1JHDA 2JCGA 2CBZA 2YMLA 4MR7A 4NI5A 1G6KA 4XVRA 3SJAA 3WL3A 1THMA 3ZUPA 4KLCA 1Z07A 2Q7XA 3RHFA 4BV8A 3C6KA 1I0IA 4AQ7A 1CP3A 1KMHB 4YMTA 5FWNA 4EM6A 3WQSB 5KSPA 3DE0X 2HF2A 4BO0A 1QVAA 4LRUA 4BFTA 1CUXA 2H51A 1EUDA 5K4HA 3H65A 5JAIA 4RZ2A 4IMJB 3GRKA 2O3QA 1WIWA 4PX2A 3WGNA 1KJ8A 3TRDA 1JRLA 1Q3TA 1W52X 4RDIA 1A9RA 4RTOA 5JECA 3T7IA 1VCIA 4N3GA 5TV2A 2JFNA 3VJMA 3O8QA 3WLKX 1NYRA 1U2DC 4B4UA 3ZGVA 3O2JA 2E18A 4BFWA 2BGIA 1Z6XA 3CX8A 5HG0A 4LQDA 1M72A 1QKJA 2HFKA 5G4KA 4AG5A 4CUZA 1E77A 4ITRC 4YRIA 2DPMA 1KQOA 5U9CA 3X44A 4ZAXA 5KX5B 3HL4A 2VHCA 2OCIA 1UBUS 5EJ8A 1JGTA 4Y9RA 2BBWA 4HH0A 1XXLA 4LY3A 3ZIAD 5THKA 1H2RS 3DGEC 1WM1A 4H0CA 3T12A 1BE1A 3TLGB 3DHYA 3NGLA 4BKQA 4QLBA 1YA4A 4DMRA 1JEQA 1ZD8A 4JYBA 1W0CA 2YWFA 1E6CA 1FLVA 2VJLA 4Y9DA 2WJJA 2H0AA 4NG5A 3P19A 5DYNA 3A9VA 4B4OA 3GR6A 3VZQA 5TMDA 5KIAA 2XUZA 1AO3A 1GYRA 3R75A 3F49S 3KVRA 4RVUA 4HLCA 2RBEA 1MU0A 4NFHA 3STXA 1Y3HA 5JSYA 1JEEA 1EFRA 1YASA 1PYDA 5ENDA 3BGSA 5TQVA 4B82A 4GRIA 4TLAA 3RBZA 3R5FA 4H31A 4OXNA 3G2LA 2ORED 5AQ1A 1AK1A 5JC1A 2RGWA 4Q82A 2C9CA 3TW4A 4DXHA 1N3BA 2B25A 2I3DA 2I2AA 1AZWA 3WGTA 1HF3A 1QGUB 1T9KA 3KK0A 4EK9A 4CLRB 3D59A 4ZN6A 5KOJA 3IKTA 3FUTA 4D3ZA 1E7QA 1RYMA 1K4KA 2I4LA 2ZP1A 1T5HX 3BGVA 3O95A 4IS2A 3WLLA 3HYLA 2CBXA 5ESWA 1YMUA 3MEQA 2BW0A 3FMVA 2H5JA 3RNLA 2VHQA 1V5EA 4AJEA 5KSZA 1N8NA 3OPYB 3IIJA 4QE3A 3DL7A 4IX9A 1QCCA 3EGOA 4KIJA 5EVJA 4EKEA 3MS7A 1ABEA 3KAPA 4HWOA 3VOTA 1KEKA 3KPWA 2QPOA 3HR4A 3ZIDA 1PNTA 2IUYA 2JD0A 1IBRA 1THZA 1R15A 5T64A 4Q4JB 3T15A 2CK3A 2WJPA 3GZTB 1NURA 1PK8A 1WD7A 3JW8A 3Q7TA 1XLUA 3HS3A 4O3FA 4LNHA 3SN6A 1N33B 1PD0A 2V3VA 4UDXX 5TPWB 2PJRA 5L3QA 3X1KA 2OXIA 1Z2PX 4ROSA 4QWMA 4TRNA 4TKVB 4F12A 4GZMA 3LCUA 5JSZB 2P5UA 1XYVA 3Q15C 1VGQA 4A8PA 2X4GA 4J6EA 3IILA 5TMPA 2W2PA 3IR5A 4G5HA 4PPQA 1KK2A 3QW4B 4E5KA 2AHOA 4AZVA 2VXOA 3WLJA 5CLHA 5FYQA 5FJIA 4CIWA 2WZDA 3A10A 5GJVC 2VYND 1ZJYA 4FTWA 4LJ5A 5T4HA 4OX9Y 2V7BA 2VRWA 1VLQA 4DNQA 1EM8B 2EJBA 4GYJA 1OAKA 1YJAA 2GXUA 3EXFA 2E6KA 4G0ZA 4TT8A 3CRMA 4HQ6A 4BL5A 3CVWA 1FTYA 1QYVA 4WESA 3QBVA 4KFUA 4RZXA 5CT9A 1KI2A 3VSDA 3NASA 1ZQ9A 1TTHA 3C1AA 3L7MA 3RASA 2RCYA 2VRNA 3KOYA 4PM4A 3B38A 4P93A 4B8YA 4YPOA 4YAIA 1KSJA 2ZETA 1KJIA 2HQBA 2WMYA 1JHYA 1L6RA 1M74A 1V25A 3JD0A 2ACVA 3MCAA 4FYXA 2R85A 1LLQA 4K9OA 4YJGA 5DFAA 1PCXA 4E14A 1Y8QA 4JS0A 1KKLA 4G5RA 5K99A 4DBLE 5DPMA 4KB5A 1KZHA 3E3OA 4POOA 1NMQA 4LECA 4P38A 2XYPA 1JH9A 2F1HA 1QIJA 3CTPA 4OQLA 2EF0A 4ME6A 1KERA 1PR3A 1G60A 3L0YA 5AH0A 4BLOA 3OVMA 1QP0A 2ZSJA 1CQJA 1EAMA 3GRRA 3C3PA 1KJ9A 2HMTA 3GLRA 2ICAA 3L01A 3N2LA 4HPXB 2IHBA 4EDFA 3TGLA 1PV4A 2ZYTX 3KYDA 3WDKA 3ZY2A 4F6RB 5AI6A 3GA0A 4L8GA 2C3UA 2QTZA 3J7TA 2X1MA 5SZKB 4E22A 3L1JA 1AHNA 4M1ZA 3NBKA 1LBIA 2D1YA 2PGLA 3FHCB 1W29A 1HE3A 4OJNA 3Q0TA 1N6LA 1YRBA 2CYAA 2ZUCA 4RLHA 3LMKA 3G13A 5BUCA 2GAIA 5DP2A 4ZRMA 4YYZA 4ZRNA 2PMCA 3L05A 4M4SA 4BMDA 5AK3A 2E4AA 2PMFA 5DMXA 5JISA 3PRJA 3TDNA 5AVSA 1LPOA 2B20A 3FFBA 3TZEA 2XCRB 1XMQB 2P8JA 1YQ9A 1W0KA 3LUKA 3O83A 1EINA 1OXBB 2J5QA 3FYHA 4PO3X 4YASA 3MELA 3BIOA 3E22A 4Y0NA 1UK8A 3FF1A 4L4RA 4LJ6A 4PCVA 4A6EA 2IHNA 5HIIA 2OFPA 3E23A 4PWZA 3H9GA 5J5AA 4HB3A 1NU8A 3DP7A 3HJRA 5DN6A 1YB4A 2VHTA 1EH5A 3IUQA 4LX8A 3OU7A 1KBQA 5JEEA 3TPCA 3P9ZA 3TTYA 5JXGA 5E6UB 4DN6A 2GZ1A 1IYZA 2ZU6A 1ISSA 2AOXA 2VK4A 4DBVO 1WCXA 3PNYA 4GQBA 5WRFA 2H92A 5FTLA 2QOEA 5DYIA 1XP5A 4E2XA 3HO1A 2IYQA 1SUCA 2ECFA 4YIHA 1DOHA 1N4DA 4X94A 3HN2A 5C2JB 4BIIA 1WMEA 1U2ZA 2J5BA 3ZLUA 1F6WA 1R5JA 2W4IA 3THSA 3KC2A 4KSYA 1Y5MA 2YH2A 2Y8EA 4WZBA 1YDWA 4ZQEA 5P8WA 4ZEVA 3ANMA 1W2HA 3LOUA 5LQRA 2ZZNA 1ZISA 2NV0A 2QZ4A 5EFZA 4D81A 3C16C 4V1CB 1M66A 3L40A 3X1JA 3LX6A 1N6PA 4ND8B 3RG8A 4OHWA 2FHPA 4ZOLF 2JGJA 2HMWA 3B1JA 3H2KA 1N1DA 1HG1A 4FKZA 1TM5E 3TOZA 2ZJBA 5EA2A 1PJSA 2EEPA 2O0HA 2WVHA 4XFKA 5BR7A 2VXCA 1YQUA 3WP0A 1W44A 4JLMA 4CMCA 2PGDA 3ADKA 3N2IA 5K3FB 2PVPA 3RJ5A 2Z09A 4MLPA 2X3UA 3LCVB 5CLLA 1WXQA 1YZKA 2OBFA 2QJWA 1Z39A 1TUIA 2PCLA 3AKDA 1E3IA 3NEPX 1XWFA 4N12A 2RH8A 5KAMA 1W48A 2FUNB 2QLLA 3L0IB 3SVZA 4ENWA 1JR3E 2ISSD 4LA4A 4ZT6A 1TU3A 1PT9A 2AEMA 5JRZA 1WXWA 1W1IA 2BSQA 2J08A 1M6VA 2Y4NA 2FW8A 1B26A 1JJFA 1BH2A 1BS9A 2DKNA 4GW3A 5AYVA 4C03A 5BQOA 1MC1A 4RTRA 1P7CA 3DZIA 1KFEB 1DCMA 1WCIB 5KJCA 3PDHA 1T10A 3GVXA 1XQ6A 4HWRA 1F6BA 3FWKA 4X5OA 1OA1A 2Y1EA 3KSUA 3U4IA 1U7DA 3I6BA 2V7PA 4HAYA 4CWAA 3H9JA 2Q2VA 5CLIA 4PSAA 5I9SA 1C80A 4WFIA 5KNLA 3OJCA 3OP1A 1ZJWA 3W5CA 1NBEA 4A23A 3PCRB 3VO8A 2ZR8A 1JU4A 1B15A 1Q7EA 3GLIB 2X3YA 1RRCA 1ZOSA 3CW8X 5HDBB 1L7XA 5JZBA 4QM7A 9MHTA 4TT3D 3B8HA 1K7EB 2OV2A 3DW3X 2FG5A 4UU8A 3E2IA 5H70A 2DLCX 2JFWA 4NBNA 3UK0A 5IKXA 4M1SA 2P3SA 4UDNA 2FK8A 4KN8A 2QM3A 3NEYA 4WKOA 4WZAB 1JKJB 5DCWA 1RRPA 3QVGA 1WTCA 1HMPA 1Y1SA 2NUBA 2V0CA 1Z73A 3FR8A 3EMVA 3LW8A 5B58C 2ZEJA 4ESEA 4K86A 1PR0A 1AGNA 3LLCA 3W1EA 1IB0A 2XE8A 4AIIA 1Q1QA 2ZSUA 3DO5A 3SXJA 5BY2A 3COJA 1HNZB 5LOVB 3WLMA 1J24A 1VCOA 1WBJB 2GXQA 1C1XA 3OLZA 3WWZA 5J58A 4JB0A 1M7HA 3OETA 4HYQA 2GN9A 2NVBA 1NY5A 5DHTA 3TFWA 1GLNA 1PGPA 1MA3A 4KQMA 2WNSA 1X1RA 4QG7A 4F5DA 3L1UA 1Y9AA 1FUEA 5FUQA 2CXSA 2CHUA 2FRXA 5JNSA 3ZWVA 5B7GA