1NM5C

R. rubrum transhydrogenase (di.q132n)2(diii)1 asymmetric complex
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
174
structure length
174
Chain Sequence
SVKAGSAEDAAFIMKNASKVIIVPGYGMAVAQAQHALREMADVLKKEGVEVSYAIHPVAGRMPGHMNVLLAEANVPYDEVFELEEINSSFQTADVAFVIGANDVTNPAAKTDPSSPIYGMPILDVEKAGTVLFIKRSMASGYAGVENELFFRNNTMMLFGDAKKMTEQIVQAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NAD(P) transhydrogenase subunit alpha part 1
publication title Glutamine 132 in the NAD(H)-binding component of proton-translocating transhydrogenase tethers the nucleotides before hydride transfer.
pubmed doi rcsb
source organism Rhodospirillum rubrum
molecule tags Oxidoreductase
total genus 49
structure length 174
sequence length 174
ec nomenclature ec 7.1.1.1: Proton-translocating NAD(P)(+) transhydrogenase.
pdb deposition date 2003-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 1nm5C00
4BVBA 2VBFA 3CLUD 1J8FA 3D4BA 4K9QA 1XLTC 1U2DC 1YTLA 1UPBA 2QQGA 5DGDA 1MCZA 1T9BA 2Q29A 2VBGA 2VK4A 1O96B 4V1CB 3GLTA 2PANA 2FR8C 3EA4A 2H2FA 1POWA 5BWNA 4F56A 3U31A 5BWOA 4BVGA 4ZZIA 2DJIA 2UZ1B 2EZUA 5EJ9A 3JR3A 4BV3A 5DGTA 3ZGOA 3D7KA 1M2GA 4JUBA 2OORC 1M2JA 4QQ8A 5IMSA 5AHKA 2PGOA 1D4OA 4ZP1A 1EFVA 1M2KA 1YI0A 5EJ8A 1U2GC 4K9LA 1U28C 3IAEA 3RIYA 4HD8A 1YI1A 4D5EA 2H4JA 3HWWA 4MZXA 5FYQA 3ZG6A 1YHZA 2EZTA 2A1UA 4JUCA 3FZNA 2Q28A 5EJMA 4KGDA 1YBHA 5K6RA 4BUZA 5EJ4A 1S5PA 2WVGA 5K3SA 2NYRA 4RMGA 1UPAA 4RJJA 1S7GA 4Y6QA 5MGNA 1PNOA 2JI8A 1HZZC 4L2IA 2IHVA 5EJAA 4TWIA 1U31A 4JT8A 4X3OA 4F4UA 4IAOA 2FRDC 2X7JA 4RJIA 1OVMA 1PYDA 3PDHA 4RMHA 4BVHA 4J1TC 4JUAA 1V5EA 4MPRA 2A1TR 3CLSD 4UUBA 2V3WA 4UTVA 1BFDA 2WVAA 4FEEA 3CF4G 4KPUA 4MPJA 1EFPA 2VK8A 2NXWA 4BN4A 4FEGA 4K9MA 2JI7A 5K6TA 2WVHA 4MQ5A 2IHTA 1E3TA 2OD9A 4D5GA 1MA3A 3FLMA 3D81A 4BN5A 5DEIA 5EJ6A 2Q5JA 1Q14A 3GLUA 4JU8A 4TWJA 1O97D 4K9PA 2Q27A 4FVTA 2HJHA 4L3OA 1UPCA 1ICIA 4GM1A 5K2OA 3FSJX 3RIGA 1JSCA 1PO7A 4IG9A 1T9AA 3GLSA 2Q5OA 2BRUC 1Q17A 1PNQA 3PKJA 4X3PA 2H2IA 3CLTD 4UU8A 2IHUA 4JD5A 3F6BX 1ZPDA 2VK1A 3GLRA 3U3DA 1OZHA 1T9DA 1Q6ZA 4Q9DA 4GM4A 2JLCA 1NM5C 4JUFA 2FWNA 1YHYA 1SZCA 3ZGVA 5MF6A 1PTJC 5EJ5A 1YNOA 4BVEA 4GP9A 4K9NA 1M2NA 2EZ8A 5MFZA 4V1CA 2PGNA 2H2DA 2OO5C 4UTRA 4QELA 4FZ3A 4O8ZA 2H59A 1QPBA 4R8MA 4HDAA 2EZ9A 2UZ1A 2JLAA 4JSRA 2H2GA 1POXA 4UTNA 5D7NA 4C78A 2Q5LA 4RMJA 2QQFA 2H4FA 1YC2A 3E9YA 4BVFA 1V5FA 1PI3A 2OD2A 1PT9A 5EJ7A 4UTXA 4BV2A 2OD7A 4COKA 4GPEA 1DJLA 1Q1AA 5MFPA 2AG1A 1Z8NA 1T9CA 4JUDX 3IAFA 1Y9DA 1SZDA 4J16C 4UU7A 4K9OA 2AG0A 4GG1A 4UTZA 4RMIA 5FEMA 4QPZA 2JIBA 4Y6LA 4JU9A 1N0HA 2H2HA 3PKIA 4RJKA 3HWX1 4KXQA 4K9KA 4V1CI 4GM0A 1V5GA 3OE1A 2VBIA 3CLRD 1M2HA 2JI6A 2Q5QA 4I5IA 4G1CA 3EY9A 3JWPA 3LQ1A 3F6EX 2FN3A 2JI9A 1PVDA 2EZ4A 2H4HA 3EYAA 4MPPA 4UUAA 1YC5A 4IF6A 2FSVC 2B4YA 5BWLA 4Y6OA 2W93A 3K35A 4JT9A 2C31A 2VJYA 1OZGA 1OZFA 4C7BA
chains in the Genus database with same CATH superfamily
3OSUA 1I1HA 3RS5A 4IX1A 5L3VA 2IBTA 1RBMA 1N2SA 2D5LA 3M6WA 1S2MA 1ULHA 1XCGB 1TOAA 2D0DA 5AKKA 3AVXA 1U5BB 2XQJA 2YIVX 2REOA 2ZRLA 4Q3AA 1E7MA 3DZCA 1E94E 1BU5A 4ID3A 1SXGA 1V8ZA 3SHFA 2Z2YA 1LBTA 1NQVA 1BHSA 4UXIA 3WGJA 4U00A 5I45A 2QLBA 4KMSA 3CINA 4GKBA 1XZKA 5AW5A 5AKHA 5DLYA 2TECE 3IPLA 2HUNA 2XUGA 5HK8A 3ANSA 5DGDA 2P65A 1ZMRA 4YTEA 3T34A 4BLUA 3AEUB 2RGEA 1N2XA 1YS6A 2DUUA 2K87A 2QTZA 3DULA 5KSYA 3RTAA 4BB0A 3HP1A 5CHYA 3CNHA 5FHRA 4Q7KA 2WG0A 4GYKA 3Q2IA 5HBGA 2FDCA 3PI6A 3R5XA 1AA9A 4KVGA 4AZ3B 2IITA 2HSGA 2AMFA 2QAIA 1MX1A 1G8JA 3HHEA 4ZAZA 2ONJA 1P1BA 4CLEA 4WTOA 3AL0C 2H2FA 4ML3A 4BVAA 3HZZA 4CL2A 1XVAA 3VJKA 4R6WA 2ONCA 5A0FA 1JHZA 2MINA 4DXAA 1WM1A 1ZM2A 4M1WA 2DQZA 2WAMA 3KB1A 1XQYA 4HXEB 1WMDA 3RC3A 4N18A 2P3SA 4AT1A 4MAMA 1R18A 1P6QA 1D2NA 3U09A 5F9HA 2M98A 3MTBA 3IODA 1F9AA 2C5LA 2FEXA 4JKYA 1JUDA 4NG5A 5IHPA 3B3JA 2J5BA 6REQB 1OU4A 2ZW9A 5TEVA 1GOTA 3UW1A 1O94A 1SXJA 1GADO 2JLXA 3T9CA 4RK6A 2GN6A 1WCIA 2D5AA 1MRNA 3IOEA 4IVQA 4A9AA 4KREA 4PNEA 1DGQA 2ZUBA 3KDAA 3SXJA 3E22A 1FDWA 3R3VA 4KAFA 3VOAA 4E31A 1NFRA 1VMKA 1BDIA 1FBTA 2GEFA 1FQOA 3ML1A 2ORYA 4EYGA 3T1VA 5EIEA 3OJCA 2Y0BA 5IDQA 1SK8A 4A36A 1L7MA 1XMPA 5DBGA 2AXNA 3SYLA 1R66A 2XGGA 4P35A 3BF7A 4QX6A 1XZFA 4X20A 3HKEB 3U9SA 4NE7A 3UKOA 1U28C 3RK4A 1OFTA 1UBOS 2HJVA 4H7KA 5BRNA 3AI7A 4MI3A 4CM4A 3IKTA 3LXRA 3L7LA 4GLFA 2XDYA 1LJUA 1XEAA 4G07A 4HPJB 1PZGA 1NW6A 1IEWA 2EWWA 1ABEA 3TNFA 4NV3A 1K8XB 1E0DA 1N2CE 2VI5A 2ID8A 2X1LA 3FOCA 3KJFA 3QNUA 4WLNA 4BO9A 3WNDA 4EGJA 4YRSA 3ADBA 1YQGA 4JJZA 5CGQB 4HLNA 3OFSA 5KNDD 3IAHA 1U7ZA 3NBQA 3CUUA 4IDEA 4U0JA 4PS1A 4MQEA 2OCKA 1CUZA 3IPYA 2QE7A 2Z98A 3MUEA 4HGNA 5CYOA 1H8EA 3V7NA 2J46A 3ZQ6A 4EARA 1ISIA 1Q83A 2A1UA 2E3JA 3DMTA 4UDOA 4OP1A 5DNUA 3NT5A 5AKLA 3FBWA 1T1SA 3P9SA 2GVNA 2Q3FA 4XZ3A 2AW3A 2W90A 3FTEA 3EASA 1YS9A 3DMYA 4HYTA 1ADGA 1JHYA 1XU4A 2NO1A 3G68A 4I55B 4PBTA 2AS0A 4E07A 3W7BA 2PR2A 2CNOA 3EQ8A 3OY2A 2G9UA 3BBPA 5EJ4A 2IXEA 3U81A 3C3EA 2G9QA 3RSQA 3VI4B 3IQIX 2HPVA 4TV8A 4ZT3A 4ZA2A 3HB7A 1NPTO 2VEOA 1E3EA 4INAA 2MCFA 5LIPA 3UFXA 4WK2B 4KQGA 3UC9A 1JKJA 4M7RA 2GZAA 4OL9A 4ZDWA 4D42A 2H00A 3ROMA 2IPAB 4N8DA 5L3ZA 5JEDA 4AJIA 2YOHA 3IB3A 1LLFA 3G02A 1O4VA 1T3TA 5IJ0B 1BXZA 4ZZ2A 2XUJA 2BGKA 5KQRA 2QR2A 1CUWA 3HLYA 1G291 1T8TA 1UOPA 1MOPA 3GFOA 1MQSA 3EH1A 5J9FA 4K88A 3UOAB 1OROA 4OU4A 2CV2A 3QVGB 2CLIB 4LSMA 4RLHA 4AECA 2G1KA 3SNKA 5K09A 4C7OA 1ZESA 1N3LA 3EUWA 4RA9A 1ZK1A 1KK3A 4YB8A 3SEQA 4CHGA 5K8VA 4PLWA 4PANA 3TRKA 4A03A 4XIGS 3RANA 1E79A 1JLLB 2ZLBA 1ORTA 2H65A 3GGCA 3MTDA 2I3ZA 4GICA 2QMZA 2B5OA 2GX6A 3TB6A 1WETA 4JVLA 4KQXA 3HGTA 1EFAA 4G0VA 2KWIA 4Q9JA 3U1VA 4KIJA 1MV5A 1NQ5A 4N03A 2JFGA 4WH0A 1W36B 4MR8A 1BFDA 1RJ9A 2PS0A 4OHPA 4S12A 1F4LA 2WVAA 3GDHA 4XSGA 2YH2A 3R3WA 3MPOA 3ZS9A 5HTOA 2J30A 2JK1A 1E3WB 2IY9A 3F5MA 4J0GA 1QUFA 3AFIA 3EYWA 4QYIA 1GDDA 4EKEA 4E33A 1Z37A 3EISA 3OIVA 1SVWA 3AINA 1Z5NA 4OMCA 1IWPB 5F1KA 3ZLTA 4KR2A 3BHIA 1YRWA 1I6LA 4GVPA 4R1TA 2F3PA 2R7LA 3HVKA 3R5JA 3VYUB 1YS7A 2Q6KA 3IEMA 3R9KA 1XJ0A 2P3OA 4H59A 5AHWA 4C3OB 3UXEA 4LQLA 1CR1A 1UMDB 4OX9B 3VPBA 4PYNA 1WSDA 3ZY3A 1Q21A 1N5MA 1BOFA 2OHVA 4ZEXA 4AUNA 2Y1LA 1P1FA 3G7NA 4ONEA 5DISB 3D4OA 1A9OA 2BEJA 2C58A 5IF3A 2D1SA 2WYOA 3U44A 3I9V1 4D5GA 1JFFB 1NR1A 1AUQA 2C3MA 2FVYA 3I92A 3LXUX 1TZBA 3USCS 3FLMA 3EE6A 3KTFA 4XSVA 4AIRA 5CA0B 3QNMA 3EEYA 3KZOA 3VYVA 2PE5A 3ORYA 1X7ZB 2BONA 2A5YB 1VE5A 4KMOA 3CLUC 4ZAFA 3UM9A 3WV5A 1RKBA 2B92A 3H11B 1L4BA 1SD2A 2W2LD 2VJAA 3HA7A 5JQGB 3PPIA 4ZN6A 2V6BA 3BJEA 3K9NA 4I81A 3UGJA 2WIGA 3LT4A 3KR2A 4P5DA 1DQYA 2A57A 1WVMA 1KS9A 2QY6A 4R84A 5HMLA 1VFPA 1D6NA 3LO8A 5DI9A 4ATNA 2V7PA 1BNCA 1KOGA 3C3DA 1AQNA 3WGLA 3SQDA 5T3UA 3PWZA 3DA8A 3JQAB 5T3YA 2JJ1A 1CY7A 3UAXA 2VHYA 4YJ3B 3VPXA 1T24A 2JLYA 2O2ZA 1QZXA 4HCJA 5A5DA 5E8JA 1ECCA 1IOVA 1K4YA 1TCCA 1W48A 3C8UA 1AKVA 3GD7A 3JQGB 3LBNA 1J49A 2G5GX 3PNPA 1CV2A 1U3CA 1KI6B 3AR5A 3MS4A 3TGWA 4EB6B 4F45A 5KJFA 1GQYA 4BLRA 1YJ8A 3GRUA 2CXRA 4GE0A 4K3VA 2GKSA 3WYNA 5L7TA 1JN0A 3BYZA 1ID1A 1X1DA 3GRRA 3I52A 4GKAA 4TKVB 1KMNA 2AUMA 3JQFC 3MWJA 2G88A 1YQ9A 2JASA 2Y1XA 3N2KA 2P9TA 3NHYA 4NCHA 1GILA 4A91A 3HM2A 2FN9A 1M72A 3PKJA 4PYOA 1W8IA 1GR0A 2OR3A 4BQFA 1VMDA 3FBTA 4I1UA 2PLWA 5E6UB 1BDHA 1ZD1A 2W8ZA 1N8NA 1SKYB 1X38A 1Z0DA 2FZVA 3BXPA 3W2TA 4ZZ3A 4X97A 5J4HA 3C15C 4D3YA 1T9ZA 4IDHA 5TR9A 4R9SA 5FFMA 3P2KA 1CJUC 2JH9A 5M29A 2XBMA 4R9NA 2KSQA 4QJ3A 5C8XA 4YJDA 1LLDA 3CX4A 3E53A 4QODA 5HKAA 4KBYA 1JWLA 1DJQA 1PG2A 2AFRA 1QXSA 1ZD8A 4X63A 3OTGA 3JD3A 4CM6A 1SCKA 5CEFA 1NNLA 1R0BA 1PQYA 1SCUA 2ZTSA 3FPLA 4PWZA 5TPZA 1U1DA 3I9KA 4XPIA 5FTJA 3M33A 2ZSJA 4IIJF 1WU7A 4KPYA 1M6NA 4HQNA 4R51A 2Z6AA 2YNMA 4OU5A 2VJOA 4QKQA 3OLYA 3LP5A 4OAPA 2O7SA 2IF2A 1PTJC 5EJ5A 2HAEA 4FEAA 2YZ2A 2Z30A 3ISJA 4DSZA 3BTOA 3MOSA 1RPAA 1U5AA 1ZJZA 5AI0A 2YJNA 3WNZA 5MFZA 5DF1A 3D7MA 3SD7A 1F20A 4KODA 5TS2A 1W1IA 3WIDA 2BH9A 4RY2A 5DOVA 5DYYA 3TBKA 2P4HX 5ALYA 3FCSB 3A26A 2XUQA 2W6JD 3DV2A 2PMWB 3T5TA 4W99A 3DQZA 3FR7A 5A9SB 3V1LA 3BMNB 4IIXA 4DXHA 2CT8A 2YVLA 3UBMA 3T95A 5CK4A 4BYGA 1IK4A 4YO8A 4ZYWA 1P6XA 4C14A 4MS1B 4TMXA 1Z39A 3V1TC 1WX1A 2RARA 2WV7A 3KUDA 4J7CA 4K8RB 4MITA 1ZN7A 4IDGA 4OUDB 3A1VA 5KNLA 2N3ZA 4Z8XA 4L2IB 4CQMD 3W8RA 3H3FA 5KQSA 3AUFA 4RHTA 1KRHA 3UHOA 2VAPA 4R2JA 4LGYA 2C5AA 3EMDA 4HFNA 5CDFA 1CUCA 2OB1A 1QH8A 4HNAA 4DBZA 2XA2A 5EJEA 2YV3A 1F8FA 2R65A 4JT2A 1Z7BA 2FEMA 1GYQA 3TR0A 3HUDA 1RACA 3WB9A 4E32A 1P1HA 3DLTA 1YVDA 5G0WA 3RVOA 3VX3A 5DTIA 2V03A 2X2FA 3H8SA 3N8HA 2RIRA 3C98A 4OYYA 4AF8A 2OOKA 1VA5A 1CTQA 1WZEA 1PI3A 3LL7A 5EYPB 3ONEA 3BH6A 3G9ZA 1PE0A 3ZV7A 2JG3A 3D54D 3JQ9A 2F8MA 5JSFA 5HW0A 3UW3A 1MJNA 1Y98A 4COKA 1BQEA 3LUHA 4QQRA 3O84A 5LD2B 1QR2A 1QRRA 4DLXA 4NCAA 3NFYA 2O07A 1PS9A 5KYGA 5L45A 4F11A 1JB9A 4YP7A 1Z8NA 4M87A 4EFMA 1N7GA 4KPUB 1B0AA 2ZYHA 1L2TA 1OKKA 2ZUTA 3GZNB 1JIXA 2GS9A 3Q0EA 3GLIE 4JUDX 2PO5A 4MP6A 1Y9DA 4R7TA 1TDJA 4TVKA 4RW0A 1KZGB 2GZDA 3IEIA 1AZLA 3SQNA 4LAFA 3N8IA 1PSZA 5CTJA 1Q57A 3COPA 5MHTA 1NV9A 2G1PA 1HA3A 4QFCA 1OSNA 3DPSA 1QO9A 4ENTA 1KP3A 3F0TA 4FFWA 4IRXA 1UMKA 3P2EA 2NUBA 4HXGA 3VR4D 2H51A 1J09A 3C8MA 4NZYA 3ZCRA 1JIKA 3KT0A 2ZRFA 4UQLA 3RT7A 2BCEA 5AUQA 1PJLA 2FXIA 1LPOA 2E4ZA 4DUPA 4OB8A 1SK9A 1I1NA 4RZSA 3NBZC 3OFNA 3PE4A 3X1DA 3WL6A 3HE3A 4YV7A 3R7LA 4E6EA 4X1IA 2BGGA 4HGQA 1COZA 1NY6A 3DVAA 3RT9A 3VH3A 3VR6A 4KLCA 3AU9A 2J67A 3B5IA 1OFIA 4PLTA 4CNQA 4NV0A 1B3RA 4BKPA 2LPMA 2SCUA 2G80A 3EDYA 2MOKA 3GJTA 2WTBA 5K9ZA 2OXCA 3PC3A 4BLVA 3ZZ0A 1SVIA 4UFPA 1Q1NA 1SUWA 3UJ6A 5B57C 1ZMOA 1ZUIA 3NHJA 3TZEA 3DT6A 3VPAA 2JI6A 5FV4A 5JYBA 1GNPA 2IXAA 3EVEA 3L7KA 5F76A 4TN5A 2J0EA 3LKDA 2BHSA 3FF1A 3OQOA 2Q6IA 3O8NA 1P77A 4IZIA 5ICGA 2C9YA 3FLEA 1M73E 4DUZB 3GUUA 3H2KA 5C8YB 2G6BA 4G1EB 1YASA 1PVDA 1DC3A 5DU2A 5KNCH 5E6RA 1IMJA 5FNZA 3TW4A 3ZGLA 5AP9A 2ZOSA 2NVUB 1F8UA 2XQKA 1FX1A 2RI1A 2WPNA 1KTIA 2ZK7A 2Y76A 5BW4A 4J0JA 5TVKA 4DMGA 3LW7A 5A5EA 3KQHA 2ZJ0A 1VDMA 2H1IA 4CKEB 4O0LA 4O59O 1W88B 1CULC 4TLBA 5K1ZA 4JB3A 1Y8RB 3RYCA 1L1FA 5KZMB 1M5TA 3LPLA 1O1YA 3FI0A 2VQSA 3R7DA 2XCIA 3ZWAA 4NMMA 4OLFA 3ZIAA 2CUTA 2JRCA 1IRXA 5EAIA 5EHIA 3JQQA 3ESBA 1N8SA 4KRFA 1XZJA 4RAOA 2WD9A 5EWMB 4DLVA 5C7OO 1ZR2A 2P6UA 2ZSIA 3EC2A 3JQCA 1NRJB 2R11A 4KIFA 4PR3A 4RD0A 1RJGA 2D62A 3RSCA 1LDBA 3LKVA 3EUFA 1HSOA 2QVCA 4FSXA 4Z3OA 4XM1A 1JYSA 3K1TA 4JODA 3N74A 2MR6A 3C7CB 3RC7A 1LLQA 4LRQA 4JL8A 4MVJA 3U3ZA 5HIIA 4PAQA 2AN1A 1QF7A 3DAFA 3DS8A 3M6UA 3WGKA 1BS1A 3IQZA 1R0KA 3BWCA 3UAOA 1DQPA 5THQA 4F4IA 1BN7A 2BWJA 3HVUA 3PV0A 4MUFA 5IVIA 4R2IA 3E7DA 3U9LA 3ULKA 3W5UA 3I5YA 3ORFA 2ONKA 5LQKA 2HMSA 3UHJA 1S01A 1T8YA 2B0CA 2C5GA 1SAYA 2DUMA 3INGA 3OOSA 4CEJA 1ZOSA 1EUDB 2WKRA 3G17A 3QOFA 1CT9A 2QMUA 1O0SA 3OOEA 2XNKA 4HS9A 2NTJA 1ZOIA 2XCUA 4NG4A 5EP4A 3BMCB 5F2NA 1IYZA 5KWSA 4Q4JA 4B3RB 3PYXA 1T25A 1BOOA 3N8KA 3PJFA 3QOXA 1KY5A 2QSZA 2CHFA 4E5PA 3DV0B 4C0SA 1KPHA 2IIVA 3COVA 3RLIA 4OIFA 1EA7A 3PPWA 5IARA 3O8LA 4YRTA 3PS9A 3SBOA 3ILYA 4CF5A 4EUNA 2JIOA 2PA3A 3ZHXA 5FT9A 2PT5A 2VPIA 1I4TD 4FNGA 4UXHA 4V0NA 2HCRA 5HF9A 5EZSA 3U31A 1JPVA 5U4XA 5BPHA 1LBIA 2F8LA 2CXTA 5BWOA 5JXIA 1A7AA 3LOPA 4NJEB 2CCGA 5E0OA 2XT9A 3U7GA 1YA4A 4BV3A 1PZXA 1THGA 4EF4A 2MYNA 3ZH9B 4EGQA 2CFRA 2IWRA 1TEXA 1NI5A 3K2QA 3PFBA 4RFLA 2J09A 1KI8A 4P58A 4QDUA 4YACA 4ZVKA 1LWNA 4FXOA 4JN6B 4WOKA 5T64A 3WK5A 3ODGA 5I4CA 1CVLA 4DRYA 1Z5GA 1VP3A 4G5GA 4X7MA 3ESAA 3WNVA 5KX5A 4UNQA 2ZAYA 2QTRA 3E1SA 4D92A 4EELA 5JAMA 1BH6A 2QLJA 1F2TB 1UC4B 5ILOA 2FOLA 4QFDA 3ENWA 4A8TA 5A6SA 1R2QA 2AVNA 4PZYA 3FA2A 1R5BA 1Z6QA 4JA0A 1DV2A 1FOEB 2IZ7A 1C14A 3C6BA 4ODIA 5EERA 4IZ6A 2OKGA 5DIZA 5EZ5A 2XODA 4A0FA 1SNYA 4ZARA 2P1RA 1L4YA 4B44A 1JQBA 2RCNA 1II9A 1E7RA 1ZDMA 1HDZA 2IUFA 3GP3A 3HCRA 1RMQA 1Q44A 2WUFA 4YP5A 4EKDA 2QYHA 3EVZA 1UFVA 2GPBA 2CHGA 4OLJA 1YE5A 5GWXA 3FFXA 1Q1QA 1O8BA 5HA5A 4OMUA 4DSNA 4CGZA 2GTHA 1W2HA 4UBKA 3WQRA 4IEIA 2O0LA 3HBNA 1R6AA 2Z9CA 1Q92A 4JGBA 5CURA 3ZXSA 4ZCIA 3ROKA 4EYSA 3ZGXA 1T5TA 3SZRA 3NZEA 2WAAA 3WADA 1YR1A 3LT5A 3DAOA 3U7EB 4IDCA 4FCCA 1UBEA 2V0CA 3ESCA 2QIOA 4WKBA 2Q6OA 4KRYA 5JRDS 2AR9A 1YE3A 3SAJA 1VLVA 4RA6A 4F3KA 2O8DA 1ML4A 2BHNA 3OEHD 3D0OA 3H5IA 3WWEA 3PE6A 1XB2A 4IUYA 4W4TA 4FGZA 4M37A 4N3AA 1N6RA 1TT5A 3JQ7A 4P3KA 1HYHA 1U8FO 1AGYA 5E6SB 1AMNA 4HWGA 4TYMA 4NYMR 3QHQA 2Y05A 4X60A 5B2EA 1RZRA 3AHGA 4Y9RA 1QTIA 2F3TA 3BAZA 3EZXA 5IEBA 1SUAA 2YZGA 4ZV4A 3SJBA 4ZAWA 5AM2A 4BO4A 5CX1B 2DFLA 3JWJA 3F4BA 5CTAA 1WZIA 2FQQA 2P62A 4FFVA 2VP2A 3LG2A 4RSMA 3N0WA 5ICMA 5JBQA 1PLLA 4B6GA 1SQGA 2ZRQA 4JLSA 3EHEA 2QRUA 3HCCA 1GNRA 1FQKA 4HX9A 3SZOA 4S2EA 4RYDA 4BRSA 2B94A 3CONA 2Z5LA 3L4SO 1E0SA 1DHTA 4PGAA 1QNLA 4RZHA 3H1BA 1NKSA 1T36B 3RYFB 3FUXA 5AKIA 2EYUA 2EP7A 4L5IA 1DADA 1QVWA 4QRHA 2I6UA 2YMMA 3CVUA 1QJ4A 4ZAXA 3VV2A 4EY7A 2BHLA 1VP9A 4IOJA 3SR3A 4EUHA 3ANXA 3A1CA 4JVNA 3CPHA 421PA 2WILA 1HH4A 3LX5A 3L07A 7ABPA 4AAYA 5COAA 3AR3A 3Q88A 4R9UC 4WK0B 3IP1A 3ER9A 3T3EA 5ADUS 1MAAA 1W25A 4XJXA 1FP2A 1T8SA 2X86A 4DXDA 5KS2A 1VJDA 2QUJA 3O2SB 1HOXA 5T4HA 5HJ5A 3UJ3X 2Z58A 4PLYA 5FKJA 1JTVA 3A6EA 5A71A 3E8SA 4MB0A 4MJ7A 1AX9A 1UPXA 5GV7A 1XWFA 2Y4NA 3EIXA 2WIBA 4UUBA 4XAQA 3B51X 4U8GA 3OM9A 2V3WA 2YCBA 2RHBA 1CHDA 3SJAA 3TG8A 2H7YA 1MC5A 4FEEA 4IFEA 3P9XA 3L8FA 1D8TA 3WBBA 3OOYA 4OI2A 2W2PA 2R1VB 3I28A 3EBPA 4L73A 4LOIA 2NTYC 2QSUA 4JB0A 2BZ1A 3CJTA 4M8NE 5CT6A 1WXWA 4BBJA 2XSZA 3DLCA 2CYCA 3PGJA 5C4IA 3RRJA 4EJSB 4LZAA 2VOJA 4CM8A 5DN6D 3TM4A 4KX5A 1RQLA 2VCHA 2FPRA 1YA8A 5DI3B 4IG4A 4DMCA 2OP0A 3WRYA 4B3MB 1T5BA 1XNJA 5LN1A 4XIFA 2C7GA 1TQ2A 2JCVA 2UVPB 2GNPA 3TTXA 4CLDA 4JR2A 1UM9A 4L9SA 1O5TA 2YYAA 3VHRA 1WMFA 4YUXA 3HLKA 3VHXA 1E3TA 4NLLA 1PQWA 2ZBGA 3MRVA 2IU6A 2YYSA 3H5LA 1S2LA 3D6MA 4MEAA 3SDSA 1USWA 3EN0A 3F78A 4QPDA 4HVLA 5HWSA 1TKBA 3DFKA 1QSGA 3DM9B 3B1KA 1YDWA 1T10A 4L95C 3C5WP 4K9SA 4CU5A 2FU5C 2WU4A 1ZD9A 4XE5A 4OK3A 4KO4S 1M8JA 1MMFB 4N5HX 1MQ8B 2QR5A 4JIGA 1F0PA 1PL7A 4MWZA 2ASVA 2DUJA 1BWRA 5JCPA 2EARA 4NHEA 3NHFA 2YWCA 1I7SB 2AQ8A 5B37A 2YICA 1TQHA 2BFAA 2O1SA 1PD0A 1SA0B 2OO3A 3EF3A 3ETGA 1V6AA 4X1KA 1UKEA 3LSYA 4Q00A 3BJRA 3I2YX 1OYYA 5F21A 4ZVMA 5JSYA 4ALLA 3IT0A 4JC5A 3ZDQA 3Q0IA 4JJEA 1G60A 4BBZA 4TQ9A 2ERYA 1UBGA 1O95C 5BRAA 1L8XA 4Y6SA 1ZVMA 4C6TB 1XNQB 1VLJA 2IHJA 2YW2A 4IKPA 1FP7A 3D4PA 1WNFA 1QIGA 3L7AA 4QYMA 5B3JA 1VIAA 4YNBA 2MSNA 2IYYA 2B98A 2QLFA 1Q20A 4JLAA 4TL7A 4WESA 3UMRA 3NXKA 1ZUD1 1WL8A 2GCPA 1F48A 2J8ZA 2QN2A 3QX7A 5DXFA 2OMEA 3NYQA 4BCBA 2XB8A 2HX1A 3LVQE 4BVKA 3NGLA 7ADHA 1PDOA 3QMVA 3SI7A 2IHNA 3M4XA 1EVYA 2ZQ5A 4PZLA 1EX9A 2FPPB 1OIXA 4WV3A 1RCTE 2BPOA 1EQAA 4NJOA 1ZOOA 5H68A 1TQDA 1Z6GA 3V2GA 2GFIA 2GJSA 5A4AA 2DQYA 3VTAA 2O8CA 2HB6A 2IUSA 4WCFA 3R7WB 3EZ9A 3HCAA 4YMUA 2EVWX 2I6SA 2H2IA 3AH8A 2BDEA 3C6KA 3HJRA 3OM8A 1BE8A 1MW9X 1E89A 1UP7A 4IHQA 2BFBA 5ALLA 4W9MC 2O2SA 4CKBB 3JYOA 4BPBA 3LDAA 1WXGA 1G59A 1Q7TA 3GLRA 3U3DA 3PX2A 4V2IA 4OA5A 4B6JA 2JL1A 1YVUA 3S2FA 4C0QC 5CFQA 2GPNA 3G9UA 1XRPA 4ZCTA 1IU9A 1P29A 3H84A 2MWMA 2KI5A 3M6FA 4EQ6B 3W34A 2PWPA 3GJ8A 2FQ1A 4CM5A 4ZEVA 4DM7A 3U1BA 2X23A 1N6HA 4CU2A 4WX2B 4X0EA 3MS2A 1L5VA 4M0EA 3I34X 1RYEA 2OC9A 4XDGA 3WKAA 4DCNA 5MF6A 4AO7A 1HSZA 1MPXA 2O0HA 3FFAA 1LXCA 5SZJA 3W8FA 1QYWA 2X7XA 3F6RA 4I1IA 4TLLB 3ROGA 3TCXB 4CF7A 5LFAA 1WZUA 4X41A 4AG5A 1C9YA 2QTBA 5CH5A 1DNPA 3JD1A 4IDFA 2WJZB 1T0HB 1M2FA 3OX1A 2PS3A 3BFPA 4FR2A 4LCJA 1TA9A 3SLKA 4EW1A 3OQBA 3E9QA 4UUQA 4BZZA 2PXXA 2BMVA 1WWKA 3ZWPA 2O7RA 2R8ZA 2R1VA 2B2NA 1LBQA 3OEYA 4JL6A 1MH9A 1ADFA 1QFJA 1ZINA 2WE7A 2YYYA 3CW8X 3LUKA 3M6LA 4S1OA 5E9WA 4KFTA 2F64A 5TRTA 3IMCA 4JK3A 1IQPA 2VT7A 2JCGA 3TH5A 4QELA 4BCCA 1QFMA 5KTKA 4FZ3A 1H8HA 3FWYA 4JQYA 4X71A 4Q4HA 3ZBPA 4LHVA 5LXTA 4WADA 4QG7A 1OC2A 2ZRHA 1P4AA 3HV2A 3IVGA 3E3LA 3KKZA 2OFFA 2UVPA 3TE6A 4EVSA 2IU4A 3P0EA 5KYWB 4G0XA 5M3BA 4AROA 4I8IA 5L3RA 1C30A 4U2BA 1BGWA 5BMVF 5EE3A 4D44A 5JJKA 5B12A 3CEPB 2HRQA 3LYLA 1JFTA 2UXCB 4OQMA 5DM2A 5CNKA 4QQNA 2B8EA 1KU6A 1CUVA 2LDXA 2R66A 3A6DA 3B3GA 1OTHA 5C7LO 1QZ3A 2YHSA 2H5LA 7GPBA 1Z36A 1UKZA 3IQDB 4FMDF 3ETNA 3G79A 3MQFA 4P6VF 3WL8A 4BNVA 2G77B 3C1OA 2OZLA 1WXFA 4ZVUA 2X3FA 3LHDA 3IMGA 4CDGA 4C22A 5JWOA 4RSHA 3B3QA 5JDCC 5E9QA 1R1DA 3LPDA 3RD5A 1NXWA 4YPOA 3ADPA 5LUAA 3I09A 5AK6A 2IYXA 1V7ZA 3DJFA 1GXSB 3A4VA 2XUIA 1J8DA 3ANNA 1ECBA 2JLQA 1M9NA 2K5UA 1H05A 4TV9F 3C48A 1PT7A 1PSDA 4U9IS 3EVAA 5AKYA 1N1GA 3RS4A 1O9BA 1T4BA 3LCJA 2B5VA 3DCYA 2JFOA 2CLSA 3FKSA 3UWSA 4B3BA 1L7QA 4U0KA 1Q0LA 1REQA 2I4TA 2JIPA 2B8JA 1GQFA 3C7TA 3GJYA 3USES 3KT8A 1I4DD 2CVFA 2VNJA 3UCEA 4JMLA 5C1BA 2EX0A 5JCXA 4BFCA 3EDCA 3P2MA 1P2DA 3AVWA 1SIOA 3HNRA 1NR7A 4CVNA 3ZVNA 4EKNB 1RQGA 5IDWA 1U80A 3ISVA 2NUAB 4E4YA 2DKNA 3WGOA 4YUWA 5F3RA 1YB5A 2EDAA 4WOCA 1P19A 1ZI6A 4L1KA 1RLUA 3SVZA 4GO1A 4HEQA 4Y6LA 5DRTA 4LS3A 4RPJA 5U1PA 1K4KA 2OCLA 5JY6A 1GARA 1C0KA 1FNSA 3LX8A 2GRUA 3ICPA 1Z38A 3LRXA 5K3BA 2D5IA 5EKSA 1UPFA 2FWJA 3H17A 2H1FA 1I5EA 4FDMA 4ARIA 1TFRA 4ARSA 2MSDB 4IHAA 1XZCA 4O4HF 5DV9A 4D79A 1IK6A 3D3QA 1U7UA 1KYXA 1W1WA 2PLRA 3HY6A 5GZ6A 3FSGD 5FWYA 2UZIR 1XZIA 3TLGA 3LQ4A 2Q4BA 4DR5B 2YMLA 4N48A 1S4QA 3QE3A 2W6PA 3T7AA 4CTOA 1RBYA 4M21A 3FKQA 5CVUA 3SE0A 1KDVA 2PY6A 2GJKA 3VPFA 3B70A 4P4UA 5BWCA 1RC8A 1L5FA 2W7TA 1V71A 3UT5A 1L7BA 2VWHA 1R7RA 4M0MA 2C7BA 4CTKA 3GPCA 4C3UA 1GU1A 4Q3OA 3R8CA 3BMOB 2E87A 3V1NA 3AETA 1OLSA 3V55A 2Y3IA 1VDZA 1TMYA 2XMQA 3RC8A 4PHGA 4L8VA 4F6LA 2HU2A 3DAHA 3R6DA 3QXHA 2DZDA 2HA4A 5FR1A 4IGKA 4CIXA 1X3SA 1R4NA 1T1JA 2FFBA 2JNWA 3SBEA 2X5OA 4DG5A 1ESCA 3WGZA 1USKA 1KY3A 5ALTA 2I65A 2B69A 3G13A 4GGOA 1CF4A 1THTA 3FBGA 2GPWA 2HSDA 1ZIPA 3HADA 2W93A 3ND6A 3PLNA 2IZ5A 5CP8A 5AKEA 1DKPA 3USZA 2EQAA 1Z6ZA 3RTEA 2FW6A 5JADA 2IYTA 3N2EA 4JL5A 4J43A 4JB2A 1QQ6A 1JNXX 1KVSA 2P6OA 5ED0A 4BYMA 3HXOA 3BGVA 3AZOA 1SB8A 1K06A 4LF4B 3MTQA 3ZXIA 4KLNA 4KQ9A 4OIMA 3RUCA 2X2PA 5ALEA 1TJNA 3E3AA 1L8OA 3FYTA 3LQ2A 4EDHA 5KB3A 4OYHA 2F1RA 1D4AA 3IE0A 4R16A 1XZAA 5COQA 1J1ZA 4LDQA 5J2UB 2GXSA 2EJWA 3V8VA 3JVVA 1S2NA 4MS3A 5KPDA 2LUOA 4K9QA 5J43A 3RFXA 4LFBB 2BP7B 2BC9A 3FPAA 3H2SA 3NYIA 4M60A 5B1DA 2HEIA 5B3KA 1A5TA 1OHHA 3C3AA 5A06A 2HA7A 3QF4B 4RYLA 5K0GA 1NN5A 1X0VA 2FSIA 2RIPA 4US1R 1GRNA 4KO1S 1KJNA 3H4VA 2AMJA 5ILGA 3ZDCA 1CXZA 1NBMD 4DQUA 3EZ2A 3M1IA 2BLNA 5JPIA 2R84A 5EXTA 2EIXA 1XAGA 3MN1A 4R1SA 1U8TA 5JE8A 1RP7A 4AKEA 3H5OA 1AN9A 4YECA 3ZLBA 5KNBH 1O0BA 2F62A 3G1WA 4Q34A 1M2EA 2FEWB 4IS2A 4O2AA 4RGYA 3MLEA 5ARCA 3RHSA 1G6HA 2M6RA 4GX5A 1NSFA 2XD9A 2Q62A 3GG2A 3O74A 4HH4A 5A5GA 2QPAA 1ZHFA 4YXWA 3TW8B 4C04A 2W8BA 4KUEA 4RBNA 3KHKA 3AR4A 4I0WB 4O1IA 1B15A 5DCUA 3RJZA 3S68A 1DC8A 3GJQA 4BFWA 4X1YB 2DPHA 4FYKA 2OM2A 4UVHA 2PFGA 4CDRA 4IIBA 1U9IA 3DOCA 1KY2A 3BL8A 2HN9A 4ZVPA 1CETA 1Q5PA 4P9NA 4CI0B 4FCVA 3DYBA 5JASA 3IT3A 3GRCA 3QVJA 3C3BA 1M6EX 1SCJA 2PAAA 2GESA 3HR7A 1GKUB 1A0OA 3G5MA 4OHKA 2A1TS 4P3OA 1VPDA 4ARZB 3AHFA 4IIVA 1DBIA 2CVHA 1LB1B 3SJ7A 1T4DA 4KBFA 3R3XA 5DW3A 4ZCMA 2IUUA 1YQTA 4GEGA 3ROPA 1Z6AA 2DU8A 5C32A 1O6FA 1B8PA 1UP4A 2W00A 4MI9A 4URYR 5F64A 4EECA 2RB5A 2JLSA 3SEZA 1C3LA 5JISA 2RD2A 1M2OA 4QT0A 4F6RB 4YK7A 4RF5A 1WY7A 1EQ2A 2YOGA 5CFOA 1CZHA 3I72A 1QFYA 1Q3KA 5DBOA 1G8GA 1A4RA 1WB4A 4JITA 3KLNA 1EG2A 1MGPA 3OKFA 4DIDA 1EX1A 4GQIA 1S8AA 2X3UA 1M2KA 2H48A 4N3BA 4RTNA 5BSUA 4PZPA 5HDQA 2Z3VA 4Z7JA 4MRVA 2BTOA 2J48A 4X54A 4BEBA 2Z04A 2MSLA 3MPUA 5I9TA 2VNIA 2FKNA 4J29A 4MUBA 1EDOA 1XBTA 2OLKA 1YR7A 4LXIA 4X8LA 1V8DA 4H3SA 4KRXA 2GFHA 1OLXB 1L9KA 1U0OC 3AEKA 3U3RA 3V4VB 3BIFA 3VJMA 4BU1A 1IN6A 3PNKA 3OESA 1UZAA 3K9QO 1UOQA 1NVWQ 1UEIA 3DCIA 4J75A 3BWVA 2R8YA 3MILA 4ZU3A 4HNUA 4MRNA 3RWOA 2OXFA 3OUTA 5TF0A 1MA0A 3D0RA 3FCXA 1NZJA 3PICA 3QF7A 1ZOLA 4MV1A 3SDZA 1FFSA 5FFFA 3VC1A 5IRCD 4CEIA 1A5AB 5DX0A 1RHQA 2FUEA 3WGYA 2NG1A 4EHLA 2YN4A 1A9RA 2ZJ4A 3B5EA 4CFZA 3MWYW 2WWTA 3PEEA 4IJWA 4RKWA 3ZG6A 1C4KA 1QX3A 1CQJA 2AYZA 2WWGA 2ZUSA 3PYLA 3W2HA 1Y1QA 4ZZ1A 4YRMA 1W2WB 4JI6B 5LQRA 2XTNA 3A7DA 3CPSA 1T2EA 4KL8S 3UMVA 1EI9A 4TS9A 3PWKA 4MXDA 4B5KA 1F6WA 3H0CA 2B2CA 5JCOA 3W3AA 2GYUA 4BIIA 4C0AC 1ZGAA 4ZYZA 1QO7A 8OHMA 1GCGA 2VSFA 3ZDDA 2H6EA 3AB3A 1S5PA 4RXUA 5LQCA 3WGUA 2FJ0A 3WLQA 2OB2A 1LVHA 4O0MA 5K3SA 4B33A 1X8KA 4KWIA 4KSCA 2BKEA 5A7GA 5EIOA 2ZR0A 3MG9A 4AG6A 1LTHR 2X9LA 3O0DA 1PDVA 1Y89A 1H6DA 1W4ZA 2QD2A 2QTFA 1G21A 3CEHA 3FXAA 2ZB4A 4NU8X 5NLLA 1I51A 5TF4A 4NC9A 3VSEA 3PPYA 3PUXA 3GY0A 3NBMA 1CY6A 3SKYA 2O2GA 3DTYA 2OCIA 2DE0X 3ZV3A 3F6SA 4JBWA 3KVRA 1TZKA 2ZDQA 4EB8A 3S81A 5FO0A 2XITA 1OWPA 1PR3A 2OHOA 4XGKA 1TB4A 4B71A 2NOAA 3HB0A 2I8LA 1V37A 1GTSA 1N0UA 4JC0A 4DCJA 3JAKA 4W1RA 3WFZA 5EIBC 5B6PA 4DS3A 4ECEA 3LO5A 1U0HC 4L4RA 4L5CA 1FP4A 2ATIA 4Z9AA 5I8PA 2D0OB 2FFAA 1O6GA 3NAQA 2O3JA 2GK3A 3AWDA 4DEXA 4EPVA 5JV5A 4RANA 1CY0A 1EB9A 2C5HA 2QAGA 4G01B 5HIKA 2GPJA 1RXYA 1UXGA 3TKLA 3II6X 2FE4A 1P1RA 2C4HA 4TS3A 3AFNA 2JAOA 5H9WA 2D06A 1ZUNA 1FFAA 4HAVA 1RYFA 4EMUA 3G2MA 3QELA 1FSZA 2VQEB 1P8JA 3THXB 4FZVA 3ZD8A 1LC3A 2BFPA 2OZKA 3FVTA 1QU3A 4P80A 1ICEA 2O54A 1KEUA 4JLOA 4WQMA 3ZNPA 2P5SA 4ZOBA 3GEMA 3FNEA 3KU1A 5K5EA 2TMDA 3VYRB 3LQQA 2O3SA 5J4KA 1N5RA 1TUGA 2Y8EA 2J0UA 5ES4B 1CUXA 3TIGA 2PZMA 3AF5A 3TXXA 2O05A 3O47A 4FQ8A 4AZWA 1MP0A 2P11A 2W6OA 1X19A 3KWFA 4YJHA 3A3OA 1KEEB 3OICA 3Q98A 4CUZA 3K92A 2VTBA 5FNVA 2XZDA 4GWGA 2F7SA 5CLHA 5JNRA 3BC1A 3CLVA 4XWAA 4PO8A 4FFMA 1CPYA 4YVFA 4XB2A 4XB6B 2P91A 1MFPA 3A3NA 1H2FA 3MINA 1UF9A 3QLVA 3GJSA 4RS4A 1T3SA 4D0GA 1M0TA 1R4MA 4Q1DA 1WSAA 1DIRA 3BA6A 1TTQB 2GHTA 3FWZA 1CEYA 1QTNA 4BNWA 1X80A 3RROA 3L49A 1G6OA 3KUKA 5JXWA 5LOVB 5KDDA 4LHYA 1F2UB 1LPNA 4MA0A 2OBYA 4NZMA 3WOHA 2YX1A 1OR8A 1DX6A 4KACA 1GTG1 1A71A 1DUSA 4RC9A 5TMEA 5B4UA 3W4KA 5JJIA 3THWA 3ZOKA 3K94A 5C1DA 2O8FA 1G2OA 2BN4A 4M86A 5KVCA 4I55F 1XXHB 5KNDA 1J9GA 5FJJA 3AUSA 3Q11A 3ERCA 4KE6A 3URMA 3EB9A 1H5QA 4C30A 2CNBA 3CLSC 2EGHA 4TKLA 2PKRA 1WA5A 4UUPA 3P9QA 5FWDA 1II8A 3EA5A 3ZHQA 1X7XB 1Z0IA 3HO6A 1I24A 2A0YA 2OEPA 2BKXA 2EKQA 3PJGA 5FL7D 4OQXA 1UPCA 3HA3A 1ICIA 5CM2Z 4FGWA 3W5JA 5CLLA 5G2OA 1CS0B 1XELA 4NJMB 5LMNB 4A0SA 3ZE8A 1XVLA 3REQB 1OIVA 1USVA 3WTCA 1RWKA 5LNK1 3EUEA 4DLKA 2XTJA 3PEUA 2YS7A 1K5DA 2I9PA 3G2IA 4WKNA 4KMRA 2JEOA 1JSCA 4RV4A 3HKDB 4GP6A 2C7VA 2YHIA 1TCUA 4ERNA 1IG3A 2QRPA 2ACVA 4PZCA 5JAHA 1ULBA 5JNLA 3IP9A 5HILA 5I7AA 1Y7HA 2C83A 2IU0A 1GTRA 2AJBA 3BWEA 1N5JA 5IYZA 4MYCA 4AQ7A 2FHPA 2CBGA 3O8OB 4FONA 4R5MA 4XJTA 4CFSA 4MQLA 2UXBB 2GEJA 1Z18A 4DC1A 1JBQA 4OGFA 5EG5A 2FOIA 4O3FA 4BGVA 1P81A 4F5DA 4KO2S 1ZPDA 1C3OA 3E84A 3DB2A 4N9QA 5EHGA 4BFTA 1GL6A 4WKOA 3JVUA 4D9CA 4Q9DA 1QKKA 4WD3A 5EJ2A 2JLCA 4GKVA 1JV2B 1GAJA 3G9QA 2VDLB 2JFUA 3T7IA 3LCCA 5FBZA 3VM6A 4YP6A 2VNHA 4RQUA 3SIPA 5BNTA 2CW5A 3KXKA 1G1MA 1VI6A 1A8QA 3AXTA 3JYHA 2G17A 4W8GA 2IQIA 3QM1A 4RIHA 2P1DA 2R8EA 1YB1A 3AP1A 4NZOA 1GVNB 1OXTA 4LOLA 5KCZA 3H6GA 2O5CA 1U3UA 2ZUDA 1Y3BE 4H9GA 1GY8A 4YRJA 1SUBA 3PHLA 3WLMA 4JQZA 2VDRB 4MYHA 3K15A 1IL0A 3DG9A 4LCEA 2R4UA 2V6MA 4DA8A 1RAFA 1AQLA 2VKTA 4LZWA 3RH0A 4ZI3A 1AK9A 3QU2A 2R5FA 2AOUA 2V6JA 4MQUA 4UHDA 3JYNA 1P31A 4GC5A 4JI4B 3AT1A 4O2BA 4GDMA 3K70B 5CA0F 5EIHA 2G1AA 4LRYA 4GI2A 4WLOA 1E2QA 3HKCB 3NGMA 2O2YA 2YZ7A 5FOSA 1NF8A 4YQZA 4TXLA 5JQGF 3HU5A 3VU9B 1XCJA 16PKA 4PRKA 3FM9A 3G2HA 3MUNA 1M8FA 5FWNA 2DQKA 1PW7A 4JSRA 4NEGA 2BH2A 4LSZA 1GG8A 2GHRA 4YBRA 1FUIA 2B82A 4NQRA 3MWEB 3WLLA 2BI8A 4GNRA 2Q3JA 3WYGA 2PFSA 5I7HA 2WI8A 3MVEA 2ZTHA 2JCBA 4MUMA 1CZLA 1TK2A 5EWJA 3SIWA 2WHPB 4JEHA 3PQ5A 2W2LA 5EQTA 2HV9A 2B78A 1D0SA 3VKVA 4RMJA 2ZCJA 4DR7B 3WE7A 4AX4A 2WM3A 1C9KA 4Z0HO 3PNVA 2AZTA 2P78A 1Z2CA 3JQBC 5D6NA 1IZYA 3FPJA 1KAMA 4D4MA 5E7JA 5LZ4A 2B1GA 1V48A 3F67A 3K8YA 1HM5A 3MJCA 3WKBA 5JW6A 4BV2A 1B0ZA 1F2DA 1R0LA 3A4YA 5CVEA 1GNSA 5D7BA 1P1JA 2FSHA 1NLFA 4HWSA 1NVVR 4HUTA 1U0FA 4R40A 4IV5A 3G85A 3RUDA 1Q1AA 1NXVA 3DBIA 5IAKA 4MVWA 4FPXA 3S3TA 4NZPA 2PVSA 3RHZA 3GGJA 2JGIA 1IM8A 1EFPB 2Q45A 1XQ9A 2WJIA 3JYLA 1X70A 3C74A 4ND2A 4WLFA 4X24A 2XA9A 5GMOA 4JI7B 1N4AA 3AJ9A 4ND5A 2YTZA 1UMBA 1Y1PA 5I47A 2HTEA 3C7DB 3D8RA 4TUYA 4L7VA 2OL4A 5E95A 1A9TA 1BRTA 3VPGA 1G8MA 2CWWA 4GG1A 2AZMA 4AKTA 3ZLUA 5BUCA 2YYZA 2NUPB 2A0UA 3PX7A 2J3JA 4XSHA 3EGVA 1A9XA 3L7JA 1C0EA 4ENUA 4M22A 2DGDA 2H0QA 3EDMA 2P9FA 1P2GA 2QKYA 1LSOA 1W0JD 1GAQA 5LLSA 4YT4A 3LRTA 1FUYB 3C85A 3DKIA 1ZWLA 5DHAA 5PGMA 3EGIA 4WA8A 4AF7A 5GOZA 2I4LA 5I51A 2YWRA 2ORVA 1OAOC 2F9MA 2XUHA 3N2GB 5IFKA 2FOXA 1XGKA 3RRBA 5K0JA 3BTUA 1K86A 1GL7A 1R9NA 3GBPA 1NE7A 1V43A 3IJPA 2OBBA 3Q6NA 1JQJC 2FJUA 5CPFA 4Z0NA 3FYUB 1NXTA 2HOQA 3A4IA 4KXQA 4Q3NA 2DEUA 2QG9A 4Q9LA 4K9KA 1Y34E 1TF7A 1DKQA 6Q21A 1W52X 2Y67A 3NIDB 1KGSA 2ZIAA 5DGXA 3FCOA 4AXBA 1HDIA 3NKVA 1NQOA 3O4HA 4B81A 4F2DA 2HCBA 4KX3A 5KNBD 2QMOA 2WFAA 2IDMA 2AWNA 3ZBTA 1P5HA 1ZGHA 4ZO4A 4B8ZA 5AVVA 1YA6A 1M2HA 4LTMA 4QNMA 3TTVA 2W0MA 1XLVA 1Z2OX 3TTSA 1AE1A 3D6FA 1Y8ZA 4ZI7B 5EE5B 2WF7A 4OP3A 5CVCA 4FFBB 3OLCX 4QICA 3TW0A 1DLJA 4EA6A 1EFKA 1W75A 4BGUA 1DKOA 2GM3A 1RFLA 4QWMA 2G72A 5U4QA 3QENA 5AI5A 2WIFA 1V16B 2EFJA 2ISCA 1TAQA 2WINI 3KM0A 4LG1A 3V9AA 3A10A 4Q1CA 1QLJA 1RWWA 5ELLA 1JFLA 2J32A 3NG1A 5IC4A 2PCLA 4L0CA 2DTDA 3NTLA 4TYYA 4QBKA 4DLNA 3D2BA 3OJEA 3GD5A 3NBUA 1HDRA 1R6DA 4NFYA 3ZPXA 1C81A 2AT1A 4OHOA 4Y6OA 3N9IA 3FJ1A 2J0SA 1UANA 3FMVA 4W5HA 5LZ8A 4CR6A 1MC1A 1LPAB 2H3EA 2PT7A 3EG9A 3EVGA 3HUUA 4JKOA 5A02A 5D6OA 4Z9FA 2HGZA 5L4SA 4DM4A 4UZEA 4Q7JB 4OI1A 3RG8A 2JA2A 2VPZA 2XZOA 1P0CA 3DD1A 1LI5A 3F5FA 3STUA 1MDBA 1JNYA 1Y8QB 3W5DA 4FS8A 3LT1A 4KPEC 2IYAA 4BFZA 3MA0A 2H1SA 2VJYA 4CQMA 4KQJA 4A8JB 1HKUA 3UICA 3R5FA 2IIBA 4ZVVA 3D4NA 2VZ9A 1SQ5A 5A5VA 4MR9A 1A1VA 4OQDA 2QX7A 1QHHA 1OH5A 3E9ZA 4Z4QA 4BVBA 2ZREA 3GV0A 3QXXA 4BWFB 1NKTA 1O4WA 5BSHA 1FDRA 3EGWA 2JCYA 1NQUA 1I33A 4E7OA 2HQSA 2FW8A 2NZUG 1J8FA 1XIVA 3P32A 4Q9IA 1RIFA 1P80A 3K6RA 5BT9A 5JYEA 4Z4IA 1D2GA 1EE2A 3A1UA 3RS3A 3ZWBA 5KO2A 2LKCA 4CKEA 3AV0B 1FMJA 4JENA 4D3SA 3AY7A 3RJ9A 4MYTA 4US0R 1EM8A 4B76A 3TM5A 3IIIA 4TLCA 3TLXA 4IMPA 1HE2A 2FPMA 4BX0A 2QQGA 4F7DA 5DTJA 1QRAA 4DMUB 1IBCA 1TQ8A 2NXCA 4LSGA 3R6GA 3W2GA 2VHTA 4BY9E 4LVNA 4XCQA 1G5FA 1MHPA 2EDCA 1AT1A 4HAZA 5DHRA 3SQLA 2GBFA 4E0BA 1TE2A 2QBYB 3OE7D 5AVRA 4HO1X 1AKRA 3PCRB 2XQGA 5ISMA 4BGEA 2WF5A 4IWYA 3EXG2 1BCSB 1FNCA 3JRXA 1W5EA 4DKXA 3P2JA 1L7EA 5BSFA 2G8LA 1GA4A 2W37A 1XLUA 3MJDA 1MKYA 1HGXA 3CX7A 4BP3A 1RC1A 5JBIA 1BROA 1IBSA 1NUQA 2HBRA 3AJ8A 3PQ6A 4JEIA 3VR4A 4NDNE 3HKBB 1DMRA 3DXXA 4YAUA 4D9JA 1E9AA 3PGLA 2BF4A 3QLJA 1IPFA 2E1RA 2VXCA 4DDUA 3JR3A 1OIWA 3RYTC 3W1VA 3CIFA 3H8VA 1AA6A 3ZWVA 4BZPA 5KSOA 3GLGE 4A2QA 2QGFA 2QUKA 2OA0A 3DUWA 2W4QA 2PZEA 2LP4Y 2WSIA 3GLVA 1BDJA 2AE2A 1TECE 3ZZ1A 5AHRA 5F4ZA 1N2ZA 2B34A 2OORC 1M0EA 4R68A 3I3SR 4DMFA 3ZJ5A 1UFOA 3AIOA 1T5DX 2HPZA 4M54A 4BMOB 3L0CA 3WGVA 5C8YF 1JHAA 4YUYA 1UK9A 3PUVA 1CC1S 1XFAA 3F9RA 3R6WA 2DPLA 4B80A 3JR7A 1ONOA 3BZUA 2NO7A 3DAGA 4IJUA 4PG4A 2IIQA 4RVGA 3QX9A 3WB0A 3A6FA 3MBKA 4NBLA 1OW3B 2BW0A 5HF6A 1IULA 4NRDA 1AZWA 3JWEA 4OJYA 2C0PA 3ZW8A 1FA9A 3SXUA 2JIDA 5IJWA 2GO1A 3PC7A 3DWGA 1Q7EA 1Y4UA 1NOJA 2RHRA 1T0IA 4JLDA 1IZZA 5E3IA 5TJ9A 3RIYA 5JJBA 5ALQA 2ZDGA 2R3SA 3PUYA 4KQFA 4MUXA 3FJOA 5E2IA 1ZK0A 2ODEA 5I9LA 2GJAA 1G2PA 3G82C 1XDGA 3HU2A 3IDSA 3E1GA 4M7PA 4RV9A 1NA5A 5CIQA 2V7BA 4ARBA 1LTQA 5K45A 3QKTA 1NYTA 5GP1A 3LX4A 2FGJA 2P8JA 4QEKA 3B82A 3QYJA 2C94A 4CMHA 1HC7A 5KREA 5SY9A 2XVZA 4H2DA 4AVYA 5H0IA 3O8DA 1S3FA 3EBOA 3U7JA 5FBWB 1Y1KE 1DHRA 5FYQA 1EP2B 3JWHA 2AGVA 2IH2A 2QPTA 1EKXA 3GGDA 3QITA 4I50A 4KWEA 4M1KA 5BVHA 4ZVSA 4W82A 1YACA 4MV3A 5JS8A 2O5VA 4I19A 3VBCA 5M5BA 2IS2A 4HY3A 1HDCA 1UEXC 3TQOA 4IDNA 4TT8A 5C0OE 3L77A 2QVLA 2R1TB 2Q1UA 3SOZA 3KAJA 4UE6A 2PNJA 5M34A 1TVEA 3K8QA 2V7GA 3BD7A 1QHFA 3LF2A 3OPYB 4ZOAA 4DLTA 1FLVA 4BO6A 1QPZA 3JALA 3DZ8A 3OURA 2B3DA 1DP4A 4AXXA 2NYRA 4RHFA 1KNXA 1ZMXA 2E7ZA 4REQB 4MB6A 4U3JA 3ZHCA 3NP9A 5CDHA 2PKXA 5M7EA 5J1SB 3CRQA 2DHRA 2P9GA 1GG5A 5EZYA 2C7OA 4NARA 4CXMA 3W90A 4YPVA 4HB3A 1DQRA 2DFTA 2GEDA 1V9LA 4UAVA 5C46F 1N6NA 4AN4A 3ECSA 5ER9A 1HFKA 3IJRA 1Q3HA 3IMKA 4KXNA 2VHJA 1GFIA 1PAUA 3AF3A 1FF9A 4MYUA 3OZGA 1ZO8A 2GPYA 3WWDA 4K6MA 2BJVA 1N9GA 1E20A 2QQ5A 1XTSA 2PBFA 3BQ9A 3IUBA 3KXDA 1FEZA 4ITVA 5EJAA 3BL5A 1CRPA 1W4BA 2C92A 4DJDC 1UM8A 3QPDA 5ELMA 3DC2A 3ESDA 3CVOA 4NAHA 3OSZA 1U3VA 5CEEA 2PYIA 3ONFA 1KR2A 2X42A 3ACCA 4ER6A 2WP0A 2A1IA 4KHPB 4ESHA 5AVTA 3T3MB 3IVXA 3D4LA 2A33A 4NHOA 2QX8A 4GOOD 2WC1A 3R4CA 4HAOA 5AT1A 2A7QA 2HWUA 2ZJ1A 1WXIA 5D5HA 1IN7A 2R6DA 2WOOA 1P9LA 3BHNA 3HK2A 4UTVA 3QWFA 1NV8A 2CB9A 1DAHA 3KTDA 2YZKA 2VHEA 4PNHA 4DWWA 3U6BA 2EBHX 1UDXA 3O94A 4YUZA 1JA9A 3N39C 4D3FA 3TECE 3IHLA 1RMYA 3U48A 1HL3A 3OP4A 5IAGA 1YDGA 4EY8A 2C9DA 3VZRA 3PZRA 1CQIA 4DRXB 3TQSA 5JR3A 4N1AA 1UBSB 4PAOA 3F3MA 1QP0A 3QRWA 2HU8A 4F3NA 3PQ2A 4TLEA 3W9SA 5L3SB 2BR5A 1CRZA 1Z5ZA 2ZB7A 3PC8A 4NZNA 1EVQA 4UNIA 1KDZA 1CZOA 3X2SA 2XOXA 3GGOA 3HJNA 2VBCA 1K6MA 2FHSA 1RJFA 3KC2A 5K4AA 5BW8A 5LZ7A 3DEFA 1Z6PA 3AMVA 3MT8A 3ZTTA 2JI7A 1AF7A 3PXDA 1I4EB 2P4UA 3PZBA 2JPDA 1WZCA 4FIDA 1V6CA 2X1VA 3PJDA 4Y1FA 3DQPA 4FE4A 3R0IA 4EAAA 1O89A 4QDTA 2BM1A 3H18A 4FFDA 4GVLA 2ZRAA 5LM3A 4YDRA 1J90A 2OHFA 1J2TA 1TCAA 5TDHA 4TTJA 1EK0A 1RQRA 2NADA 2GTIA 3K9CA 3WDSA 2J0QA 4OKIA 3IUMA 3ZDXB 1UJMA 2J7KA 3W9BA 4FT4A 3LDFA 4ZCQA 5KKNB 2YY6A 4ND7A 2NT4A 4F86A 4FGKA 1N7JA 1S8NA 1FPMA 1ZFNA 2W2TA 1VRCA 3FVRA 4QNNA 3GOHA 2FRDA 2QA5A 5FTWA 1YO6A 4MS4A 2A5DA 3WMRA 2XNSA 4KQCA 5C5IA 1M8GA 4G5RA 1I1OA 2P4SA 1RQXA 5KHOC 4Q3BA 3OEHA 5FTLA 2O2HA 3WBJA 4N01A 3EXAA 3RJ5A 5IJZA 4JI1B 3TLZA 1PT6A 3SQXA 1WDKA 3SPXA 4PGFA 1XLWA 1Z7EA 3GA5A 2WZQA 1H5UA 4UQPA 3SKXA 3LLVA 3B1ZA 4CM3A 4ABYA 5BV8A 4X95A 1YD7A 2PH3A 4JSYA 1T5HX 1LFDB 1MJ5A 2Z1NA 4BXOB 4KQMA 4HN9A 4Q7EA 4EI8A 5DT2A 3REOA 1X7DA 1WCWA 4QVKA 5FIUA 2O3UA 3DZGA 5F78A 3NVAA 5G4KA 4NENA 4BJ5A 2PMDA 5IVHA 1O6BA 2NUTB 2XKKA 2I29A 1G20E 4JLMA 3ZV5A 1BE6A 1GYPA 1XA4A 2IHBA 4YRCA 4CV2A 2YXBA 1OBVA 1WHTA 4F46A 1H3NA 4P53A 2RKOA 1UPUA 3NHRA 3KD2A 3PXGA 3I5MA 5C4GB 1OGIA 1ZW6A 3OAAD 2QGNA 1BA3A 2C2HA 4RO0A 4TKUB 3R4VA 4DADA 2EF0A 2XWBF 3RODA 1WCV1 5JHGB 3AR7A 3L7CA 3SFTA 4Z1MD 3S1LA 5JH7A 5J5AA 1LDGA 2VDPB 1YTUA 1J9ZA 2W9XA 1OT3A 4ZHQA 5A4FS 4REOA 1TUEA 1UKAA 3WMXA 5C4MA 5K0BA 4W9NC 2H08A 1GPWB 4U4AA 4FC6A 4PAGA 3E70C 3MJ4A 1QOPB 4TLDA 2EQBA 1E8MA 4GM4A 1JZQA 1XMQB 4IXMA 3A9TA 4IM7A 4UEKA 2CDCA 4Y0VA 1KOLA 1GZ7A 1YT5A 4I9NA 4BMDA 4D1YA 3LXXA 1M8PA 2RONA 4IZHA 1NXSA 5L51A 2PUGA 4JLJA 4PS0A 4URWR 3RK1A 4WDRA 4QVIA 3MWGA 3N8NA 3O4GA 2BF7A 4LKRA 1PV2A 3MC1A 5BW6B 3ZQKA 3HA5A 3EGXB 2ZSFA 3ILXA 3C3XA 4A15A 1K7YA 1DC7A 2QX6A 3BN3A 1JLSA 1DTWA 3E4DA 3Q7EA 1CJVC 4ADSG 2GN9A 3PNQA 3DF9A 3IB6A 2XTZA 4FR5A 4Y2GA 2BEVB 4F5YA 5BV0A 1K66A 5CDUA 2BV3A 1E69A 1Y33E 4QUEA 1YR8A 2D7DA 1K2WA 4MRRA 4E13A 2H5EA 2ATEA 3WWYA 5H9VA 2GCEA 2IYNA 4DRXA 2ZVPX 5DN6A 4GECA 2ISSD 3AGPA 3H2ZA 3LGSA 1CD5A 1BQ3A 2KBEA 3E2PA 2J9YB 1V3VA 2QI9C 1MC8A 1A97A 5DTRA 1QQBA 3LK7A 2ZDHA 3QUQA 2H59A 3AIIA 1E2PA 3KO8A 1UJBA 3N86A 4PR0A 4BP8A 4CMEC 2JH8A 1O77A 1TZCA 2I5PO 3PD1A 5FAKA 1ZSYA 4QPJC 2ZSBA 2JLAA 4I4TA 1AUPA 3EEFA 4QJ4A 4BNYA 3AEQB 1V1RB 1Y3AA 2EHJA 1DINA 4KE7A 4RD6A 5DLDA 3ZV6A 2KQUA 4UASA 4LXHA 4XD7A 3KOYA 3QPAA 3THYB 2QVBA 2A30A 2CLLB 4N49A 1EDZA 1KYTA 1M6VB 1JALA 3RU9A 3AI3A 1FQWA 3PC2A 3SN6A 3F7NA 1E6MA 2BTQA 2PKQO 2X6RA 3OZTA 3D1JA 1XPUA 1HQKA 1XZHA 1YBAA 3PNBA 4K0RA 4W1QA 1YWGO 3ZWYA 3A25A 3ZJYA 1V5FA 3GAMA 2IP2A 1E1DA 3B1FA 3PYMA 4DIBA 4X90A 1LBEA 3JCZA 3MYYA 4Y18A 4CLXA 3SKVA 3VDQA 4CJXA 1CUIA 2QV7A 4A23A 3AVYA 2QNBA 5CB4B 2XYVA 3MELA 2YRFA 3OP1A 2ALJA 2PJDA 5IBRA 2BMWA 1QFXA 1PL8A 1QRUA 4ENSA 4J49A 4S1WA 4GOJA 3I4FA 5K3CA 4FYMA 3JARA 4IXWA 4DKJA 5BR7A 1FXSA 4PQYA 4E03A 4NBSA 1QO0A 2H4YA 1Z6XA 2AG1A 3K31A 3KSRA 3L01A 4R4JA 5CMLA 1KQFA 5G3YA 2YMQA 2XNHA 4P7GA 4XUGB 4BFVA 1VBNA 2YUTA 5JVDA 2EX1A 3ICQB 4EG4A 3ABQB 4R71A 1PJZA 1A4UA 1NIPA 2QTWB 1RI4A 5TQ0A 1L8AA 2QTMA 3EPPA 5LU8A 3Q2KA 1BD4A 3C4JA 4QJIA 2X4GA 2RCYA 1XSEA 3IBFA 4RMIA 2R00C 5DSXA 1W36C 3CW9A 1M67A 3V32A 1SOAA 4BFSA 3Q3HA 1Z74A 4CMGA 3BWDD 1WB6A 3UMFA 3IR7A 3JVEA 5J5VA 1TF2A 1XMVA 3NPAA 1VKRA 4KZPA 1AXEA 3EWSA 1EVKA 4JU9A 1PCXA 4LDAA 3EZ6A 1MB3A 2W2QA 2H63A 2XNDD 3JAMA 3OQ1A 3WWPA 2KJQA 2OLJA 2PSHA 3B9RA 4FCWA 4YA6A 1E2LA 1QGUB 2M2IA 4CKCB 1FY2A 1NYQA 2EKLA 2FPUA 2R8OA 3AJRA 2IBMA 3BG5A 3KUUA 3M3PA 3P9IA 4IIDA 1QCDA 2HGSA 2IOYA 4LJSA 4F04A 4PN7A 1P18A 5ICSA 3H05A 1T9HA 1H3FA 1VCNA 3B7GA 4D0LB 1GAXA 1CFZA 2O2DA 2C7QA 4HGYA 2DECA 1OF1A 1KJ9A 4G85A 2ZJ3A 3O38A 2VJCA 2FX3A 1CLEA 3MSCA 3OCJA 4AJ2A 4BNHA 4DAOA 3OQ6A 4MWSA 3RC1A 4V2UA 1C7JA 1MT0A 5BVGA 1GFZA 2E6UX 4AJEA 4EUSA 3EY9A 3KPUA 3KYBA 4KLAA 4LWOA 4U63A 3GQVA 4QFBA 4MTLA 2XDQB 4HB2A 4G4IA 5K6AA 2H16A 4QAQA 1Y5MA 3C70A 1G98A 4JBIA 1P9RA 1QC5A 2IT1A 3KL2A 4QGGA 3AFMA 4IF6A 5HK9A 5JAZA 2ODWA 1STOA 3MWFA 1X0XA 1Z8DA 1DJMA 4ME6A 3CVVA 3UV3A 1QHGA 2VJKA 1MAUA 4HQFA 1ZZEA 1RI3A 1WXXA 4RK4A 1E6WA 1KK1A 3KJNA 2I7XA 3TLAA 4D43A 5JJ5A 1GO2A 2QD1A 5FD8A 3JQ9C 1K5PA 1XYYA 2IA5A 1NJ6A 4JLKA 4IXTA 4IMJB 1YBMA 3ECCA 3VNRA 4BGDA 2PL3A 5IKEA 4RSRA 3GO4A 3TNJA 4QOHA 5EJFA 2Z9DA 3FCEA 4JOSA 5F35A 4CUKA 3FZEA 3OPQA 1Z63A 4H35A 2RI6A 3VU1A 4AZ0B 2XD4A 3CE9A 4KE8A 3GWZA 5H3CA 1QB7A 3JQEA 3Q7PA 2GN2A 1H4TA 1OAKA 4D74A 3LT0A 2GBGA 2HMUA 2PXHA 2AHOA 2HK7A 3BXXA 3LP6A 1DO2A 3OC6A 4WBNA 1Q95A 3N59A 2XUFA 2YV5A 4RKEA 1E0JA 4PC7A 1XAIA 2CF5A 2FYTA 4FIZA 1L5HA 1FTWA 5JJLA 1TVMA 1WUJS 1M2VA 2XJ9A 1SVSA 2IY8A 3TJZA 5HM8A 3LCVB 3PRJA 4H16A 2VYND 1UMCB 1MIOA 2ADFA 1KAQA 4HTFB 4O4JB 3KJGA 2GUGA 4LQCA 4MP8A 5LPNA 4CGYA 5FPHA 5JAIA 5LQUA 1MOSA 2OOSA 2NXNA 1YTLA 2OV6A 1XD2B 1P75A 2V7VA 5F9MA 4GSLA 3IHKA 3G1TA 2FK8A 3KXPA 2WJPA 4YJFA 4EBBA 1YL7A 1ZMTA 3L9XA 2AA3A 3O8QB 3R0VA 1RJDA 4WLVA 1IAVA 3FWPA 1UPBA 1WABA 4I7EA 4IIHA 5HF5A 3G23A 1H2EA 3AQIA 5A2QA 2YDXA 4ZAYA 5REQA 2O8EA 6LDHA 1NDUA 2BGTA 3OZAA 2JKYA 3AJEA 2V9CA 4BMPB 1SIBE 3DXFA 3GMDA 5DNEA 3WIEA 1IPHA 4BMXA 3Q7SA 1PWZA 1OWMA 1O96B 2GEBA 1YJ5A 2QTAA 1U7TA 5EIFA 4ZEWA 3RW9A 3AYZB 4AY4A 5BSKA 5TMPA 2O8VA 3K1YA 4ZXFA 1Z47A 1NQXA 4DJEC 3BORA 1DJOA 3BMXA 3EG5A 1X92A 1AF4A 2CNWD 2HWXA 2VZ0A 3HN2A 4FOSA 4JFAA 4IO0A 5HQ3B 3QE0A 3P4UA 3ET4A 2A6PA 4JFRA 5JSQA 3UY4A 1X9GA 1HDGO 4KO3S 1W59A 1JDVA 1BCRB 1ZN2A 4RLFA 4RZUA 4L0MA 2WIKA 5DCLA 5DTQA 3OO1A 2EZUA 3HZHA 2B61A 1JT9A 4ZU1X 2DETA 4QEZA 3OCWA 3KWJA 2AB0A 2L82A 1A8PA 2HSWA 1GPMA 1Q84A 4Y2PA 4JUBA 3BX1A 1GUDA 3L06A 1RQ2A 3FLBA 3N7AA 3PDWA 1BMTA 2BEKA 2F1OA 1GRVA 2O57A 5CFNA 2O2IA 2ID7A 2JIMA 3FH0A 4INZA 3ZWDA 2FQWA 4B73A 1E7YA 3HWRA 3L0BA 4Q1EA 3B5JA 2A3NA 3O3OB 1D4OA 1YBVA 4U02A 3V34A 2QRJA 4EYEA 4ZI2A 5A4KA 5C2JB 3MCZA 4K81B 4J0KA 2X41A 4G6ZA 3UEOA 4F92B 1EESA 1ULUA 1ISHA 1FFDA 3KYDB 3ND7A 1DFIA 2PRYA 4PO1A 1Z2EA 2OQVA 2WICA 1HOTA 2AJ8A 3IH5A 3ZE0B 4S0ZA 4EJFA 1H9CA 3WK8A 1QE3A 5IC5A 3O9ZA 5SICE 1OD6A 3R3ZA 5DNYB 5KYYB 4TXJA 1NP6A 2ECOA 2C8LA 5AUPB 2IDJA 1ZBQA 1O6CA 2PZLA 3IO5A 4XX0B 4MCIA 4EW6A 3IMEA 4AY6A 1YUNA 2IYSA 4MKZA 1RWVA 5G1OA 3U3KA 2CKDA 2G70A 3VXKA 1WW8A 2JZCA 4UHHA 3CVYA 1HT1E 1QYCA 4RIFA 2VDQB 4C21A 3PUIA 1WEHA 2QRVB 2XJ4A 4HEA1 5IDXA 2G82A 5L3QA 1E6EA 1CX9B 3ADOA 4WFIA 5FTMA 4C4ZA 4D5EA 1ADCA 3D9QX 4DYVA 4Z2AA 1RXWA 4Z7QB 3K6JA 4AP5A 5AVKA 4OMFG 4DREA 4WNAA 3ZNOA 2JC3A 4QTUB 5TE9A 1PZFA 1TO6A 5CLGA 5J2UF 1VGQA 3FN4A 5TQJA 5F77A 1ENZA 5LD2C 4OXYA 3FZNA 3ETLA 3QYAA 5GPBA 3WDLA 5K3FB 2OHGA 1YR6A 1QAQA 4IVRA 4QJBA 3M1AA 2CMGA 2EL7A 4YJ2A 1F2VA 2PH7A 4PVCA 3VC3A 4AS2A 4BUZA 2NU8B 4W5NA 2XKBA 2GYWA 4XUEA 3CKLA 2HNBA 4XVQA 1CG6A 5JS7A 2FCAA 2B8NA 2BMDA 1GKKA 2H06A 2I80A 1NJ8A 2CJWA 1UJ4A 2QRGA 4LHEA 1DWOA 3DDOA 1YOBA 1LDMA 3WB2A 5C8DA 1SEVA 4ND3A 4P4SB 8ADHA 3CZ5A 4IOKA 3BMQB 3HJAA 2N0SA 3FDZB 4FN4A 1TK9A 3MTJA 3WHIA 5IZCC 4C9BA 5MGNA 1WBDA 2A92A 3UAGA 3L8EA 4QOFA 3R8XA 5JPDA 1A8IA 5K4GA 1AK1A 2C2KA 2WJJA 4M6WA 2CKMA 2P2ZA 4OXIA 1NBMA 2P2NA 1IE3A 3I2HA 1FU7A 5IBQA 3RVPA 4OA8A 5DP1A 4IMRA 4ZIRB 3QJYA 4TWIA 1GIAA 4M1QA 3QY9A 3H5TA 1RLJA 2XRFA 5B3AA 3DE5X 1HK7A 4WACA 2Y1KA 1GPDG 3KYCA 4ISBA 1WLYA 4ZMBA 1DOZA 4KPGA 4W6ZA 3ABSB 2JBAB 3G2LA 4LMRA 2XCSB 5LQNA 3SSAA 1W94A 1LDNA 1DEOA 3V7WA 4JHLA 4GRAA 4PLVA 2A5FA 2AOTA 8GPBA 3HU1A 3NWOA 4LJKA 4F9GA 1XTUA 4EHIA 1C50A 2FPOA 2CNLA 4NEHB 1B8NA 4CCYB 4OQPA 3T38A 3PTAA 1E60A 1DC6A 2ZJ6A 4IJQA 1N3BA 1ZIOA 1CJBA 3EPJA 5DN9A 1C1XA 3ZI7A 1QCCA 5BXQC 1F17A 1R0CA 1UJNA 3PC4A 2E2WA 2GLXA 2WMOB 1G17A 1Y37A 4G81A 4TWZA 1O9HA 4F5EA 1C0LA 3EXFA 1MG5A 1L3BA 2VPQA 2ZSEA 1FK8A 1E1YA 1FYVA 2PUHA 1SHJA 3CCBA 3N6VA 4MRSA 4RD3A 1ZN9A 2X9QA 4UBIA 2VT3A 2WWXA 3DHEA 3IOCA 1SOUA 1VM6A 3GNLA 1BFKA 3NOVA 3T52A 3IPCA 4AS3A 3FTPA 3CJRA 1UZLA 5JECA 2F43B 2YWJA 1SCDA 4Y0AA 1U0EA 2W71A 1FVFA 4MNTA 1KTVA 4UM9D 2BMEA 4HDKA 1IFXA 3SS8A 2IHTA 5GJBA 3F96A 2OD9A 1CNFA 5BR4A 2Q4RA 2V65A 1NC3A 2ZWMA 3W6OA 2WOJA 1WCYA 2KX7A 2W4MA 1JR3E 4JWTA 2XCTB 2WD7A 2X0IA 3UJNA 2O59A 1P44A 2B30A 2GKGA 3CF0A 5KOHA 3LXMA 3EQ6A 3KSAC 4GDFA 1MAWA 2Q5EA 3HWSA 3CKKA 3K6KA 4G5XA 1EHYA 1OLOA 4MTCA 1RXIA 2HDNB 3O4FA 4QOEA 1TEHA 5D3ZA 4BLPA 1E66A 4KVAA 2CYBA 1SBIA 5EGSA 4OUKX 4XX0A 2W6ZA 1BW9A 2VYVD 3CTPA 3JQDA 3KPVA 4N39A 1KORA 3PCTA 2V3VA 1PEYA 2M1ZA 4R81A 4Z7OB 1PS0A 4P1ZA 4DMHA 2HT1A 2XZLA 1SCBA 2R8XA 4X94A 5F51A 3TD9A 1JLRA 5H3HA 1DEHA 3FNQA 4H1WA 2EJCA 2BEWA 4BTEA 4IHKA 3H1AA 4LQDA 5KU7A 2CNNA 4S3MA 4L4XA 4M1ZA 3SZMA 4ES6A 3RKSA 4QRDA 3CRW1 1DAMA 2HC9A 4CMBA 3T12A 2VJMA 4A27A 4DQLA 4KV9A 4MV0A 4QPPA 5GONA 2FMFA 1SG9A 2RJOA 4UPVA 2C78A 5AW7A 1WZ2A 4D25A 4JJGA 2LZ0A 3NI2A 2RGDA 5DWQA 5CRIA 1SU8A 2G5TA 1BMDA 2H4ZA 2AW5A 2VAWA 2PAFA 2QTLA 2Z3WA 3Q15C 4OAOA 2BFFB 4TRJA 1EGAA 1LPPA 2Y99A 1O94D 2ZRKA 3EAFA 3JVIA 3LH5A 2QIPA 4FSDA 3OO0A 2Q5OA 1B00A 1W5BA 3D3WB 2PQ0A 3QVOA 1AC5A 4MQFB 3TDNA 4DQ0A 1HFWA 1PNQA 1PKXA 2JANA 3IV7A 4PYMA 5AJUA 2D74A 3EFOB 4R3NA 5BXYA 1TUBB 1D4ZA 4Q47A 1E1CB 4TRRA 3TE7A 4DJ5X 4JYZA 1DQNA 1FRQA 3RRZA 3DDSA 4QDJA 3I32A 3PNLA 5MGBA 3MWDB 3D64A 1N1MA 1V4BA 1FYDA 4Y2XA 1UWCA 2JGEA 2PVCA 2X1MA 4BP1A 1V39A 3EQZA 3GB9A 5FWXA 1HNWB 1VMIA 1MX9A 1M2WA 5G1PA 1EDEA 3ENVA 3KAPA 2BCGY 2QG6A 2ORIA 4LYHA 4XOUA 3W78A 4DABA 4MVJH 2BSQA 3FNRA 4DV5B 3F9IA 1FNMA 5KYUA 1QBKC 3DBLB 1ANKA 1ZNQO 4HAYA 4KAAA 4KN9S 4LN1A 4P33A 5HM6A 1TM5E 1IZ7A 1U6JA 2DWOA 4LJ7A 4P82A 1VE6A 2IEIA 2Z08A 2BUBA 3QPCA 1AUXA 2P35A 4JS0A 5E4JA 1NYRA 3HA2A 3N0XA 3W5IA 3W79A 4NK4A 5IU6A 5DO9A 1C1DB 5KTRA 1FL9A 3PIRA 4POAA 2MIIA 2D2VA 2IZ1A 3OZXA 4CQLA 4GP9A 2ZIZA 3TF5A 4X66B 5DHTA 3COWA 1H8ED 3UH0A 5IS2A 1QIMA 1NHGA 1ZZGA 2ERXA 2QTNA 1A9SA 1DXHA 3CF2A 2AIRA 2WU0A 4ROTA 1KMHB 3NWBA 3UYLA 4G1MB 2J3EA 3LBAA 2OV3A 4OG2A 3S6JA 1E9EA 1HKHA 1WAMA 2B2XA 4KGZA 1TU4A 2OO5C 4GNKA 4OREX 1CJKC 2ZGVA 2DH6A 1FE8A 3P5BA 4MWTA 5I9SA 2ZVDA 2C2OA 4DUGD 4H6VA 4EZIA 2JKVA 4OXXA 5EQFA 1XMOB 3FHTA 4K87A 3NUGA 4B4KA 2XUZA 2IYUA 3H1TA 1X2BA 3DKVA 5LA6B 3HYTA 1NGSA 3SR0A 1VJCA 3L6UA 4UMFA 3H6KA 1YBFA 3QXSA 4OQ4A 5AOVA 3RSFA 3NBXX 1I32A 3MBIA 4WY8A 3UJDA 1KKLA 1RP1A 3IELA 4GXTA 2DLCX 1HRKA 1P2FA 1HPLA 2APJA 2K2WA 1CE8A 1JG1A 4J2OA 1A98A 4Z9YA 5J4LA 2PIAA 3Q7QA 3GBSA 1IATA 2A0XA 4BFXA 4G1FA 3DOEA 5AW1A 1FVXA 1XEXA 2AFVA 2WTEA 4MUNA 5CLIA 3FPGA 3OCYA 4OYRA 2Q5LA 3K20A 5JXJA 3KT3A 2AK2A 3DVSX 2EFHB 1C1HA 4HLCA 1NM5A 1KI9A 3ECAA 4WCFC 5CJPA 1VG8A 1J0BA 3ZY2A 4E88A 1QZUA 1GKLA 2WG1A 2HF8A 3QVXA 4JP1A 4BVFA 1ZH0A 1FXWF 2ZKLA 1P1CA 2RGWA 3R09A 3ASZA 4ARVA 1XHLA 2BFDB 1FRFS 3QXCA 4FFLA 4L8WB 4C76A 2IRWA 4GU5A 4GPEA 5K2MA 2BZSA 1YCDA 4OBBA 3AGQA 1E2MA 1SC9A 2FH5B 1J5PA 3K0AA 2VPPA 3LUCA 4RV5A 2BVNA 2VEDA 4YQFA 4GL2A 1EUCA 4U8HA 1YFJA 2PBLA 3ICOA 4OVKA 2HADA 3SNHA 1XZMA 2IOQA 3ZZNA 2CFTA 4LC0A 2OGWA 5EINA 4UNSA 3VH2A 3ZDEA 2AQHA 3R0XA 4CRWB 3KHTA 1EHIA 4IL5A 1WPRA 2NTVA 1U1FA 1UAYA 4TMYA 3NVKI 1UC5B 1HMYA 1J07A 1J0DA 2XVXA 1NQTA 4S24A 3WLAA 5LKAA 4G0MA 4C4RA 3OT1B 4FP9A 4I6GA 3SF8A 1ONBA 4O4LB 3TAHA 1Q7RA 1QM5A 4FS3A 4BB9A 1JS1X 2BDTA 4PZEA 3G3EA 3DBRB 4FUTA 3Q8LA 4ALMA 2HF7A 3H9GA 2EWMA 4RJKA 4FR0A 3LCRA 4PFQA 5LL6P 4OAQA 4HDQB 1EFRD 3WR5A 3T61A 1TYDE 2WLSA 4XM2A 2Z2IA 4EJSC 1Z12A 1CF9A 2D0IA 2GF9A 2HJ9A 1P6UA 3EQ7A 4FDLA 4L4UA 5HGJA 2FMHA 4AJHA 3O5AA 2XWJI 2F9FA 3L4BA 3IKVA 3RREA 1P9WA 2CGEA 2OCDA 3IA2A 4GMXA 3EW9A 5HSGA 3AESA 5KWIA 3KQOA 4FJ2A 1XTQA 1JG2A 5KUTA 1F60A 3D2AA 4D4IA 4H15A 2KBFA 1PEDA 4FYWA 4KQ6A 4Q03A 3CUYA 5ERYA 1HT0A 2A5GA 3K1JA 2H31A 1X86B 5EKTA 3GCWA 4DR2B 3EXEB 4G9EA 2GBCA 4YP1A 1P0MA 1YXMA 2P3LA 2ZANA 5BOSA 3NTUA 4BAUA 3TZHA 3FCYA 3M5PA 2Q9AA 4GOLD 3QMWA 4IY1A 2C95A 4PG6A 5ESWA 4BVJA 3B3FA 4L75A 1YKSA 5CM8B 3BVPA 2GCOA 2IPMA 4PGMA 4R6XA 2R1UA 2C4UA 2EP8A 1BC5A 4FBLA 1EGQA 4H1VA 4HGOA 2CEKA 1VI5A 3DZHA 1SUPA 1OX4B 4ALKA 1TMGE 1YKGA 2N42A 3EIWA 3SGLA 3WWCA 4DLLA 2W2VA 1U0GA 2OHHA 1NVDA 1K08A 5FP0A 5KCMA 2FSVC 1Q50A 2UVDA 3OUZA 4JI0B 2JHFA 4HYYA 2C2BA 3FAKA 1FUUA 4F84A 2WABA 4N5MA 3CKMA 1TI7A 2OUKA 2HO5A 3SFZA 3WLPA 3F71A 3MQ4A 2ECQA 1FMFA 4D02A 1N7IA 2NP7A 2IW3A 3UG7A 3ZHOA 3E7FA 2BFEA 4G0PA 5KQMA 1SULA 5AW8A 2AFIA 2NQ2C 3T94A 3F5QA 4BNKA 3ZJVA 3RQIA 2QRZA 5EE9A 2PTGA 4B9EA 4D8XA 5H4HA 1WVIA 1T4CB 1YK0A 5FB3A 3LGAA 2C8JA 4CLHA 3GLIA 4D82A 2H2AA 1DXOA 2F4NA 4WDQA 4Z5XA 4C88A 2GOYA 4QUDA 4QHYA 4BMYA 1NY5A 4PTYA 2RHHA 1B23P 3NAMA 3LLUA 4RVSA 3D4BA 3EARA 4W5TA 1Z6YA 5AH0A 3QUTA 3PDIB 1AKWA 1EVIA 2Q7OE 1J0XO 2IE8A 3KBOA 4O8CA 1P7CA 4HFRA 4KYVA 4U9HS 5CT4A 1OU0A 3DW3X 1PUXA 4FT2A