1NMNA

Structure of yqgf from escherichia coli, a hypothetical protein
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
137
structure length
120
Chain Sequence
SGTLLAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGLPLNMDGTEQPLTARARKFANRIHGRFGVEVKLHDERLSTVGKVDSASAVIILESYFEQGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of yqgF from Escherichia coli, a hypothetical protein
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yqgF
total genus 37
structure length 120
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03652 RuvX Holliday junction resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.140 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 YqgF/RNase H-like domain 1nmnA00
1OVQA 1VHXA 3BZCA 1IV0A 2OCEA 1NU0A 3BZKA 3PSFA 1NMNA 3PSIA
chains in the Genus database with same CATH superfamily
4CK3A 1QZ5A 1XHXA 5MLCQ 1WN7A 5FPMA 3L2UA 4BVOA 5HLFA 4CZHA 4DFMA 2DFFA 4RW4A 1S5JA 4JLHA 4U67L 4M3WA 3CPEA 3H45C 1KAZA 5AZIB 1BOTO 2CGKA 2DFHA 4BDZA 4FJ9A 3KLFA 3VEZA 5IT9O 2VCPA 4DR6K 3SLCA 1BGXT 4Z4EA 1IKXA 4LFAK 4CGDA 3TAQA 2HSTA 3MXJA 2YNGA 4KB1A 3THWA 2E1ZA 4OO1J 1NKCA 4Z4FA 3RMBA 5AQRA 4K8ZA 4FM0A 4K41A 3TAPA 3OYBA 3K9JA 4DU4A 4FPBA 3CJ1A 3OYHA 4BC4A 3JSMA 5FDLA 4C8MA 5BRHA 2CH5A 3VEOA 4LSLA 1GOBA 3LDLA 2P51A 2EX3A 4BDPA 4CF0A 3CCRN 1BCMA 2ZGZA 4FW1A 2NRHA 5C0YA 4CD3A 3LDSA 2O4IA 3HSTB 2IAJA 1DKGD 3HXMA 1TK0A 4CEAA 4B3MK 4FWOA 5ADXH 2WOMA 3M8QA 4N47A 3ZSZA 3V9SA 3SMPA 3S3NA 2HHHK 1RDWX 4CHYA 4BRNA 1H1VA 5E84A 3TAEA 4B9LA 4WFNL 3V9WA 1GLBG 3TPQA 2IIRA 2OPPA 2IDOA 3DXMA 4H03B 3RSEB 3CCEN 4R79A 4CJ3A 1E4FT 4FWKA 3U8XA 3F73A 1ZBFA 3R6MA 4H5RA 3HBTA 4I9LA 3V1OA 1WBDA 2F7TA 5AQFA 2DPNA 2XY8A 5AQTA 2PZSA 4MO4A 5JS2A 1WSJA 4KI4A 4N5SA 4H5VA 2OCEA 3C7NB 4RCHA 4KBOA 3NF8A 2Q2RA 3MEGA 5CYMA 3EEQA 3DRSA 4CZLA 4W5RA 4XH4A 2OTLN 3MEEA 4BC2A 4CZKA 4F4KA 3AVNA 4IDKA 1IH7A 3D45A 1B92A 3U3YA 2QWRA 5LJWA 4IFEA 3LP2A 4QAGA 3SUQA 2O8CB 4CI6A 1NGCA 3I33A 4FSVA 3QB0A 4F2SA 1RTHA 3I0SA 4DFJA 3ENHA 5AQZA 1VQ6N 4EAHD 3BF1A 2HOEA 3ID6A 4MDAA 5AQJA 3L2RA 3E1YA 5BREA 2P9PB 3VQ6A 1K6YA 4DV4K 4L3QA 4DUZK 1BL3A 3HOTA 5M1OA 3C6HA 4F3OA 1O13A 1GOCA 3KK7A 2HMIA 2RPIA 1N6QA 3NAEA 2YHBA 3IUCA 4FYDA 3ZETA 1ATSA 4B08A 4CJLA 2XY5A 1HMVA 4CZGA 5C12A 2G8VA 3ID8A 2P9KB 3M8PA 3VQQA 4XH1A 4A5AA 3JAMO 4JI5K 1CZ9A 4MLHA 4AM7A 4LY7A 2OANA 1QVFM 3MEDA 5JVGL 4IO8A 3J7ZO 4WE1A 3NH0A 1U47A 4YDUA 2YHYA 2ASOA 3AVBA 5M1PA 3CYMA 2HHXA 3OY9A 2QXLA 4FWSA 2PYJA 3HL8A 3MWTA 4KHUA 3M8RA 3IDHA 1HNIA 4E7LA 3NBPA 1X9WA 2IOCA 3V9ZA 2KTQA 1C0GA 1CZAN 2WUSA 2R7YA 5LJVA 1SKWA 2RE2A 4AHCA 2VYPA 4BR2A 1Q7YO 2KW4A 5C25A 2OYQA 4KI6A 2FSNA 4BGAA 3WEEB 3CCUN 3QEIA 1XMQK 4YOVA 4DQQA 4DV6K 4EZ6A 3PO5A 4FJ5A 4Z94A 4M7YA 5JMVA 3A2FA 4BRGA 5JLHA 4CJPA 1SV5A 5HOOA 3MDQA 4CBXA 3L6QA 4YORA 3MAQA 1TUYA 1MA9B 1NJYA 3HI0A 3U3GA 5EX5A 3PLAA 4B1XB 1DT9A 4FJMA 1RT3A 3CG7A 3TAGA 1QSSA 1GLAG 3IS9A 1NK8A 4CZMA 1N5YA 4DTPA 5HRRA 3O1WA 3LP0A 3ATVA 1GLDG 4YOYA 1TGOA 2G8FA 4B1UB 5GIPA 4I2PA 3WT0A 4LF8K 3NMUA 3BF3A 3EN9A 2CGLA 1RTIA 2FXUA 5BRFA 4A62A 5KQ8A 1VSJA 3AARA 1YUWA 5EVZA 3VQ8A 4DTUA 4FZXC 3E66A 1ZBHA 1Y64A 3V81A 5CYQA 2E1YA 1HUXA 4K42A 1EETA 3VENA 4CECA 1VSKA 3LDQA 2OZSA 4LFCK 1SKSA 1OVQA 2Z1JA 4A2BA 1Q9XA 2QWOA 5HBMA 3EYZA 2ASPA 3AO1A 3AA5X 4DFPA 1JXBA 4CZEA 4CESA 1NMNA 1VQMN 1C6VA 4CEDA 1VSEA 4LSNA 3O5BA 3ZX0A 4CJFA 3FZKA 4DLGA 4H5WA 4CGFA 4EFHA 3VQ9A 1BA1A 3FZHA 4DF8A 4B3OA 1N33K 3ATUA 5CR4A 3DLLL 5TKWA 3QINA 3K58A 3UKUA 5BPNA 3LP3A 4B1YB 2AP1A 4BACA 1S1XA 5SWMA 1DGKN 4CJEA 2E6LA 3VF4A 4B3RK 4FM2A 5AZJA 3LDOA 3AO4A 3JYTA 4DTOA 3J80O 4GW6A 3RWUA 3D2FA 3OYMA 3SPYA 2DY4A 4KV8A 4JRPA 4F8RA 3A5MC 2V51B 1BUPA 4DQSA 3P38A 4FLWA 4EIAA 2YCHA 3VQ4A 2O8FA 3ASMA 2BANA 3QBWA 2D4WA 1QHTA 3ZETB 4DR2K 2FBXA 3VPZA 3LALA 3IFRA 1HYVA 4FOEA 4FK0A 3U9ZA 1XC3A 2RKIA 3QMLA 1REVA 1XI1A 3AY9A 4DSKA 3HM9A 4JKFA 1NGFA 4JS5A 3CC4N 4ELVA 1BA0A 5J2NA 4AH9A 1RT1A 3HVRA 3OYJA 1Q8IA 5AQLA 3UB5A 3ULEA 3ENOA 1YJNN 1NK5A 4CFCA 2YNHA 4WF9L 3EZ5A 3M6GA 4MDBA 1JLEA 4DF4A 3PUFA 3B6OA 4CF1A 2YJEA 3CIPA 4KHYA 1W97L 1QSYA 3OS1A 3P1GA 2P9LA 1NOZA 1HQEA 4FWNA 1SL2A 4FJXA 1NJXA 4BRMA 1TYQA 1NU0A 1N36K 4E7HA 4GNIA 4FWRA 3AV9A 3LPTA 4B8CA 4JKGB 5I9EB 3SI6A 1NK7A 3HO1A 1EP4A 2P9NA 3PIPL 1VQ4N 1WSHA 1VSHA 3O4NA 4KHNA 4K43A 1TKDA 1WAFA 3HVTA 5AQSA 1VQON 4JK7A 4WYBA 3CMEN 4HUFA 2GV9A 2JWKA 1NKBA 5CZ1A 1LWCA 1E4GT 1LW0A 2FSJA 4LF9K 2YJFA 1D8YA 4LC9B 2P9NB 1BO5O 4AHRA 4CJQA 1RCHA 4H4OA 3IAYA 2VGMA 3ZSRA 1XMOK 3IRXA 3CCLN 5KRTA 3MN9A 3AO2A 3C6UA 4OPJA 3TAFA 3NH2A 1XHZA 2AA4A 4BREA 1Q81O 3D6RA 5AQIA 4DQRA 3CXCM 3O9TA 5EY4A 1RBUA 5FPEA 3QO9A 1IKVA 3O4QA 3O3HA 3KWGA 4FZZA 3R1XA 2Y1JA 1K8AO 4FZYA 1Z05A 3HP6A 2H3GX 1KRPA 2IGIA 4H0PA 3ZX3A 3TARA 3CFOA 1OH8A 4BROA 2ZJQL 4JK8A 1WUAA 4OPAA 2YHAA 3VMFB 1GOAA 2NRZA 4KB0A 1C0TA 3DLRA 5AQGA 1V4SA 3CF5L 2NLXA 3THWB 3THYB 4BR7A 4DTNA 4CEEA 2FSKA 1T44A 4I6MA 1U04A 1VQ7N 3BEXA 1YT3A 4DR4K 5M1KA 1LCUA 3AA4A 3O9SA 1LOTB 4W5OA 2E2QA 1L3VA 1RNHA 2KZMA 1Q9YA 3V9XA 3FZMA 4BR4A 2W40A 2UU9K 2ZD1A 4DV5K 1G15A 4GKJK 4B9VA 3K9KA 4CZJA 3SQ2A 1C1CA 1C1BA 1LW2A 2AJQA 4PL7A 3KTQA 4DUYK 2IVOA 1VRUA 3K2PA 5AZJB 3LWLA 3MN6A 1RT5A 1NGEA 1U2VA 3M1FA 3TR8A 1P8ZA 1IJJA 4CK1A 3WXKA 4BC3A 3SCXA 4E1JA 3CC7N 2D0CA 4M3RA 4DV3K 4DU1A 1M1KO 1TAQA 2OPRA 1A5WA 5SZTA 3EL2A 3L8BA 1YF5L 3VEVA 1XQSC 4CHQA 2P5OA 3CC2N 4PQUA 4HUEA 3CI5A 3DWLA 1XC9A 3CQXA 4IJAA 1HJOA 2OPQA 3VETA 3SYZA 4WFBL 3VESA 2O8BA 2P9KA 1XNQK 1X9MA 4C8NA 3ZSYA 4E1NA 4FJIA 3TABA 4C23A 1U4BA 4BG8A 1NLVA 3Q7BA 1DEJA 3QLHA 4JV5K 1S9GA 4MQ3A 4FJJA 3GL1A 2V52B 5IWAK 3ZEUB 3DLHA 1JCGA 1TKZA 3A8YA 3D2EA 5C2DA 2P9SA 1J54A 3TU5A 1JCEA 1ASWA 3PSFA 4MO5A 3GE1A 3QICA 4W5QA 3MX2A 3MMVA 5AFUA 1NJWA 4R5PA 1NNEA 4CE9A 3AVMA 3LDNA 1HRHA 1VQ5N 3RVCA 4H8KA 2DFEA 3AVFA 3MN7A 2E4LA 3MK6A 4XIUA 2E6MA 4KHPK 2F8SA 4PL8A 1QQCA 1XNRK 3L2VA 5F1XA 3IG1A 5I42A 4H0VB 2E5LK 1TL1A 3VGMA 1JLCA 3VQ7A 2A41A 4PUOA 2HW3A 3ALYA 1T6CA 5BN9A 4XEIA 3T1HK 1JJ2M 4FJ8A 4YY3K 3CM6A 3QERA 1JLFA 4Y1CA 4IOAL 2XO7A 4I9QA 4UY8O 5AR0A 3S3MA 1HKGA 4KPYA 1TKTA 3NVMA 4E0DA 3QFPA 1ZXOA 3PY8A 5JS1A 4C8LA 1RT2A 3E9PA 3ENBA 1QQNA 3KWIA 3CJAA 5HL7L 3THVA 4DS5A 4JI3K 3EE9A 3KLIA 5CZ2A 2ZWHA 4JI7K 3FR0A 3FZFA 4W5NA 1O1WA 4FWLA 1NGDA 3OYKA 2JGUA 1ZBLA 3HPGA 4CFBA 5J2PA 5CE3A 3K5OA 3L2QA 2F4VK 4U7BA 5AQOA 3TTDA 5D3GA 1NM1A 1JLAA 3QIPA 5AQHA 1J6ZA 3BZCA 1NOYA 1U2VB 3C0BA 1U48A 2ZGYA 3T3FA 2P5GA 1ATRA 4DFKA 1BISA 3MWPA 4CCHA 3WXJA 4GV9A 3RMDA 3L4QA 1RBSA 5AQXA 1KVAA 1C1AA 1OH5A 3CJ7A 4OGEA 4IBNA 4UQGA 4CW7B 1FJGK 3ZCMA 3KVGA 4DQPA 2OPSA 3F5TA 3SPZA 4LH4A 4M3XA 2XRIA 3BZKA 5AQQA 4CFDA 1ZYQA 1KC8O 4OLBA 1MU2A 1W7AA 4H0XB 3TSQA 1GLLO 1TK8A 1E3MA 1KFSA 1HKCA 3AVKA 4IJNA 3M5RA 3K5LA 1J5OA 3HTVA 3CQ8A 4JKBA 1Y97A 1TUUA 5F2RA 1YAGA 3TSPA 3TANA 4LD0A 2VGNA 4LFBK 2WBNA 4X66K 4CEOA 3DLEA 2E2OA 4FLTA 4HTUA 1BWFO 3M3ZA 4CHNA 3HP9A 4BG9A 4C8KA 2VWKA 4IOXA 3VQAA 3VN5A 3DRPA 4E7KA 4H0YB 4H0OA 3EY1A 1V4TA 3KZBA 1T03A 3O4WA 3AVIA 3OBWA 3ULEB 4DWIA 1VHXA 1B9DA 4CEQA 3RR7A 4JKDA 3ZSQA 1SKRA 4NLBA 4FO0A 4DKWA 1HX1A 3SV3A 1ASVA 3GOIA 1J53A 3R9PA 4NCAA 3IKMA 3D7EO 1CXUA 2Q0UA 3QESA 2ZJRL 2Z1GA 3WQUA 2A3ZA 4FLXA 5BR8K 3CCVN 5AJ3K 4QCLA 4QS9A 4GVMA 3T19A 1EX4A 2I7PA 1GLFO 2F9WA 5KPRA 5AQPA 2Q3SA 4K25A 4FLUA 3SQ0A 1FKPA 1YVNA 1OVYA 5DM6L 2ASMA 3JS6A 3ZT0A 2YX6A 3P83D 2E2NA 4J2EA 3PV8A 3MXMA 3E9LA 4BR9A 2HF3A 2JWLA 4NLCA 1GLCG 3PX4A 4JAXA 1C0UA 3KLEA 1NK6A 1TV6A 4Q5VA 1S1WA 4CJ5A 4A57A 4Z4CA 3VGKA 4F2RA 4DTRA 4M7XA 5LY3A 4OKEA 4CJ4A 3TAMA 4BDYA 3OHRA 4DV2K 2HHVA 4JKHA 4PWDA 3WNFA 3JXUA 4BR0A 1IG9A 2OA8A 3MN5A 1DLOA 3O8MA 4HTLA 4C1NK 4IEIA 3OYDA 1S1TA 3F9MA 4AHUA 3SV4A 4HCBA 4IOCL 4CGJA 4O0JA 3O3GA 1SUQA 4NCBA 1IBLK 4AHSA 5KPZA 1JL1A 4CZIA 1WSEA 3S9HA 3WXIA 1I3AA 3ITHA 3LM2A 2P9IA 1WLJA 4O44A 4B1ZA 2KFZA 4FLVA 2BDPA 2ETJA 4IKFA 4YFUA 1RDAA 3P5JA 2E8AA 4DTSA 4K0KK 2PBDA 4KAZA 3G71N 3NFAA 3RMAA 3C65A 1UAXA 2D0OA 2Q0RA 2E20A 4N56A 2HVIA 1OH7A 1GLEG 2KHOA 4FCYA 1TKXA 3I8BA 5FLXO 3QETA 1SL1A 3WXLA 4KH6A 4JRQA 3T1AA 1ATNA 3RRHA 4JNEA 3CCJN 3V6DA 2ZF5O 1VRTA 2P9SB 1QQOA 2YHXA 3ZEUA 4DSIA 5HRNA 1GLJO 5J2QA 4OGCA 1VSIA 5B8HA 4PHTX 4CGHA 1T8EA 3A0IX 3ULDA 2GBZA 4JHDB 2W41A 1Z25A 3OYNA 3OYGA 5JVHL 3I56N 2NRTA 3KKRA 4KTWA 4FWQA 3H1VX 3QEPA 2A5XA 2PY5A 3L0QA 3A5LC 3AVJA 1J9AA 4Y1DA 4CBWA 4RW9A 1VQKN 2Q97A 1CZBA 4OLAA 2QKKA 2W6LA 5AQUA 3ZSOA 1RT4A 4YOXA 2HHTA 5AFUH 3BDPA 2F9TA 5TKYA 1U49A 4CHZA 3K57A 1W0HA 4FW2A 1FKOA 3CQYA 1ZBUA 2UUAK 2W42A 3SJJA 1EXQA 4CHPA 3KLGA 4H0TB 4CERA 1BU6O 4AF1A 2P9IB 4JI6K 1BI4B 2QWNA 2RHKA 3QFUA 3OA9A 2NNWA 5AQKA 4FL9A 4ZTFA 4N76A 2BTFA 2ITMA 3J81O 4OPKA 4F3TA 4PKHA 3H1QA 3RTVA 4DTMA 5J2MA 3AA2A 4IFVA 4ISEA 2QWMA 4M3UA 4CGIA 5HRPA 4JI8K 5JICA 3VEYA 5CHIA 1QS4A 1NK0A 1HNWK 3LM9A 3CCQN 1S9EA 1F21A 1WNSA 1T3VA 3P39A 4DSEA 4E7IA 2FF3B 1JKHA 1NGJA 2Z1IA 1NMDA 1Q82O 2I5JA 2A6AA 4CEBA 4TSXA 4DR3K 3U6FA 1KLNA 4J8FA 1NKEA 3HJFA 2D1KA 1FXXA 3OTOK 4FM1A 1YITN 2X74A 5LMUK 1SQKA 3AVCA 3THYA 4BRLA 2Z1HA 4M41A 3G25A 2D0BA 1N32K 1HYZA 4KFBA 1G99A 2D0PA 5C2FA 1A5XA 5GINA 2GEMA 3FGUA 4BRQA 4JS4A 2V7ZA 4JHDA 1UA0A 4FXDA 1TK5A 4J2AA 1TVRA 2QA4N 1ZBSA 3EKUA 1JL2A 4DTXA 3LANA 1RT7A 4ELTA 1VK0A 2P9PA 1X9SA 3KD5E 5E26A 3LAMA 4A2AA 1S6PA 3S3OA 1UWBA 4BGBA 4KH5A 3ZT3A 4O55A 4JI1K 1ITGA 4DLEA 2QXFA 3PX0A 3LAKA 3NGZA 2VQFK 3H6EA 4MLEA 3CFRA 3TI0A 1Q18A 1OH6A 4OPHA 2QEXN 1SZ2A 2IS3A 1N34K 1K9MO 1VQ9N 1ESVA 5LMNK 2ITGA 4JKGA 3DM2A 1QHAA 1HQUA 4Z0UA 1YVUA 1IKYA 2ATQA 3O08A 2NRRA 1FK9A 3ZYYX 3H08A 3I8DA 5BRDA 1EKEA 4I2QA 1EQYA 4DS4A 3N4PA 1T7PA 4HVJA 4DMNA 1IV0A 5KTQA 4A5BA 2IVNA 1ZC6A 4WQ5A 1EWQA 1QVGM 2PAVA 4WFAL 3KJVA 4DSFA 3ZSVA 2GWJA 2A42A 5FRMA 2BGGA 3LWMA 3AAPA 2HHSA 4DG1A 2W6KA 3RMCA 3P4IA 1DTTA 4HUGA 4CF9A 4CIGA 4BE1A 1N8RO 5KGWA 4AHTA 4CBUA 3NE6A 1J5EK 2DTUA 5GADP 3N4QA 4LF6K 3O3FA 3VQPA 4BRHA 4Y0WA 4M3TA 3AVAA 3H3OB 1KXPA 4BWJA 3BP8A 4B8AB 4E7JA 3DRRA 4ILGB 1YJWN 1NGGA 1D4XA 3EO3A 4CIFA 1C0MA 1LAVA 1C0FA 1YTUA 3O9QA 3AVGA 2O8FB 1RILA 3O1BA 1Z6RA 1K8KB 1QQMA 5BPLA 2Q1NA 2HNZA 2NRWA 3CPWM 4DV1K 4IG0A 3OYLA 4OJRA 4BRCA 2HB5A 3D2FB 3VEWA 3HRGA 3ZSWA 1RBRA 3HYFA 3VQ5A 3C6AA 2HBLA 4JKCA 4Z4GA 5ADXA 3KKSA 1KD1O 4IZ9A 4FVUA 4PA1A 3OVNA 3UKUB 4ID1A 1RDCA 1MWKA 2Q31A 3KD1E 4CGGA 2A40A 3DXKA 2VG7A 3NF9A 4CJRA 4KHWA 1CLQA 1I39A 4LF4K 4FJNA 3Q7CA 4EHUA 4JK9A 4NO7A 4W5TA 1YHQN 4DSJA 3QIOA 5AQNA 3EZWA 3FE1A 4DTJA 1NGAA 2NRXA 2VWJA 4FWPA 4GVEA 4B9NA 3WUHA 1TYQB 4ISGA 1VSFA 3LPUA 1WB9A 5FPDA 2J4RA 3G0ZA 4JI2K 3CETA 2OTJN 4KRFA 1VSDA 3AO5A 1DTQA 2P9LB 4DHYA 1YJ9N 4EHTA 3QBXA 3BGRA 4BRDA 3NGIA 3VOVA 4GKKK 4GV6A 3OYIA 2CH6A 2BUPA 4CJVA 1HNVA 4M45A 4B9SA 1D5AA 4KTQA 5AQWA 1YTAA 1CXQA 2NRVA 3AVLA 4B9MA 3VF6A 5EOYA 4BR5A 4CK2A 4DCHA 5M1NA 3FZLA 1HJRA 2X78A 5EXWA 4O5BA 3HZ6A 3NHGA 5FRNA 4A61A 2YNFA 3DAWA 1QE1A 1TL3A 4OX9K 3OBYA 3L2WA 4O8UA 4Z4HA 3OS0A 4M42A 4CJKA 4WQ4A 3HSCA 4RWTA 4BWMA 1RBVA 2G8HA 2O4GA 5ELZA 3V1RA 4JKAA 1LV5A 4ZTJA 1S6QA 1IG8A 1SAZA 4OKKA 3LL3A 5GAEP 4NXNK 2HMPA 2F8TA 3SZ2A 1S1VA 1R59O 1D9FA 2ZE2A 2E2PA 2FBVA 4FJKA 3U9DA 2WC9A 3K5NA 3VQBA 3M8SA 2PYLA 3BY5A 1KAXA 1WOQA 2WTUA 4IDHA 3VQDA 4DQ8A 4KHQA 3OYEA 5KRSA 3O80A 3V9UA 3MXIA 1T05A 2UXCK 5C24A 5A2QO 4O0IA 4WQ5C 2BE2A 3SBTA 3I55N 1MWMA 1NJIO 3A5OC 3DXKB 1RTJA 4PKIA 2X6NA 3T69A 1SL0A 3WEEA 2EHGA 1NGHA 2HVHA 4KH4A 3D0PA 2OZMA 1BI4A 3WXMB 3NCIA 5I3UA 2HBMA 1BG3A 3EKSA 4I6MB 1WSFA 5JLFA 4FLYA 4KHSA 2GWKA 3CJ9A 3PIOL 5DK5A 3VTIA 3SUOA 4AHVA 3VA3A 2HNDA 1UA1A 1HNZK 4B9QA 1RDBA 2XY7A 4ICLA 3A5NC 3CM5A 1VQPN 4YOWA 3L4IA 3PX6A 1BHLA 4NCGA 3W0LA 5GAGP 4HHTA 3E01A 4CEFA 4MFBA 4NXMK 3FLCO 2I7NA 2RN2A 2B4JA 2FC0A 2QKBA 4DV0K 2KKZA 4X64K 3DOKA 1UOCA 3NH1A 3G4SN 4BVPA 2GELA 2A1SA 3T1YK 2ZM6K 4IWVA 3V1QA 4JEPA 2YV0X 1JLGA 3SUPA 3VQCA 3SQ4A 2HNYA 3SAFA 3AGRA 4BRPA 3AAQA 3VTHA 3O9RA 1R0AA 1IBMK 4O4GA 4A59A 3OYFA 2YKMA 4CFAA 4ILHA 4IEEA 1IO2A 2O8BB 1RDDA 3G6EN 3RSEA 3VA0A 3DLBA 2EWSA 3OYCA 3J7YP 3CD6N 1YXQA 2FF6A 2B6AA 4CF8A 4Q0BA 5F0XA 2QWPA 3SNNA 4PKGA 2E88A 2B5JA 4GV3A 3S41A 3OS2A 3AA3A 3HT3A 2G8WA 1KVCA 4O5FA 5E41A 4FJHA 4YOUA 2FBYA 3F2KA 3DI6A 2HHQA 3R8EA 3C7NA 4FPAA 5C10A 3WQTA 2ZQBA 4AQYK 4CF2A 2QTDA 1HKBA 5LL6Z 3UE5A 3VGLA 4IO9L 1HYSA 4AILC 1X9JA 3VQEA 3DOLA 2WFBA 1SS6A 4KREA 1TAUA 3CERA 3HPHA 3C95A 3K59A 4FK2A 1BIZA 1YI2N 1WSIA 3EE8A 2YI1A 3OYAA 3DYAA 1NK4A 1RDUA 1QSLA 3QEXA 4B1VA 5AQVA 2LSNA 4FOIA 3J8AA 3WNHA 3VEXA 3ZSXA 2NUBA 4GY2B 3CJCA 5DMRA 3DMJA 4B3TK 1MDUB 3TWHA 2CGJA 1VQNN 4GMJB 2QK9A 3ISNC 4NYNA 2FLOA 2QW9A 4CJUA 2Q36A 3NDKA 5M1FA 4BC5A 3FFKB 5AZIA 2FBTA 1LWFA 3HPOA 3SAHA 3BUZB 3H3NO 3SK3A 2VG6A 3AGKA 4RW6A 3F9KA 2P9UA 4L8RB 5CY4A 1EO1A 3PSIA 4J2DA 3FFIA 4M63C 1QTMA 4E19A 2P9UB 2A1RA 1WBBA 3KLHA 3K5MA 4LH5A 5KI6A 4RTFD 2KQ2A 1VSLA 1WAJA 3ZT4A 1KQSM 2X6SA 3WNGA 1KLMA 2QI2A 3V4IA 4WQ4C 3NF7A 4IXCA 4X62K 1Q86O 4DR5K 4QS7A 1X3NA 4EZ9A 2HHUA 2D5RA 1K73O 1RTDA 2UYTA 2V7YA 4DQIA 3O6WA 4H4MA 3RRGA 3L3UA 4BE0A 3UIQA 3NVKA 4RW8A 3MCPA 1OKJA 3HK2A 3LZIA 1KSPA 1KTQA 4FVMA 3GG4A 2KLAA 5KQDA 1NG9A 2XY6A 2GUIA 3DXMB 4DR7K 5DM7L 4AM6A 2O8EB 2IC3A 4CHOA 3VERA 3LZJA 3J7AP 3KK1A 2HBJA 3ZT1A 1S1UA 4JD2B 4CJSA 1ZBIA 1P90A 4YHHK 4IFYA 3G10A 1YIJN 1EWRA 1BQNA 1NJZA 1L3UA 1W9HA 5KPTA 2YNIA 4H5TA 3CFPA 4JI0K 4QS8A 3THXB 4JI4K 4PY5A 5AQYA 5BN8A 4C1NI 1HPMA 3GDQA 3AO3A 4C8OA 3PO4A 1KAYA 5AQMA 4BQLA 1KCFA 1M90O 3ZX2A 4YNQA 4KKOA 2F96A 3P31A 1RT6A 4LF5K 4ILJA 3SJHA 1S22A 4J2BA 5HROA 2HF4A 1RBTA 2NZTA 4FJLA 2JLEA 3O9UA 5KGXA 2RF2A 3CHWA 2QWLA 3D2EB 5J1EA 4BQZA 4DB3A 5HP1A 4OKJA 1BCOA 4H5NA 4ID5A 3CCMN 2IVPA 4EP4A 2VQEK 1L5UA 4XH5A 4E89A 5EU7A 4K8XA 1NK9A 1X3MA 1VQ8N 3SQ1A 4OVLA 2YKNA 1JXEA 3SMSA 1VQLN 3MX5A 1NGIA 1IBKK 3K0SA 5H1SQ 3MCAB 2UUBK 4DV7K 3B8AX 1HLUA 4CIEA 1HNXK 3RR8A 4YDUC 2GTDA 5T7BA 5BPMA 2KZZA 4DU3A 4BY9C 4FJGA 3CJBA 4CJWA 4E3SA 4WCEL 3SBGA 3DJCA 2YHWA 2UUCK 3KK2A 1ILYA 3UKRB 3T7ZA 3U4LA 1IKWA 1XWLA 4HWIA 2WONA 1I94K 3HOSA 1JLBA 4CJ7A 1RGIA 4O8KA 1HR0K 1B9FA 2GX9A 5FROA 4NB4A 3C94A 3CCSN 4DSLA 4B1WB 4CJTA 4JN4A 2PFUA 2D0AA 3I0RA 5BR9A 1D9DA 3E9OA 3HM8A 2Y1IA 4LF7K 2UXBK 5C42A 1T6DA 2QM1A 1LAWA 3L3VA 2G8UA 3QEVA 4BRKA 3SUNA 3R3LA 4DR1K 1NWKA 4JKEA 4KO0A 4X65K 3ZLJA 2O8DA 4KTZA 3OJUA 4FLZA 1VSMA 3ZT2A 4N41A 4BRFA 4BRAA 3VF2A 1NGBA 3TTFA 3C6TA 1VAZA 1U45A 1XUPO 4HCCA 4QOZB 1L3TA 4FK4A 4BRIA 3DLGA 4B9TA 1KVBA 1JCFA 4CD1A 3KIOA 4FWMA 2VWBA 1LWEA 3WNEA 1L3SA 4G9ZA 4CZFA 1KFDA 5FPNA 1HPZA 2HBKA 1W2BM 4IG3A 4RW7A 4I7FA 3QNNA 2O8CA 4YOTA 4ISFA 1FW6A 1ASUA 3H46O 3TTCA 2G8IA 3SAGA 4M3ZA 3TSUA 2VG5A 4B9UA 4G1QA 1S72N 2O8EA 1X1PA 3NF6A 3QDKA 3KK3A 3CMAN 3KHYA 4V19S 2O8DB 4CVNE 2QWQA 4M3YA 4EP5A 3QEWA 4CEZA 2HHWA 2P1JA 4E1MA 5HRSA 1QZ6A 1A5VA 4ZHRA 3W3DA 2ZJPL 3MECA 4B3SK 1NBWA 4RG8A 4ELUA 3AVHA 3LDPA 3OJSA 2G8KA 1BDGA 3IMXA 3THXA 4FJ7A 5GAHP 5M1QA 1WSGA 4Z4IA 5C15A 3NGYA 3GBTA 2UXDK 1BIUA 1Z26A 1JLQA 3LP1A 1RFQA 3QNOA 1U6ZA 5K14A 2BH1A 3OW2M 2KFNA 5GIOA 4JD2A 4BE2A 3UKRA 4F9OA 2XHBA 1K8KA 1BQMA 3DLKA 4NYFA 1S3XA 3B6PA 2GUPA 4JYAK
chains in the Genus database with same CATH topology
1OVQA 1VHXA 3BZCA 1IV0A 2OCEA 1NU0A 3BZKA 3PSFA 1NMNA 3PSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVQ A;  1VHX A;  3BZC A;  1IV0 A;  2OCE A;  1NU0 A;  3BZK A;  3PSF A;  1NMN A;  3PSI A; 
#chains in the Genus database with same CATH topology
 4CK3 A;  1QZ5 A;  1XHX A;  5MLC Q;  1WN7 A;  5FPM A;  3L2U A;  4BVO A;  5HLF A;  4CZH A;  4DFM A;  2DFF A;  4RW4 A;  1S5J A;  4JLH A;  4U67 L;  4M3W A;  3CPE A;  3H45 C;  1KAZ A;  5AZI B;  1BOT O;  2CGK A;  2DFH A;  4BDZ A;  4FJ9 A;  3KLF A;  3VEZ A;  5IT9 O;  2VCP A;  4DR6 K;  3SLC A;  1BGX T;  4Z4E A;  1IKX A;  4LFA K;  4CGD A;  3TAQ A;  2HST A;  3MXJ A;  2YNG A;  4KB1 A;  3THW A;  2E1Z A;  4OO1 J;  1NKC A;  4Z4F A;  3RMB A;  5AQR A;  4K8Z A;  4FM0 A;  4K41 A;  3TAP A;  3OYB A;  3K9J A;  4DU4 A;  4FPB A;  3CJ1 A;  3OYH A;  4BC4 A;  3JSM A;  5FDL A;  4C8M A;  5BRH A;  2CH5 A;  3VEO A;  4LSL A;  1GOB A;  3LDL A;  2P51 A;  2EX3 A;  4BDP A;  4CF0 A;  3CCR N;  1BCM A;  2ZGZ A;  4FW1 A;  2NRH A;  5C0Y A;  4CD3 A;  3LDS A;  2O4I A;  3HST B;  2IAJ A;  1DKG D;  3HXM A;  1TK0 A;  4CEA A;  4B3M K;  4FWO A;  5ADX H;  2WOM A;  3M8Q A;  4N47 A;  3ZSZ A;  3V9S A;  3SMP A;  3S3N A;  2HHH K;  1RDW X;  4CHY A;  4BRN A;  1H1V A;  5E84 A;  3TAE A;  4B9L A;  4WFN L;  3V9W A;  1GLB G;  3TPQ A;  2IIR A;  2OPP A;  2IDO A;  3DXM A;  4H03 B;  3RSE B;  3CCE N;  4R79 A;  4CJ3 A;  1E4F T;  4FWK A;  3U8X A;  3F73 A;  1ZBF A;  3R6M A;  4H5R A;  3HBT A;  4I9L A;  3V1O A;  1WBD A;  2F7T A;  5AQF A;  2DPN A;  2XY8 A;  5AQT A;  2PZS A;  4MO4 A;  5JS2 A;  1WSJ A;  4KI4 A;  4N5S A;  4H5V A;  2OCE A;  3C7N B;  4RCH A;  4KBO A;  3NF8 A;  2Q2R A;  3MEG A;  5CYM A;  3EEQ A;  3DRS A;  4CZL A;  4W5R A;  4XH4 A;  2OTL N;  3MEE A;  4BC2 A;  4CZK A;  4F4K A;  3AVN A;  4IDK A;  1IH7 A;  3D45 A;  1B92 A;  3U3Y A;  2QWR A;  5LJW A;  4IFE A;  3LP2 A;  4QAG A;  3SUQ A;  2O8C B;  4CI6 A;  1NGC A;  3I33 A;  4FSV A;  3QB0 A;  4F2S A;  1RTH A;  3I0S A;  4DFJ A;  3ENH A;  5AQZ A;  1VQ6 N;  4EAH D;  3BF1 A;  2HOE A;  3ID6 A;  4MDA A;  5AQJ A;  3L2R A;  3E1Y A;  5BRE A;  2P9P B;  3VQ6 A;  1K6Y A;  4DV4 K;  4L3Q A;  4DUZ K;  1BL3 A;  3HOT A;  5M1O A;  3C6H A;  4F3O A;  1O13 A;  1GOC A;  3KK7 A;  2HMI A;  2RPI A;  1N6Q A;  3NAE A;  2YHB A;  3IUC A;  4FYD A;  3ZET A;  1ATS A;  4B08 A;  4CJL A;  2XY5 A;  1HMV A;  4CZG A;  5C12 A;  2G8V A;  3ID8 A;  2P9K B;  3M8P A;  3VQQ A;  4XH1 A;  4A5A A;  3JAM O;  4JI5 K;  1CZ9 A;  4MLH A;  4AM7 A;  4LY7 A;  2OAN A;  1QVF M;  3MED A;  5JVG L;  4IO8 A;  3J7Z O;  4WE1 A;  3NH0 A;  1U47 A;  4YDU A;  2YHY A;  2ASO A;  3AVB A;  5M1P A;  3CYM A;  2HHX A;  3OY9 A;  2QXL A;  4FWS A;  2PYJ A;  3HL8 A;  3MWT A;  4KHU A;  3M8R A;  3IDH A;  1HNI A;  4E7L A;  3NBP A;  1X9W A;  2IOC A;  3V9Z A;  2KTQ A;  1C0G A;  1CZA N;  2WUS A;  2R7Y A;  5LJV A;  1SKW A;  2RE2 A;  4AHC A;  2VYP A;  4BR2 A;  1Q7Y O;  2KW4 A;  5C25 A;  2OYQ A;  4KI6 A;  2FSN A;  4BGA A;  3WEE B;  3CCU N;  3QEI A;  1XMQ K;  4YOV A;  4DQQ A;  4DV6 K;  4EZ6 A;  3PO5 A;  4FJ5 A;  4Z94 A;  4M7Y A;  5JMV A;  3A2F A;  4BRG A;  5JLH A;  4CJP A;  1SV5 A;  5HOO A;  3MDQ A;  4CBX A;  3L6Q A;  4YOR A;  3MAQ A;  1TUY A;  1MA9 B;  1NJY A;  3HI0 A;  3U3G A;  5EX5 A;  3PLA A;  4B1X B;  1DT9 A;  4FJM A;  1RT3 A;  3CG7 A;  3TAG A;  1QSS A;  1GLA G;  3IS9 A;  1NK8 A;  4CZM A;  1N5Y A;  4DTP A;  5HRR A;  3O1W A;  3LP0 A;  3ATV A;  1GLD G;  4YOY A;  1TGO A;  2G8F A;  4B1U B;  5GIP A;  4I2P A;  3WT0 A;  4LF8 K;  3NMU A;  3BF3 A;  3EN9 A;  2CGL A;  1RTI A;  2FXU A;  5BRF A;  4A62 A;  5KQ8 A;  1VSJ A;  3AAR A;  1YUW A;  5EVZ A;  3VQ8 A;  4DTU A;  4FZX C;  3E66 A;  1ZBH A;  1Y64 A;  3V81 A;  5CYQ A;  2E1Y A;  1HUX A;  4K42 A;  1EET A;  3VEN A;  4CEC A;  1VSK A;  3LDQ A;  2OZS A;  4LFC K;  1SKS A;  1OVQ A;  2Z1J A;  4A2B A;  1Q9X A;  2QWO A;  5HBM A;  3EYZ A;  2ASP A;  3AO1 A;  3AA5 X;  4DFP A;  1JXB A;  4CZE A;  4CES A;  1NMN A;  1VQM N;  1C6V A;  4CED A;  1VSE A;  4LSN A;  3O5B A;  3ZX0 A;  4CJF A;  3FZK A;  4DLG A;  4H5W A;  4CGF A;  4EFH A;  3VQ9 A;  1BA1 A;  3FZH A;  4DF8 A;  4B3O A;  1N33 K;  3ATU A;  5CR4 A;  3DLL L;  5TKW A;  3QIN A;  3K58 A;  3UKU A;  5BPN A;  3LP3 A;  4B1Y B;  2AP1 A;  4BAC A;  1S1X A;  5SWM A;  1DGK N;  4CJE A;  2E6L A;  3VF4 A;  4B3R K;  4FM2 A;  5AZJ A;  3LDO A;  3AO4 A;  3JYT A;  4DTO A;  3J80 O;  4GW6 A;  3RWU A;  3D2F A;  3OYM A;  3SPY A;  2DY4 A;  4KV8 A;  4JRP A;  4F8R A;  3A5M C;  2V51 B;  1BUP A;  4DQS A;  3P38 A;  4FLW A;  4EIA A;  2YCH A;  3VQ4 A;  2O8F A;  3ASM A;  2BAN A;  3QBW A;  2D4W A;  1QHT A;  3ZET B;  4DR2 K;  2FBX A;  3VPZ A;  3LAL A;  3IFR A;  1HYV A;  4FOE A;  4FK0 A;  3U9Z A;  1XC3 A;  2RKI A;  3QML A;  1REV A;  1XI1 A;  3AY9 A;  4DSK A;  3HM9 A;  4JKF A;  1NGF A;  4JS5 A;  3CC4 N;  4ELV A;  1BA0 A;  5J2N A;  4AH9 A;  1RT1 A;  3HVR A;  3OYJ A;  1Q8I A;  5AQL A;  3UB5 A;  3ULE A;  3ENO A;  1YJN N;  1NK5 A;  4CFC A;  2YNH A;  4WF9 L;  3EZ5 A;  3M6G A;  4MDB A;  1JLE A;  4DF4 A;  3PUF A;  3B6O A;  4CF1 A;  2YJE A;  3CIP A;  4KHY A;  1W97 L;  1QSY A;  3OS1 A;  3P1G A;  2P9L A;  1NOZ A;  1HQE A;  4FWN A;  1SL2 A;  4FJX A;  1NJX A;  4BRM A;  1TYQ A;  1NU0 A;  1N36 K;  4E7H A;  4GNI A;  4FWR A;  3AV9 A;  3LPT A;  4B8C A;  4JKG B;  5I9E B;  3SI6 A;  1NK7 A;  3HO1 A;  1EP4 A;  2P9N A;  3PIP L;  1VQ4 N;  1WSH A;  1VSH A;  3O4N A;  4KHN A;  4K43 A;  1TKD A;  1WAF A;  3HVT A;  5AQS A;  1VQO N;  4JK7 A;  4WYB A;  3CME N;  4HUF A;  2GV9 A;  2JWK A;  1NKB A;  5CZ1 A;  1LWC A;  1E4G T;  1LW0 A;  2FSJ A;  4LF9 K;  2YJF A;  1D8Y A;  4LC9 B;  2P9N B;  1BO5 O;  4AHR A;  4CJQ A;  1RCH A;  4H4O A;  3IAY A;  2VGM A;  3ZSR A;  1XMO K;  3IRX A;  3CCL N;  5KRT A;  3MN9 A;  3AO2 A;  3C6U A;  4OPJ A;  3TAF A;  3NH2 A;  1XHZ A;  2AA4 A;  4BRE A;  1Q81 O;  3D6R A;  5AQI A;  4DQR A;  3CXC M;  3O9T A;  5EY4 A;  1RBU A;  5FPE A;  3QO9 A;  1IKV A;  3O4Q A;  3O3H A;  3KWG A;  4FZZ A;  3R1X A;  2Y1J A;  1K8A O;  4FZY A;  1Z05 A;  3HP6 A;  2H3G X;  1KRP A;  2IGI A;  4H0P A;  3ZX3 A;  3TAR A;  3CFO A;  1OH8 A;  4BRO A;  2ZJQ L;  4JK8 A;  1WUA A;  4OPA A;  2YHA A;  3VMF B;  1GOA A;  2NRZ A;  4KB0 A;  1C0T A;  3DLR A;  5AQG A;  1V4S A;  3CF5 L;  2NLX A;  3THW B;  3THY B;  4BR7 A;  4DTN A;  4CEE A;  2FSK A;  1T44 A;  4I6M A;  1U04 A;  1VQ7 N;  3BEX A;  1YT3 A;  4DR4 K;  5M1K A;  1LCU A;  3AA4 A;  3O9S A;  1LOT B;  4W5O A;  2E2Q A;  1L3V A;  1RNH A;  2KZM A;  1Q9Y A;  3V9X A;  3FZM A;  4BR4 A;  2W40 A;  2UU9 K;  2ZD1 A;  4DV5 K;  1G15 A;  4GKJ K;  4B9V A;  3K9K A;  4CZJ A;  3SQ2 A;  1C1C A;  1C1B A;  1LW2 A;  2AJQ A;  4PL7 A;  3KTQ A;  4DUY K;  2IVO A;  1VRU A;  3K2P A;  5AZJ B;  3LWL A;  3MN6 A;  1RT5 A;  1NGE A;  1U2V A;  3M1F A;  3TR8 A;  1P8Z A;  1IJJ A;  4CK1 A;  3WXK A;  4BC3 A;  3SCX A;  4E1J A;  3CC7 N;  2D0C A;  4M3R A;  4DV3 K;  4DU1 A;  1M1K O;  1TAQ A;  2OPR A;  1A5W A;  5SZT A;  3EL2 A;  3L8B A;  1YF5 L;  3VEV A;  1XQS C;  4CHQ A;  2P5O A;  3CC2 N;  4PQU A;  4HUE A;  3CI5 A;  3DWL A;  1XC9 A;  3CQX A;  4IJA A;  1HJO A;  2OPQ A;  3VET A;  3SYZ A;  4WFB L;  3VES A;  2O8B A;  2P9K A;  1XNQ K;  1X9M A;  4C8N A;  3ZSY A;  4E1N A;  4FJI A;  3TAB A;  4C23 A;  1U4B A;  4BG8 A;  1NLV A;  3Q7B A;  1DEJ A;  3QLH A;  4JV5 K;  1S9G A;  4MQ3 A;  4FJJ A;  3GL1 A;  2V52 B;  5IWA K;  3ZEU B;  3DLH A;  1JCG A;  1TKZ A;  3A8Y A;  3D2E A;  5C2D A;  2P9S A;  1J54 A;  3TU5 A;  1JCE A;  1ASW A;  3PSF A;  4MO5 A;  3GE1 A;  3QIC A;  4W5Q A;  3MX2 A;  3MMV A;  5AFU A;  1NJW A;  4R5P A;  1NNE A;  4CE9 A;  3AVM A;  3LDN A;  1HRH A;  1VQ5 N;  3RVC A;  4H8K A;  2DFE A;  3AVF A;  3MN7 A;  2E4L A;  3MK6 A;  4XIU A;  2E6M A;  4KHP K;  2F8S A;  4PL8 A;  1QQC A;  1XNR K;  3L2V A;  5F1X A;  3IG1 A;  5I42 A;  4H0V B;  2E5L K;  1TL1 A;  3VGM A;  1JLC A;  3VQ7 A;  2A41 A;  4PUO A;  2HW3 A;  3ALY A;  1T6C A;  5BN9 A;  4XEI A;  3T1H K;  1JJ2 M;  4FJ8 A;  4YY3 K;  3CM6 A;  3QER A;  1JLF A;  4Y1C A;  4IOA L;  2XO7 A;  4I9Q A;  4UY8 O;  5AR0 A;  3S3M A;  1HKG A;  4KPY A;  1TKT A;  3NVM A;  4E0D A;  3QFP A;  1ZXO A;  3PY8 A;  5JS1 A;  4C8L A;  1RT2 A;  3E9P A;  3ENB A;  1QQN A;  3KWI A;  3CJA A;  5HL7 L;  3THV A;  4DS5 A;  4JI3 K;  3EE9 A;  3KLI A;  5CZ2 A;  2ZWH A;  4JI7 K;  3FR0 A;  3FZF A;  4W5N A;  1O1W A;  4FWL A;  1NGD A;  3OYK A;  2JGU A;  1ZBL A;  3HPG A;  4CFB A;  5J2P A;  5CE3 A;  3K5O A;  3L2Q A;  2F4V K;  4U7B A;  5AQO A;  3TTD A;  5D3G A;  1NM1 A;  1JLA A;  3QIP A;  5AQH A;  1J6Z A;  3BZC A;  1NOY A;  1U2V B;  3C0B A;  1U48 A;  2ZGY A;  3T3F A;  2P5G A;  1ATR A;  4DFK A;  1BIS A;  3MWP A;  4CCH A;  3WXJ A;  4GV9 A;  3RMD A;  3L4Q A;  1RBS A;  5AQX A;  1KVA A;  1C1A A;  1OH5 A;  3CJ7 A;  4OGE A;  4IBN A;  4UQG A;  4CW7 B;  1FJG K;  3ZCM A;  3KVG A;  4DQP A;  2OPS A;  3F5T A;  3SPZ A;  4LH4 A;  4M3X A;  2XRI A;  3BZK A;  5AQQ A;  4CFD A;  1ZYQ A;  1KC8 O;  4OLB A;  1MU2 A;  1W7A A;  4H0X B;  3TSQ A;  1GLL O;  1TK8 A;  1E3M A;  1KFS A;  1HKC A;  3AVK A;  4IJN A;  3M5R A;  3K5L A;  1J5O A;  3HTV A;  3CQ8 A;  4JKB A;  1Y97 A;  1TUU A;  5F2R A;  1YAG A;  3TSP A;  3TAN A;  4LD0 A;  2VGN A;  4LFB K;  2WBN A;  4X66 K;  4CEO A;  3DLE A;  2E2O A;  4FLT A;  4HTU A;  1BWF O;  3M3Z A;  4CHN A;  3HP9 A;  4BG9 A;  4C8K A;  2VWK A;  4IOX A;  3VQA A;  3VN5 A;  3DRP A;  4E7K A;  4H0Y B;  4H0O A;  3EY1 A;  1V4T A;  3KZB A;  1T03 A;  3O4W A;  3AVI A;  3OBW A;  3ULE B;  4DWI A;  1VHX A;  1B9D A;  4CEQ A;  3RR7 A;  4JKD A;  3ZSQ A;  1SKR A;  4NLB A;  4FO0 A;  4DKW A;  1HX1 A;  3SV3 A;  1ASV A;  3GOI A;  1J53 A;  3R9P A;  4NCA A;  3IKM A;  3D7E O;  1CXU A;  2Q0U A;  3QES A;  2ZJR L;  2Z1G A;  3WQU A;  2A3Z A;  4FLX A;  5BR8 K;  3CCV N;  5AJ3 K;  4QCL A;  4QS9 A;  4GVM A;  3T19 A;  1EX4 A;  2I7P A;  1GLF O;  2F9W A;  5KPR A;  5AQP A;  2Q3S A;  4K25 A;  4FLU A;  3SQ0 A;  1FKP A;  1YVN A;  1OVY A;  5DM6 L;  2ASM A;  3JS6 A;  3ZT0 A;  2YX6 A;  3P83 D;  2E2N A;  4J2E A;  3PV8 A;  3MXM A;  3E9L A;  4BR9 A;  2HF3 A;  2JWL A;  4NLC A;  1GLC G;  3PX4 A;  4JAX A;  1C0U A;  3KLE A;  1NK6 A;  1TV6 A;  4Q5V A;  1S1W A;  4CJ5 A;  4A57 A;  4Z4C A;  3VGK A;  4F2R A;  4DTR A;  4M7X A;  5LY3 A;  4OKE A;  4CJ4 A;  3TAM A;  4BDY A;  3OHR A;  4DV2 K;  2HHV A;  4JKH A;  4PWD A;  3WNF A;  3JXU A;  4BR0 A;  1IG9 A;  2OA8 A;  3MN5 A;  1DLO A;  3O8M A;  4HTL A;  4C1N K;  4IEI A;  3OYD A;  1S1T A;  3F9M A;  4AHU A;  3SV4 A;  4HCB A;  4IOC L;  4CGJ A;  4O0J A;  3O3G A;  1SUQ A;  4NCB A;  1IBL K;  4AHS A;  5KPZ A;  1JL1 A;  4CZI A;  1WSE A;  3S9H A;  3WXI A;  1I3A A;  3ITH A;  3LM2 A;  2P9I A;  1WLJ A;  4O44 A;  4B1Z A;  2KFZ A;  4FLV A;  2BDP A;  2ETJ A;  4IKF A;  4YFU A;  1RDA A;  3P5J A;  2E8A A;  4DTS A;  4K0K K;  2PBD A;  4KAZ A;  3G71 N;  3NFA A;  3RMA A;  3C65 A;  1UAX A;  2D0O A;  2Q0R A;  2E20 A;  4N56 A;  2HVI A;  1OH7 A;  1GLE G;  2KHO A;  4FCY A;  1TKX A;  3I8B A;  5FLX O;  3QET A;  1SL1 A;  3WXL A;  4KH6 A;  4JRQ A;  3T1A A;  1ATN A;  3RRH A;  4JNE A;  3CCJ N;  3V6D A;  2ZF5 O;  1VRT A;  2P9S B;  1QQO A;  2YHX A;  3ZEU A;  4DSI A;  5HRN A;  1GLJ O;  5J2Q A;  4OGC A;  1VSI A;  5B8H A;  4PHT X;  4CGH A;  1T8E A;  3A0I X;  3ULD A;  2GBZ A;  4JHD B;  2W41 A;  1Z25 A;  3OYN A;  3OYG A;  5JVH L;  3I56 N;  2NRT A;  3KKR A;  4KTW A;  4FWQ A;  3H1V X;  3QEP A;  2A5X A;  2PY5 A;  3L0Q A;  3A5L C;  3AVJ A;  1J9A A;  4Y1D A;  4CBW A;  4RW9 A;  1VQK N;  2Q97 A;  1CZB A;  4OLA A;  2QKK A;  2W6L A;  5AQU A;  3ZSO A;  1RT4 A;  4YOX A;  2HHT A;  5AFU H;  3BDP A;  2F9T A;  5TKY A;  1U49 A;  4CHZ A;  3K57 A;  1W0H A;  4FW2 A;  1FKO A;  3CQY A;  1ZBU A;  2UUA K;  2W42 A;  3SJJ A;  1EXQ A;  4CHP A;  3KLG A;  4H0T B;  4CER A;  1BU6 O;  4AF1 A;  2P9I B;  4JI6 K;  1BI4 B;  2QWN A;  2RHK A;  3QFU A;  3OA9 A;  2NNW A;  5AQK A;  4FL9 A;  4ZTF A;  4N76 A;  2BTF A;  2ITM A;  3J81 O;  4OPK A;  4F3T A;  4PKH A;  3H1Q A;  3RTV A;  4DTM A;  5J2M A;  3AA2 A;  4IFV A;  4ISE A;  2QWM A;  4M3U A;  4CGI A;  5HRP A;  4JI8 K;  5JIC A;  3VEY A;  5CHI A;  1QS4 A;  1NK0 A;  1HNW K;  3LM9 A;  3CCQ N;  1S9E A;  1F21 A;  1WNS A;  1T3V A;  3P39 A;  4DSE A;  4E7I A;  2FF3 B;  1JKH A;  1NGJ A;  2Z1I A;  1NMD A;  1Q82 O;  2I5J A;  2A6A A;  4CEB A;  4TSX A;  4DR3 K;  3U6F A;  1KLN A;  4J8F A;  1NKE A;  3HJF A;  2D1K A;  1FXX A;  3OTO K;  4FM1 A;  1YIT N;  2X74 A;  5LMU K;  1SQK A;  3AVC A;  3THY A;  4BRL A;  2Z1H A;  4M41 A;  3G25 A;  2D0B A;  1N32 K;  1HYZ A;  4KFB A;  1G99 A;  2D0P A;  5C2F A;  1A5X A;  5GIN A;  2GEM A;  3FGU A;  4BRQ A;  4JS4 A;  2V7Z A;  4JHD A;  1UA0 A;  4FXD A;  1TK5 A;  4J2A A;  1TVR A;  2QA4 N;  1ZBS A;  3EKU A;  1JL2 A;  4DTX A;  3LAN A;  1RT7 A;  4ELT A;  1VK0 A;  2P9P A;  1X9S A;  3KD5 E;  5E26 A;  3LAM A;  4A2A A;  1S6P A;  3S3O A;  1UWB A;  4BGB A;  4KH5 A;  3ZT3 A;  4O55 A;  4JI1 K;  1ITG A;  4DLE A;  2QXF A;  3PX0 A;  3LAK A;  3NGZ A;  2VQF K;  3H6E A;  4MLE A;  3CFR A;  3TI0 A;  1Q18 A;  1OH6 A;  4OPH A;  2QEX N;  1SZ2 A;  2IS3 A;  1N34 K;  1K9M O;  1VQ9 N;  1ESV A;  5LMN K;  2ITG A;  4JKG A;  3DM2 A;  1QHA A;  1HQU A;  4Z0U A;  1YVU A;  1IKY A;  2ATQ A;  3O08 A;  2NRR A;  1FK9 A;  3ZYY X;  3H08 A;  3I8D A;  5BRD A;  1EKE A;  4I2Q A;  1EQY A;  4DS4 A;  3N4P A;  1T7P A;  4HVJ A;  4DMN A;  1IV0 A;  5KTQ A;  4A5B A;  2IVN A;  1ZC6 A;  4WQ5 A;  1EWQ A;  1QVG M;  2PAV A;  4WFA L;  3KJV A;  4DSF A;  3ZSV A;  2GWJ A;  2A42 A;  5FRM A;  2BGG A;  3LWM A;  3AAP A;  2HHS A;  4DG1 A;  2W6K A;  3RMC A;  3P4I A;  1DTT A;  4HUG A;  4CF9 A;  4CIG A;  4BE1 A;  1N8R O;  5KGW A;  4AHT A;  4CBU A;  3NE6 A;  1J5E K;  2DTU A;  5GAD P;  3N4Q A;  4LF6 K;  3O3F A;  3VQP A;  4BRH A;  4Y0W A;  4M3T A;  3AVA A;  3H3O B;  1KXP A;  4BWJ A;  3BP8 A;  4B8A B;  4E7J A;  3DRR A;  4ILG B;  1YJW N;  1NGG A;  1D4X A;  3EO3 A;  4CIF A;  1C0M A;  1LAV A;  1C0F A;  1YTU A;  3O9Q A;  3AVG A;  2O8F B;  1RIL A;  3O1B A;  1Z6R A;  1K8K B;  1QQM A;  5BPL A;  2Q1N A;  2HNZ A;  2NRW A;  3CPW M;  4DV1 K;  4IG0 A;  3OYL A;  4OJR A;  4BRC A;  2HB5 A;  3D2F B;  3VEW A;  3HRG A;  3ZSW A;  1RBR A;  3HYF A;  3VQ5 A;  3C6A A;  2HBL A;  4JKC A;  4Z4G A;  5ADX A;  3KKS A;  1KD1 O;  4IZ9 A;  4FVU A;  4PA1 A;  3OVN A;  3UKU B;  4ID1 A;  1RDC A;  1MWK A;  2Q31 A;  3KD1 E;  4CGG A;  2A40 A;  3DXK A;  2VG7 A;  3NF9 A;  4CJR A;  4KHW A;  1CLQ A;  1I39 A;  4LF4 K;  4FJN A;  3Q7C A;  4EHU A;  4JK9 A;  4NO7 A;  4W5T A;  1YHQ N;  4DSJ A;  3QIO A;  5AQN A;  3EZW A;  3FE1 A;  4DTJ A;  1NGA A;  2NRX A;  2VWJ A;  4FWP A;  4GVE A;  4B9N A;  3WUH A;  1TYQ B;  4ISG A;  1VSF A;  3LPU A;  1WB9 A;  5FPD A;  2J4R A;  3G0Z A;  4JI2 K;  3CET A;  2OTJ N;  4KRF A;  1VSD A;  3AO5 A;  1DTQ A;  2P9L B;  4DHY A;  1YJ9 N;  4EHT A;  3QBX A;  3BGR A;  4BRD A;  3NGI A;  3VOV A;  4GKK K;  4GV6 A;  3OYI A;  2CH6 A;  2BUP A;  4CJV A;  1HNV A;  4M45 A;  4B9S A;  1D5A A;  4KTQ A;  5AQW A;  1YTA A;  1CXQ A;  2NRV A;  3AVL A;  4B9M A;  3VF6 A;  5EOY A;  4BR5 A;  4CK2 A;  4DCH A;  5M1N A;  3FZL A;  1HJR A;  2X78 A;  5EXW A;  4O5B A;  3HZ6 A;  3NHG A;  5FRN A;  4A61 A;  2YNF A;  3DAW A;  1QE1 A;  1TL3 A;  4OX9 K;  3OBY A;  3L2W A;  4O8U A;  4Z4H A;  3OS0 A;  4M42 A;  4CJK A;  4WQ4 A;  3HSC A;  4RWT A;  4BWM A;  1RBV A;  2G8H A;  2O4G A;  5ELZ A;  3V1R A;  4JKA A;  1LV5 A;  4ZTJ A;  1S6Q A;  1IG8 A;  1SAZ A;  4OKK A;  3LL3 A;  5GAE P;  4NXN K;  2HMP A;  2F8T A;  3SZ2 A;  1S1V A;  1R59 O;  1D9F A;  2ZE2 A;  2E2P A;  2FBV A;  4FJK A;  3U9D A;  2WC9 A;  3K5N A;  3VQB A;  3M8S A;  2PYL A;  3BY5 A;  1KAX A;  1WOQ A;  2WTU A;  4IDH A;  3VQD A;  4DQ8 A;  4KHQ A;  3OYE A;  5KRS A;  3O80 A;  3V9U A;  3MXI A;  1T05 A;  2UXC K;  5C24 A;  5A2Q O;  4O0I A;  4WQ5 C;  2BE2 A;  3SBT A;  3I55 N;  1MWM A;  1NJI O;  3A5O C;  3DXK B;  1RTJ A;  4PKI A;  2X6N A;  3T69 A;  1SL0 A;  3WEE A;  2EHG A;  1NGH A;  2HVH A;  4KH4 A;  3D0P A;  2OZM A;  1BI4 A;  3WXM B;  3NCI A;  5I3U A;  2HBM A;  1BG3 A;  3EKS A;  4I6M B;  1WSF A;  5JLF A;  4FLY A;  4KHS A;  2GWK A;  3CJ9 A;  3PIO L;  5DK5 A;  3VTI A;  3SUO A;  4AHV A;  3VA3 A;  2HND A;  1UA1 A;  1HNZ K;  4B9Q A;  1RDB A;  2XY7 A;  4ICL A;  3A5N C;  3CM5 A;  1VQP N;  4YOW A;  3L4I A;  3PX6 A;  1BHL A;  4NCG A;  3W0L A;  5GAG P;  4HHT A;  3E01 A;  4CEF A;  4MFB A;  4NXM K;  3FLC O;  2I7N A;  2RN2 A;  2B4J A;  2FC0 A;  2QKB A;  4DV0 K;  2KKZ A;  4X64 K;  3DOK A;  1UOC A;  3NH1 A;  3G4S N;  4BVP A;  2GEL A;  2A1S A;  3T1Y K;  2ZM6 K;  4IWV A;  3V1Q A;  4JEP A;  2YV0 X;  1JLG A;  3SUP A;  3VQC A;  3SQ4 A;  2HNY A;  3SAF A;  3AGR A;  4BRP A;  3AAQ A;  3VTH A;  3O9R A;  1R0A A;  1IBM K;  4O4G A;  4A59 A;  3OYF A;  2YKM A;  4CFA A;  4ILH A;  4IEE A;  1IO2 A;  2O8B B;  1RDD A;  3G6E N;  3RSE A;  3VA0 A;  3DLB A;  2EWS A;  3OYC A;  3J7Y P;  3CD6 N;  1YXQ A;  2FF6 A;  2B6A A;  4CF8 A;  4Q0B A;  5F0X A;  2QWP A;  3SNN A;  4PKG A;  2E88 A;  2B5J A;  4GV3 A;  3S41 A;  3OS2 A;  3AA3 A;  3HT3 A;  2G8W A;  1KVC A;  4O5F A;  5E41 A;  4FJH A;  4YOU A;  2FBY A;  3F2K A;  3DI6 A;  2HHQ A;  3R8E A;  3C7N A;  4FPA A;  5C10 A;  3WQT A;  2ZQB A;  4AQY K;  4CF2 A;  2QTD A;  1HKB A;  5LL6 Z;  3UE5 A;  3VGL A;  4IO9 L;  1HYS A;  4AIL C;  1X9J A;  3VQE A;  3DOL A;  2WFB A;  1SS6 A;  4KRE A;  1TAU A;  3CER A;  3HPH A;  3C95 A;  3K59 A;  4FK2 A;  1BIZ A;  1YI2 N;  1WSI A;  3EE8 A;  2YI1 A;  3OYA A;  3DYA A;  1NK4 A;  1RDU A;  1QSL A;  3QEX A;  4B1V A;  5AQV A;  2LSN A;  4FOI A;  3J8A A;  3WNH A;  3VEX A;  3ZSX A;  2NUB A;  4GY2 B;  3CJC A;  5DMR A;  3DMJ A;  4B3T K;  1MDU B;  3TWH A;  2CGJ A;  1VQN N;  4GMJ B;  2QK9 A;  3ISN C;  4NYN A;  2FLO A;  2QW9 A;  4CJU A;  2Q36 A;  3NDK A;  5M1F A;  4BC5 A;  3FFK B;  5AZI A;  2FBT A;  1LWF A;  3HPO A;  3SAH A;  3BUZ B;  3H3N O;  3SK3 A;  2VG6 A;  3AGK A;  4RW6 A;  3F9K A;  2P9U A;  4L8R B;  5CY4 A;  1EO1 A;  3PSI A;  4J2D A;  3FFI A;  4M63 C;  1QTM A;  4E19 A;  2P9U B;  2A1R A;  1WBB A;  3KLH A;  3K5M A;  4LH5 A;  5KI6 A;  4RTF D;  2KQ2 A;  1VSL A;  1WAJ A;  3ZT4 A;  1KQS M;  2X6S A;  3WNG A;  1KLM A;  2QI2 A;  3V4I A;  4WQ4 C;  3NF7 A;  4IXC A;  4X62 K;  1Q86 O;  4DR5 K;  4QS7 A;  1X3N A;  4EZ9 A;  2HHU A;  2D5R A;  1K73 O;  1RTD A;  2UYT A;  2V7Y A;  4DQI A;  3O6W A;  4H4M A;  3RRG A;  3L3U A;  4BE0 A;  3UIQ A;  3NVK A;  4RW8 A;  3MCP A;  1OKJ A;  3HK2 A;  3LZI A;  1KSP A;  1KTQ A;  4FVM A;  3GG4 A;  2KLA A;  5KQD A;  1NG9 A;  2XY6 A;  2GUI A;  3DXM B;  4DR7 K;  5DM7 L;  4AM6 A;  2O8E B;  2IC3 A;  4CHO A;  3VER A;  3LZJ A;  3J7A P;  3KK1 A;  2HBJ A;  3ZT1 A;  1S1U A;  4JD2 B;  4CJS A;  1ZBI A;  1P90 A;  4YHH K;  4IFY A;  3G10 A;  1YIJ N;  1EWR A;  1BQN A;  1NJZ A;  1L3U A;  1W9H A;  5KPT A;  2YNI A;  4H5T A;  3CFP A;  4JI0 K;  4QS8 A;  3THX B;  4JI4 K;  4PY5 A;  5AQY A;  5BN8 A;  4C1N I;  1HPM A;  3GDQ A;  3AO3 A;  4C8O A;  3PO4 A;  1KAY A;  5AQM A;  4BQL A;  1KCF A;  1M90 O;  3ZX2 A;  4YNQ A;  4KKO A;  2F96 A;  3P31 A;  1RT6 A;  4LF5 K;  4ILJ A;  3SJH A;  1S22 A;  4J2B A;  5HRO A;  2HF4 A;  1RBT A;  2NZT A;  4FJL A;  2JLE A;  3O9U A;  5KGX A;  2RF2 A;  3CHW A;  2QWL A;  3D2E B;  5J1E A;  4BQZ A;  4DB3 A;  5HP1 A;  4OKJ A;  1BCO A;  4H5N A;  4ID5 A;  3CCM N;  2IVP A;  4EP4 A;  2VQE K;  1L5U A;  4XH5 A;  4E89 A;  5EU7 A;  4K8X A;  1NK9 A;  1X3M A;  1VQ8 N;  3SQ1 A;  4OVL A;  2YKN A;  1JXE A;  3SMS A;  1VQL N;  3MX5 A;  1NGI A;  1IBK K;  3K0S A;  5H1S Q;  3MCA B;  2UUB K;  4DV7 K;  3B8A X;  1HLU A;  4CIE A;  1HNX K;  3RR8 A;  4YDU C;  2GTD A;  5T7B A;  5BPM A;  2KZZ A;  4DU3 A;  4BY9 C;  4FJG A;  3CJB A;  4CJW A;  4E3S A;  4WCE L;  3SBG A;  3DJC A;  2YHW A;  2UUC K;  3KK2 A;  1ILY A;  3UKR B;  3T7Z A;  3U4L A;  1IKW A;  1XWL A;  4HWI A;  2WON A;  1I94 K;  3HOS A;  1JLB A;  4CJ7 A;  1RGI A;  4O8K A;  1HR0 K;  1B9F A;  2GX9 A;  5FRO A;  4NB4 A;  3C94 A;  3CCS N;  4DSL A;  4B1W B;  4CJT A;  4JN4 A;  2PFU A;  2D0A A;  3I0R A;  5BR9 A;  1D9D A;  3E9O A;  3HM8 A;  2Y1I A;  4LF7 K;  2UXB K;  5C42 A;  1T6D A;  2QM1 A;  1LAW A;  3L3V A;  2G8U A;  3QEV A;  4BRK A;  3SUN A;  3R3L A;  4DR1 K;  1NWK A;  4JKE A;  4KO0 A;  4X65 K;  3ZLJ A;  2O8D A;  4KTZ A;  3OJU A;  4FLZ A;  1VSM A;  3ZT2 A;  4N41 A;  4BRF A;  4BRA A;  3VF2 A;  1NGB A;  3TTF A;  3C6T A;  1VAZ A;  1U45 A;  1XUP O;  4HCC A;  4QOZ B;  1L3T A;  4FK4 A;  4BRI A;  3DLG A;  4B9T A;  1KVB A;  1JCF A;  4CD1 A;  3KIO A;  4FWM A;  2VWB A;  1LWE A;  3WNE A;  1L3S A;  4G9Z A;  4CZF A;  1KFD A;  5FPN A;  1HPZ A;  2HBK A;  1W2B M;  4IG3 A;  4RW7 A;  4I7F A;  3QNN A;  2O8C A;  4YOT A;  4ISF A;  1FW6 A;  1ASU A;  3H46 O;  3TTC A;  2G8I A;  3SAG A;  4M3Z A;  3TSU A;  2VG5 A;  4B9U A;  4G1Q A;  1S72 N;  2O8E A;  1X1P A;  3NF6 A;  3QDK A;  3KK3 A;  3CMA N;  3KHY A;  4V19 S;  2O8D B;  4CVN E;  2QWQ A;  4M3Y A;  4EP5 A;  3QEW A;  4CEZ A;  2HHW A;  2P1J A;  4E1M A;  5HRS A;  1QZ6 A;  1A5V A;  4ZHR A;  3W3D A;  2ZJP L;  3MEC A;  4B3S K;  1NBW A;  4RG8 A;  4ELU A;  3AVH A;  3LDP A;  3OJS A;  2G8K A;  1BDG A;  3IMX A;  3THX A;  4FJ7 A;  5GAH P;  5M1Q A;  1WSG A;  4Z4I A;  5C15 A;  3NGY A;  3GBT A;  2UXD K;  1BIU A;  1Z26 A;  1JLQ A;  3LP1 A;  1RFQ A;  3QNO A;  1U6Z A;  5K14 A;  2BH1 A;  3OW2 M;  2KFN A;  5GIO A;  4JD2 A;  4BE2 A;  3UKR A;  4F9O A;  2XHB A;  1K8K A;  1BQM A;  3DLK A;  4NYF A;  1S3X A;  3B6P A;  2GUP A;  4JYA K; 
#chains in the Genus database with same CATH homology
 1OVQ A;  1VHX A;  3BZC A;  1IV0 A;  2OCE A;  1NU0 A;  3BZK A;  3PSF A;  1NMN A;  3PSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...