1NMTA

N-myristoyl transferase from candida albicans at 2.45 a
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
392
structure length
392
Chain Sequence
b'EGPIDKLKTPEDVPNDPLPLISDFEWSTLDIDDNLQLDELYKLLYDNYVEDIDATFRFKYSHEFFQWALKPPGWRKDWHVGVRVKSTGKLVAFIAATPVTFKLNKSNKVIDSVEINFLCIHKKLRNKRLAPVLIKEITRRVNKQNIWQALYTGGSILPTPLTTCRYQHRPINWSKLHDVGFSHLPPNQTKSSMVASYTLPNNPKLKGLRPMTGKDVSTVLSLLYKYQERFDIVQLFTEEEFKHWMLGHDENSDSNVVKSYVVEDENGIITDYFSYYLLPFTVLDNAQHDELGIAYLFYYASDSFEKPNYKKRLNELITDALITSKKFGVDVFNCLTCQDNTYFLKDCKFGSGDGFLNYYLFNYRTFPMDGGIDKKTKEVVEDQTSGIGVVLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-MYRISTOYL TRANSFERASE
publication title Crystal structure of the anti-fungal target N-myristoyl transferase.
pubmed doi rcsb
source organism Candida albicans
molecule tags Myristylation
total genus 121
structure length 392
sequence length 392
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 1997-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1nmtA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1nmtA02
1S7FA 4KVXA 3DSBA 3R1KA 4AVCA 4HNYB 5KTCA 5C88A 2FIWA 4H6UA 3S6GA 4E2AA 4AVBA 1M4GA 1P4NA 3JUWA 3W6SA 4DNCA 1WK4A 4CAVA 4JWPA 3ZZIA 3VWDA 2D4OA 4F6AA 4YGOA 1IICA 1Q2DA 2Y0MA 2BSWA 3DDDA 1XF8A 4MI4A 2R8VA 1VKCA 4L89A 2OU2A 3G8WA 4U5YA 4QB9A 4B5PB 2Z11A 4MHDA 2B5GB 2Z10A 5J8FA 3TOAA 4XNHB 4U9YA 4CAWA 2H5MA 3S6FA 4YFJA 2X7BA 1YGHA 3P2FA 1B6BA 2EUIA 3FXTA 1MK4A 1VHSA 2ARHA 4B5OA 1K4JA 4ZBGA 2VEZA 2PDOA 4KUBA 4B5PA 1M4DA 5HMNA 3W6XA 1M4IA 2VBQA 4MY0A 4NXYA 3TO6A 1IIDA 1BO4A 4LX9A 2REFA 1Y9KA 2BEIA 1YR0A 4AG9A 2PR1A 1R57A 2OZGA 3TFYA 1YX0A 1I21A 3LD2A 5CNPA 3D2MA 1KUXA 2FT0A 1N71A 2HUZA 1L0CA 4OLLA 1RXTA 1IYLA 3S6HA 1KZFA 3TO9A 4H6ZA 4IF5A 2QIRA 2VI7A 3SXOA 1GHEA 5HH1A 1IB1E 5ISVA 1QSTA 2GANA 4Y49B 5E96A 5IV0A 1TIQA 5IB0A 2GIVA 4NF1A 2PRBA 1Z9UA 3TO7A 2GE3A 3V8IA 2G3TA 2ZPAA 3LODA 4HNWB 3GY9A 4IUSA 1XE4A 2Q04A 1CM0A 1Z4RA 1YREA 4KOVA 1Z4EA 2FIAA 1YK3A 4JJXA 2FXFA 5KTDA 3PP9A 1S7KA 3PZJA 2KCWA 4XPLA 2BL1A 3EXNA 4KUAA 3R9FA 2J8NA 4R87A 1S7LA 2P6GA 5F46A 3I3GA 2R1IA 4KOSA 4J3GA 3CXSA 1PU9A 4KOXA 2VZYA 4F0YA 1BOBA 4RI1A 2P6EA 1KUVA 1QSMA 4HKFA 5IX3A 5KTAA 2Q44A 3F5BA 4R57A 3S6KA 4BMHA 4E8OA 2P6FA 5H84A 5J8CA 4JLYA 3QB8A 4NSQA 3FRMA 3FB3A 4EVYA 1FY7A 1M1DA 4FD7A 3TT2A 4KZTA 3T9YA 4CRZB 1YVKA 3E0KA 4FD6A 4KVOE 4HNXB 1QSOA 2I79A 4KLVA 1NSLA 2PSWA 2VXKA 1KUYA 3EO4A 3C26A 2CNSA 1Q2CA 3IGRA 2AJ6A 2ATRA 4XPDC 4R3LA 4CS0B 2O28A 3DR8A 4UWIA 3ZJ0A 3GKRA 2PC1A 2JLMA 3PGPA 4X5KA 1S3ZA 2B4BA 4U9ZA 4PSXA 2FCKA 3EFAA 3K9UA 4UWJA 4PV6A 1PUAA 2JEVA 2OH1A 1S60A 2G0BA 5EBVA 3T90A 5F48A 2QMLA 3FBUA 3R95A 2I00A 3I9SA 3JVNA 2EVNA 3WR7A 2WPXA 3MGDA 4AVAA 2DXQA 3N7ZA 2Q7BA 1U6MA 2HV2A 3DNSA 3VWEA 3BJ7A 4KOUA 5JPHA 3TE4A 2A4NA 4H89A 4KOYA 1V0CA 4QBJA 3D8PA 3R9GA 2B4DA 4II9A 5FVJA 2RC4A 4YRHA 5GCNA 2PR8A 5EC4A 3B8GA 2QECA 1XEBA 4Y49C 2VZZA 2ZW7A 3BJ8A 4M3SA 1YLEA 4PK3A 4UA3A 3TOBA 4AG7A 4R9MA 3RYOA 3CXPA 3SHPA 4KOTA 5F47A 4JD6A 4OADA 1CJWA 2D4PA 2FE7A 1WWZA 2R7HA 1IYKA 2ZXVA 3CXQA 1QSNA 2FL4A 3DR6A 2OB0A 4L8AA 2VQYA 4QC6A 1OZPA 2ZW4A 4R3KA 3G3SA 4LUAA 4I49A 2ZW6A 4RS2A 4UBRA 4MJ8A 3H4QA 2B3VA 1SQHA 1M44A 2HQYA 4MY3A 4AB7A 1QSRA 4XPDB 5DWMA 3FNCA 2B58A 2F5IA 2PQ8A 2G3AA 4GS4A 2REEA 1S5KA 4MBUA 1S7NA 3IWGA 3D3SA 5C82A 3F8KA 2OZUA 2CY2A 1UFHA 2NMTA 2P0WA 4PSWA 4PK2A 3FYNA 3R9EA 1I1DA 3SXNA 1Y7RA 3OWCA 2CNMA 3F0AA 2FS5A 2FSRA 4FD4A 2Z0ZA 2B5GA 4ORFA 4XNHC 5H86A 4KVME 2CNTA 4FD5A 4QVTA 4M85A 4KLWA 1B87A 5DWNA 3QAHA 1Y9WA 3EC4A 1YVOA 4KORA 2IL4A 3TTHA 2J8RA 1LRZA 2OZHA 2Q4VA 4K30A 5I0CA 1MJ9A 3EY5A 1ON0A 2B4DB 2AE6A 4XPKA 3GYAA 1NMTA 4CAXA 4E0AA 3BLNA 3D2PA 5JQ4A 1P0HA 3FIXA 4QUSA 1MJAA 1J4JA 4KOWA 1XIXA 1Q2YA 2K5TA 2C27A 4JXQA 3R96A 2BUEA 4CRYB 2Q4YA 3NE7A 1XMTA 2JDDA 2WPWA 3W91A 1NE9A 3KKWA 4NEXA 2B3UA 2J8MA 4OAEA 4ONUA 4JXRA 4NCZA 2ZW5A 3P2HA 2Q0YA 2JDCA 3TCVA 3UY5A 1I12A 5F49A 2R98A 1MJBA 1RO5A
chains in the Genus database with same CATH superfamily
1S7FA 2ZEPA 4KVXA 3DSBA 3H8FA 3R1KA 4AVCA 2EO8A 4HNYB 5KTCA 4NFRA 5C88A 2FIWA 4H6UA 3S6GA 4E2AA 4AVBA 1M4GA 1P4NA 2PVVA 3JUWA 3W6SA 2ABZA 4DNCA 5F09A 1WK4A 4CAVA 4JWPA 3ZZIA 3S9NA 1EE3P 1YSJA 2ZEDA 2Z3KA 3BHXA 4NGMA 4MCRA 1ZLHA 2D4OA 1LANA 4ZX9A 3VWDA 1Z5RA 4F6AA 4NGTA 4YGOA 2PIZA 1IICA 1Q2DA 1TXRA 5G20A 3TX8A 4P4EA 3B3VA 4MCPA 2Y0MA 4C7HA 3LWUA 2BSWA 3QAYA 4NGRA 3DDDA 5A28A 1XF8A 2BOAA 4MI4A 2WUUA 2WZNA 4ONWA 4P44A 2R8VA 1VKCA 3WC6A 4L89A 2ZEGA 4BINA 4OKOA 4ZX8A 2OU2A 3G8WA 4KS9A 2PJBA 3S9MA 1LAMA 4U5YA 4CGMA 4G1PA 4QB9A 2EWBA 4TWEA 2Z11A 4B5PB 4Q38A 1XRYA 4MHDA 2B5GB 5THWA 2Z10A 5J8FA 1JQGA 4XNHB 3TOAA 4PXDA 4U9YA 2CTCA 4CAWA 2H5MA 3S6FA 4YFJA 4P10A 5AG5A 2X7BA 1YGHA 3P2FA 5LYLA 1FNOA 1B6BA 2ZENA 1LCPA 2BO9A 4OIWA 2EUIA 3FXTA 1MK4A 1VHSA 1AYEA 2ARHA 4B5OA 1K4JA 2Z3MA 4M6GA 4ZBGA 4MFJA 5HVFA 2Z3PA 3VATA 3PB4X 2Z3NA 3VARA 4LQGA 3D4UA 2GLFA 2VEZA 2QYVA 4YWYA 2PDOA 3BI1A 3DGVA 2O53A 4KUBA 4P6YA 4B5PA 1M4DA 5HMNA 1XFOA 4UF4A 4B11A 2JBJA 5K8NA 3GB0A 3PRTA 4IAVA 3W6XA 1M4IA 2VBQA 4A2ZA 4MY0A 3WABA 4NXYA 2ZEEA 3B3WA 3TO6A 5LRJA 1BO4A 1IIDA 4LX9A 2REFA 3CPAA 1Y9KA 3FX6A 2BEIA 2ODFA 1YR0A 4P4DA 4AG9A 1BLLE 1R57A 2OZGA 2PR1A 3TFYA 1YX0A 1I21A 1Y7EA 3LD2A 1R3NA 3D2MA 5CNPA 1KUXA 2FT0A 2J9AA 4R8FA 4UFWA 1CPXA 1N71A 4OC4A 4B10A 2HUZA 1BAVA 1HDUA 1L0CA 3IWWA 4OLLA 2AFZA 4DYOA 4OIDA 4X8IA 4A94A 1RXTA 4BBHA 4YU9A 1IYLA 3S6HA 3SJGA 1KZFA 3IFEA 3TO9A 2BCOA 3IO1A 4P4IA 1F2PA 4OMEA 4H6ZA 4IF5A 2QIRA 5LRGA 4M6HA 1CBXA 4OC2A 4KSAA 2GU2A 2VI7A 3SXOA 1CP7A 1GHEA 2PJ2A 5HH1A 2PJ3A 1IB1E 5ISVA 1QSTA 2GANA 4ZY0A 4Y49B 1PCAA 5E96A 1ARMA 5IV0A 2AFUA 1KWMA 1TIQA 3SJFA 1CP6A 5G21A 2ZELA 5IB0A 2GIVA 3IU2A 2PRBA 1Z9UA 3D66A 2GE3A 3KGQA 4NF1A 4O23A 3TO7A 3KL9A 4NJQA 2PJ7A 3V8IA 1Z2LA 2G3TA 2ZOGA 2ZPAA 3LODA 3N5FA 4HNWB 3WC5A 3NH8A 4CPAA 3GY9A 4IUSA 1XE4A 5BWAB 4WWVA 3ISXA 4MMOA 3B3CA 4MCQA 2Q04A 4UFVA 4UCPA 1CM0A 1Z4RA 4LQ6A 3K9TA 1YREA 4MCSA 4KOVA 1Z4EA 3GIUA 3CT9A 4CAFA 2FIAA 4FUUA 4TNUA 1YK3A 1TKHA 4EMEA 4JJXA 2FXFA 5IB9A 3H8EA 5KTDA 3LMSA 1UWYA 3PP9A 4X2TA 3KHXA 2IJZA 1S7KA 1IU8A 2AFSA 3PZJA 2KCWA 4B13A 1AUGA 4XPLA 4UEFA 2BL1A 3EXNA 4KUAA 3KR4A 3R9FA 5JH9A 2J8NA 4R87A 4R6TA 4MFKA 4MFPA 1QMUA 2FVGA 1ZG7A 1S7LA 2P6GA 5F46A 5JGFA 3PFOA 8CPAA 3I3GA 3RZAA 2DPTA 2R1IA 4KOSA 3D68A 3D7HA 4OC0A 1CX8A 1F57A 1M4LA 4J3GA 1GYTA 1Q7LA 3FF3A 3RNZA 3FJUA 3CXSA 2YNDA 2Z3OA 1TKJA 4A39A 2CTBA 1IY7A 2PVWA 4NGPA 1Z8TA 2G9DA 2HB6A 1PU9A 4OC1A 3B2YA 4KOXA 1ZG9A 2VZYA 4F0YA 1BOBA 4RI1A 5D29A 2P6EA 3VH9A 3WT4A 3V38A 1KUVA 3SI1A 3CZXA 1QSMA 1TKFA 4FWUA 4HKFA 2AFMA 5IX3A 5KTAA 4MHZA 2Q44A 3F5BA 1ELMP 2CF4A 2OOTA 3QNVA 6CPAA 2DF5A 4PPZA 4R57A 4UIAA 3RBUA 2Q43A 3S6KA 4BMHA 4E8OA 5LRKA 4MRIA 2P6FA 5H84A 5J8CA 2ZEMA 1ELLP 4JLYA 3QB8A 4NSQA 4A31A 3FRMA 3FB3A 4EVYA 1FY7A 2I3CA 1M1DA 4FD7A 1LAPA 3TT2A 3B7IA 4KZTA 3T9YA 1TF9A 2NYQA 4CRZB 3H8GA 1YVKA 3E0KA 4FD6A 3SJEA 4KVOE 1H8LA 4HNXB 2ZEFA 1QSOA 3FEEA 2I79A 5LYDA 3IJ3A 2C6PA 4KLVA 3CPXA 4UCNA 1NSLA 2PSWA 4IK2A 4PXEA 2VXKA 1KUYA 4C2XA 3EO4A 3C26A 2CNSA 3IWEA 4RUHA 4NGSA 4B12A 4A38A 1Q2CA 3IGRA 2AJ6A 5EMIA 2ATRA 4XPDC 1ZO0A 4CGPA 4Q36A 4R3LA 4DJLA 4H2KA 4CS0B 2O28A 3DR8A 4C7IA 4UWIA 3KR5A 2QJ8A 5AGEA 3GKRA 3ZJ0A 2PC1A 2PJ9A 2C6CA 3SI2A 1JWQA 2C1CA 2JLMA 3PGPA 2YGWA 1DE4C 1R43A 4X5KA 1S3ZA 2B4BA 2F8HA 2AFWA 4U9ZA 4PSXA 2FCKA 3EFAA 5AG6A 3K9UA 2CXAA 1YW4A 5I4MA 4UWJA 4C68A 4PV6A 1PUAA 1ARLA 4ZY2A 2JEVA 4C2YA 2OH1A 5AG7A 5J1QA 2WSAA 2V77A 1S60A 2G0BA 1QQ9A 4PXCA 3FECA 1AMPA 4F8ZA 1ZG8A 5EBVA 5G1ZA 3T90A 5F48A 2QMLA 3FBUA 1YMEA 4MFQA 3R95A 5LYFA 1VIXA 4P4JA 2I00A 3I9SA 3JVNA 3TC8A 2EVNA 3WR7A 2ZOFA 3CDXA 4A30A 3RAMA 2WPXA 1VHEA 3MGDA 4AVAA 3BXMA 2DXQA 1IGBA 2OR4A 3N7ZA 4UCMA 1IOIA 1LOKA 2RFHA 3WC7A 2Q7BA 1U6MA 2Q4ZA 2HV2A 1YW6A 3DNSA 4OC5A 5CPAA 3VWEA 3BJ7A 4KOUA 5HVGA 5JPHA 3TE4A 2A4NA 3IC1A 4H89A 1YLOA 3FVLA 4CYNA 2Q7SA 2YNCA 3KASA 4KOYA 1V0CA 4QBJA 3D8PA 3JRUA 3R9GA 3FMCA 2JBKA 2PE3A 3H5ZA 5G22A 3B3TA 2PJ0A 2B4DA 4II9A 4K3NA 4P45A 5FVJA 2RC4A 3KQZA 2WYRA 3IU1A 3PB7X 4YRHA 2Q51A 3B3SA 5GCNA 4KSIA 4RN7A 2DEAA 2IQ6A 2PR8A 5EC4A 4GM5A 3B8GA 2EK9A 2QECA 2YNEA 1XEBA 4Y49C 2PJ6A 2VZZA 2ZW7A 3BJ8A 3KQXA 1YLEA 1BPNA 4KSFA 4M3SA 4PK3A 4UA3A 3SI0A 4R9MA 3TOBA 3RYOA 3PFEA 3CXPA 4AG7A 3PB9X 3SHPA 4KOTA 5F47A 3D7DA 4JD6A 4OADA 2PJ1A 1CJWA 2CIJA 4JYWA 1DTDA 2NSMA 2D4PA 2HC9A 2FE7A 1VGYA 1WWZA 2R7HA 4WJBA 1IYKA 2ZEOA 2ZXVA 4FAIA 3S9LA 3CXQA 4R7MA 1QSNA 3ISZA 1FT7A 1LFWA 2FL4A 2PJ4A 3KI9A 3DR6A 2OB0A 4L8AA 3NA6A 2VQYA 2V8GA 3KZWA 4P4BA 4QC6A 4A37A 1BPMA 2AFOA 1OZPA 2POKA 4W9YA 5K8PA 2XEJA 2PJ5A 2ZW4A 4R3KA 3G3SA 4LUAA 4I49A 2ZW6A 4RS2A 4UBRA 3JTKA 4MJ8A 2PJCA 3H4QA 2B3VA 2GREA 2PJAA 1SQHA 2ZEHA 4ZY1A 1HDQA 2PRQA 4MXUA 1XMBA 1M44A 2HQYA 4MY3A 4AB7A 4F9VA 4ZI6A 1VHOA 2JEWA 4HPSA 4Q7AA 3GLJA 3PBBA 3D7FA 1QSRA 4XPDB 5DWMA 5CBMA 2ANPA 3FNCA 1Z8LA 5HVHA 2B58A 2F5IA 2PQ8A 1XJOA 3NH4A 2V8VA 4JZ0A 1X12A 4IHMA 2G3AA 4A33A 4CGLA 4OP4A 5HXDA 5JQ4A 4GS4A 5D8NA 2REEA 2Z3LA 3HUVA 5JM6A 3T8WA 1S5KA 4MBUA 1S7NA 3IWGA 4Z65A 3D3SA 5C82A 1OBRA 4MHNA 3F8KA 4MHPA 5A27A 2OZUA 4AXVA 2CY2A 4OC3A 4B14A 3GUXA 4UFXA 1UFHA 2NMTA 2P0WA 4PSWA 4CAEA 3LACA 2QVPA 4PK2A 3PB8X 4EFDA 4NGQA 3FYNA 3R9EA 4DUKA 3FH4A 4PQAA 1XOVA 1NSAA 1I1DA 3SXNA 1Y7RA 3NH5A 2PIYA 3OWCA 4GXHA 4MHYA 4EWTA 4A32A 2CNMA 3D67A 3F0AA 2PCUA 3RO0A 1IOFA 2V8DA 2FS5A 2FSRA 3PEIA 1Z8XA 4FD4A 2F7VA 2Z0ZA 3MN8A 2B5GA 3L2NA 4ORFA 4XNHC 5LYIA 7CPAA 5H86A 3SJXA 1XBUA 2PJ8A 4KVME 2CNTA 4FD5A 4QVTA 4M85A 1RTQA 4F0XA 4KLWA 1B87A 3DLJA 5DWNA 4CGNA 3QAHA 5ELYA 1Y9WA 3MRUA 3EC4A 1YVOA 2XEFA 4A95A 4CYPA 4KORA 2IL4A 4R76A 3TTHA 2DPSA 1LRZA 1PYTB 1CG2A 2J8RA 2OZHA 2Q4VA 4K30A 4BD9A 5I0CA 1MJ9A 2C6GA 3EY5A 4P4FA 4C2ZA 1ON0A 1Y0RA 2B4DB 2VL1A 4ZYQA 5AG4A 2AE6A 4XPKA 3PB6X 1CPSA 3GYAA 3A9LA 1NMTA 4CAXA 4E0AA 3BLNA 3D2PA 2AFXA 2EBJA 4MFLA 3D7GA 1P0HA 2V8HA 4NGNA 1YQEA 1TF8A 1MJAA 3FIXA 3FEDA 4QUSA 1Z8WA 1X10A 1J4JA 5K8OA 2XEIA 4UIBA 2EK8A 3I1UA 4MFZA 3K2KA 4KOWA 2RB7A 4UEZA 3BI0A 4FBEA 3IIBA 2XEGA 4NJRA 1Q2YA 1XIXA 2K5TA 1Y0YA 2C27A 4JXQA 3NFZA 4PXBA 5DS0A 3R96A 3PBEA 1ZLIA 2BUEA 4CRYB 2Q4YA 3NE7A 1XMTA 2O4HA 4UEEA 5K8MA 2JDDA 2WPWA 4X3RA 4B6ZA 3W91A 3HLPA 1NE9A 3KKWA 4NEXA 2B3UA 2J8MA 4OAEA 4F9UA 3IEHA 3KHZA 4JXRA 2GLJA 2ZW5A 4NCZA 4ONUA 1A2ZA 4CYOA 2YNCC 3P2HA 4ZGYB 2Q0YA 2JDCA 3NE8A 4CGOA 3B35A 1HEEA 3TCVA 3UY5A 1I12A 2IMOA 4CYQA 1F2OA 3V7ZA 5F49A 2R98A 1MJBA 2GFQA 4M6IA 1RO5A
chains in the Genus database with same CATH topology
1S7FA 4KVXA 3DSBA 3R1KA 4AVCA 4HNYB 5KTCA 5C88A 2FIWA 4H6UA 3S6GA 4E2AA 4AVBA 1M4GA 1P4NA 3JUWA 3W6SA 4DNCA 1WK4A 4CAVA 4JWPA 3ZZIA 2Z3KA 3VWDA 2D4OA 4F6AA 4YGOA 1IICA 1Q2DA 5G20A 2Y0MA 4C7HA 2BSWA 3DDDA 5A28A 1XF8A 4MI4A 2WUUA 2R8VA 1VKCA 4L89A 2OU2A 3G8WA 4KS9A 4U5YA 4CGMA 4QB9A 4B5PB 2Z11A 4Q38A 4MHDA 2B5GB 2Z10A 5J8FA 3TOAA 4XNHB 4U9YA 4CAWA 2H5MA 3S6FA 4YFJA 5AG5A 2X7BA 1YGHA 3P2FA 1B6BA 2EUIA 3FXTA 1MK4A 1VHSA 2ARHA 4B5OA 1K4JA 2Z3MA 4ZBGA 4MFJA 2Z3PA 2Z3NA 2VEZA 2PDOA 4KUBA 4B5PA 1M4DA 5HMNA 4B11A 3W6XA 1M4IA 2VBQA 4A2ZA 4MY0A 4NXYA 3TO6A 1IIDA 1BO4A 4LX9A 2REFA 1Y9KA 2BEIA 1YR0A 4AG9A 2PR1A 1R57A 2OZGA 3TFYA 1YX0A 1I21A 3LD2A 5CNPA 3D2MA 1KUXA 2FT0A 4UFWA 1N71A 4B10A 2HUZA 1L0CA 4OLLA 1RXTA 4BBHA 1IYLA 3S6HA 1KZFA 3TO9A 4H6ZA 4IF5A 2QIRA 4KSAA 2VI7A 3SXOA 1GHEA 5HH1A 1IB1E 5ISVA 1QSTA 2GANA 4Y49B 5E96A 5IV0A 1TIQA 5G21A 5IB0A 2GIVA 3IU2A 2PRBA 1Z9UA 4NF1A 2GE3A 3TO7A 3V8IA 2G3TA 2ZPAA 3LODA 4HNWB 3GY9A 4IUSA 1XE4A 5BWAB 2Q04A 4UFVA 4UCPA 1CM0A 1Z4RA 1YREA 4KOVA 1Z4EA 4CAFA 2FIAA 1YK3A 4JJXA 2FXFA 5KTDA 3PP9A 1S7KA 3PZJA 2KCWA 4B13A 4XPLA 2BL1A 3EXNA 4KUAA 3R9FA 2J8NA 4R87A 4MFKA 4MFPA 1S7LA 2P6GA 5F46A 3I3GA 2DPTA 2R1IA 4KOSA 4J3GA 3CXSA 2YNDA 2Z3OA 1PU9A 4KOXA 2VZYA 4F0YA 1BOBA 4RI1A 2P6EA 1KUVA 1QSMA 4HKFA 5IX3A 5KTAA 2Q44A 3F5BA 4R57A 3S6KA 4BMHA 4E8OA 2P6FA 5H84A 5J8CA 4JLYA 3QB8A 4NSQA 4A31A 3FRMA 3FB3A 4EVYA 1FY7A 1M1DA 4FD7A 3TT2A 4KZTA 3T9YA 4CRZB 1YVKA 3E0KA 4FD6A 4KVOE 4HNXB 1QSOA 2I79A 4KLVA 4UCNA 1NSLA 2PSWA 2VXKA 1KUYA 4C2XA 3EO4A 3C26A 2CNSA 3IWEA 4B12A 1Q2CA 3IGRA 2AJ6A 2ATRA 4XPDC 1ZO0A 4CGPA 4Q36A 4R3LA 4CS0B 2O28A 3DR8A 4C7IA 4UWIA 5AGEA 3ZJ0A 3GKRA 2PC1A 2JLMA 3PGPA 2YGWA 4X5KA 1S3ZA 2B4BA 4U9ZA 4PSXA 2FCKA 3EFAA 5AG6A 3K9UA 2CXAA 4UWJA 4C68A 4PV6A 1PUAA 2JEVA 4C2YA 2OH1A 5AG7A 2WSAA 1S60A 2G0BA 5EBVA 5G1ZA 3T90A 5F48A 2QMLA 3FBUA 4MFQA 3R95A 2I00A 3I9SA 3JVNA 2EVNA 3WR7A 4A30A 2WPXA 3MGDA 4AVAA 2DXQA 3N7ZA 4UCMA 2Q7BA 1U6MA 2HV2A 3DNSA 3VWEA 3BJ7A 4KOUA 5JPHA 3TE4A 2A4NA 4H89A 4CYNA 2YNCA 4KOYA 1V0CA 4QBJA 3D8PA 3R9GA 3H5ZA 5G22A 2B4DA 4II9A 5FVJA 2RC4A 3IU1A 4YRHA 5GCNA 2PR8A 5EC4A 3B8GA 2QECA 2YNEA 1XEBA 4Y49C 2VZZA 2ZW7A 3BJ8A 4M3SA 1YLEA 4PK3A 4UA3A 3TOBA 4AG7A 4R9MA 3RYOA 3CXPA 3SHPA 4KOTA 5F47A 4JD6A 4OADA 1CJWA 2D4PA 2FE7A 1WWZA 2R7HA 1IYKA 2ZXVA 3CXQA 1QSNA 2FL4A 3DR6A 2OB0A 4L8AA 2VQYA 4QC6A 1OZPA 2ZW4A 4R3KA 3G3SA 4LUAA 4I49A 2ZW6A 4RS2A 4UBRA 3JTKA 4MJ8A 3H4QA 2B3VA 1SQHA 1M44A 2HQYA 4MY3A 4AB7A 1QSRA 4XPDB 5DWMA 3FNCA 2B58A 2F5IA 2PQ8A 2G3AA 4A33A 4CGLA 4GS4A 2REEA 2Z3LA 1S5KA 4MBUA 1S7NA 3IWGA 3D3SA 5C82A 3F8KA 5A27A 2OZUA 4B14A 2CY2A 4UFXA 1UFHA 2NMTA 2P0WA 4PSWA 4CAEA 4PK2A 3FYNA 3R9EA 1I1DA 3SXNA 1Y7RA 3OWCA 4A32A 2CNMA 3F0AA 2FS5A 2FSRA 4FD4A 2Z0ZA 2B5GA 4ORFA 4XNHC 5H86A 4KVME 2CNTA 4FD5A 4QVTA 4M85A 4F0XA 4KLWA 1B87A 4CGNA 5DWNA 3QAHA 1Y9WA 3EC4A 1YVOA 4A95A 4CYPA 4KORA 2IL4A 3TTHA 2DPSA 1LRZA 2J8RA 2OZHA 2Q4VA 4K30A 5I0CA 1MJ9A 3EY5A 4C2ZA 1ON0A 2B4DB 5AG4A 2AE6A 4XPKA 3GYAA 3A9LA 1NMTA 4CAXA 4E0AA 3BLNA 3D2PA 4MFLA 5JQ4A 1P0HA 3FIXA 4QUSA 1MJAA 1J4JA 4MFZA 4KOWA 1XIXA 1Q2YA 2K5TA 2C27A 4JXQA 3R96A 2BUEA 4CRYB 2Q4YA 3NE7A 1XMTA 2JDDA 2WPWA 3W91A 1NE9A 3KKWA 4NEXA 2B3UA 2J8MA 4OAEA 4ONUA 4JXRA 4NCZA 2ZW5A 4CYOA 2YNCC 3P2HA 4ZGYB 2Q0YA 2JDCA 4CGOA 3TCVA 3UY5A 1I12A 4CYQA 5F49A 2R98A 1MJBA 4KSFA 1RO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7F A;  4KVX A;  3DSB A;  3R1K A;  4AVC A;  4HNY B;  5KTC A;  5C88 A;  2FIW A;  4H6U A;  3S6G A;  4E2A A;  4AVB A;  1M4G A;  1P4N A;  3JUW A;  3W6S A;  4DNC A;  1WK4 A;  4CAV A;  4JWP A;  3ZZI A;  3VWD A;  2D4O A;  4F6A A;  4YGO A;  1IIC A;  1Q2D A;  2Y0M A;  2BSW A;  3DDD A;  1XF8 A;  4MI4 A;  2R8V A;  1VKC A;  4L89 A;  2OU2 A;  3G8W A;  4U5Y A;  4QB9 A;  4B5P B;  2Z11 A;  4MHD A;  2B5G B;  2Z10 A;  5J8F A;  3TOA A;  4XNH B;  4U9Y A;  4CAW A;  2H5M A;  3S6F A;  4YFJ A;  2X7B A;  1YGH A;  3P2F A;  1B6B A;  2EUI A;  3FXT A;  1MK4 A;  1VHS A;  2ARH A;  4B5O A;  1K4J A;  4ZBG A;  2VEZ A;  2PDO A;  4KUB A;  4B5P A;  1M4D A;  5HMN A;  3W6X A;  1M4I A;  2VBQ A;  4MY0 A;  4NXY A;  3TO6 A;  1IID A;  1BO4 A;  4LX9 A;  2REF A;  1Y9K A;  2BEI A;  1YR0 A;  4AG9 A;  2PR1 A;  1R57 A;  2OZG A;  3TFY A;  1YX0 A;  1I21 A;  3LD2 A;  5CNP A;  3D2M A;  1KUX A;  2FT0 A;  1N71 A;  2HUZ A;  1L0C A;  4OLL A;  1RXT A;  1IYL A;  3S6H A;  1KZF A;  3TO9 A;  4H6Z A;  4IF5 A;  2QIR A;  2VI7 A;  3SXO A;  1GHE A;  5HH1 A;  1IB1 E;  5ISV A;  1QST A;  2GAN A;  4Y49 B;  5E96 A;  5IV0 A;  1TIQ A;  5IB0 A;  2GIV A;  4NF1 A;  2PRB A;  1Z9U A;  3TO7 A;  2GE3 A;  3V8I A;  2G3T A;  2ZPA A;  3LOD A;  4HNW B;  3GY9 A;  4IUS A;  1XE4 A;  2Q04 A;  1CM0 A;  1Z4R A;  1YRE A;  4KOV A;  1Z4E A;  2FIA A;  1YK3 A;  4JJX A;  2FXF A;  5KTD A;  3PP9 A;  1S7K A;  3PZJ A;  2KCW A;  4XPL A;  2BL1 A;  3EXN A;  4KUA A;  3R9F A;  2J8N A;  4R87 A;  1S7L A;  2P6G A;  5F46 A;  3I3G A;  2R1I A;  4KOS A;  4J3G A;  3CXS A;  1PU9 A;  4KOX A;  2VZY A;  4F0Y A;  1BOB A;  4RI1 A;  2P6E A;  1KUV A;  1QSM A;  4HKF A;  5IX3 A;  5KTA A;  2Q44 A;  3F5B A;  4R57 A;  3S6K A;  4BMH A;  4E8O A;  2P6F A;  5H84 A;  5J8C A;  4JLY A;  3QB8 A;  4NSQ A;  3FRM A;  3FB3 A;  4EVY A;  1FY7 A;  1M1D A;  4FD7 A;  3TT2 A;  4KZT A;  3T9Y A;  4CRZ B;  1YVK A;  3E0K A;  4FD6 A;  4KVO E;  4HNX B;  1QSO A;  2I79 A;  4KLV A;  1NSL A;  2PSW A;  2VXK A;  1KUY A;  3EO4 A;  3C26 A;  2CNS A;  1Q2C A;  3IGR A;  2AJ6 A;  2ATR A;  4XPD C;  4R3L A;  4CS0 B;  2O28 A;  3DR8 A;  4UWI A;  3ZJ0 A;  3GKR A;  2PC1 A;  2JLM A;  3PGP A;  4X5K A;  1S3Z A;  2B4B A;  4U9Z A;  4PSX A;  2FCK A;  3EFA A;  3K9U A;  4UWJ A;  4PV6 A;  1PUA A;  2JEV A;  2OH1 A;  1S60 A;  2G0B A;  5EBV A;  3T90 A;  5F48 A;  2QML A;  3FBU A;  3R95 A;  2I00 A;  3I9S A;  3JVN A;  2EVN A;  3WR7 A;  2WPX A;  3MGD A;  4AVA A;  2DXQ A;  3N7Z A;  2Q7B A;  1U6M A;  2HV2 A;  3DNS A;  3VWE A;  3BJ7 A;  4KOU A;  5JPH A;  3TE4 A;  2A4N A;  4H89 A;  4KOY A;  1V0C A;  4QBJ A;  3D8P A;  3R9G A;  2B4D A;  4II9 A;  5FVJ A;  2RC4 A;  4YRH A;  5GCN A;  2PR8 A;  5EC4 A;  3B8G A;  2QEC A;  1XEB A;  4Y49 C;  2VZZ A;  2ZW7 A;  3BJ8 A;  4M3S A;  1YLE A;  4PK3 A;  4UA3 A;  3TOB A;  4AG7 A;  4R9M A;  3RYO A;  3CXP A;  3SHP A;  4KOT A;  5F47 A;  4JD6 A;  4OAD A;  1CJW A;  2D4P A;  2FE7 A;  1WWZ A;  2R7H A;  1IYK A;  2ZXV A;  3CXQ A;  1QSN A;  2FL4 A;  3DR6 A;  2OB0 A;  4L8A A;  2VQY A;  4QC6 A;  1OZP A;  2ZW4 A;  4R3K A;  3G3S A;  4LUA A;  4I49 A;  2ZW6 A;  4RS2 A;  4UBR A;  4MJ8 A;  3H4Q A;  2B3V A;  1SQH A;  1M44 A;  2HQY A;  4MY3 A;  4AB7 A;  1QSR A;  4XPD B;  5DWM A;  3FNC A;  2B58 A;  2F5I A;  2PQ8 A;  2G3A A;  4GS4 A;  2REE A;  1S5K A;  4MBU A;  1S7N A;  3IWG A;  3D3S A;  5C82 A;  3F8K A;  2OZU A;  2CY2 A;  1UFH A;  2NMT A;  2P0W A;  4PSW A;  4PK2 A;  3FYN A;  3R9E A;  1I1D A;  3SXN A;  1Y7R A;  3OWC A;  2CNM A;  3F0A A;  2FS5 A;  2FSR A;  4FD4 A;  2Z0Z A;  2B5G A;  4ORF A;  4XNH C;  5H86 A;  4KVM E;  2CNT A;  4FD5 A;  4QVT A;  4M85 A;  4KLW A;  1B87 A;  5DWN A;  3QAH A;  1Y9W A;  3EC4 A;  1YVO A;  4KOR A;  2IL4 A;  3TTH A;  2J8R A;  1LRZ A;  2OZH A;  2Q4V A;  4K30 A;  5I0C A;  1MJ9 A;  3EY5 A;  1ON0 A;  2B4D B;  2AE6 A;  4XPK A;  3GYA A;  1NMT A;  4CAX A;  4E0A A;  3BLN A;  3D2P A;  5JQ4 A;  1P0H A;  3FIX A;  4QUS A;  1MJA A;  1J4J A;  4KOW A;  1XIX A;  1Q2Y A;  2K5T A;  2C27 A;  4JXQ A;  3R96 A;  2BUE A;  4CRY B;  2Q4Y A;  3NE7 A;  1XMT A;  2JDD A;  2WPW A;  3W91 A;  1NE9 A;  3KKW A;  4NEX A;  2B3U A;  2J8M A;  4OAE A;  4ONU A;  4JXR A;  4NCZ A;  2ZW5 A;  3P2H A;  2Q0Y A;  2JDC A;  3TCV A;  3UY5 A;  1I12 A;  5F49 A;  2R98 A;  1MJB A;  1RO5 A; 
#chains in the Genus database with same CATH topology
 1S7F A;  2ZEP A;  4KVX A;  3DSB A;  3H8F A;  3R1K A;  4AVC A;  2EO8 A;  4HNY B;  5KTC A;  4NFR A;  5C88 A;  2FIW A;  4H6U A;  3S6G A;  4E2A A;  4AVB A;  1M4G A;  1P4N A;  2PVV A;  3JUW A;  3W6S A;  2ABZ A;  4DNC A;  5F09 A;  1WK4 A;  4CAV A;  4JWP A;  3ZZI A;  3S9N A;  1EE3 P;  1YSJ A;  2ZED A;  2Z3K A;  3BHX A;  4NGM A;  4MCR A;  1ZLH A;  2D4O A;  1LAN A;  4ZX9 A;  3VWD A;  1Z5R A;  4F6A A;  4NGT A;  4YGO A;  2PIZ A;  1IIC A;  1Q2D A;  1TXR A;  5G20 A;  3TX8 A;  4P4E A;  3B3V A;  4MCP A;  2Y0M A;  4C7H A;  3LWU A;  2BSW A;  3QAY A;  4NGR A;  3DDD A;  5A28 A;  1XF8 A;  2BOA A;  4MI4 A;  2WUU A;  2WZN A;  4ONW A;  4P44 A;  2R8V A;  1VKC A;  3WC6 A;  4L89 A;  2ZEG A;  4BIN A;  4OKO A;  4ZX8 A;  2OU2 A;  3G8W A;  4KS9 A;  2PJB A;  3S9M A;  1LAM A;  4U5Y A;  4CGM A;  4G1P A;  4QB9 A;  2EWB A;  4TWE A;  2Z11 A;  4B5P B;  4Q38 A;  1XRY A;  4MHD A;  2B5G B;  5THW A;  2Z10 A;  5J8F A;  1JQG A;  4XNH B;  3TOA A;  4PXD A;  4U9Y A;  2CTC A;  4CAW A;  2H5M A;  3S6F A;  4YFJ A;  4P10 A;  5AG5 A;  2X7B A;  1YGH A;  3P2F A;  5LYL A;  1FNO A;  1B6B A;  2ZEN A;  1LCP A;  2BO9 A;  4OIW A;  2EUI A;  3FXT A;  1MK4 A;  1VHS A;  1AYE A;  2ARH A;  4B5O A;  1K4J A;  2Z3M A;  4M6G A;  4ZBG A;  4MFJ A;  5HVF A;  2Z3P A;  3VAT A;  3PB4 X;  2Z3N A;  3VAR A;  4LQG A;  3D4U A;  2GLF A;  2VEZ A;  2QYV A;  4YWY A;  2PDO A;  3BI1 A;  3DGV A;  2O53 A;  4KUB A;  4P6Y A;  4B5P A;  1M4D A;  5HMN A;  1XFO A;  4UF4 A;  4B11 A;  2JBJ A;  5K8N A;  3GB0 A;  3PRT A;  4IAV A;  3W6X A;  1M4I A;  2VBQ A;  4A2Z A;  4MY0 A;  3WAB A;  4NXY A;  2ZEE A;  3B3W A;  3TO6 A;  5LRJ A;  1BO4 A;  1IID A;  4LX9 A;  2REF A;  3CPA A;  1Y9K A;  3FX6 A;  2BEI A;  2ODF A;  1YR0 A;  4P4D A;  4AG9 A;  1BLL E;  1R57 A;  2OZG A;  2PR1 A;  3TFY A;  1YX0 A;  1I21 A;  1Y7E A;  3LD2 A;  1R3N A;  3D2M A;  5CNP A;  1KUX A;  2FT0 A;  2J9A A;  4R8F A;  4UFW A;  1CPX A;  1N71 A;  4OC4 A;  4B10 A;  2HUZ A;  1BAV A;  1HDU A;  1L0C A;  3IWW A;  4OLL A;  2AFZ A;  4DYO A;  4OID A;  4X8I A;  4A94 A;  1RXT A;  4BBH A;  4YU9 A;  1IYL A;  3S6H A;  3SJG A;  1KZF A;  3IFE A;  3TO9 A;  2BCO A;  3IO1 A;  4P4I A;  1F2P A;  4OME A;  4H6Z A;  4IF5 A;  2QIR A;  5LRG A;  4M6H A;  1CBX A;  4OC2 A;  4KSA A;  2GU2 A;  2VI7 A;  3SXO A;  1CP7 A;  1GHE A;  2PJ2 A;  5HH1 A;  2PJ3 A;  1IB1 E;  5ISV A;  1QST A;  2GAN A;  4ZY0 A;  4Y49 B;  1PCA A;  5E96 A;  1ARM A;  5IV0 A;  2AFU A;  1KWM A;  1TIQ A;  3SJF A;  1CP6 A;  5G21 A;  2ZEL A;  5IB0 A;  2GIV A;  3IU2 A;  2PRB A;  1Z9U A;  3D66 A;  2GE3 A;  3KGQ A;  4NF1 A;  4O23 A;  3TO7 A;  3KL9 A;  4NJQ A;  2PJ7 A;  3V8I A;  1Z2L A;  2G3T A;  2ZOG A;  2ZPA A;  3LOD A;  3N5F A;  4HNW B;  3WC5 A;  3NH8 A;  4CPA A;  3GY9 A;  4IUS A;  1XE4 A;  5BWA B;  4WWV A;  3ISX A;  4MMO A;  3B3C A;  4MCQ A;  2Q04 A;  4UFV A;  4UCP A;  1CM0 A;  1Z4R A;  4LQ6 A;  3K9T A;  1YRE A;  4MCS A;  4KOV A;  1Z4E A;  3GIU A;  3CT9 A;  4CAF A;  2FIA A;  4FUU A;  4TNU A;  1YK3 A;  1TKH A;  4EME A;  4JJX A;  2FXF A;  5IB9 A;  3H8E A;  5KTD A;  3LMS A;  1UWY A;  3PP9 A;  4X2T A;  3KHX A;  2IJZ A;  1S7K A;  1IU8 A;  2AFS A;  3PZJ A;  2KCW A;  4B13 A;  1AUG A;  4XPL A;  4UEF A;  2BL1 A;  3EXN A;  4KUA A;  3KR4 A;  3R9F A;  5JH9 A;  2J8N A;  4R87 A;  4R6T A;  4MFK A;  4MFP A;  1QMU A;  2FVG A;  1ZG7 A;  1S7L A;  2P6G A;  5F46 A;  5JGF A;  3PFO A;  8CPA A;  3I3G A;  3RZA A;  2DPT A;  2R1I A;  4KOS A;  3D68 A;  3D7H A;  4OC0 A;  1CX8 A;  1F57 A;  1M4L A;  4J3G A;  1GYT A;  1Q7L A;  3FF3 A;  3RNZ A;  3FJU A;  3CXS A;  2YND A;  2Z3O A;  1TKJ A;  4A39 A;  2CTB A;  1IY7 A;  2PVW A;  4NGP A;  1Z8T A;  2G9D A;  2HB6 A;  1PU9 A;  4OC1 A;  3B2Y A;  4KOX A;  1ZG9 A;  2VZY A;  4F0Y A;  1BOB A;  4RI1 A;  5D29 A;  2P6E A;  3VH9 A;  3WT4 A;  3V38 A;  1KUV A;  3SI1 A;  3CZX A;  1QSM A;  1TKF A;  4FWU A;  4HKF A;  2AFM A;  5IX3 A;  5KTA A;  4MHZ A;  2Q44 A;  3F5B A;  1ELM P;  2CF4 A;  2OOT A;  3QNV A;  6CPA A;  2DF5 A;  4PPZ A;  4R57 A;  4UIA A;  3RBU A;  2Q43 A;  3S6K A;  4BMH A;  4E8O A;  5LRK A;  4MRI A;  2P6F A;  5H84 A;  5J8C A;  2ZEM A;  1ELL P;  4JLY A;  3QB8 A;  4NSQ A;  4A31 A;  3FRM A;  3FB3 A;  4EVY A;  1FY7 A;  2I3C A;  1M1D A;  4FD7 A;  1LAP A;  3TT2 A;  3B7I A;  4KZT A;  3T9Y A;  1TF9 A;  2NYQ A;  4CRZ B;  3H8G A;  1YVK A;  3E0K A;  4FD6 A;  3SJE A;  4KVO E;  1H8L A;  4HNX B;  2ZEF A;  1QSO A;  3FEE A;  2I79 A;  5LYD A;  3IJ3 A;  2C6P A;  4KLV A;  3CPX A;  4UCN A;  1NSL A;  2PSW A;  4IK2 A;  4PXE A;  2VXK A;  1KUY A;  4C2X A;  3EO4 A;  3C26 A;  2CNS A;  3IWE A;  4RUH A;  4NGS A;  4B12 A;  4A38 A;  1Q2C A;  3IGR A;  2AJ6 A;  5EMI A;  2ATR A;  4XPD C;  1ZO0 A;  4CGP A;  4Q36 A;  4R3L A;  4DJL A;  4H2K A;  4CS0 B;  2O28 A;  3DR8 A;  4C7I A;  4UWI A;  3KR5 A;  2QJ8 A;  5AGE A;  3GKR A;  3ZJ0 A;  2PC1 A;  2PJ9 A;  2C6C A;  3SI2 A;  1JWQ A;  2C1C A;  2JLM A;  3PGP A;  2YGW A;  1DE4 C;  1R43 A;  4X5K A;  1S3Z A;  2B4B A;  2F8H A;  2AFW A;  4U9Z A;  4PSX A;  2FCK A;  3EFA A;  5AG6 A;  3K9U A;  2CXA A;  1YW4 A;  5I4M A;  4UWJ A;  4C68 A;  4PV6 A;  1PUA A;  1ARL A;  4ZY2 A;  2JEV A;  4C2Y A;  2OH1 A;  5AG7 A;  5J1Q A;  2WSA A;  2V77 A;  1S60 A;  2G0B A;  1QQ9 A;  4PXC A;  3FEC A;  1AMP A;  4F8Z A;  1ZG8 A;  5EBV A;  5G1Z A;  3T90 A;  5F48 A;  2QML A;  3FBU A;  1YME A;  4MFQ A;  3R95 A;  5LYF A;  1VIX A;  4P4J A;  2I00 A;  3I9S A;  3JVN A;  3TC8 A;  2EVN A;  3WR7 A;  2ZOF A;  3CDX A;  4A30 A;  3RAM A;  2WPX A;  1VHE A;  3MGD A;  4AVA A;  3BXM A;  2DXQ A;  1IGB A;  2OR4 A;  3N7Z A;  4UCM A;  1IOI A;  1LOK A;  2RFH A;  3WC7 A;  2Q7B A;  1U6M A;  2Q4Z A;  2HV2 A;  1YW6 A;  3DNS A;  4OC5 A;  5CPA A;  3VWE A;  3BJ7 A;  4KOU A;  5HVG A;  5JPH A;  3TE4 A;  2A4N A;  3IC1 A;  4H89 A;  1YLO A;  3FVL A;  4CYN A;  2Q7S A;  2YNC A;  3KAS A;  4KOY A;  1V0C A;  4QBJ A;  3D8P A;  3JRU A;  3R9G A;  3FMC A;  2JBK A;  2PE3 A;  3H5Z A;  5G22 A;  3B3T A;  2PJ0 A;  2B4D A;  4II9 A;  4K3N A;  4P45 A;  5FVJ A;  2RC4 A;  3KQZ A;  2WYR A;  3IU1 A;  3PB7 X;  4YRH A;  2Q51 A;  3B3S A;  5GCN A;  4KSI A;  4RN7 A;  2DEA A;  2IQ6 A;  2PR8 A;  5EC4 A;  4GM5 A;  3B8G A;  2EK9 A;  2QEC A;  2YNE A;  1XEB A;  4Y49 C;  2PJ6 A;  2VZZ A;  2ZW7 A;  3BJ8 A;  3KQX A;  1YLE A;  1BPN A;  4KSF A;  4M3S A;  4PK3 A;  4UA3 A;  3SI0 A;  4R9M A;  3TOB A;  3RYO A;  3PFE A;  3CXP A;  4AG7 A;  3PB9 X;  3SHP A;  4KOT A;  5F47 A;  3D7D A;  4JD6 A;  4OAD A;  2PJ1 A;  1CJW A;  2CIJ A;  4JYW A;  1DTD A;  2NSM A;  2D4P A;  2HC9 A;  2FE7 A;  1VGY A;  1WWZ A;  2R7H A;  4WJB A;  1IYK A;  2ZEO A;  2ZXV A;  4FAI A;  3S9L A;  3CXQ A;  4R7M A;  1QSN A;  3ISZ A;  1FT7 A;  1LFW A;  2FL4 A;  2PJ4 A;  3KI9 A;  3DR6 A;  2OB0 A;  4L8A A;  3NA6 A;  2VQY A;  2V8G A;  3KZW A;  4P4B A;  4QC6 A;  4A37 A;  1BPM A;  2AFO A;  1OZP A;  2POK A;  4W9Y A;  5K8P A;  2XEJ A;  2PJ5 A;  2ZW4 A;  4R3K A;  3G3S A;  4LUA A;  4I49 A;  2ZW6 A;  4RS2 A;  4UBR A;  3JTK A;  4MJ8 A;  2PJC A;  3H4Q A;  2B3V A;  2GRE A;  2PJA A;  1SQH A;  2ZEH A;  4ZY1 A;  1HDQ A;  2PRQ A;  4MXU A;  1XMB A;  1M44 A;  2HQY A;  4MY3 A;  4AB7 A;  4F9V A;  4ZI6 A;  1VHO A;  2JEW A;  4HPS A;  4Q7A A;  3GLJ A;  3PBB A;  3D7F A;  1QSR A;  4XPD B;  5DWM A;  5CBM A;  2ANP A;  3FNC A;  1Z8L A;  5HVH A;  2B58 A;  2F5I A;  2PQ8 A;  1XJO A;  3NH4 A;  2V8V A;  4JZ0 A;  1X12 A;  4IHM A;  2G3A A;  4A33 A;  4CGL A;  4OP4 A;  5HXD A;  5JQ4 A;  4GS4 A;  5D8N A;  2REE A;  2Z3L A;  3HUV A;  5JM6 A;  3T8W A;  1S5K A;  4MBU A;  1S7N A;  3IWG A;  4Z65 A;  3D3S A;  5C82 A;  1OBR A;  4MHN A;  3F8K A;  4MHP A;  5A27 A;  2OZU A;  4AXV A;  2CY2 A;  4OC3 A;  4B14 A;  3GUX A;  4UFX A;  1UFH A;  2NMT A;  2P0W A;  4PSW A;  4CAE A;  3LAC A;  2QVP A;  4PK2 A;  3PB8 X;  4EFD A;  4NGQ A;  3FYN A;  3R9E A;  4DUK A;  3FH4 A;  4PQA A;  1XOV A;  1NSA A;  1I1D A;  3SXN A;  1Y7R A;  3NH5 A;  2PIY A;  3OWC A;  4GXH A;  4MHY A;  4EWT A;  4A32 A;  2CNM A;  3D67 A;  3F0A A;  2PCU A;  3RO0 A;  1IOF A;  2V8D A;  2FS5 A;  2FSR A;  3PEI A;  1Z8X A;  4FD4 A;  2F7V A;  2Z0Z A;  3MN8 A;  2B5G A;  3L2N A;  4ORF A;  4XNH C;  5LYI A;  7CPA A;  5H86 A;  3SJX A;  1XBU A;  2PJ8 A;  4KVM E;  2CNT A;  4FD5 A;  4QVT A;  4M85 A;  1RTQ A;  4F0X A;  4KLW A;  1B87 A;  3DLJ A;  5DWN A;  4CGN A;  3QAH A;  5ELY A;  1Y9W A;  3MRU A;  3EC4 A;  1YVO A;  2XEF A;  4A95 A;  4CYP A;  4KOR A;  2IL4 A;  4R76 A;  3TTH A;  2DPS A;  1LRZ A;  1PYT B;  1CG2 A;  2J8R A;  2OZH A;  2Q4V A;  4K30 A;  4BD9 A;  5I0C A;  1MJ9 A;  2C6G A;  3EY5 A;  4P4F A;  4C2Z A;  1ON0 A;  1Y0R A;  2B4D B;  2VL1 A;  4ZYQ A;  5AG4 A;  2AE6 A;  4XPK A;  3PB6 X;  1CPS A;  3GYA A;  3A9L A;  1NMT A;  4CAX A;  4E0A A;  3BLN A;  3D2P A;  2AFX A;  2EBJ A;  4MFL A;  3D7G A;  1P0H A;  2V8H A;  4NGN A;  1YQE A;  1TF8 A;  1MJA A;  3FIX A;  3FED A;  4QUS A;  1Z8W A;  1X10 A;  1J4J A;  5K8O A;  2XEI A;  4UIB A;  2EK8 A;  3I1U A;  4MFZ A;  3K2K A;  4KOW A;  2RB7 A;  4UEZ A;  3BI0 A;  4FBE A;  3IIB A;  2XEG A;  4NJR A;  1Q2Y A;  1XIX A;  2K5T A;  1Y0Y A;  2C27 A;  4JXQ A;  3NFZ A;  4PXB A;  5DS0 A;  3R96 A;  3PBE A;  1ZLI A;  2BUE A;  4CRY B;  2Q4Y A;  3NE7 A;  1XMT A;  2O4H A;  4UEE A;  5K8M A;  2JDD A;  2WPW A;  4X3R A;  4B6Z A;  3W91 A;  3HLP A;  1NE9 A;  3KKW A;  4NEX A;  2B3U A;  2J8M A;  4OAE A;  4F9U A;  3IEH A;  3KHZ A;  4JXR A;  2GLJ A;  2ZW5 A;  4NCZ A;  4ONU A;  1A2Z A;  4CYO A;  2YNC C;  3P2H A;  4ZGY B;  2Q0Y A;  2JDC A;  3NE8 A;  4CGO A;  3B35 A;  1HEE A;  3TCV A;  3UY5 A;  1I12 A;  2IMO A;  4CYQ A;  1F2O A;  3V7Z A;  5F49 A;  2R98 A;  1MJB A;  2GFQ A;  4M6I A;  1RO5 A; 
#chains in the Genus database with same CATH homology
 1S7F A;  4KVX A;  3DSB A;  3R1K A;  4AVC A;  4HNY B;  5KTC A;  5C88 A;  2FIW A;  4H6U A;  3S6G A;  4E2A A;  4AVB A;  1M4G A;  1P4N A;  3JUW A;  3W6S A;  4DNC A;  1WK4 A;  4CAV A;  4JWP A;  3ZZI A;  2Z3K A;  3VWD A;  2D4O A;  4F6A A;  4YGO A;  1IIC A;  1Q2D A;  5G20 A;  2Y0M A;  4C7H A;  2BSW A;  3DDD A;  5A28 A;  1XF8 A;  4MI4 A;  2WUU A;  2R8V A;  1VKC A;  4L89 A;  2OU2 A;  3G8W A;  4KS9 A;  4U5Y A;  4CGM A;  4QB9 A;  4B5P B;  2Z11 A;  4Q38 A;  4MHD A;  2B5G B;  2Z10 A;  5J8F A;  3TOA A;  4XNH B;  4U9Y A;  4CAW A;  2H5M A;  3S6F A;  4YFJ A;  5AG5 A;  2X7B A;  1YGH A;  3P2F A;  1B6B A;  2EUI A;  3FXT A;  1MK4 A;  1VHS A;  2ARH A;  4B5O A;  1K4J A;  2Z3M A;  4ZBG A;  4MFJ A;  2Z3P A;  2Z3N A;  2VEZ A;  2PDO A;  4KUB A;  4B5P A;  1M4D A;  5HMN A;  4B11 A;  3W6X A;  1M4I A;  2VBQ A;  4A2Z A;  4MY0 A;  4NXY A;  3TO6 A;  1IID A;  1BO4 A;  4LX9 A;  2REF A;  1Y9K A;  2BEI A;  1YR0 A;  4AG9 A;  2PR1 A;  1R57 A;  2OZG A;  3TFY A;  1YX0 A;  1I21 A;  3LD2 A;  5CNP A;  3D2M A;  1KUX A;  2FT0 A;  4UFW A;  1N71 A;  4B10 A;  2HUZ A;  1L0C A;  4OLL A;  1RXT A;  4BBH A;  1IYL A;  3S6H A;  1KZF A;  3TO9 A;  4H6Z A;  4IF5 A;  2QIR A;  4KSA A;  2VI7 A;  3SXO A;  1GHE A;  5HH1 A;  1IB1 E;  5ISV A;  1QST A;  2GAN A;  4Y49 B;  5E96 A;  5IV0 A;  1TIQ A;  5G21 A;  5IB0 A;  2GIV A;  3IU2 A;  2PRB A;  1Z9U A;  4NF1 A;  2GE3 A;  3TO7 A;  3V8I A;  2G3T A;  2ZPA A;  3LOD A;  4HNW B;  3GY9 A;  4IUS A;  1XE4 A;  5BWA B;  2Q04 A;  4UFV A;  4UCP A;  1CM0 A;  1Z4R A;  1YRE A;  4KOV A;  1Z4E A;  4CAF A;  2FIA A;  1YK3 A;  4JJX A;  2FXF A;  5KTD A;  3PP9 A;  1S7K A;  3PZJ A;  2KCW A;  4B13 A;  4XPL A;  2BL1 A;  3EXN A;  4KUA A;  3R9F A;  2J8N A;  4R87 A;  4MFK A;  4MFP A;  1S7L A;  2P6G A;  5F46 A;  3I3G A;  2DPT A;  2R1I A;  4KOS A;  4J3G A;  3CXS A;  2YND A;  2Z3O A;  1PU9 A;  4KOX A;  2VZY A;  4F0Y A;  1BOB A;  4RI1 A;  2P6E A;  1KUV A;  1QSM A;  4HKF A;  5IX3 A;  5KTA A;  2Q44 A;  3F5B A;  4R57 A;  3S6K A;  4BMH A;  4E8O A;  2P6F A;  5H84 A;  5J8C A;  4JLY A;  3QB8 A;  4NSQ A;  4A31 A;  3FRM A;  3FB3 A;  4EVY A;  1FY7 A;  1M1D A;  4FD7 A;  3TT2 A;  4KZT A;  3T9Y A;  4CRZ B;  1YVK A;  3E0K A;  4FD6 A;  4KVO E;  4HNX B;  1QSO A;  2I79 A;  4KLV A;  4UCN A;  1NSL A;  2PSW A;  2VXK A;  1KUY A;  4C2X A;  3EO4 A;  3C26 A;  2CNS A;  3IWE A;  4B12 A;  1Q2C A;  3IGR A;  2AJ6 A;  2ATR A;  4XPD C;  1ZO0 A;  4CGP A;  4Q36 A;  4R3L A;  4CS0 B;  2O28 A;  3DR8 A;  4C7I A;  4UWI A;  5AGE A;  3ZJ0 A;  3GKR A;  2PC1 A;  2JLM A;  3PGP A;  2YGW A;  4X5K A;  1S3Z A;  2B4B A;  4U9Z A;  4PSX A;  2FCK A;  3EFA A;  5AG6 A;  3K9U A;  2CXA A;  4UWJ A;  4C68 A;  4PV6 A;  1PUA A;  2JEV A;  4C2Y A;  2OH1 A;  5AG7 A;  2WSA A;  1S60 A;  2G0B A;  5EBV A;  5G1Z A;  3T90 A;  5F48 A;  2QML A;  3FBU A;  4MFQ A;  3R95 A;  2I00 A;  3I9S A;  3JVN A;  2EVN A;  3WR7 A;  4A30 A;  2WPX A;  3MGD A;  4AVA A;  2DXQ A;  3N7Z A;  4UCM A;  2Q7B A;  1U6M A;  2HV2 A;  3DNS A;  3VWE A;  3BJ7 A;  4KOU A;  5JPH A;  3TE4 A;  2A4N A;  4H89 A;  4CYN A;  2YNC A;  4KOY A;  1V0C A;  4QBJ A;  3D8P A;  3R9G A;  3H5Z A;  5G22 A;  2B4D A;  4II9 A;  5FVJ A;  2RC4 A;  3IU1 A;  4YRH A;  5GCN A;  2PR8 A;  5EC4 A;  3B8G A;  2QEC A;  2YNE A;  1XEB A;  4Y49 C;  2VZZ A;  2ZW7 A;  3BJ8 A;  4M3S A;  1YLE A;  4PK3 A;  4UA3 A;  3TOB A;  4AG7 A;  4R9M A;  3RYO A;  3CXP A;  3SHP A;  4KOT A;  5F47 A;  4JD6 A;  4OAD A;  1CJW A;  2D4P A;  2FE7 A;  1WWZ A;  2R7H A;  1IYK A;  2ZXV A;  3CXQ A;  1QSN A;  2FL4 A;  3DR6 A;  2OB0 A;  4L8A A;  2VQY A;  4QC6 A;  1OZP A;  2ZW4 A;  4R3K A;  3G3S A;  4LUA A;  4I49 A;  2ZW6 A;  4RS2 A;  4UBR A;  3JTK A;  4MJ8 A;  3H4Q A;  2B3V A;  1SQH A;  1M44 A;  2HQY A;  4MY3 A;  4AB7 A;  1QSR A;  4XPD B;  5DWM A;  3FNC A;  2B58 A;  2F5I A;  2PQ8 A;  2G3A A;  4A33 A;  4CGL A;  4GS4 A;  2REE A;  2Z3L A;  1S5K A;  4MBU A;  1S7N A;  3IWG A;  3D3S A;  5C82 A;  3F8K A;  5A27 A;  2OZU A;  4B14 A;  2CY2 A;  4UFX A;  1UFH A;  2NMT A;  2P0W A;  4PSW A;  4CAE A;  4PK2 A;  3FYN A;  3R9E A;  1I1D A;  3SXN A;  1Y7R A;  3OWC A;  4A32 A;  2CNM A;  3F0A A;  2FS5 A;  2FSR A;  4FD4 A;  2Z0Z A;  2B5G A;  4ORF A;  4XNH C;  5H86 A;  4KVM E;  2CNT A;  4FD5 A;  4QVT A;  4M85 A;  4F0X A;  4KLW A;  1B87 A;  4CGN A;  5DWN A;  3QAH A;  1Y9W A;  3EC4 A;  1YVO A;  4A95 A;  4CYP A;  4KOR A;  2IL4 A;  3TTH A;  2DPS A;  1LRZ A;  2J8R A;  2OZH A;  2Q4V A;  4K30 A;  5I0C A;  1MJ9 A;  3EY5 A;  4C2Z A;  1ON0 A;  2B4D B;  5AG4 A;  2AE6 A;  4XPK A;  3GYA A;  3A9L A;  1NMT A;  4CAX A;  4E0A A;  3BLN A;  3D2P A;  4MFL A;  5JQ4 A;  1P0H A;  3FIX A;  4QUS A;  1MJA A;  1J4J A;  4MFZ A;  4KOW A;  1XIX A;  1Q2Y A;  2K5T A;  2C27 A;  4JXQ A;  3R96 A;  2BUE A;  4CRY B;  2Q4Y A;  3NE7 A;  1XMT A;  2JDD A;  2WPW A;  3W91 A;  1NE9 A;  3KKW A;  4NEX A;  2B3U A;  2J8M A;  4OAE A;  4ONU A;  4JXR A;  4NCZ A;  2ZW5 A;  4CYO A;  2YNC C;  3P2H A;  4ZGY B;  2Q0Y A;  2JDC A;  4CGO A;  3TCV A;  3UY5 A;  1I12 A;  4CYQ A;  5F49 A;  2R98 A;  1MJB A;  4KSF A;  1RO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...