1NMTA

N-myristoyl transferase from candida albicans at 2.45 a
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
392
structure length
392
Chain Sequence
EGPIDKLKTPEDVPNDPLPLISDFEWSTLDIDDNLQLDELYKLLYDNYVEDIDATFRFKYSHEFFQWALKPPGWRKDWHVGVRVKSTGKLVAFIAATPVTFKLNKSNKVIDSVEINFLCIHKKLRNKRLAPVLIKEITRRVNKQNIWQALYTGGSILPTPLTTCRYQHRPINWSKLHDVGFSHLPPNQTKSSMVASYTLPNNPKLKGLRPMTGKDVSTVLSLLYKYQERFDIVQLFTEEEFKHWMLGHDENSDSNVVKSYVVEDENGIITDYFSYYLLPFTVLDNAQHDELGIAYLFYYASDSFEKPNYKKRLNELITDALITSKKFGVDVFNCLTCQDNTYFLKDCKFGSGDGFLNYYLFNYRTFPMDGGIDKKTKEVVEDQTSGIGVVLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-MYRISTOYL TRANSFERASE
publication title Crystal structure of the anti-fungal target N-myristoyl transferase.
pubmed doi rcsb
source organism Candida albicans
molecule tags Myristylation
total genus 121
structure length 392
sequence length 392
chains with identical sequence B, C
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 1997-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1nmtA01
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 1nmtA02
4UWIA 2AJ6A 4AG7A 4JXRA 1M1DA 3R1KA 2R8VA 4UA3A 4QUSA 2EVNA 5F49A 5EBVA 3BLNA 3QB8A 2P6GA 2ZXVA 1I1DA 3LD2A 1N71A 3GYAA 4U9YA 1UFHA 2CNTA 2FL4A 3TT2A 3CXPA 4YFJA 3TO6A 2J8MA 3PZJA 1IICA 2AE6A 1Y9KA 5ISVA 4KORA 3IGRA 4KOYA 4KOVA 5J8CA 3VWDA 4HNYB 2DXQA 2REFA 3MGDA 3TFYA 2JLMA 3E0KA 4B5PB 4K30A 5C88A 1IB1E 4L8AA 4NSQA 3R9GA 1YREA 2CNMA 4R87A 2CNSA 3I3GA 2ZW4A 4ZBGA 5GCNA 1S7LA 2GANA 4KOWA 2PDOA 1GHEA 2X7BA 1Q2YA 2HV2A 3EC4A 3TO7A 3EO4A 4PSWA 4KLWA 2IL4A 3D8PA 3SHPA 5I0CA 2OZGA 3WR7A 3TOBA 4MI4A 1WK4A 3F5BA 4BMHA 2BL1A 3PP9A 4NXYA 4HNXB 2VBQA 4KUAA 5DWMA 2PSWA 2B4DB 1U6MA 4I49A 4KVME 3TOAA 2VI7A 4HKFA 3G3SA 2I00A 3FYNA 2GE3A 1YGHA 5FVJA 4JXQA 5E96A 4XPDB 4QVTA 3DSBA 1YX0A 1LRZA 4E8OA 3LODA 4H89A 2R1IA 4KVXA 4CAWA 1Z4RA 4Y49B 4B5PA 1Y9WA 2P0WA 4RI1A 2Q04A 5IX3A 4KOTA 2Z10A 1YVOA 4FD4A 1MJ9A 2FT0A 4NEXA 4H6ZA 5F47A 4QBJA 2J8NA 1IYKA 2VEZA 5KTCA 2OU2A 1M44A 4MHDA 2K5TA 4XPKA 1R57A 4IF5A 5JPHA 3NE7A 4AVCA 3GKRA 4ORFA 2VXKA 3GY9A 3H4QA 3F0AA 3S6KA 2NMTA 3P2FA 2PR1A 3JUWA 1VHSA 1S5KA 2FIWA 4E0AA 1QSRA 1VKCA 2REEA 2VZYA 3EFAA 3S6GA 4U9ZA 2G3TA 5J8FA 4XNHB 2G3AA 3V8IA 2ATRA 4JLYA 2Q4YA 2FSRA 2B4DA 4J3GA 1B87A 1KUYA 4CRZB 1CJWA 2A4NA 1XEBA 1KUXA 1K4JA 2Q4VA 1QSNA 5KTAA 1NSLA 3T9YA 4AG9A 4AVBA 2JEVA 2G0BA 2VQYA 5HH1A 1S7FA 1PUAA 3VWEA 2Q0YA 1RO5A 1KUVA 5HMNA 3CXQA 1J4JA 4CRYB 3D2PA 1NMTA 5H86A 2O28A 4Y49C 5IV0A 4DNCA 2D4OA 3W6SA 4MBUA 2QMLA 2VZZA 3ZJ0A 3JVNA 3W91A 1IIDA 4KUBA 4JJXA 4NF1A 2CY2A 2Q7BA 4H6UA 1BO4A 2B3UA 4II9A 2ZW6A 5C82A 2JDDA 2OB0A 3KKWA 2HQYA 4XPLA 2FS5A 2C27A 5F48A 1YR0A 2PC1A 3F8KA 3K9UA 1OZPA 1V0CA 4KVOE 4UWJA 3P2HA 3D3SA 5EC4A 1L0CA 2PQ8A 3QAHA 2B3VA 3EXNA 4XNHC 2ARHA 3R9FA 4KOUA 3FBUA 1P0HA 4AVAA 4LX9A 4UBRA 5IB0A 4FD5A 2ZW7A 1S7NA 3RYOA 2BEIA 2Q44A 2QIRA 2B5GB 1CM0A 3CXSA 1XMTA 4JWPA 2JDCA 1WWZA 2OZUA 3FNCA 3SXOA 4OADA 4YGOA 3BJ7A 5DWNA 2F5IA 4MY3A 2HUZA 2BSWA 4L89A 2RC4A 3B8GA 3C26A 2EUIA 1MJAA 1XIXA 1YK3A 2I79A 2B58A 1BOBA 2QECA 4KOXA 1Q2CA 1IYLA 3D2MA 4CAXA 1P4NA 1S3ZA 3DDDA 1YVKA 2GIVA 4JD6A 4OAEA 4KLVA 4M85A 3IWGA 4IUSA 4U5YA 3DR6A 1FY7A 1Z4EA 1RXTA 4PSXA 1MK4A 2H5MA 2OZHA 2FXFA 5CNPA 1S7KA 4M3SA 1M4IA 3N7ZA 1I21A 4RS2A 4R3LA 4XPDC 1QSTA 2R98A 4HNWB 2P6FA 3S6HA 4PV6A 4QB9A 1QSMA 1Y7RA 2J8RA 4R9MA 2OH1A 4R3KA 3T90A 4QC6A 1SQHA 5H84A 3SXNA 2B5GA 1YLEA 2ZPAA 2PRBA 2FCKA 1M4GA 4R57A 3BJ8A 1PU9A 1TIQA 2Z11A 4EVYA 4E2AA 3FB3A 4CS0B 1MJBA 4KOSA 4MJ8A 2Y0MA 4KZTA 3R96A 1Z9UA 4LUAA 2PR8A 1ON0A 3FRMA 5JQ4A 2WPWA 3TE4A 3FIXA 4X5KA 3TTHA 3R9EA 4NCZA 3EY5A 1B6BA 3S6FA 1XF8A 1I12A 3W6XA 2R7HA 4B5OA 4F6AA 2D4PA 3R95A 2ZW5A 4CAVA 1XE4A 3OWCA 3TO9A 2Z0ZA 3TCVA 3PGPA 4PK2A 2FIAA 2P6EA 1KZFA 1S60A 4FD6A 4OLLA 4F0YA 4MY0A 4FD7A 3G8WA 2WPXA 1Q2DA 3DR8A 3ZZIA 1M4DA 3UY5A 1NE9A 3I9SA 2FE7A 4YRHA 4AB7A 1QSOA 4PK3A 2BUEA 4GS4A 3DNSA 2KCWA 5F46A 5KTDA 3FXTA 4ONUA 2B4BA
chains in the Genus database with same CATH superfamily
4UWIA 2AJ6A 1CPXA 4AG7A 1EE3P 1F2PA 4JXRA 1M1DA 3KR5A 1BPMA 2AFXA 4F0XA 3R1KA 2R8VA 1XMBA 4UA3A 4QUSA 2EVNA 5F49A 1CP6A 2Z3KA 1Z8WA 2AFZA 3IO1A 5EBVA 3KASA 3WT4A 4OMEA 3BLNA 4TNUA 5G21A 3QB8A 3FF3A 2ZOGA 2P6GA 2ZXVA 1I1DA 1M4LA 3LD2A 3PFEA 1FT7A 1N71A 3GYAA 1Z2LA 4M6IA 4U9YA 2G9DA 1ELLP 1UFHA 3K2KA 2CNTA 2FL4A 3HLPA 4K3NA 3CXPA 5LRGA 3TT2A 3VARA 3IIBA 4CGOA 3TO6A 1YQEA 4YFJA 2J8MA 3PZJA 4DYOA 1IICA 2AE6A 4OIDA 4ZGYB 3JRUA 3PB6X 4ZY2A 4OC0A 4A37A 1Y9KA 1AMPA 4CGMA 3H5ZA 4KORA 5ISVA 3IGRA 1CP7A 1X10A 4KOYA 4KOVA 1Y7EA 4PPZA 2O53A 5J8CA 3VWDA 2XEGA 1TXRA 3KL9A 1LOKA 2DXQA 3CT9A 4FUUA 4HNYB 4MHZA 4UEFA 1R3NA 2BCOA 1VIXA 2REFA 3MN8A 5G1ZA 3DGVA 4A32A 3MGDA 1LCPA 3TFYA 3IWWA 2BO9A 2JLMA 4RUHA 2HB6A 3E0KA 4B5PB 2NYQA 4K30A 4PQAA 5AGEA 5THWA 5C88A 1IB1E 3H8EA 4L8AA 4ZX8A 4NSQA 3S9MA 3R9GA 4A2ZA 4F9UA 1YREA 2CNMA 4R87A 5HXDA 2CNSA 3I3GA 4NJQA 2ZW4A 4ZBGA 4P4EA 4OC2A 4P4JA 5GCNA 3S9NA 1ZLHA 1S7LA 2DF5A 2GANA 3D68A 4KOWA 2IJZA 4KSIA 4MCQA 2PDOA 1GHEA 3FECA 4NGNA 4A30A 4C2YA 5JM6A 5LYIA 4NGTA 2X7BA 1Q2YA 2HV2A 4C2ZA 2XEJA 3EC4A 3B35A 3D7FA 5F09A 3TO7A 3EO4A 4PSWA 4KLWA 2IL4A 4W9YA 3D8PA 3WC7A 3SHPA 5I0CA 2OZGA 2V8HA 2ODFA 3WR7A 3TOBA 4KS9A 2RB7A 4MI4A 4MCRA 1WK4A 4A39A 3SI0A 1ZLIA 3BXMA 1CX8A 3F5BA 4MMOA 2I3CA 4BMHA 4X2TA 4UIAA 4A38A 2Z3LA 4NGQA 5JH9A 2BL1A 3PP9A 3N5FA 3D7HA 4NXYA 2VL1A 3D67A 2YGWA 4HNXB 2VBQA 4KUAA 2XEIA 1OBRA 2PE3A 2PSWA 2B4DB 1F57A 1U6MA 4MFQA 4B13A 4I49A 4C7HA 4KVME 3TOAA 2VI7A 4HKFA 3G3SA 4UFVA 5EMIA 2I00A 4CAFA 4CAEA 1ARMA 1KWMA 3KGQA 5HVHA 3FYNA 2GE3A 4B11A 2GLJA 1YGHA 1YMEA 5FVJA 4JXQA 3SJGA 5IB9A 1QQ9A 4XPDB 5E96A 4QVTA 3DSBA 3PRTA 1YX0A 1LRZA 2PJ8A 2J9AA 5BWAB 4E8OA 7CPAA 1ZG8A 4GXHA 5HVFA 5DS0A 3LODA 4H89A 2R1IA 3FEEA 4KVXA 3RBUA 2AFUA 4CAWA 1VGYA 1Z4RA 4H2KA 5AG5A 4Y49B 2AFMA 4B5PA 3LWUA 1Y9WA 2P0WA 4RI1A 5HVGA 2Q04A 3FX6A 2EK8A 5A28A 4UIBA 2OOTA 5IX3A 4KOTA 2Z10A 1YVOA 4FD4A 3IC1A 1HDQA 1MJ9A 4PXDA 1BLLE 2FT0A 4NEXA 4H6ZA 4LQGA 5F47A 4QBJA 2J8NA 4CYNA 1IYKA 2VEZA 5KTCA 2OU2A 4HPSA 4C2XA 1M44A 1H8LA 3WABA 4MHDA 1TKJA 2K5TA 4XPKA 5ELYA 1YSJA 1VHEA 4UEZA 4M6HA 1CPSA 1R57A 4IF5A 5JPHA 3CPXA 3D7GA 3NE7A 4AVCA 3GKRA 3NA6A 4ORFA 2VXKA 3GY9A 3H4QA 3PBBA 3F0AA 3S6KA 2NMTA 3P2FA 4NGSA 2PR1A 3H8FA 3PB9X 5K8NA 3JUWA 3FEDA 2Z3MA 3IU2A 1VHSA 2Z3OA 1GYTA 1S5KA 2DPTA 3BI0A 3BHXA 2FIWA 2YNEA 3WC5A 4WJBA 4A33A 4E0AA 1QSRA 3GUXA 1VKCA 2REEA 2VZYA 3EFAA 3S6GA 4X3RA 2JBJA 1LANA 4ONWA 4U9ZA 3CDXA 2G3TA 1ZG9A 2O4HA 5J8FA 4XNHB 2G3AA 1RTQA 2EBJA 1IY7A 3KQZA 3KHXA 4IAVA 3V8IA 4CGPA 4DUKA 5D8NA 2ATRA 4JLYA 2Q4YA 2FSRA 4R6TA 4B14A 3MRUA 4UFXA 4MFLA 2B4DA 4J3GA 1B87A 2WYRA 1KUYA 2YNDA 1FNOA 3JTKA 4CRZB 1CJWA 2A4NA 1XEBA 4NGRA 4PXBA 3ISZA 4M6GA 1KUXA 2GREA 2ZEFA 1K4JA 5G22A 2PJ5A 2Q4VA 1ZG7A 1QSNA 5KTAA 2AFWA 1NSLA 6CPAA 3T9YA 4AG9A 4AVBA 2OR4A 2JEVA 2G0BA 3L2NA 2VQYA 5HH1A 1S7FA 1PUAA 3VWEA 2Q0YA 1RO5A 4B10A 3PEIA 2PJ0A 1AUGA 1KUVA 2GLFA 5HMNA 3CXQA 3KZWA 1J4JA 3NH5A 2DEAA 4CRYB 3D2PA 2PJ3A 2ZEMA 4P45A 1NMTA 5H86A 4EFDA 2O28A 4RN7A 4Y49C 2POKA 4FWUA 5IV0A 4DNCA 3RAMA 2D4OA 3IWEA 2V77A 3W6SA 2V8VA 3KHZA 4P4FA 4MBUA 3FJUA 2C6PA 2PJ1A 4CGLA 4Z65A 3LACA 2QMLA 5LYLA 2GFQA 2VZZA 1XRYA 3ZJ0A 3JVNA 3W91A 1IIDA 4KUBA 4JJXA 3GB0A 2WUUA 4NF1A 1TF8A 2CY2A 2RFHA 2Q7BA 4H6UA 3GIUA 3FH4A 2PVVA 3SI2A 1BO4A 2B3UA 2C1CA 4WWVA 4II9A 2EK9A 2ZW6A 4MFJA 5A27A 5C82A 2JDDA 2OB0A 3KKWA 2PCUA 2HQYA 4XPLA 2HC9A 4Q36A 2PJ7A 3TC8A 2FS5A 2C27A 5F48A 4EWTA 4MXUA 2AFOA 2V8GA 1YR0A 2PC1A 2AFSA 3F8KA 3K9UA 1OZPA 1V0CA 4KVOE 4UWJA 3P2HA 2ZEDA 3D3SA 3SI1A 1TKHA 1ZO0A 5EC4A 1L0CA 4A95A 3RZAA 1QMUA 2PQ8A 3IU1A 2ZEHA 3QAHA 4G1PA 2B3VA 3EXNA 4NGPA 2CIJA 4XNHC 2ARHA 4ZYQA 4MFZA 3R9FA 3PB7X 4KOUA 2DPSA 3FBUA 1P0HA 4AVAA 4LX9A 1CG2A 1LAPA 5DWMA 4IK2A 2Q7SA 4UBRA 4Q7AA 2CF4A 5IB0A 4OC3A 2EO8A 4BBHA 3SJXA 4FD5A 3LMSA 2ZW7A 1YW4A 2CTCA 3CPAA 4Q38A 1VHOA 3GLJA 1DE4C 1S7NA 4MRIA 4B12A 3RYOA 2BEIA 2Q44A 2EWBA 2QIRA 1DTDA 4OIWA 2B5GB 1CM0A 3CXSA 4C68A 1XMTA 2NSMA 2ZEOA 1TKFA 3KI9A 1UWYA 4JWPA 2JDCA 1WWZA 3NFZA 5CPAA 2OZUA 2ZEGA 3FNCA 3SXOA 2PRQA 4OADA 3B3WA 4YGOA 5K8OA 4X8IA 3BJ7A 4AXVA 5DWNA 1XBUA 3NE8A 3BI1A 2F5IA 3TX8A 4MY3A 2HUZA 4TWEA 2BSWA 4L89A 3FVLA 4F6AA 2RC4A 3B8GA 2QVPA 2QYVA 3C26A 2EUIA 1MJAA 1XIXA 1YK3A 2ANPA 2I79A 2B58A 1BOBA 2QECA 4KOXA 1Q2CA 1IYLA 4MFPA 4UCNA 4FBEA 3D2MA 1A2ZA 4NFRA 2ABZA 4CAXA 1PCAA 1P4NA 1S3ZA 3DDDA 2F7VA 3I1UA 1YVKA 2GIVA 1AYEA 2XEFA 3IJ3A 2V8DA 4CYQA 4F9VA 3IEHA 2IQ6A 2QJ8A 1XOVA 2PJ9A 2ZELA 4JD6A 5G20A 4OAEA 3B3CA 3T8WA 1Z8LA 4FAIA 2PJAA 2F8HA 4ZY0A 4KLVA 3ISXA 2C6GA 5K8MA 1XFOA 4M85A 3IWGA 4IUSA 4U5YA 3DR6A 1LAMA 5AG6A 8CPAA 5D29A 3NH8A 1FY7A 1Z4EA 1RXTA 4A94A 5I4MA 4PSXA 1MK4A 1JQGA 1XJOA 4CYPA 3D4UA 4KSFA 3IFEA 2H5MA 2OZHA 4UEEA 2FXFA 5CNPA 5AG7A 1S7KA 3PB8X 4M3SA 1M4IA 1LFWA 1IOIA 3N7ZA 2PJCA 2PJ4A 1I21A 4RS2A 4R3LA 4P4IA 4XPDC 1Z8TA 4C7IA 1QSTA 4ZI6A 4KSAA 2R98A 4HNWB 2P6FA 5JGFA 3S6HA 4PV6A 4QB9A 1QSMA 1X12A 1Y7RA 2PVWA 3PBEA 4MHPA 4OP4A 2J8RA 4R9MA 4UF4A 2OH1A 2PJ6A 4IHMA 4R3KA 2WZNA 4YU9A 3T90A 3RNZA 1Q7LA 4QC6A 1SQHA 5H84A 3SXNA 2B5GA 1YLEA 4ZY1A 5CBMA 1ELMP 4JZ0A 2ZPAA 2ZEPA 4UCMA 2PRBA 2FCKA 2GU2A 1M4GA 1Z8XA 4R57A 3BJ8A 1PU9A 1TIQA 2Z11A 4R8FA 4EVYA 4E2AA 3FB3A 3V7ZA 4CS0B 4EMEA 5LYFA 3CZXA 1MJBA 5J1QA 4KOSA 4MJ8A 3WC6A 4YWYA 4MHYA 2Y0MA 1YLOA 4KZTA 2Q43A 2PJBA 2CTBA 4R7MA 3R96A 1Z5RA 1Z9UA 2Q51A 4LQ6A 1IOFA 2PR8A 4LUAA 3SJEA 4P10A 2ZOFA 1ON0A 2JEWA 3D7DA 3FRMA 4GM5A 4O23A 4P6YA 2PIZA 3B3TA 5JQ4A 1HEEA 2WPWA 4OC4A 4NGMA 4B6ZA 3TE4A 3FIXA 4X5KA 1TF9A 2ZENA 3TTHA 2Z3NA 3R9EA 3VH9A 4NCZA 1YW6A 3EY5A 3V38A 1B6BA 3S6FA 4DJLA 1XF8A 1I12A 5AG4A 3K9TA 3W6XA 2R7HA 3B7IA 1HDUA 2IMOA 4MHNA 3KR4A 2Q4ZA 4PXEA 4B5OA 2D4PA 3R95A 4MCSA 2ZW5A 3RO0A 4CAVA 1XE4A 5K8PA 4OC5A 3H8GA 1IGBA 3QNVA 3A9LA 3OWCA 3KQXA 2JBKA 3PB4X 3NH4A 3B2YA 3TO9A 3HUVA 2Z0ZA 4BINA 3S9LA 3TCVA 3D66A 3PGPA 4P4BA 4PK2A 2FIAA 2P6EA 1KZFA 1S60A 4R76A 1F2OA 4FD6A 4CYOA 5LYDA 4OLLA 4NJRA 4F0YA 4MY0A 5LRJA 3DLJA 1Y0RA 4FD7A 1Y0YA 2YNCA 3B3SA 4BD9A 1NSAA 1BAVA 2Z3PA 3G8WA 4MCPA 2C6CA 4OKOA 4MFKA 4F8ZA 4UFWA 2WPXA 1Q2DA 2ZEEA 3DR8A 3B3VA 3ZZIA 1R43A 4A31A 2PIYA 4UCPA 1ARLA 1BPNA 1M4DA 2YNCC 3FMCA 1NE9A 3I9SA 3UY5A 2FE7A 4YRHA 4OC1A 3VATA 4AB7A 4P4DA 1PYTB 4PXCA 3QAYA 4P44A 1QSOA 4CGNA 2PJ2A 3SJFA 1CBXA 4PK3A 2BUEA 3PFOA 1JWQA 4GS4A 3DNSA 2CXAA 2KCWA 4CPAA 2BOAA 4ZX9A 5F46A 5KTDA 5LRKA 2FVGA 3FXTA 4ONUA 2B4BA 1IU8A 2WSAA 4JYWA
chains in the Genus database with same CATH topology
4UWIA 2AJ6A 4AG7A 4JXRA 1M1DA 4F0XA 3R1KA 2R8VA 4UA3A 4QUSA 2EVNA 5F49A 2Z3KA 5EBVA 3BLNA 5G21A 3QB8A 2P6GA 2ZXVA 1I1DA 3LD2A 1N71A 3GYAA 4U9YA 1UFHA 2CNTA 2FL4A 3TT2A 3CXPA 4YFJA 4CGOA 3TO6A 2J8MA 3PZJA 1IICA 2AE6A 4ZGYB 1Y9KA 4CGMA 3H5ZA 4KORA 5ISVA 3IGRA 4KOYA 4KOVA 5J8CA 3VWDA 4HNYB 2DXQA 2REFA 5G1ZA 4A32A 3MGDA 3TFYA 2JLMA 3E0KA 4B5PB 4K30A 5AGEA 5C88A 1IB1E 4L8AA 4NSQA 4A2ZA 3R9GA 1YREA 2CNMA 4R87A 2CNSA 3I3GA 2ZW4A 4ZBGA 5GCNA 1S7LA 2GANA 4KOWA 2PDOA 1GHEA 4A30A 4C2YA 2X7BA 1Q2YA 2HV2A 4C2ZA 3EC4A 3TO7A 3EO4A 4PSWA 4KLWA 2IL4A 3D8PA 3SHPA 5I0CA 2OZGA 3WR7A 3TOBA 4KS9A 4MI4A 1WK4A 3F5BA 4BMHA 2Z3LA 2BL1A 3PP9A 4NXYA 2YGWA 4HNXB 2VBQA 4KUAA 5DWMA 2PSWA 4MFQA 2B4DB 1U6MA 4B13A 4I49A 4C7HA 4KVME 3TOAA 2VI7A 4HKFA 3G3SA 4UFVA 2I00A 4CAFA 4CAEA 3FYNA 2GE3A 4B11A 1YGHA 5FVJA 4JXQA 5E96A 4XPDB 4QVTA 3DSBA 1YX0A 1LRZA 5BWAB 4E8OA 3LODA 4H89A 2R1IA 4KVXA 4CAWA 1Z4RA 5AG5A 4Y49B 4B5PA 1Y9WA 2P0WA 4RI1A 2Q04A 5A28A 5IX3A 4KOTA 2Z10A 1YVOA 4FD4A 1MJ9A 2FT0A 4NEXA 4H6ZA 5F47A 4QBJA 2J8NA 4CYNA 1IYKA 2VEZA 5KTCA 2OU2A 4C2XA 1M44A 4MHDA 2K5TA 4XPKA 1R57A 4IF5A 5JPHA 3NE7A 4AVCA 3GKRA 4ORFA 2VXKA 3GY9A 3H4QA 3F0AA 3S6KA 2NMTA 3P2FA 2PR1A 3JUWA 2Z3MA 3IU2A 1VHSA 2Z3OA 1S5KA 2DPTA 2FIWA 2YNEA 4A33A 4E0AA 1QSRA 1VKCA 2REEA 2VZYA 3EFAA 3S6GA 4U9ZA 2G3TA 5J8FA 4XNHB 2G3AA 4CGPA 3V8IA 2ATRA 4JLYA 2Q4YA 2FSRA 4B14A 4UFXA 4MFLA 2B4DA 4J3GA 1B87A 1KUYA 2YNDA 3JTKA 4CRZB 1CJWA 2A4NA 1XEBA 1KUXA 5G22A 1K4JA 2Q4VA 1QSNA 5KTAA 1NSLA 3T9YA 4AG9A 4AVBA 2JEVA 2G0BA 2VQYA 5HH1A 1S7FA 1PUAA 3VWEA 2Q0YA 1RO5A 4B10A 1KUVA 5HMNA 3CXQA 1J4JA 4CRYB 3D2PA 1NMTA 5H86A 2O28A 4Y49C 5IV0A 4DNCA 2D4OA 3IWEA 3W6SA 4MBUA 4CGLA 2QMLA 2VZZA 3ZJ0A 3JVNA 3W91A 1IIDA 4KUBA 4JJXA 4NF1A 2WUUA 2CY2A 2Q7BA 4H6UA 1BO4A 2B3UA 4II9A 2ZW6A 4MFJA 5C82A 2JDDA 2OB0A 3KKWA 2HQYA 4XPLA 4Q36A 2FS5A 2C27A 5F48A 1YR0A 2PC1A 3F8KA 3K9UA 1OZPA 1V0CA 4KVOE 4UWJA 3P2HA 3D3SA 1ZO0A 5EC4A 1L0CA 4A95A 2PQ8A 3IU1A 3QAHA 2B3VA 3EXNA 4XNHC 2ARHA 4MFZA 3R9FA 4KOUA 2DPSA 3FBUA 1P0HA 4AVAA 4LX9A 4UBRA 5IB0A 4BBHA 4FD5A 2ZW7A 4Q38A 1S7NA 4B12A 3RYOA 2BEIA 2Q44A 2QIRA 2B5GB 1CM0A 3CXSA 4C68A 1XMTA 4JWPA 2JDCA 1WWZA 2OZUA 3FNCA 3SXOA 4OADA 4YGOA 3BJ7A 5DWNA 2F5IA 4MY3A 2HUZA 2BSWA 4L89A 2RC4A 3B8GA 3C26A 2EUIA 1MJAA 1XIXA 1YK3A 2I79A 2B58A 1BOBA 2QECA 4KOXA 1Q2CA 1IYLA 4MFPA 4UCNA 3D2MA 4CAXA 1P4NA 1S3ZA 3DDDA 1YVKA 2GIVA 4CYQA 5G20A 4JD6A 4OAEA 4KLVA 4M85A 3IWGA 4IUSA 4U5YA 3DR6A 5AG6A 1FY7A 1Z4EA 1RXTA 4PSXA 1MK4A 4CYPA 4KSFA 2H5MA 2OZHA 2FXFA 5CNPA 5AG7A 1S7KA 4M3SA 1M4IA 3N7ZA 1I21A 4RS2A 4R3LA 4XPDC 4C7IA 1QSTA 4KSAA 2R98A 4HNWB 2P6FA 3S6HA 4PV6A 4QB9A 1QSMA 1Y7RA 2J8RA 4R9MA 2OH1A 4R3KA 3T90A 4QC6A 1SQHA 5H84A 3SXNA 2B5GA 1YLEA 2ZPAA 4UCMA 2PRBA 2FCKA 1M4GA 4R57A 3BJ8A 1PU9A 1TIQA 2Z11A 4EVYA 4E2AA 3FB3A 4CS0B 1MJBA 4KOSA 4MJ8A 2Y0MA 4KZTA 3R96A 1Z9UA 4LUAA 2PR8A 1ON0A 3FRMA 5JQ4A 2WPWA 3TE4A 3FIXA 4X5KA 3TTHA 2Z3NA 3R9EA 4NCZA 3EY5A 1B6BA 3S6FA 1XF8A 1I12A 5AG4A 3W6XA 2R7HA 4B5OA 4F6AA 5A27A 2D4PA 3R95A 2ZW5A 4CAVA 1XE4A 3A9LA 3OWCA 3TO9A 2Z0ZA 3TCVA 3PGPA 4PK2A 2FIAA 2P6EA 1KZFA 1S60A 4FD6A 4CYOA 4OLLA 4F0YA 4MY0A 4FD7A 2YNCA 2Z3PA 3G8WA 4MFKA 4UFWA 2WPXA 1Q2DA 3DR8A 4A31A 3ZZIA 4UCPA 1M4DA 2YNCC 3UY5A 1NE9A 3I9SA 2FE7A 4YRHA 4AB7A 1QSOA 4CGNA 4PK3A 2BUEA 4GS4A 3DNSA 2CXAA 2KCWA 5F46A 5KTDA 3FXTA 4ONUA 2B4BA 2WSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UWI A;  2AJ6 A;  4AG7 A;  4JXR A;  1M1D A;  3R1K A;  2R8V A;  4UA3 A;  4QUS A;  2EVN A;  5F49 A;  5EBV A;  3BLN A;  3QB8 A;  2P6G A;  2ZXV A;  1I1D A;  3LD2 A;  1N71 A;  3GYA A;  4U9Y A;  1UFH A;  2CNT A;  2FL4 A;  3TT2 A;  3CXP A;  4YFJ A;  3TO6 A;  2J8M A;  3PZJ A;  1IIC A;  2AE6 A;  1Y9K A;  5ISV A;  4KOR A;  3IGR A;  4KOY A;  4KOV A;  5J8C A;  3VWD A;  4HNY B;  2DXQ A;  2REF A;  3MGD A;  3TFY A;  2JLM A;  3E0K A;  4B5P B;  4K30 A;  5C88 A;  1IB1 E;  4L8A A;  4NSQ A;  3R9G A;  1YRE A;  2CNM A;  4R87 A;  2CNS A;  3I3G A;  2ZW4 A;  4ZBG A;  5GCN A;  1S7L A;  2GAN A;  4KOW A;  2PDO A;  1GHE A;  2X7B A;  1Q2Y A;  2HV2 A;  3EC4 A;  3TO7 A;  3EO4 A;  4PSW A;  4KLW A;  2IL4 A;  3D8P A;  3SHP A;  5I0C A;  2OZG A;  3WR7 A;  3TOB A;  4MI4 A;  1WK4 A;  3F5B A;  4BMH A;  2BL1 A;  3PP9 A;  4NXY A;  4HNX B;  2VBQ A;  4KUA A;  5DWM A;  2PSW A;  2B4D B;  1U6M A;  4I49 A;  4KVM E;  3TOA A;  2VI7 A;  4HKF A;  3G3S A;  2I00 A;  3FYN A;  2GE3 A;  1YGH A;  5FVJ A;  4JXQ A;  5E96 A;  4XPD B;  4QVT A;  3DSB A;  1YX0 A;  1LRZ A;  4E8O A;  3LOD A;  4H89 A;  2R1I A;  4KVX A;  4CAW A;  1Z4R A;  4Y49 B;  4B5P A;  1Y9W A;  2P0W A;  4RI1 A;  2Q04 A;  5IX3 A;  4KOT A;  2Z10 A;  1YVO A;  4FD4 A;  1MJ9 A;  2FT0 A;  4NEX A;  4H6Z A;  5F47 A;  4QBJ A;  2J8N A;  1IYK A;  2VEZ A;  5KTC A;  2OU2 A;  1M44 A;  4MHD A;  2K5T A;  4XPK A;  1R57 A;  4IF5 A;  5JPH A;  3NE7 A;  4AVC A;  3GKR A;  4ORF A;  2VXK A;  3GY9 A;  3H4Q A;  3F0A A;  3S6K A;  2NMT A;  3P2F A;  2PR1 A;  3JUW A;  1VHS A;  1S5K A;  2FIW A;  4E0A A;  1QSR A;  1VKC A;  2REE A;  2VZY A;  3EFA A;  3S6G A;  4U9Z A;  2G3T A;  5J8F A;  4XNH B;  2G3A A;  3V8I A;  2ATR A;  4JLY A;  2Q4Y A;  2FSR A;  2B4D A;  4J3G A;  1B87 A;  1KUY A;  4CRZ B;  1CJW A;  2A4N A;  1XEB A;  1KUX A;  1K4J A;  2Q4V A;  1QSN A;  5KTA A;  1NSL A;  3T9Y A;  4AG9 A;  4AVB A;  2JEV A;  2G0B A;  2VQY A;  5HH1 A;  1S7F A;  1PUA A;  3VWE A;  2Q0Y A;  1RO5 A;  1KUV A;  5HMN A;  3CXQ A;  1J4J A;  4CRY B;  3D2P A;  1NMT A;  5H86 A;  2O28 A;  4Y49 C;  5IV0 A;  4DNC A;  2D4O A;  3W6S A;  4MBU A;  2QML A;  2VZZ A;  3ZJ0 A;  3JVN A;  3W91 A;  1IID A;  4KUB A;  4JJX A;  4NF1 A;  2CY2 A;  2Q7B A;  4H6U A;  1BO4 A;  2B3U A;  4II9 A;  2ZW6 A;  5C82 A;  2JDD A;  2OB0 A;  3KKW A;  2HQY A;  4XPL A;  2FS5 A;  2C27 A;  5F48 A;  1YR0 A;  2PC1 A;  3F8K A;  3K9U A;  1OZP A;  1V0C A;  4KVO E;  4UWJ A;  3P2H A;  3D3S A;  5EC4 A;  1L0C A;  2PQ8 A;  3QAH A;  2B3V A;  3EXN A;  4XNH C;  2ARH A;  3R9F A;  4KOU A;  3FBU A;  1P0H A;  4AVA A;  4LX9 A;  4UBR A;  5IB0 A;  4FD5 A;  2ZW7 A;  1S7N A;  3RYO A;  2BEI A;  2Q44 A;  2QIR A;  2B5G B;  1CM0 A;  3CXS A;  1XMT A;  4JWP A;  2JDC A;  1WWZ A;  2OZU A;  3FNC A;  3SXO A;  4OAD A;  4YGO A;  3BJ7 A;  5DWN A;  2F5I A;  4MY3 A;  2HUZ A;  2BSW A;  4L89 A;  2RC4 A;  3B8G A;  3C26 A;  2EUI A;  1MJA A;  1XIX A;  1YK3 A;  2I79 A;  2B58 A;  1BOB A;  2QEC A;  4KOX A;  1Q2C A;  1IYL A;  3D2M A;  4CAX A;  1P4N A;  1S3Z A;  3DDD A;  1YVK A;  2GIV A;  4JD6 A;  4OAE A;  4KLV A;  4M85 A;  3IWG A;  4IUS A;  4U5Y A;  3DR6 A;  1FY7 A;  1Z4E A;  1RXT A;  4PSX A;  1MK4 A;  2H5M A;  2OZH A;  2FXF A;  5CNP A;  1S7K A;  4M3S A;  1M4I A;  3N7Z A;  1I21 A;  4RS2 A;  4R3L A;  4XPD C;  1QST A;  2R98 A;  4HNW B;  2P6F A;  3S6H A;  4PV6 A;  4QB9 A;  1QSM A;  1Y7R A;  2J8R A;  4R9M A;  2OH1 A;  4R3K A;  3T90 A;  4QC6 A;  1SQH A;  5H84 A;  3SXN A;  2B5G A;  1YLE A;  2ZPA A;  2PRB A;  2FCK A;  1M4G A;  4R57 A;  3BJ8 A;  1PU9 A;  1TIQ A;  2Z11 A;  4EVY A;  4E2A A;  3FB3 A;  4CS0 B;  1MJB A;  4KOS A;  4MJ8 A;  2Y0M A;  4KZT A;  3R96 A;  1Z9U A;  4LUA A;  2PR8 A;  1ON0 A;  3FRM A;  5JQ4 A;  2WPW A;  3TE4 A;  3FIX A;  4X5K A;  3TTH A;  3R9E A;  4NCZ A;  3EY5 A;  1B6B A;  3S6F A;  1XF8 A;  1I12 A;  3W6X A;  2R7H A;  4B5O A;  4F6A A;  2D4P A;  3R95 A;  2ZW5 A;  4CAV A;  1XE4 A;  3OWC A;  3TO9 A;  2Z0Z A;  3TCV A;  3PGP A;  4PK2 A;  2FIA A;  2P6E A;  1KZF A;  1S60 A;  4FD6 A;  4OLL A;  4F0Y A;  4MY0 A;  4FD7 A;  3G8W A;  2WPX A;  1Q2D A;  3DR8 A;  3ZZI A;  1M4D A;  3UY5 A;  1NE9 A;  3I9S A;  2FE7 A;  4YRH A;  4AB7 A;  1QSO A;  4PK3 A;  2BUE A;  4GS4 A;  3DNS A;  2KCW A;  5F46 A;  5KTD A;  3FXT A;  4ONU A;  2B4B A; 
#chains in the Genus database with same CATH topology
 4UWI A;  2AJ6 A;  1CPX A;  4AG7 A;  1EE3 P;  1F2P A;  4JXR A;  1M1D A;  3KR5 A;  1BPM A;  2AFX A;  4F0X A;  3R1K A;  2R8V A;  1XMB A;  4UA3 A;  4QUS A;  2EVN A;  5F49 A;  1CP6 A;  2Z3K A;  1Z8W A;  2AFZ A;  3IO1 A;  5EBV A;  3KAS A;  3WT4 A;  4OME A;  3BLN A;  4TNU A;  5G21 A;  3QB8 A;  3FF3 A;  2ZOG A;  2P6G A;  2ZXV A;  1I1D A;  1M4L A;  3LD2 A;  3PFE A;  1FT7 A;  1N71 A;  3GYA A;  1Z2L A;  4M6I A;  4U9Y A;  2G9D A;  1ELL P;  1UFH A;  3K2K A;  2CNT A;  2FL4 A;  3HLP A;  4K3N A;  3CXP A;  5LRG A;  3TT2 A;  3VAR A;  3IIB A;  4CGO A;  3TO6 A;  1YQE A;  4YFJ A;  2J8M A;  3PZJ A;  4DYO A;  1IIC A;  2AE6 A;  4OID A;  4ZGY B;  3JRU A;  3PB6 X;  4ZY2 A;  4OC0 A;  4A37 A;  1Y9K A;  1AMP A;  4CGM A;  3H5Z A;  4KOR A;  5ISV A;  3IGR A;  1CP7 A;  1X10 A;  4KOY A;  4KOV A;  1Y7E A;  4PPZ A;  2O53 A;  5J8C A;  3VWD A;  2XEG A;  1TXR A;  3KL9 A;  1LOK A;  2DXQ A;  3CT9 A;  4FUU A;  4HNY B;  4MHZ A;  4UEF A;  1R3N A;  2BCO A;  1VIX A;  2REF A;  3MN8 A;  5G1Z A;  3DGV A;  4A32 A;  3MGD A;  1LCP A;  3TFY A;  3IWW A;  2BO9 A;  2JLM A;  4RUH A;  2HB6 A;  3E0K A;  4B5P B;  2NYQ A;  4K30 A;  4PQA A;  5AGE A;  5THW A;  5C88 A;  1IB1 E;  3H8E A;  4L8A A;  4ZX8 A;  4NSQ A;  3S9M A;  3R9G A;  4A2Z A;  4F9U A;  1YRE A;  2CNM A;  4R87 A;  5HXD A;  2CNS A;  3I3G A;  4NJQ A;  2ZW4 A;  4ZBG A;  4P4E A;  4OC2 A;  4P4J A;  5GCN A;  3S9N A;  1ZLH A;  1S7L A;  2DF5 A;  2GAN A;  3D68 A;  4KOW A;  2IJZ A;  4KSI A;  4MCQ A;  2PDO A;  1GHE A;  3FEC A;  4NGN A;  4A30 A;  4C2Y A;  5JM6 A;  5LYI A;  4NGT A;  2X7B A;  1Q2Y A;  2HV2 A;  4C2Z A;  2XEJ A;  3EC4 A;  3B35 A;  3D7F A;  5F09 A;  3TO7 A;  3EO4 A;  4PSW A;  4KLW A;  2IL4 A;  4W9Y A;  3D8P A;  3WC7 A;  3SHP A;  5I0C A;  2OZG A;  2V8H A;  2ODF A;  3WR7 A;  3TOB A;  4KS9 A;  2RB7 A;  4MI4 A;  4MCR A;  1WK4 A;  4A39 A;  3SI0 A;  1ZLI A;  3BXM A;  1CX8 A;  3F5B A;  4MMO A;  2I3C A;  4BMH A;  4X2T A;  4UIA A;  4A38 A;  2Z3L A;  4NGQ A;  5JH9 A;  2BL1 A;  3PP9 A;  3N5F A;  3D7H A;  4NXY A;  2VL1 A;  3D67 A;  2YGW A;  4HNX B;  2VBQ A;  4KUA A;  2XEI A;  1OBR A;  2PE3 A;  2PSW A;  2B4D B;  1F57 A;  1U6M A;  4MFQ A;  4B13 A;  4I49 A;  4C7H A;  4KVM E;  3TOA A;  2VI7 A;  4HKF A;  3G3S A;  4UFV A;  5EMI A;  2I00 A;  4CAF A;  4CAE A;  1ARM A;  1KWM A;  3KGQ A;  5HVH A;  3FYN A;  2GE3 A;  4B11 A;  2GLJ A;  1YGH A;  1YME A;  5FVJ A;  4JXQ A;  3SJG A;  5IB9 A;  1QQ9 A;  4XPD B;  5E96 A;  4QVT A;  3DSB A;  3PRT A;  1YX0 A;  1LRZ A;  2PJ8 A;  2J9A A;  5BWA B;  4E8O A;  7CPA A;  1ZG8 A;  4GXH A;  5HVF A;  5DS0 A;  3LOD A;  4H89 A;  2R1I A;  3FEE A;  4KVX A;  3RBU A;  2AFU A;  4CAW A;  1VGY A;  1Z4R A;  4H2K A;  5AG5 A;  4Y49 B;  2AFM A;  4B5P A;  3LWU A;  1Y9W A;  2P0W A;  4RI1 A;  5HVG A;  2Q04 A;  3FX6 A;  2EK8 A;  5A28 A;  4UIB A;  2OOT A;  5IX3 A;  4KOT A;  2Z10 A;  1YVO A;  4FD4 A;  3IC1 A;  1HDQ A;  1MJ9 A;  4PXD A;  1BLL E;  2FT0 A;  4NEX A;  4H6Z A;  4LQG A;  5F47 A;  4QBJ A;  2J8N A;  4CYN A;  1IYK A;  2VEZ A;  5KTC A;  2OU2 A;  4HPS A;  4C2X A;  1M44 A;  1H8L A;  3WAB A;  4MHD A;  1TKJ A;  2K5T A;  4XPK A;  5ELY A;  1YSJ A;  1VHE A;  4UEZ A;  4M6H A;  1CPS A;  1R57 A;  4IF5 A;  5JPH A;  3CPX A;  3D7G A;  3NE7 A;  4AVC A;  3GKR A;  3NA6 A;  4ORF A;  2VXK A;  3GY9 A;  3H4Q A;  3PBB A;  3F0A A;  3S6K A;  2NMT A;  3P2F A;  4NGS A;  2PR1 A;  3H8F A;  3PB9 X;  5K8N A;  3JUW A;  3FED A;  2Z3M A;  3IU2 A;  1VHS A;  2Z3O A;  1GYT A;  1S5K A;  2DPT A;  3BI0 A;  3BHX A;  2FIW A;  2YNE A;  3WC5 A;  4WJB A;  4A33 A;  4E0A A;  1QSR A;  3GUX A;  1VKC A;  2REE A;  2VZY A;  3EFA A;  3S6G A;  4X3R A;  2JBJ A;  1LAN A;  4ONW A;  4U9Z A;  3CDX A;  2G3T A;  1ZG9 A;  2O4H A;  5J8F A;  4XNH B;  2G3A A;  1RTQ A;  2EBJ A;  1IY7 A;  3KQZ A;  3KHX A;  4IAV A;  3V8I A;  4CGP A;  4DUK A;  5D8N A;  2ATR A;  4JLY A;  2Q4Y A;  2FSR A;  4R6T A;  4B14 A;  3MRU A;  4UFX A;  4MFL A;  2B4D A;  4J3G A;  1B87 A;  2WYR A;  1KUY A;  2YND A;  1FNO A;  3JTK A;  4CRZ B;  1CJW A;  2A4N A;  1XEB A;  4NGR A;  4PXB A;  3ISZ A;  4M6G A;  1KUX A;  2GRE A;  2ZEF A;  1K4J A;  5G22 A;  2PJ5 A;  2Q4V A;  1ZG7 A;  1QSN A;  5KTA A;  2AFW A;  1NSL A;  6CPA A;  3T9Y A;  4AG9 A;  4AVB A;  2OR4 A;  2JEV A;  2G0B A;  3L2N A;  2VQY A;  5HH1 A;  1S7F A;  1PUA A;  3VWE A;  2Q0Y A;  1RO5 A;  4B10 A;  3PEI A;  2PJ0 A;  1AUG A;  1KUV A;  2GLF A;  5HMN A;  3CXQ A;  3KZW A;  1J4J A;  3NH5 A;  2DEA A;  4CRY B;  3D2P A;  2PJ3 A;  2ZEM A;  4P45 A;  1NMT A;  5H86 A;  4EFD A;  2O28 A;  4RN7 A;  4Y49 C;  2POK A;  4FWU A;  5IV0 A;  4DNC A;  3RAM A;  2D4O A;  3IWE A;  2V77 A;  3W6S A;  2V8V A;  3KHZ A;  4P4F A;  4MBU A;  3FJU A;  2C6P A;  2PJ1 A;  4CGL A;  4Z65 A;  3LAC A;  2QML A;  5LYL A;  2GFQ A;  2VZZ A;  1XRY A;  3ZJ0 A;  3JVN A;  3W91 A;  1IID A;  4KUB A;  4JJX A;  3GB0 A;  2WUU A;  4NF1 A;  1TF8 A;  2CY2 A;  2RFH A;  2Q7B A;  4H6U A;  3GIU A;  3FH4 A;  2PVV A;  3SI2 A;  1BO4 A;  2B3U A;  2C1C A;  4WWV A;  4II9 A;  2EK9 A;  2ZW6 A;  4MFJ A;  5A27 A;  5C82 A;  2JDD A;  2OB0 A;  3KKW A;  2PCU A;  2HQY A;  4XPL A;  2HC9 A;  4Q36 A;  2PJ7 A;  3TC8 A;  2FS5 A;  2C27 A;  5F48 A;  4EWT A;  4MXU A;  2AFO A;  2V8G A;  1YR0 A;  2PC1 A;  2AFS A;  3F8K A;  3K9U A;  1OZP A;  1V0C A;  4KVO E;  4UWJ A;  3P2H A;  2ZED A;  3D3S A;  3SI1 A;  1TKH A;  1ZO0 A;  5EC4 A;  1L0C A;  4A95 A;  3RZA A;  1QMU A;  2PQ8 A;  3IU1 A;  2ZEH A;  3QAH A;  4G1P A;  2B3V A;  3EXN A;  4NGP A;  2CIJ A;  4XNH C;  2ARH A;  4ZYQ A;  4MFZ A;  3R9F A;  3PB7 X;  4KOU A;  2DPS A;  3FBU A;  1P0H A;  4AVA A;  4LX9 A;  1CG2 A;  1LAP A;  5DWM A;  4IK2 A;  2Q7S A;  4UBR A;  4Q7A A;  2CF4 A;  5IB0 A;  4OC3 A;  2EO8 A;  4BBH A;  3SJX A;  4FD5 A;  3LMS A;  2ZW7 A;  1YW4 A;  2CTC A;  3CPA A;  4Q38 A;  1VHO A;  3GLJ A;  1DE4 C;  1S7N A;  4MRI A;  4B12 A;  3RYO A;  2BEI A;  2Q44 A;  2EWB A;  2QIR A;  1DTD A;  4OIW A;  2B5G B;  1CM0 A;  3CXS A;  4C68 A;  1XMT A;  2NSM A;  2ZEO A;  1TKF A;  3KI9 A;  1UWY A;  4JWP A;  2JDC A;  1WWZ A;  3NFZ A;  5CPA A;  2OZU A;  2ZEG A;  3FNC A;  3SXO A;  2PRQ A;  4OAD A;  3B3W A;  4YGO A;  5K8O A;  4X8I A;  3BJ7 A;  4AXV A;  5DWN A;  1XBU A;  3NE8 A;  3BI1 A;  2F5I A;  3TX8 A;  4MY3 A;  2HUZ A;  4TWE A;  2BSW A;  4L89 A;  3FVL A;  4F6A A;  2RC4 A;  3B8G A;  2QVP A;  2QYV A;  3C26 A;  2EUI A;  1MJA A;  1XIX A;  1YK3 A;  2ANP A;  2I79 A;  2B58 A;  1BOB A;  2QEC A;  4KOX A;  1Q2C A;  1IYL A;  4MFP A;  4UCN A;  4FBE A;  3D2M A;  1A2Z A;  4NFR A;  2ABZ A;  4CAX A;  1PCA A;  1P4N A;  1S3Z A;  3DDD A;  2F7V A;  3I1U A;  1YVK A;  2GIV A;  1AYE A;  2XEF A;  3IJ3 A;  2V8D A;  4CYQ A;  4F9V A;  3IEH A;  2IQ6 A;  2QJ8 A;  1XOV A;  2PJ9 A;  2ZEL A;  4JD6 A;  5G20 A;  4OAE A;  3B3C A;  3T8W A;  1Z8L A;  4FAI A;  2PJA A;  2F8H A;  4ZY0 A;  4KLV A;  3ISX A;  2C6G A;  5K8M A;  1XFO A;  4M85 A;  3IWG A;  4IUS A;  4U5Y A;  3DR6 A;  1LAM A;  5AG6 A;  8CPA A;  5D29 A;  3NH8 A;  1FY7 A;  1Z4E A;  1RXT A;  4A94 A;  5I4M A;  4PSX A;  1MK4 A;  1JQG A;  1XJO A;  4CYP A;  3D4U A;  4KSF A;  3IFE A;  2H5M A;  2OZH A;  4UEE A;  2FXF A;  5CNP A;  5AG7 A;  1S7K A;  3PB8 X;  4M3S A;  1M4I A;  1LFW A;  1IOI A;  3N7Z A;  2PJC A;  2PJ4 A;  1I21 A;  4RS2 A;  4R3L A;  4P4I A;  4XPD C;  1Z8T A;  4C7I A;  1QST A;  4ZI6 A;  4KSA A;  2R98 A;  4HNW B;  2P6F A;  5JGF A;  3S6H A;  4PV6 A;  4QB9 A;  1QSM A;  1X12 A;  1Y7R A;  2PVW A;  3PBE A;  4MHP A;  4OP4 A;  2J8R A;  4R9M A;  4UF4 A;  2OH1 A;  2PJ6 A;  4IHM A;  4R3K A;  2WZN A;  4YU9 A;  3T90 A;  3RNZ A;  1Q7L A;  4QC6 A;  1SQH A;  5H84 A;  3SXN A;  2B5G A;  1YLE A;  4ZY1 A;  5CBM A;  1ELM P;  4JZ0 A;  2ZPA A;  2ZEP A;  4UCM A;  2PRB A;  2FCK A;  2GU2 A;  1M4G A;  1Z8X A;  4R57 A;  3BJ8 A;  1PU9 A;  1TIQ A;  2Z11 A;  4R8F A;  4EVY A;  4E2A A;  3FB3 A;  3V7Z A;  4CS0 B;  4EME A;  5LYF A;  3CZX A;  1MJB A;  5J1Q A;  4KOS A;  4MJ8 A;  3WC6 A;  4YWY A;  4MHY A;  2Y0M A;  1YLO A;  4KZT A;  2Q43 A;  2PJB A;  2CTB A;  4R7M A;  3R96 A;  1Z5R A;  1Z9U A;  2Q51 A;  4LQ6 A;  1IOF A;  2PR8 A;  4LUA A;  3SJE A;  4P10 A;  2ZOF A;  1ON0 A;  2JEW A;  3D7D A;  3FRM A;  4GM5 A;  4O23 A;  4P6Y A;  2PIZ A;  3B3T A;  5JQ4 A;  1HEE A;  2WPW A;  4OC4 A;  4NGM A;  4B6Z A;  3TE4 A;  3FIX A;  4X5K A;  1TF9 A;  2ZEN A;  3TTH A;  2Z3N A;  3R9E A;  3VH9 A;  4NCZ A;  1YW6 A;  3EY5 A;  3V38 A;  1B6B A;  3S6F A;  4DJL A;  1XF8 A;  1I12 A;  5AG4 A;  3K9T A;  3W6X A;  2R7H A;  3B7I A;  1HDU A;  2IMO A;  4MHN A;  3KR4 A;  2Q4Z A;  4PXE A;  4B5O A;  2D4P A;  3R95 A;  4MCS A;  2ZW5 A;  3RO0 A;  4CAV A;  1XE4 A;  5K8P A;  4OC5 A;  3H8G A;  1IGB A;  3QNV A;  3A9L A;  3OWC A;  3KQX A;  2JBK A;  3PB4 X;  3NH4 A;  3B2Y A;  3TO9 A;  3HUV A;  2Z0Z A;  4BIN A;  3S9L A;  3TCV A;  3D66 A;  3PGP A;  4P4B A;  4PK2 A;  2FIA A;  2P6E A;  1KZF A;  1S60 A;  4R76 A;  1F2O A;  4FD6 A;  4CYO A;  5LYD A;  4OLL A;  4NJR A;  4F0Y A;  4MY0 A;  5LRJ A;  3DLJ A;  1Y0R A;  4FD7 A;  1Y0Y A;  2YNC A;  3B3S A;  4BD9 A;  1NSA A;  1BAV A;  2Z3P A;  3G8W A;  4MCP A;  2C6C A;  4OKO A;  4MFK A;  4F8Z A;  4UFW A;  2WPX A;  1Q2D A;  2ZEE A;  3DR8 A;  3B3V A;  3ZZI A;  1R43 A;  4A31 A;  2PIY A;  4UCP A;  1ARL A;  1BPN A;  1M4D A;  2YNC C;  3FMC A;  1NE9 A;  3I9S A;  3UY5 A;  2FE7 A;  4YRH A;  4OC1 A;  3VAT A;  4AB7 A;  4P4D A;  1PYT B;  4PXC A;  3QAY A;  4P44 A;  1QSO A;  4CGN A;  2PJ2 A;  3SJF A;  1CBX A;  4PK3 A;  2BUE A;  3PFO A;  1JWQ A;  4GS4 A;  3DNS A;  2CXA A;  2KCW A;  4CPA A;  2BOA A;  4ZX9 A;  5F46 A;  5KTD A;  5LRK A;  2FVG A;  3FXT A;  4ONU A;  2B4B A;  1IU8 A;  2WSA A;  4JYW A; 
#chains in the Genus database with same CATH homology
 4UWI A;  2AJ6 A;  4AG7 A;  4JXR A;  1M1D A;  4F0X A;  3R1K A;  2R8V A;  4UA3 A;  4QUS A;  2EVN A;  5F49 A;  2Z3K A;  5EBV A;  3BLN A;  5G21 A;  3QB8 A;  2P6G A;  2ZXV A;  1I1D A;  3LD2 A;  1N71 A;  3GYA A;  4U9Y A;  1UFH A;  2CNT A;  2FL4 A;  3TT2 A;  3CXP A;  4YFJ A;  4CGO A;  3TO6 A;  2J8M A;  3PZJ A;  1IIC A;  2AE6 A;  4ZGY B;  1Y9K A;  4CGM A;  3H5Z A;  4KOR A;  5ISV A;  3IGR A;  4KOY A;  4KOV A;  5J8C A;  3VWD A;  4HNY B;  2DXQ A;  2REF A;  5G1Z A;  4A32 A;  3MGD A;  3TFY A;  2JLM A;  3E0K A;  4B5P B;  4K30 A;  5AGE A;  5C88 A;  1IB1 E;  4L8A A;  4NSQ A;  4A2Z A;  3R9G A;  1YRE A;  2CNM A;  4R87 A;  2CNS A;  3I3G A;  2ZW4 A;  4ZBG A;  5GCN A;  1S7L A;  2GAN A;  4KOW A;  2PDO A;  1GHE A;  4A30 A;  4C2Y A;  2X7B A;  1Q2Y A;  2HV2 A;  4C2Z A;  3EC4 A;  3TO7 A;  3EO4 A;  4PSW A;  4KLW A;  2IL4 A;  3D8P A;  3SHP A;  5I0C A;  2OZG A;  3WR7 A;  3TOB A;  4KS9 A;  4MI4 A;  1WK4 A;  3F5B A;  4BMH A;  2Z3L A;  2BL1 A;  3PP9 A;  4NXY A;  2YGW A;  4HNX B;  2VBQ A;  4KUA A;  5DWM A;  2PSW A;  4MFQ A;  2B4D B;  1U6M A;  4B13 A;  4I49 A;  4C7H A;  4KVM E;  3TOA A;  2VI7 A;  4HKF A;  3G3S A;  4UFV A;  2I00 A;  4CAF A;  4CAE A;  3FYN A;  2GE3 A;  4B11 A;  1YGH A;  5FVJ A;  4JXQ A;  5E96 A;  4XPD B;  4QVT A;  3DSB A;  1YX0 A;  1LRZ A;  5BWA B;  4E8O A;  3LOD A;  4H89 A;  2R1I A;  4KVX A;  4CAW A;  1Z4R A;  5AG5 A;  4Y49 B;  4B5P A;  1Y9W A;  2P0W A;  4RI1 A;  2Q04 A;  5A28 A;  5IX3 A;  4KOT A;  2Z10 A;  1YVO A;  4FD4 A;  1MJ9 A;  2FT0 A;  4NEX A;  4H6Z A;  5F47 A;  4QBJ A;  2J8N A;  4CYN A;  1IYK A;  2VEZ A;  5KTC A;  2OU2 A;  4C2X A;  1M44 A;  4MHD A;  2K5T A;  4XPK A;  1R57 A;  4IF5 A;  5JPH A;  3NE7 A;  4AVC A;  3GKR A;  4ORF A;  2VXK A;  3GY9 A;  3H4Q A;  3F0A A;  3S6K A;  2NMT A;  3P2F A;  2PR1 A;  3JUW A;  2Z3M A;  3IU2 A;  1VHS A;  2Z3O A;  1S5K A;  2DPT A;  2FIW A;  2YNE A;  4A33 A;  4E0A A;  1QSR A;  1VKC A;  2REE A;  2VZY A;  3EFA A;  3S6G A;  4U9Z A;  2G3T A;  5J8F A;  4XNH B;  2G3A A;  4CGP A;  3V8I A;  2ATR A;  4JLY A;  2Q4Y A;  2FSR A;  4B14 A;  4UFX A;  4MFL A;  2B4D A;  4J3G A;  1B87 A;  1KUY A;  2YND A;  3JTK A;  4CRZ B;  1CJW A;  2A4N A;  1XEB A;  1KUX A;  5G22 A;  1K4J A;  2Q4V A;  1QSN A;  5KTA A;  1NSL A;  3T9Y A;  4AG9 A;  4AVB A;  2JEV A;  2G0B A;  2VQY A;  5HH1 A;  1S7F A;  1PUA A;  3VWE A;  2Q0Y A;  1RO5 A;  4B10 A;  1KUV A;  5HMN A;  3CXQ A;  1J4J A;  4CRY B;  3D2P A;  1NMT A;  5H86 A;  2O28 A;  4Y49 C;  5IV0 A;  4DNC A;  2D4O A;  3IWE A;  3W6S A;  4MBU A;  4CGL A;  2QML A;  2VZZ A;  3ZJ0 A;  3JVN A;  3W91 A;  1IID A;  4KUB A;  4JJX A;  4NF1 A;  2WUU A;  2CY2 A;  2Q7B A;  4H6U A;  1BO4 A;  2B3U A;  4II9 A;  2ZW6 A;  4MFJ A;  5C82 A;  2JDD A;  2OB0 A;  3KKW A;  2HQY A;  4XPL A;  4Q36 A;  2FS5 A;  2C27 A;  5F48 A;  1YR0 A;  2PC1 A;  3F8K A;  3K9U A;  1OZP A;  1V0C A;  4KVO E;  4UWJ A;  3P2H A;  3D3S A;  1ZO0 A;  5EC4 A;  1L0C A;  4A95 A;  2PQ8 A;  3IU1 A;  3QAH A;  2B3V A;  3EXN A;  4XNH C;  2ARH A;  4MFZ A;  3R9F A;  4KOU A;  2DPS A;  3FBU A;  1P0H A;  4AVA A;  4LX9 A;  4UBR A;  5IB0 A;  4BBH A;  4FD5 A;  2ZW7 A;  4Q38 A;  1S7N A;  4B12 A;  3RYO A;  2BEI A;  2Q44 A;  2QIR A;  2B5G B;  1CM0 A;  3CXS A;  4C68 A;  1XMT A;  4JWP A;  2JDC A;  1WWZ A;  2OZU A;  3FNC A;  3SXO A;  4OAD A;  4YGO A;  3BJ7 A;  5DWN A;  2F5I A;  4MY3 A;  2HUZ A;  2BSW A;  4L89 A;  2RC4 A;  3B8G A;  3C26 A;  2EUI A;  1MJA A;  1XIX A;  1YK3 A;  2I79 A;  2B58 A;  1BOB A;  2QEC A;  4KOX A;  1Q2C A;  1IYL A;  4MFP A;  4UCN A;  3D2M A;  4CAX A;  1P4N A;  1S3Z A;  3DDD A;  1YVK A;  2GIV A;  4CYQ A;  5G20 A;  4JD6 A;  4OAE A;  4KLV A;  4M85 A;  3IWG A;  4IUS A;  4U5Y A;  3DR6 A;  5AG6 A;  1FY7 A;  1Z4E A;  1RXT A;  4PSX A;  1MK4 A;  4CYP A;  4KSF A;  2H5M A;  2OZH A;  2FXF A;  5CNP A;  5AG7 A;  1S7K A;  4M3S A;  1M4I A;  3N7Z A;  1I21 A;  4RS2 A;  4R3L A;  4XPD C;  4C7I A;  1QST A;  4KSA A;  2R98 A;  4HNW B;  2P6F A;  3S6H A;  4PV6 A;  4QB9 A;  1QSM A;  1Y7R A;  2J8R A;  4R9M A;  2OH1 A;  4R3K A;  3T90 A;  4QC6 A;  1SQH A;  5H84 A;  3SXN A;  2B5G A;  1YLE A;  2ZPA A;  4UCM A;  2PRB A;  2FCK A;  1M4G A;  4R57 A;  3BJ8 A;  1PU9 A;  1TIQ A;  2Z11 A;  4EVY A;  4E2A A;  3FB3 A;  4CS0 B;  1MJB A;  4KOS A;  4MJ8 A;  2Y0M A;  4KZT A;  3R96 A;  1Z9U A;  4LUA A;  2PR8 A;  1ON0 A;  3FRM A;  5JQ4 A;  2WPW A;  3TE4 A;  3FIX A;  4X5K A;  3TTH A;  2Z3N A;  3R9E A;  4NCZ A;  3EY5 A;  1B6B A;  3S6F A;  1XF8 A;  1I12 A;  5AG4 A;  3W6X A;  2R7H A;  4B5O A;  4F6A A;  5A27 A;  2D4P A;  3R95 A;  2ZW5 A;  4CAV A;  1XE4 A;  3A9L A;  3OWC A;  3TO9 A;  2Z0Z A;  3TCV A;  3PGP A;  4PK2 A;  2FIA A;  2P6E A;  1KZF A;  1S60 A;  4FD6 A;  4CYO A;  4OLL A;  4F0Y A;  4MY0 A;  4FD7 A;  2YNC A;  2Z3P A;  3G8W A;  4MFK A;  4UFW A;  2WPX A;  1Q2D A;  3DR8 A;  4A31 A;  3ZZI A;  4UCP A;  1M4D A;  2YNC C;  3UY5 A;  1NE9 A;  3I9S A;  2FE7 A;  4YRH A;  4AB7 A;  1QSO A;  4CGN A;  4PK3 A;  2BUE A;  4GS4 A;  3DNS A;  2CXA A;  2KCW A;  5F46 A;  5KTD A;  3FXT A;  4ONU A;  2B4B A;  2WSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...