1NN6A

Human pro-chymase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
224
structure length
222
Chain Sequence
b'GGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymase
publication title Structure of human pro-chymase: a model for the activating transition of granule-associated proteases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 52
structure length 222
sequence length 224
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2003-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nn6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nn6A02
3ENSB 1GG6C 2PKSB 1F0UA 4DW2U 1O2ZA 1PPZA 1W12U 4PROA 3K2UA 1V2QT 1FY3A 3RXIA 2WV5A 3D49H 2ZECA 4BAQB 2WPKS 5FHTA 3BIVH 1O2UA 1P04A 3FP6E 3M3SA 2B0FA 4Y8XA 3ELAH 1XUIA 1K21H 2ZGBH 2J94A 4Y79A 1MH0A 1CA0C 1N6XA 1ZSLA 3QZQA 1AUJA 1MTUA 1HAGE 2WPMS 4MG3A 1GHWH 3GCTF 1GBCA 7ESTE 5L2YH 2D26C 2FI3E 3LDXH 1HJ8A 4ABGA 4AB9A 1YGCH 1O39A 3BTTE 1GJ7B 2YNAA 2WPLS 1FZZA 2BQWB 2F91A 3ATMA 1G37A 4NSYA 1SGIB 3L3TA 4Y7AA 4ZXYH 1V2OT 1AUTC 2FX6A 4HFPB 1MUEB 2ZU3A 2BHGA 4MNYA 2FZZA 2VVCA 3KEEA 1CGIE 1S85A 2GTBA 4AORA 1DFPA 2OQ5A 1XVMA 1C1WH 1Y3UA 2HRVA 4JYVH 4FU8A 1RRKA 1G3DA 1TNLA 3M5NA 1IQLA 1WTGH 3ZYDA 1EZSC 4WVPE 3A83A 5EW1H 3KCGH 4I8KA 2XYAA 5C2ZA 1V2KT 5C5OA 3HKIB 1HYLA 1XX9A 5F6MA 1VGCB 3FANA 2WPIS 2FOBA 3DFJA 2FX4A 4X2VA 1TB6H 5E0GA 5FCKA 3SU3A 3KQBA 3WY8A 4IN1A 1T8NA 4ESTE 3S9BA 3ZZ6A 1LHCH 1YPHC 4I31A 1O5GH 1C1TA 1ZPCA 2ODQA 5SGAE 3F9HA 2B9LA 3E16B 2G81E 1N8OB 3BEIB 2BLOA 1QB9A 2IPHA 4UONA 4E06H 4GCHF 1TPPA 2HOBA 1P3CA 1ZJKA 3UFAA 1O0DH 1P2MA 1TNGA 2ZGJA 1VITG 1SLUB 1UTJA 1SQOA 3T27A 3U8TH 2ZP0H 4ZAEA 1ELBA 5DPAA 5EXMA 2QXHA 3R3GB 4B2BA 8KME2 2AYWA 5LPFA 3RM0H 4FUFA 3F9FA 2AMQA 1BZXE 1QBNA 2PSYA 3HK3B 1CGHA 1D6RA 1AB9B 2A5KA 3B9FH 1G30B 2Z94A 2GZ7A 3MNXA 3FZZA 1DLEA 5L30H 2GV7A 3MU5A 1GHAF 2XC0A 1TGSZ 1L4ZA 2G4TA 3GYLB 4WF8A 3SO3A 1QJ7B 2QA9E 4MPXA 7GCHF 3Q3YA 3RLWH 5GIBA 3P6ZB 3LGTA 1SI5H 1WQSA 2BDCA 1O3JA 2GVFA 5F8ZA 1K1OA 3BTQE 1AD8H 3GCHC 1PPHE 1IQJA 3ZVGA 3BTKE 3VXEH 1TQ0B 1BHXF 1TA2A 2O8MA 3T62A 5A8YA 3V13A 1T4UH 1TNKA 5C1YA 3RXLA 3QGNB 4R8TB 1ARBA 1UTNA 3UNSA 1QIXB 3RXFA 5FPYA 1OWHA 2FEQH 4OS2A 1MQ6A 4YZUA 1GI6A 3Q00A 1TRNA 5CMXH 1HRTH 1EOLA 2A1DB 2B5TB 3NKKA 2AH4X 2XXLA 5DGJA 1CHOG 2YOLA 2VGCC 4CR5A 2R0KA 1P2JA 4KTUA 1C5TA 1E35B 1ABIH 1Q2WA 3GY3A 5DP9A 1GBDA 1ZYOA 3AAVA 4ZKOU 4Y11E 1DPOA 1UCYE 1GJ9B 3SNCA 4AFSA 2GD4B 1W7XH 1XXFA 2Q6DA 1ANCA 4K1TA 3MYWA 4TYDA 2FWWA 2AIQA 3FVFB 1O38A 1YPLH 2FOCA 5LH8A 3OTJE 5BPEA 3UQVA 2VIDA 3B23B 1IQNA 1K1NA 3KHVA 1O32A 4X0WU 4HZHA 4FVDA 4YT7H 3LGUA 1EUFA 1XKAC 2F9UA 3GCOA 1C4V2 3O8BA 3HPTB 2FP7B 1RJXB 1SGRE 3AVZA 4ISHH 3SGQE 4THNH 1EAIA 2A4RA 1C5SA 1GGDC 2J4IA 1K1MA 1NRRH 3ZVDA 1C1UH 1GHVH 4Y7BA 1LPKB 1QQ4A 1O5BB 5HMAA 3RMMH 3T29A 2C3SA 2OD3B 4JZFH 3TJUA 5C1UA 5HGGA 2AERH 2XCNA 1MTVA 1RFNA 1ELDE 1UTMA 3UREA 1BMAA 2UWOA 3AASA 2UUFB 3PWCA 2OUAA 1M9UA 4A1VA 3UTUH 1OWKA 4E7RG 1PPBH 4XFQA 2XRCA 5GWZA 1H9LB 3RMLH 3MH6A 1J15A 1GPZA 1O37A 3STIA 5EU8A 1Z8RA 4HTCH 4ZMAH 5AFYH 2GGVB 1VGCC 4D7FA 3M7UA 4AN7A 1MZDA 1CT0E 2ANKH 3GDSA 1EASA 2OTVA 5E0JA 1MTSA 2ZDAH 3A7XA 2I6QA 2IN2A 1AE8H 3RU4E 4NA7A 1RTLA 1MU6B 1Y8TA 3AAUA 1BTUA 5F8TA 2R3YA 1C5VA 1QR3E 2F9VA 9ESTA 1VJ9U 4A6LA 2P3UB 3MO6A 1ZRBA 2J34A 2FYQA 1Y3YA 5LPEA 4NIYA 1O5CB 1C4Y2 1NM6A 2XC4A 1SOZA 1QA7A 1NRNH 1O33A 3ZVBA 1UVPA 4MVNA 1K1JA 2RCEA 4FUDA 2GCTB 1A4WH 2Z9LA 1P0SH 4X1SU 1ESTA 3EAJA 3M37A 5A0AE 1G3CA 1UMAH 3ZYEA 1NU9A 3P8OA 1DITH 3VB4A 1NY22 2RG3A 1QFKH 4I8JA 1O3DA 1Q3XA 1GI3A 2ZDNA 1K1LA 3LOXA 6GCHF 3H7OA 1AB9C 1THSH 1ZMLA 1PYTC 2K1QA 3TK6A 4NFFA 4WXIA 4BXWA 4WJG2 3SU5A 4CREA 1MAXA 1BHXB 1PPFE 1SR5C 1ZOMA 1EJNA 1RXPA 2TGAA 1EJMA 1QNJA 2CF9H 4MNWA 4AFZA 2D8WA 5FPTA 3DHKH 2HPQH 4I8LA 1SLWB 2PKAB 2PGBB 3UUZA 5GXPA 1IHTH 4X6NA 1SFIA 4I33A 4ZH8A 2BXUH 2ZF0H 2Y6TA 3FZDA 1FAXA 1F2SE 1Z8GA 1CSOE 1BQYA 8LPRA 3UOPA 2VWLA 4DIHH 2EEKA 1DSUA 4YLUA 2PLXA 5ESTE 1GHBF 5E2OA 3M61U 1GMCG 2R2WU 1AKSA 3GY7A 2BLQA 2HVXA 1G32B 3V12A 1V2UT 2BY6X 5EQQA 3RC5A 1AN1E 2OC7A 3A7ZA 3GCNA 4AFUA 1CA0B 2G51A 1GJDB 5GPIB 1G36A 1L1GA 3VXFH 1BTXA 1AVWA 1BBRK 4K8BA 3UR9A 1OWJA 2ZPSA 1CU1A 1GMHG 1GWAA 3ZZAA 3ZZ7A 2NWNA 1AZ8A 2BMGB 3EA9A 1JMOH 3E90B 5EW2H 4GAWA 2FM2A 3NK8A 3NUMA 1HAOH 1YPEH 2OLGA 1W13U 1RD3B 3P8FA 1TE0A 1QJ1B 3A81A 4ASHA 5FAHA 1EXFA 4WH8A 3MH4A 2Y7ZA 3OX7U 4BAHB 5K7RA 3UQOA 5ETXA 5FBIA 1OP0A 3K9XB 2BD2A 3QWCH 4Y0YE 2A7CA 2BDHA 2QV1A 3RXUA 1TA6A 1TPOA 1KSNA 4GSOA 1KXBA 3QTVH 5EPYA 1Z1IA 2KAIA 1EB1H 2ZU4A 3BTFE 1IQMA 1OKXA 3QGJA 1AIXH 8ESTE 1LCYA 3ZVFA 1EZQA 3F9EA 3SI3H 3UWIA 4MLFB 1TX8A 1B0EA 5C20A 1P8VC 4AGJA 2FYRA 4DCDA 1ANEA 4GUXA 1SPJA 1PJPA 3U8OH 1C4U2 1ELTA 1KLIH 1O3MA 4H6TA 4IMZA 5DP6A 4Y10E 4NIXA 2Z3DA 1FN8A 1PPEE 1ACBE 2BDGA 2Z9IA 2F9BH 4B73A 1C5XB 2A2QH 3V0XA 4AZ2B 1ZR0A 1MTWA 4JZ1A 4BTUB 1HAIH 4YOJA 1GMDF 4Q7ZA 1P2NA 2WPHS 3SU6A 2H1UA 2NU1E 2GCHG 2VH0A 4YOGA 1MTNC 1OP8A 2A7HA 3M3VA 4SGBE 4YM9A 3TITA 1TGNA 3BEUA 2SFAA 1HAPH 2C8XB 1KXAA 2A4GA 1C5RA 1HUTH 4E7NA 2NU4E 1GBJA 2BVXH 3TJNA 2HNTC 3RXTA 4NZQA 3S69A 1ELAA 3PLKA 1NO9H 2FTMA 4WXVA 5A2MH 1T31A 3MFJA 3LKWA 2O9QA 1F0RA 4JMYA 1GJ6A 2F83A 2EI7A 2FOAA 2DE8A 2VINA 1L4DA 3UIRA 1Y3VA 1DWBH 3KNXA 5A09A 3QLPH 4ZHMU 1AZZA 4Y8YA 2GCTC 1C2EA 5CHAC 1GHXH 4DG4A 2WUBA 2C8ZB 3TIUA 1OWEA 1Z1JA 1O30A 1O3CA 5DJ7A 1F7ZA 1GI2A 3MI4A 1P3EA 2ZKSA 2SGEE 2VU8E 3BTHE 5DP3A 1SQAA 1YP9A 1H8DH 4AG1A 2ZGCA 1PFXC 1AE5A 1UK3A 2UWPA 1EAXA 1JRTA 3GCHB 3PTNA 1GI9B 2ANMH 2QYIA 2W3IA 1EOJA 2SGFE 1UK4A 1FPHH 1H8IH 1DANH 1HB0B 5JB8S 2OINA 4LZ1H 1UVOA 2BD7A 1FIWA 1AGJA 5TCAA 5EXLA 3M3TA 1ANBA 1E36B 4JZEH 5JBBS 1RS0A 5A8ZA 4BXSA 1GL1A 4WY3A 3SBKA 4KGAA 1WYKA 1YLDA 1ESAA 4OS6A 4A1XA 2Y7XA 1UCYH 3TGJE 1O5FH 1OYQA 4MDSA 4IS5A 1LHDH 4Y71A 1O2KA 4BTTB 2UUKB 3EGKH 1C2DA 1O2QA 3A80A 2ZCHP 5T6GA 2Y81A 1O5AB 5T3HA 1C1MA 3C1KA 4XBCA 3S9AA 1S83A 3BN9A 1F5KU 2P95A 4CRGA 1QHRB 2GMTB 2J92A 4FUIA 3RXQA 1QJ6B 1V2LT 3BTME 4TWYA 3T25A 1MCTA 3P8GA 1PQ8A 2UWLA 4K2YA 2ZDMA 1P9UA 1S6FA 1L1JA 1A7SA 1F92A 3ZZ8A 2DE9A 3S9CA 1J17T 1BRUP 1JRSA 1C5MD 2ZHFH 1UVTH 2ZDVH 3OY5U 3P8NA 1ORFA 1W3CA 5G4BA 1YF4A 1LKAA 1Y59T 1XXDA 1D3PB 2PTNA 3SJOA 4XOJA 1BBRE 1Z6EA 1OPHB 1A3BH 2Z7FE 3RXAA 4AYVB 1WSSH 1VCQA 2O8TA 1NFYA 2RA3A 1G2MA 2TGDA 1GBAA 4GLYA 2FOHA 4NGAH 3VB3A 3SN8A 4K1EA 4Y6DA 1UK2A 4CRAA 2O8UA 1GGDB 2R9PA 3KQDA 1BTZA 4BAOB 1J16A 1ZMNA 1TRYA 1GHYH 4X6PA 1F5LA 1YBWA 1WQVH 1FXYA 3TH3H 3K6ZA 4TY7A 3RXCA 4ZHLU 2XNIA 2BD3A 2G8TA 4INLA 1O2HA 2OC8A 3M35A 4X2WA 2FI4E 1S6HA 4UFFH 3SI4H 3FP7E 1TMTH 1V2PT 1NFWA 5DP5A 1QA0A 1YC0A 1L0ZA 1YCPH 3GY6A 4AGKA 1GVZA 3RMOH 1AO5A 3A82A 4MNXA 1NN6A 1HIAA 1A61H 1HJAC 4UE7H 3TU7H 3PTBA 1U6QA 5EQSA 2CV3A 3D65E 2C93B 4RKOB 4MPUA 1A1RA 1B5GH 1GBTA 2OC1A 3P95A 2XTTB 5JB9S 5C3NA 1DE7H 5E8EH 1N1LA 2GDEH 3MH5A 2GKVE 1S82A 4O3TA 1EP6A 3A7YA 1IHSH 1CE5A 1LVOA 4HI3A 3SGAE 2IJOB 4AOQA 3PROA 3HGPA 1G9IE 4MNVA 1TPSA 1GHZA 4BANB 1LMWB 1C1OA 3SUGA 1IQGA 2ANWA 1FY5A 1A0JA 4NA8A 1GBBA 1XMNB 3V7TA 3NZIA 1PQ5A 1CQQA 1VITH 3LJJA 1BUIA 4F49A 5J4SA 5C1XA 2PGQB 2BZAA 4ISIH 1O5DH 4UFDH 4OGXA 1LHFH 2HNTF 3RXJA 1DY8A 1GJ4H 1HPGA 2ZU1A 1GI8B 4GVUA 2XBVA 2VVUA 3A7TA 1V6DA 1ZTLA 1S81A 3MU1A 3SV7A 3KL6A 3NPSA 1O3LA 3QZRA 1ZHMA 5EOKA 1WV7H 3AW0A 1ZHPA 3VPKA 1KDQB 4GHQA 2ZCLP 1EATA 1KIGH 4KTSA 4LK4A 1K1PA 3SUEA 1ZJDA 4NCYA 2EA3A 4ISLA 4Y0ZE 3B8JA 2VB0A 3RXKA 1BA8B 2WYGA 4WMFA 1UHBB 1C1QA 2W7UA 1UVUH 1PPCE 4CRDA 1MD8A 2ZFTA 3I29A 4X8TH 3TVJB 3M7QA 4X1NU 1FUJA 1MBMA 1Z6JH 3BV9B 2JH0D 2BY7X 4WMEA 1YCPM 1PYTD 2BD8A 3ESTA 1O2OA 3K6YA 4YOIA 1P12E 2ZHDA 1C2FA 2CF8H 1UTOA 3MNCA 1C5LH 4CRCA 1GBIA 1K28D 1NFXA 3CS0A 2ZGHA 5EG4A 1SC8U 3LJOA 1K2I1 1O2NA 2ZIQH 4K3JA 1ZMJA 1MKXH 2QF3A 3SOSA 4O9VA 1OS8A 2PSXA 1O3KA 1LDTT 1SFQB 5CE1A 2GMTC 1DWDH 1V2TT 1K22H 2B7DH 1GDQA 3KIDU 1A5IA 1O2TA 4DOQA 4LZ4B 2GZ9A 3SZNA 1EPTB 1YPKH 3HK6B 3PMAB 5GCHG 6ESTA 1THRH 1VCWA 4A5TS 3QDZB 2CXVA 3O8RA 4WMDA 1S0RA 1LKBA 5FBEA 4Z6AH 3OYPA 1O2RA 2ZCKP 5HM9A 4U01A 4I8GA 5T6DA 1EQ9A 3RXBA 4WWYA 4WH6A 2V3HH 1V3XA 2SNVA 4HGCA 1OXGA 4ZHAA 1YYY1 2PR3A 1D3QB 5FPSA 2ZI2H 2ZPQA 5GDSH 1THPB 4AG2A 2BD9A 1H4WA 1O2YA 3IITA 4JK6A 4NWKA 1V2MT 2J9NA 1TAWA 2O8LA 2VIWA 2Z3CA 3VB5A 5I46H 5HXFA 4ZXXH 2CN0H 3T26A 1P9SA 1FJSA 4RKJB 4VGCC 1TIOA 1X7AC 1TNHA 2BY5X 1EZUC 2FOMB 5L6NH 4XBBA 7KMEH 1HAVB 2XC5A 1BB0B 1SGQE 1FY4A 2PUQH 3VB7A 1DOJA 1C5WB 2W26A 3S0NA 5IYTA 1MKWH 4H4FA 1O3HA 1ETRH 2NU2E 1DWCH 2PWXA 2ANYA 3MHWU 4X1QU 1MTNB 1YPHE 3EDXB 3A7VA 4INKA 2H5DA 3KQCA 3ATLA 1TBRH 2QF0A 4M7GA 1XUFA 4ZUHA 3F6UH 2ZHQH 1MMJN 3S7KB 2TGPZ 3PMHB 1O2IA 2ZU2A 4Q80A 1NT1A 1SLXB 4DJZB 3UY9A 4JYUH 5AVDA 2PTCE 3M5OA 1P09A 3Q3XA 5GJ4B 3RUOA 3T28A 2ZFPH 1H9HE 1NRQH 4FUEA 2XWBI 1BOQA 1MKWK 1SGYE 2XCFA 3MO3A 5FXLA 2OBQA 3E8LA 2G5NA 3Q3KA 2EI6A 1TBZH 4BTIB 5A0CA 1BIOA 2ZFQH 1P2QA 2H2ZA 2BLVA 1TLDA 4Q2KA 5CHAB 3UNQA 4NIVA 4AB8A 4NWLA 3TNTA 1Z8JB 2Y5GA 1F5RA 1O3AA 2BXTH 4TPIZ 3ATKA 2ZTZA 5JBTA 1C5QA 4X8UH 2GZ8A 4MTBA 1C9PA 2H9TH 2WPJS 2G55A 1SGDE 2ZTYA 1LHGH 2IOTA 4B71A 4NG9H 2KAIB 1BT7A 1NU7B 4JYTA 3D23A 3SUDA 1ETTH 3CENA 4XSKU 3M5LA 2HLCA 4LXBH 1ANDA 3DA9B 3P17H 2V35A 2CJIA 4UEHH 2AMDA 1A5GH 1C5UA 1F0TA 3LGIA 4JK5A 1QRWA 1NESE 1MZAA 2FESH 2FDAA 4F4OC 1KXCA 2A7JA 4TPYA 1DICA 3GCTG 4B1TA 4X8VH 3LIWA 3HKJB 1VITF 3VB6A 1ZTJA 4MPVA 4UD9H 5JYIA 3U1JB 4FUGA 1NS3A 1O2XA 2M5TA 1P05A 2VWNA 2EC9H 1A5HA 1TX7A 2PHBA 3U1IB 2UUJB 2ODYB 1SGTA 2A4OA 4DGJA 1W2KH 4U32A 3D62A 2AFQB 5BRRE 1ESBA 3FP8E 2QCYA 1O3FA 3L6PA 1LPGB 2ALPA 1WCZA 1HAYB 3MTYA 4JCNA 3H5CB 2FOEA 3SJ9A 1FNIA 4Z0KA 4FU9A 1AMHA 1GI0A 3SJIA 3OU0A 2C8YB 3PMJA 1PQAA 1EPTC 3RDZA 5TCCA 1MQ5A 4FUBA 1C1SA 1KTTB 2FS9A 1A2CH 3ZZ9A 1GJCB 5J4QA 3O8CA 2GV6A 1FPCH 2JKHA 4DT7B 3RXRA 5FX5A 1GDNA 4MPWA 2G4UA 2Z9JA 2R0LA 3LT3A 1C5NH 1A46H 2JETC 4GCHG 4JZIA 4TWWA 1G3EA 1HLTH 3E6PH 5H4IB 4U30A 2AMPA 4TY6A 3U69H 2XW9A 1INCA 3MNBA 1YLCA 3SGBE 5F8XA 1P11E 7LPRA 2H9HA 1CHGA 2WYJA 1SL3A 1C5OH 3PMBB 2PV9B 3A7WA 2P8OC 3RMNH 2VIQA 1JIMA 1T8OA 1CHOF 1HJAB 1EKBB 1O2SA 1TOCB 3A84A 2F9NA 2Q6GA 3GDVA 1S0QA 1IOEA 1ID5H 4CRBA 1ZLRA 2YNBA 2W7SA 3TGIE 1DM4B 1ZGIA 1UJ1A 4J1YA 4FU7A 2VWMA 2W3KA 3LC3A 2FS8A 2VIOA 1BITA 2FXRA 4ABDA 2PKAA 1E0FD 1ZPBA 5IDKA 1IQFA 3LPRA 2BTCE 3RM2H 4Q7YA 4A7IB 2J2UA 2SGPE 1GHAG 3ZZ4A 1HFDA 4INHA 2SGDE 3ZZDA 1G2LA 1O2MA 2Y5FA 3U98H 5ABWA 1RGQA 7GCHG 2ZGXH 3FFGA 2PUXB 4AFQA 2QAAA 3E0NB 4YLQH 1XKBC 2Z9GA 3BEFB 3RC4A 4LOYH 3LH3A 1TFXA 2A4QA 4NSVA 1LHEH 1MAYA 1NRSH 4YTAA 1HNEE 1B0FA 4ZROA 2Y5HA 4B74A 4RN6A 2FIRH 5DKMA 3TK9A 2I6SA 4D9RA 3SU0A 3BF6H 1EAWA 1GCTB 1D3TB 1F0SA 1UTLM 3MU4A 1QB1A 3PO1B 2TRMA 1GBFA 3DT0H 1K1IA 3SNEA 5K0HA 1JOUB 1HCGA 1LVMA 4AYYB 2XBWA 2TPIZ 1WU1A 4OS4A 2TBSA 2W5EA 2JH6D 2P3FH 1DY9A 1HAXB 2SNWA 1SGPE 3STJA 1WBGB 2QY0B 2AEIH 1TABE 1QL8A 1DUEA 1QBVH 1ZSJA 1Y5AT 1HXEH 2ZFRH 1LVYA 3TH4H 2ZA5A 1ZHRA 2ZO3H 5C5NA 1HAHH 1T8LA 1P10A 3P70B 2P93A 2ZPRA 1O3GA 5HYOA 3URCA 1P57B 4J2YB 2XWAA 3E1XB 1SSXA 1C2JA 1AFQB 4ABJA 1XM1A 3AW1A 1WAYB 4D76A 1Z7KA 3A87A 1J14A 1GBLA 3HATH 5C67A 3SJKA 1C2IA 1NC6A 3SV8A 2RDLA 1HDTH 1QQUA 2BDIA 1L2EA 2ZQ1A 3GY2A 3BG4B 2Y82A 5DK1A 2OBOA 4H42U 3SUFA 1ARCA 4B2CA 1O2JA 4YO9A 1ZZZA 5AF9H 1D3DB 1TPAE 1YPJH 1UCYK 1UTQA 3GY4A 3SU4A 2ZG0H 1CA8B 4JZDH 3M5MA 3F1SB 5JDUB 4CRFA 1BJUA 2ULLA 2QGRA 1WUNH 1IQEA 1DX5M 1AFEH 2ZHWH 3GY8A 2FTLE 4Q7XA 3ODFA 1C2MA 4BAMB 4NZLA 4Y8ZA 1P06A 3QUMP 1TWXB 3CP7A 3N7OA 5A0BA 3SU2A 1L1NA 1RIWB 2FOFA 1GI7B 2C90B 1W0YH 1A0LA 4MQAA 5A8XA 1B7XB 4KTCA 3BTWE 1HV7A 6LPRA 5E2PA 4VGCB 4XE4A 5DP4A 3RXVA 3SV2H 2A5IA 2AGEX 1HBTH 3TNSA 1SVPA 2GT8A 1GMCF 1D9IA 1AY6H 3RXOA 2SGQE 4CHAB 4K8YA 3ZZ5A 1W0ZU 3IWMA 1Y3XA 1NFUA 1IQHA 1O3IA 3LC5A 1O3BA 2Q6FA 1C1VH 2H5CA 2CMYA 1NTPA 1W10U 1GMHF 2BQ6B 1DXWA 1W14U 3EQ0H 1ELFA 4NIWA 1V2JT 2ALVA 1LTOA 1Y3WA 2VNTA 6GCHG 4Y76A 4E05H 4FUHA 3EA8A 2UUYA 2P59A 2STBE 2HGTH 3IG6B 1O5EH 3SW2B 1TGTA 1TBQH 4IN2A 1DXPA 5EODA 3A8AA 1GJBB 1YCPK 5EGMA 1ZRKA 3I77A 9LPRA 1C5ZB 2ZDKA 5AHGH 2Y80A 1AVGH 3OY6U 1SMFE 1JXPA 2HNTE 1IQKA 4GPGA 1QGFA 1D6WA 1XUKA 1GBEA 1KLTA 3NXPA 4B75A 1OWDA 2BDYA 2J95A 3SU1A 4ABHA 1YM0A 1FI8A 4CBNA 3RXEA 3TPIZ 1GHBG 1UTPA 1FV9A 1TNJA 2HALA 3EA7A 1GCTC 3PO1C 1SGEE 1BJVA 2WUCA 2BB4A 6CHAC 3QN7A 4XDEA 5HM2A 2FLRH 5JPMH 3Q77A 1QY6A 3U9AH 3A8BA 1BRAA 5B6OA 2OCVB 3VGCB 5ESBA 5LPRA 1GJ5H 3C27B 2C4FH 1C9TA 3TGKE 4I8HA 3SORA 2GCHF 4IW4E 2A2XH 1EAUA 1CVWH 2ZFFH 3SNDA 1Y5UT 3HGNA 1CBWC 3QX5H 4XBDA 3JZ1B 1O3NA 3O8DA 4NA9H 1TYNA 3T5FH 2V6NA 1RTKA 1XUGA 2FO9A 1QRXA 3ZZ3A 3A89A 1C2HA 1A0HB 1LPZB 3PYHA 5LGOA 1SHYA 2CGAA 2TIOA 1E38B 1DWEH 1AHTH 2C8WB 1UO6A 1AU8A 2BD4A 3OSYA 5F03A 1ELCA 2A45B 1AFQC 2ZQ2A 4YT6H 1V2NT 1YPGH 3RXGA 3ZVCA 3M36A 1P03A 3TLOA 4CH2B 3A85A 4ZKNU 3A8DA 2ESTE 3BG8A 4K5ZA 1YPMH 3E3TA 3RXDA 2J38A 1ABJH 2A0QB 1FQ3A 1JWTA 1O3PB 1OX1A 1KXFA 4RSPA 2QC2A 2STAE 3BG4C 5AFZH 1FAKH 3DFLA 3FAOA 1NPMA 1LQDB 4UDWH 4CBOA 2H9EH 1FMGA 4I7YH 1WOFA 1BMLA 3DUXH 3GDUA 3RP2A 2PKSC 2GX4A 4D9QA 1KYNA 2BM2A 3BIUH 4DY7B 2QXJA 3I78A 1Q31A 1T8MA 3SJ8A 1C2KA 2AIPA 1GJ8B 1MKXK 2BY9X 2JETB 1V2WT 1GJAB 4BNRA 1QB6A 1FY8E 1C5PA 1O36A 4YESB 3MO9A 1GMDG 4O3UA 1C1NA 5DP7A 1VZQH 2BDAA 1TQ7B 4I32A 1BMMH 3KF2A 1G3BA 4OS7A 2P8OB 2LNCA 1RIWC 3UPEA 1H9IE 1A3EH 1SGFA 3GICB 3TK5A 3PV4A 2FPZA 3NCLA 3ZZCA 3SV9A 1OWIA 1MD7A 3LGYA 2BQ7B 4ISNA 2BD5A 4CR9A 1DDJA 5EQRA 1DT2A 1DSTA 4ZKRU 3SNBA 1KDQA 4X8SH 3SQEE 1P02A 4DIIH 1EX3A 2A5AA 1VR1H 4CHAC 3A86A 2PFEA 5T6FA 1TMBH 2DUCA 5E0HA 1O34A 4O03A 2O8WA 1E34B 3DD2H 1GI5A 3T2NA 3SHCH 5DP8A 1TRMA 1DS2E 1TALA 1UHBA 1AVXA 4IGDA 2P3TB 1AKSB 1P2OA 3PLPA 3GOVB 1AI8H 1JBUH 2G52A 2V3OH 2FI5E 2FLBH 1JIRA 1S5SA 4KELA 3F9GA 2Z6BD 4R0IA 1EZXC 1SGFG 1EJAA 1BTPA 3BTEE 1ZSKA 3VEQB 2ILNA 4FVBA 4ZKSU 2BVSH 3MNSA 1V2ST 2FODA 4BAKB 3QTOH 3RXPA 4B2AA 4OS1A 2CHAB 1IQIA 1SHHB 8GCHG 1N8OC 3A88A 1GBKA 3E91A 1EPTA 4X1RU 1O2PA 3PLBA 2P16A 2ZTXA 2EI8A 1W7GH 1XUHA 4IC6A 1HJ9A 2BOKA 3QK1A 1T4VH 2F9PA 1XVOA 3LU9B 1O2VA 4ABFA 1VJAU 4UFGH 3M7TA 1QURH 4NFEA 3ZZBA 4KP0A 1HXFH 4OS5A 4X2XA 1C2GA 1NRPH 2GDDA 3GY5A 1FDPA 3JZ2B 5EXNA 1C2LA 1O31A 1QTFA 2LPRA 3VGCC 2R2MB 1GBHA 2ZHEH 3KN2A 5FX6A 1HGTH 2RA0A 1GL0E 4IBLH 1ZTKA 3NWUA 5I25A 2BZ6H 1UVSH 1ETSH 2WINI 2AS9A 1KTSB 3TH2H 3MU0A 4ABIA 3H7TA 4X1PU 2TGTA 1OOKB 3TJVA 1KXEA 1T7CA 1BBRH 2A32A 1HAVA 2FMJA 3PM3A 2THFB 3UWJH 1O2WA 4DVAU 1QBOA 2BDBA 2BX3A 2VIVA 3U8RH 3TJOA 1TMUH 2ODPA 4BOHA 3G01A 1GG6B 1KXDA 1C1RA 3LGWA 1J9CH 1O3OA 1TGBA 3F68H 2QIQA 4D8NA 1DLKB 4FXGH 1N6YA 3PWBA 1ELEE 1P2KA 1ZGVA 1P2IA 1K9OE 2QXIA 2BOHB 1OSSA 1ELGA 4K69A 3EE0B 4CH8B 5JBCS 1BDAA 1FY1A 1FIZA 2P94A 3BSQA 4IMQA 2ZC9H 4K60A 5FCRA 2V0BA 1O2LA 2BVRH 3E0PB 3MOCA 1TGCA 3RXSA 1FN6A 1IAUA 1NROH 2D1JA 4A92A 1SLVB 1D4PB 2XBXA 4UFEH 3BTGE 2Z9KA 3L33A 1BTYA 1ELVA 2PW8H 1MCVA 4ISOA 4ABEA 3RLYH 1GBMA 3MU8A 1TOMH 1QRZA 3GYMA 1O35A 1C1PA 2G00A 1Z71A 1O3EA 3P92A 1HAZB 1SG8B 2NU0E 1H1BA 1GVKB 5PTPA 3ZV9A 1TNIA 2BLWA 2QN5T 5DG6A 1GI4A 2SGAA 3MH7A 2HWLB 2G5VA 3SQHE 5GCHF 1CT2E 1PQ7A 4DURA 1AQ7A 1OYTH 4FUCA 2F3CE 2OP9A 4ABAA 2VVVA 3UOUA 1SGNE 2VIPA 3V3MA 1SQTA 2WV4A 2OC0A 1YKTA 2BYAX 2QXGA 1ZPZA 3W94A 1SB1H 3ATIA 2VJ1A 3W95A 1DVAH 2H6MA 3A8CA 1E37B 1CO7E 1XUJA 3ATWA 4KKDA 1W11U 2ZU5A 4QT8C 1V2VT 3RU4T 2HPPH 1GVLA 2ZFSA 1QL9A 1UTKA 1AWFH 3BTDE 2ZEBA 5TJXA 2VWOA 3URDA 3K65B 3EYDA 3S7HB 5DO4H 1P01A 2GT7A 1GI1A 3LGVA 2OQUA 1J8AA 1CT4E 3CS7A 2BX4A 3SV6A 4H6SB 1LQEA 2D2DA 4FUJA 1BCUH 4ABBA 1FONA 2XBYA 4D7GA 3MWIU 1Z8IB 2OXSA 1GDUA 3ODDA 5EPNA 6CHAB 2CHAC 4B76A 4OGYA 2FOGA 4A1TA 1S84A 4IC5A 5L2ZH 1PPGE 1BMNH 2AGIX 2A31A 4U2WA 1BRBE 1SBWA 2R3UA 1V2RT 2ZDLA 3PB1E 3SNAA 1SOTA 2F9OA 1EP5A 1RTFB 1FLEE 2NU3E 1W8BH 1MBQA 1TONA 3RU4D 1CBWB 3VFEA 1NZQH 3RXMA 2GP9B 4X2YA 1AWHB 1Y5BT 3LH1A 1MU8B 3MMGA 2ZZUH 1QCPA 1WTHD 3GISB 4AX9H 1QL7A 1TX6A 2ZNKH 1LO6A 2VH6A 3R0FA 2Q1JA 3ITIA 3KQEA 1HIAB 1KY9A 1OP2A 1BTWA 1CGJE 3LONA 4X6OA 1LVBA 3UR6A 3KGPA 3Q76A 1T32A 2Z3EA 1C5YB 1VCPA 1EB2A 4K1SA 3ZV8A 1SGCA 2BY8X 4GHTA 1BRCE 3SHAH 2AGGX 1BTHH 4SGAE 8GCHF 4O97A 2ASUB 3UNRA 3ZVEA 1O2GH 2B8OH 1KLJH 2JH5D 3RXHA 5JBAS 3QO6A 1DUAA 4X6MA 3ZVAA 2ZWLH 1GCDA 3RC6A 2VGCB
chains in the Genus database with same CATH superfamily
3ENSB 1GG6C 2PKSB 1F0UA 4DW2U 1O2ZA 1PPZA 1W12U 4PROA 3K2UA 1V2QT 1FY3A 3RXIA 2WV5A 3D49H 2ZECA 4BAQB 2WPKS 5FHTA 3BIVH 1O2UA 1P04A 3FP6E 3M3SA 2B0FA 4Y8XA 3ELAH 1XUIA 1K21H 2ZGBH 2J94A 4Y79A 1MH0A 1CA0C 1N6XA 1ZSLA 3QZQA 1AUJA 1MTUA 5CDFE 3DSOA 1HAGE 2WPMS 4MG3A 1GHWH 3GCTF 1GBCA 7ESTE 5L2YH 2D26C 2FI3E 3LDXH 1HJ8A 4ABGA 4AB9A 1YGCH 1O39A 3BTTE 1GJ7B 2YNAA 2WPLS 1FZZA 3PRBA 2BQWB 2F91A 3ATMA 1G37A 4NSYA 1SGIB 3L3TA 4Y7AA 4ZXYH 1V2OT 1AUTC 2FX6A 4HFPB 1MUEB 2ZU3A 2BHGA 4MNYA 2FZZA 2VVCA 3KEEA 1CGIE 1S85A 2GTBA 5EIYA 4AORA 1DFPA 2OQ5A 1XVMA 1C1WH 1Y3UA 2HRVA 4JYVH 4FU8A 1RRKA 1G3DA 1TNLA 3M5NA 1IQLA 1WTGH 3ZYDA 1EZSC 4WVPE 3A83A 5EW1H 3KCGH 4I8KA 2XYAA 5C2ZA 1V2KT 5C5OA 3HKIB 4P02A 1HYLA 1XX9A 5F6MA 1VGCB 3FANA 2WPIS 2FOBA 3DFJA 2FX4A 4X2VA 1TB6H 5E0GA 5FCKA 3W1EA 3SU3A 3KQBA 3WY8A 4IN1A 1T8NA 4ESTE 3S9BA 3ZZ6A 1LHCH 1YPHC 4I31A 1O5GH 1C1TA 1ZPCA 2ODQA 5SGAE 3F9HA 2B9LA 3E16B 2G81E 1N8OB 3BEIB 2BLOA 1QB9A 2IPHA 4UONA 4E06H 4GCHF 1TPPA 3CNRA 2L6OA 2HOBA 1P3CA 1ZJKA 3UFAA 1O0DH 1P2MA 1TNGA 2ZGJA 2WHXA 1VITG 1SLUB 1UTJA 1SQOA 3T27A 3U8TH 2ZP0H 2PP6A 4ZAEA 1ELBA 5DPAA 5EXMA 2QXHA 4FOUC 3R3GB 4B2BA 8KME2 2AYWA 5LPFA 3RM0H 4FUFA 2KFWA 3F9FA 2AMQA 2LELA 1BZXE 1QBNA 2PSYA 5C17A 3HK3B 1CGHA 1D6RA 1AB9B 2A5KA 3B9FH 1G30B 2Z94A 2GZ7A 3MNXA 3FZZA 4ASUD 3WW7A 1DLEA 5L30H 2GV7A 3MU5A 1GHAF 2XC0A 1TGSZ 1L4ZA 2G4TA 3GYLB 4WF8A 3SO3A 1QJ7B 2QA9E 4MPXA 7GCHF 3Q3YA 3RLWH 5GIBA 3P6ZB 4F55A 3LGTA 1SI5H 1WQSA 2BDCA 1O3JA 2GVFA 5F8ZA 1K1OA 3BTQE 1AD8H 3GCHC 1PPHE 1IQJA 3F3BA 3ZVGA 3BTKE 3VXEH 1TQ0B 1WXRA 1BHXF 1TA2A 2O8MA 3T62A 5A8YA 3V13A 1T4UH 1TNKA 5C1YA 3RXLA 3QGNB 4R8TB 1ARBA 1UTNA 3UNSA 1QIXB 3RXFA 5FPYA 1OWHA 2FEQH 4OS2A 1MQ6A 4YZUA 1GI6A 2KCPA 3Q00A 1TRNA 5CMXH 1HRTH 1EOLA 2A1DB 2B5TB 3NKKA 2AH4X 2XXLA 2WZQA 5DGJA 1CHOG 2YOLA 2VGCC 4CR5A 2R0KA 1P2JA 4KTUA 5FL7D 1C5TA 1E35B 1ABIH 1Q2WA 3GY3A 5DP9A 1GBDA 1ZYOA 3AAVA 4ZKOU 4Y11E 1DPOA 1UCYE 1GJ9B 3SNCA 4AFSA 2GD4B 1W7XH 1XXFA 2Q6DA 1ANCA 4K1TA 3MYWA 4TYDA 2FWWA 2AIQA 3FVFB 1O38A 1YPLH 2FOCA 5LH8A 3OTJE 5BPEA 3UQVA 2VIDA 3B23B 1IQNA 1K1NA 3KHVA 1O32A 4X0WU 4HZHA 4FVDA 4YT7H 3LGUA 1EUFA 1XKAC 2F9UA 3GCOA 1C4V2 3SZEA 3O8BA 3HPTB 2FP7B 1RJXB 1SGRE 3AVZA 4ISHH 3SGQE 4THNH 1EAIA 2A4RA 1C5SA 1GGDC 2J4IA 1K1MA 1NRRH 3H09A 3ZVDA 1C1UH 1GHVH 4Y7BA 1LPKB 1QQ4A 1O5BB 5HMAA 3RMMH 3T29A 2C3SA 2OD3B 4JZFH 3TJUA 5C1UA 5HGGA 2AERH 2XCNA 1MTVA 1RFNA 1ELDE 1UTMA 3UREA 1BMAA 2UWOA 3AASA 2UUFB 3PWCA 2OUAA 1M9UA 4A1VA 3UTUH 1OWKA 4AC9A 4E7RG 1PPBH 4XFQA 2XRCA 5GNDA 5GWZA 1H9LB 3RMLH 2JJ2D 3MH6A 1J15A 1GPZA 1O37A 3STIA 5EU8A 1Z8RA 4HTCH 4ZMAH 5AFYH 2GGVB 1VGCC 4D7FA 3M7UA 4AN7A 1MZDA 1CT0E 2ANKH 3GDSA 1EASA 2OTVA 5E0JA 1MTSA 2ZDAH 3A7XA 2I6QA 5B6LA 2IN2A 1AE8H 3RU4E 4RT1A 4NA7A 1RTLA 1MU6B 1Y8TA 3AAUA 1BTUA 5F8TA 2R3YA 1C5VA 1QR3E 2F9VA 9ESTA 1VJ9U 4A6LA 2P3UB 3MO6A 1ZRBA 2J34A 2FYQA 1Y3YA 5LPEA 4NIYA 1O5CB 1C4Y2 1NM6A 2XC4A 1SOZA 1QA7A 1NRNH 1O33A 3ZVBA 1UVPA 4MVNA 1K1JA 2RCEA 4ACAA 4FUDA 2GCTB 1A4WH 2Z9LA 1P0SH 4X1SU 1ESTA 3EAJA 3M37A 5A0AE 1G3CA 1UMAH 3ZYEA 1NU9A 3P8OA 1DITH 3VB4A 1NY22 2RG3A 1QFKH 4I8JA 1O3DA 1Q3XA 1GI3A 2ZDNA 1K1LA 3LOXA 6GCHF 3H7OA 1AB9C 1THSH 1ZMLA 1PYTC 2K1QA 3TK6A 4NFFA 4WXIA 4BXWA 4WJG2 3SU5A 3F2HA 4CREA 1MAXA 1BHXB 1PPFE 1SR5C 1ZOMA 1EJNA 1RXPA 2TGAA 5C0TA 1EJMA 1QNJA 2CF9H 4MNWA 4AFZA 2D8WA 5FPTA 3DHKH 2HPQH 4I8LA 1SLWB 2PKAB 2PGBB 3UUZA 5GXPA 1IHTH 5DN6D 4X6NA 1SFIA 4I33A 4ZH8A 2BXUH 2ZF0H 2Y6TA 3FZDA 1FAXA 1F2SE 1Z8GA 1CSOE 1BQYA 8LPRA 3UOPA 2VWLA 4DIHH 2EEKA 1DSUA 4YLUA 2PLXA 5ESTE 1GHBF 1W0JD 5E2OA 2RFKC 3M61U 1GMCG 2R2WU 1AKSA 3GY7A 1MABB 1QZ8A 2BLQA 2HVXA 1G32B 3V12A 1V2UT 2BY6X 5EQQA 3RC5A 1AN1E 2OC7A 3A7ZA 3GCNA 4AFUA 1CA0B 2G51A 1GJDB 5GPIB 1G36A 1L1GA 3VXFH 1BTXA 1AVWA 1BBRK 4K8BA 3UR9A 1OWJA 4B6EA 2W6JD 2ZPSA 1CU1A 1GMHG 1GWAA 3ZZAA 3ZZ7A 2NWNA 1AZ8A 2BMGB 3EA9A 1JMOH 3E90B 5EW2H 4GAWA 2FM2A 3NK8A 3NUMA 1HAOH 1YPEH 2OLGA 1W13U 5EJ1A 1RD3B 3P8FA 1TE0A 1QJ1B 3A81A 4ASHA 5FAHA 1EXFA 4WH8A 3MH4A 2Y7ZA 3OX7U 4BAHB 5K7RA 3UQOA 5ETXA 5FBIA 1OP0A 3K9XB 2BD2A 3QWCH 4Y0YE 2A7CA 2BDHA 2QV1A 3RXUA 1TA6A 1TPOA 1KSNA 4GSOA 3PV2A 1KXBA 2HLDD 3QTVH 1Z1IA 5EPYA 2KAIA 1EB1H 2ZU4A 3BTFE 1IQMA 1OKXA 3QGJA 1AIXH 3DSPA 8ESTE 1LCYA 3ZVFA 1EZQA 3F9EA 3SI3H 3UWIA 4MLFB 1TX8A 1B0EA 5C20A 1P8VC 4AGJA 2FYRA 4DCDA 1ANEA 4GUXA 1SPJA 1PJPA 3U8OH 1C4U2 1ELTA 1KLIH 1COWD 1O3MA 4H6TA 4IMZA 5DP6A 4Y10E 4NIXA 2QE7D 2XNDD 2Z3DA 1FN8A 1PPEE 1ACBE 2BDGA 2Z9IA 2F9BH 4B73A 1C5XB 2A2QH 3V0XA 4AZ2B 1ZR0A 1MTWA 4JZ1A 4BTUB 4TT3D 1HAIH 4YOJA 1GMDF 4Q7ZA 1P2NA 2WPHS 3SU6A 2H1UA 2NU1E 2GCHG 2VH0A 4YOGA 1MTNC 1OP8A 2A7HA 3M3VA 3NRLA 4SGBE 4YM9A 3TITA 1TGNA 3BEUA 2SFAA 1HAPH 2C8XB 1KXAA 2A4GA 1C5RA 1HUTH 4E7NA 2NU4E 1WDIA 1GBJA 2BVXH 3TJNA 2HNTC 3RXTA 4NZQA 3S69A 1ELAA 3PLKA 1NO9H 2FTMA 4WXVA 5A2MH 1T31A 3MFJA 3LKWA 2K8IA 1F0RA 2O9QA 4JMYA 1GJ6A 2F83A 2EI7A 2FOAA 2DE8A 2VINA 1L4DA 3UIRA 1Y3VA 1DWBH 3KNXA 5A09A 3QLPH 4ZHMU 1AZZA 4Y8YA 2GCTC 1C2EA 5CHAC 1GHXH 4DG4A 2WUBA 2C8ZB 3TIUA 1OWEA 1Z1JA 1O30A 1O3CA 5DJ7A 1F7ZA 1GI2A 3MI4A 1P3EA 2ZKSA 2SGEE 2VU8E 3BTHE 5DP3A 1SQAA 1YP9A 1H8DH 4AG1A 2ZGCA 3N7EA 1PFXC 1AE5A 1UK3A 2UWPA 1EAXA 1JRTA 3GCHB 3PTNA 1GI9B 2ANMH 2QYIA 2W3IA 4Q4LA 1EOJA 2SGFE 1UK4A 1FPHH 1H8IH 1DANH 1HB0B 5JB8S 2OINA 3KYGA 1UVOA 4LZ1H 2BD7A 1FIWA 1AGJA 5TCAA 5EXLA 3M3TA 1ANBA 1E36B 4JZEH 5JBBS 1RS0A 5F53A 5A8ZA 4BXSA 1GL1A 4WY3A 3SBKA 4KGAA 1WYKA 1YLDA 1ESAA 4OS6A 4A1XA 2Y7XA 1UCYH 3TGJE 1O5FH 1OYQA 4MDSA 4IS5A 1LHDH 4Y71A 1O2KA 4BTTB 2UUKB 3EGKH 1C2DA 1O2QA 3A80A 2ZCHP 5T6GA 2Y81A 1O5AB 5T3HA 1C1MA 3C1KA 4XBCA 3S9AA 1S83A 3BN9A 1F5KU 2P95A 4CRGA 1QHRB 2GMTB 2J92A 4FUIA 3RXQA 1QJ6B 1V2LT 3BTME 4TWYA 3T25A 1MCTA 3P8GA 1PQ8A 2UWLA 2JIZD 4K2YA 2ZDMA 1P9UA 1S6FA 1L1JA 1A7SA 1F92A 3ZZ8A 2DE9A 3S9CA 1J17T 1BRUP 1JRSA 1C5MD 2ZHFH 1UVTH 2ZDVH 3OY5U 3P8NA 1ORFA 1W3CA 5G4BA 1YF4A 1LKAA 1Y59T 1XXDA 1D3PB 2PTNA 3SJOA 4XOJA 5KEDA 1BBRE 1Z6EA 1OPHB 1A3BH 2Z7FE 3RXAA 4AYVB 1WSSH 2J98B 1VCQA 2O8TA 1NFYA 2RA3A 1G2MA 2TGDA 1GBAA 4GLYA 2FOHA 4NGAH 3VB3A 3SN8A 4K1EA 4Y6DA 1UK2A 4CRAA 2O8UA 1GGDB 2R9PA 3KQDA 1BTZA 4BAOB 1KMHB 1J16A 1ZMNA 1TRYA 1GHYH 4X6PA 1F5LA 1YBWA 1WQVH 1FXYA 3TH3H 3K6ZA 4TY7A 3RXCA 4ZHLU 2XNIA 2BD3A 2G8TA 4INLA 1O2HA 2OC8A 3M35A 4X2WA 2FI4E 1S6HA 1UW7A 4UFFH 3SI4H 3FP7E 4XRNA 1TMTH 1V2PT 5CHBA 1NFWA 5DP5A 1QA0A 1YC0A 1L0ZA 1YCPH 3GY6A 4AGKA 1GVZA 3RMOH 1AO5A 3A82A 4MNXA 3F0PA 1NN6A 1HIAA 1A61H 1HJAC 4UE7H 3TU7H 3PTBA 1U6QA 5EQSA 2CV3A 3D65E 2C93B 4RKOB 4MPUA 1A1RA 1B5GH 1GBTA 2OC1A 3P95A 2XTTB 5JB9S 5C3NA 1DE7H 5E8EH 1N1LA 2GDEH 3MH5A 2GKVE 1S82A 4O3TA 1EP6A 3A7YA 1IHSH 3GS9A 1CE5A 1LVOA 4HI3A 3SGAE 2IJOB 3WWFA 4AOQA 3PROA 3HGPA 1G9IE 4MNVA 1TPSA 1GHZA 4BANB 1LMWB 1C1OA 3SUGA 1IQGA 2ANWA 1FY5A 1A0JA 4NA8A 1GBBA 1XMNB 3V7TA 3NZIA 1PQ5A 1CQQA 1VITH 3LJJA 1BUIA 4F49A 5J4SA 5C1XA 2PGQB 2BZAA 4ISIH 1O5DH 4UFDH 4OGXA 1LHFH 4Z1MD 3WWBA 2HNTF 3RXJA 1DY8A 1GJ4H 1HPGA 4TSFD 2ZU1A 1GI8B 4GVUA 2XBVA 2VVUA 3A7TA 1V6DA 1ZTLA 1S81A 3MU1A 3SV7A 3KL6A 3NPSA 1O3LA 3QZRA 1ZHMA 5EOKA 1WV7H 3AW0A 1ZHPA 3VPKA 1KDQB 4GHQA 2ZCLP 1EATA 1KIGH 4KTSA 4LK4A 1K1PA 3SUEA 1ZJDA 4NCYA 2EA3A 4ISLA 4Y0ZE 3B8JA 2VB0A 3RXKA 1BA8B 2WYGA 4WMFA 1UHBB 1C1QA 2W7UA 1UVUH 1PPCE 4CRDA 1MD8A 2ZFTA 3I29A 4X8TH 3TVJB 2KCAA 3M7QA 4X1NU 1FUJA 1MBMA 1SKYE 1Z6JH 3BV9B 2JH0D 2BY7X 4WMEA 1YCPM 1PYTD 2BD8A 3ESTA 1O2OA 3EE7A 3K6YA 4YOIA 1P12E 2ZHDA 1C2FA 2CF8H 1UTOA 3MNCA 1C5LH 4CRCA 1GBIA 1K28D 1NFXA 3CS0A 2ZGHA 5EG4A 1SC8U 3LJOA 1K2I1 1O2NA 2ZIQH 4K3JA 4ZCNA 1ZMJA 1MKXH 2QF3A 3SOSA 4O9VA 1OS8A 2PSXA 1O3KA 1LDTT 1SFQB 5CE1A 2GMTC 1DWDH 1V2TT 1K22H 2B7DH 1GDQA 3KIDU 1A5IA 1O2TA 4DOQA 4LZ4B 2GZ9A 3SZNA 1EPTB 1YPKH 3HK6B 3PMAB 5GCHG 6ESTA 1THRH 1VCWA 4A5TS 3QDZB 2CXVA 3O8RA 4WMDA 1S0RA 1LKBA 5FBEA 4Z6AH 3OYPA 1O2RA 2ZCKP 5HM9A 4U01A 4I8GA 5T6DA 1EQ9A 3RXBA 4WWYA 4WH6A 2V3HH 1V3XA 2SNVA 4HGCA 1OXGA 1OHHD 4ZHAA 1YYY1 2PR3A 1D3QB 5FPSA 2ZI2H 2ZPQA 5GDSH 1THPB 4AG2A 2BD9A 1H4WA 1O2YA 3IITA 4JK6A 4NWKA 1V2MT 2J9NA 1TAWA 2O8LA 2VIWA 2Z3CA 3VB5A 5I46H 5HXFA 4ZXXH 2CN0H 3T26A 1P9SA 1FJSA 4RKJB 4VGCC 1TIOA 1X7AC 1TNHA 2BY5X 1EZUC 2FOMB 5L6NH 4XBBA 7KMEH 1HAVB 2XC5A 1BB0B 1SGQE 1FY4A 2PUQH 3VB7A 1DOJA 1C5WB 2W26A 3S0NA 5IYTA 1MKWH 4H4FA 1O3HA 1ETRH 2NU2E 1DWCH 2PWXA 2ANYA 3MHWU 4X1QU 1MTNB 1YPHE 3EDXB 3A7VA 1YWUA 4INKA 2H5DA 3KQCA 3ATLA 1TBRH 5EJZA 2QF0A 4M7GA 1XUFA 4ZUHA 3F6UH 2ZHQH 1MMJN 3F0OA 2TGPZ 3S7KB 3PMHB 3F2FA 1O2IA 2ZU2A 4Q80A 1NT1A 1SLXB 4DJZB 3UY9A 4JYUH 5AVDA 2PTCE 3M5OA 1P09A 3Q3XA 5GJ4B 3RUOA 3T28A 2ZFPH 1H9HE 1NRQH 4FUEA 2XWBI 1BOQA 1MKWK 1SGYE 2XCFA 3FO8D 3MO3A 5FXLA 2OBQA 3E8LA 2G5NA 3Q3KA 2EI6A 1TBZH 4BTIB 5A0CA 1BIOA 2ZFQH 1P2QA 2H2ZA 2BLVA 1TLDA 4Q2KA 5CHAB 3UNQA 4NIVA 4AB8A 4NWLA 3TNTA 1Z8JB 2Y5GA 1F5RA 2V3MA 1O3AA 2BXTH 2W6ID 4TPIZ 3ATKA 2ZTZA 5JBTA 1C5QA 4X8UH 2GZ8A 4MTBA 1C9PA 2H9TH 2WPJS 2G55A 1SGDE 2ZTYA 1LHGH 2IOTA 4B71A 4NG9H 2KAIB 1BT7A 1NU7B 4JYTA 3D23A 3SUDA 1ETTH 3CENA 4XSKU 3M5LA 2HLCA 4LXBH 1ANDA 3DA9B 3P17H 2V35A 2CJIA 4UEHH 2AHME 2AMDA 1A5GH 1C5UA 1F0TA 3LGIA 4JK5A 3SYJA 1QRWA 1NESE 1MZAA 2FESH 3DSGA 2FDAA 4F4OC 1KXCA 2A7JA 4TPYA 1DICA 3GCTG 4B1TA 4X8VH 3LIWA 3HKJB 2QF4A 1VITF 3VB6A 1ZTJA 4MPVA 4UD9H 5JYIA 3U1JB 4FUGA 1NS3A 1O2XA 2M5TA 1P05A 2VWNA 2EC9H 1A5HA 1TX7A 2PHBA 3U1IB 4ACBA 2UUJB 2ODYB 1SGTA 2A4OA 4DGJA 1W2KH 4U32A 3D62A 2AFQB 5BRRE 1ESBA 3FP8E 2QCYA 1O3FA 3L6PA 1LPGB 2ALPA 1WCZA 1HAYB 3MTYA 4JCNA 3H5CB 2CK3D 2FOEA 3SJ9A 1FNIA 2XOKD 4FU9A 1AMHA 4Z0KA 2J97A 5C94A 1GI0A 3SJIA 3OU0A 2C8YB 3PMJA 1PQAA 1EPTC 3RDZA 5TCCA 1MQ5A 4FUBA 1C1SA 1KTTB 2FS9A 1A2CH 3ZZ9A 1GJCB 5J4QA 3O8CA 2GV6A 1FPCH 2JKHA 4DT7B 3RXRA 5FX5A 1GDNA 4MPWA 2K0QA 2G4UA 2Z9JA 2R0LA 2IPQX 3LT3A 1C5NH 1A46H 2JETC 4GCHG 4JZIA 4TWWA 1G3EA 1HLTH 3E6PH 5H4IB 4U30A 2AMPA 4TY6A 3U69H 2XW9A 1INCA 3MNBA 1YLCA 3SGBE 5F8XA 1P11E 7LPRA 2H9HA 1CHGA 2WYJA 1SL3A 1C5OH 3PMBB 2PV9B 3A7WA 2P8OC 3RMNH 2VIQA 1JIMA 1T8OA 1CHOF 1HJAB 1EKBB 1O2SA 1TOCB 3A84A 2F9NA 2Q6GA 3GDVA 1S0QA 1IOEA 1ID5H 4CRBA 1ZLRA 2YNBA 2W7SA 4M9FA 3TGIE 1DM4B 1ZGIA 1UJ1A 4J1YA 4FU7A 2VWMA 2KR7A 2W3KA 3LC3A 2FS8A 2VIOA 1BITA 2FXRA 4ABDA 2PKAA 1E0FD 1ZPBA 5IDKA 1IQFA 3LPRA 4B6FA 2BTCE 3RM2H 4Q7YA 4A7IB 2J2UA 2SGPE 4I86A 1GHAG 3ZZ4A 1HFDA 4INHA 2SGDE 3ZZDA 1G2LA 1O2MA 2Y5FA 3U98H 5ABWA 1RGQA 7GCHG 2ZGXH 3FFGA 2PUXB 4AFQA 2QAAA 3E0NB 4YLQH 1XKBC 2Z9GA 3BEFB 3RC4A 4LOYH 3LH3A 1TFXA 2A4QA 4NSVA 1LHEH 1MAYA 1NRSH 4YTAA 1HNEE 1B0FA 4ZROA 2Y5HA 4B74A 4RN6A 2FIRH 5DKMA 3TK9A 2I6SA 4D9RA 3SU0A 1E1QD 3BF6H 1EAWA 1GCTB 3OE7D 1D3TB 1F0SA 1UTLM 3MU4A 1QB1A 3PO1B 2TRMA 1GBFA 3DT0H 1K1IA 3SNEA 5K0HA 1JOUB 1HCGA 1LVMA 4AYYB 2XBWA 2J5UA 2TPIZ 1WU1A 4OS4A 4OM9A 2TBSA 2W5EA 2JH6D 2P3FH 4P00A 1DY9A 1HAXB 2SNWA 1SGPE 3STJA 1WBGB 2QY0B 2AEIH 1TABE 1QL8A 1DUEA 1QBVH 1ZSJA 1Y5AT 1HXEH 2ZFRH 1LVYA 3TH4H 2ZA5A 1ZHRA 2WV9A 1FX0B 2OK5A 2ZO3H 5C5NA 1HAHH 1T8LA 5HIYA 1P10A 3P70B 2IJD1 2P93A 2ZPRA 3OFND 1O3GA 5HYOA 3URCA 1P57B 4J2YB 2XWAA 3E1XB 2F43B 1SSXA 1C2JA 1AFQB 4ABJA 1XM1A 3AW1A 1WAYB 4D76A 1Z7KA 3A87A 1J14A 1GBLA 3HATH 5C67A 3SJKA 4FETA 2HVYB 1C2IA 1NC6A 3SV8A 2RDLA 1HDTH 1QQUA 2BDIA 1L2EA 2ZQ1A 3GY2A 3BG4B 2Y82A 5DK1A 2OBOA 4H42U 3SUFA 1ARCA 4B2CA 1O2JA 4YO9A 1ZZZA 5AF9H 1D3DB 1TPAE 4F48B 1YPJH 1UCYK 1UTQA 3GY4A 3SU4A 2ZG0H 1CA8B 4JZDH 3M5MA 3F1SB 5JDUB 1E79D 4CRFA 1BJUA 2ULLA 2QGRA 1WUNH 1IQEA 1DX5M 1AFEH 2JJ1D 2ZHWH 2FTLE 3GY8A 3ODFA 4Q7XA 3UAIC 1C2MA 4RI0A 4BAMB 4YXWD 4NZLA 4Y8ZA 1P06A 3FOAA 3QUMP 1TWXB 3CP7A 3N7OA 5A0BA 3SU2A 1L1NA 1RIWB 2FOFA 1GI7B 2C90B 1W0YH 1A0LA 4MQAA 5A8XA 1B7XB 4KTCA 3BTWE 1HV7A 6LPRA 5E2PA 4VGCB 4XE4A 5DP4A 3RXVA 3SV2H 2A5IA 2AGEX 1HBTH 3TNSA 1SVPA 2GT8A 1GMCF 1D9IA 1AY6H 3RXOA 2SGQE 4CHAB 4K8YA 3ZZ5A 1W0ZU 3IWMA 1Y3XA 1NFUA 1IQHA 1O3IA 3LC5A 1O3BA 2Q6FA 1C1VH 2H5CA 2CMYA 2QF5A 1NTPA 3OEHD 1W10U 1GMHF 2BQ6B 1DXWA 1W14U 3EQ0H 1ELFA 4NIWA 1V2JT 2ALVA 1LTOA 1Y3WA 2VNTA 1E1RD 6GCHG 4Y76A 4E05H 4FUHA 2KX4A 1NBMD 2UUYA 3EA8A 2P59A 2STBE 2HGTH 3IG6B 1O5EH 3SW2B 5IK2D 1TGTA 1TBQH 1W0KD 4IN2A 1DXPA 5EODA 3A8AA 1GJBB 1YCPK 5EGMA 3MQKC 1ZRKA 3I77A 9LPRA 1C5ZB 2ZDKA 5AHGH 2Y80A 1AVGH 3OY6U 1SMFE 1JXPA 2HNTE 1IQKA 4GPGA 1QGFA 1D6WA 1XUKA 1GBEA 1KLTA 3NXPA 4B75A 1OWDA 2BDYA 2J95A 3SU1A 4ABHA 1YM0A 1FI8A 4CBNA 3RXEA 3TPIZ 1GHBG 1UTPA 4HG6A 1FV9A 1TNJA 2HALA 2YMSC 3EA7A 3FKSD 1GCTC 3PO1C 1SGEE 1BJVA 2WUCA 2BB4A 2J98A 3QN7A 6CHAC 4XDEA 5HM2A 2FLRH 5JPMH 3Q77A 1QY6A 1H8HD 3A8BA 3U9AH 1BRAA 5B6OA 2OCVB 3VGCB 5ESBA 5LPRA 1GJ5H 3C27B 2C4FH 1C9TA 3TGKE 4I8HA 3SORA 2GCHF 4IW4E 2A2XH 1EAUA 1CVWH 2ZFFH 3SNDA 1Y5UT 3HGNA 1CBWC 3QX5H 4XBDA 3JZ1B 1O3NA 3O8DA 4NA9H 1TYNA 3T5FH 2V6NA 1RTKA 1XUGA 2FO9A 1QRXA 3ZZ3A 3A89A 2WSSD 1C2HA 1A0HB 1LPZB 3PYHA 5LGOA 1SHYA 3PV5A 2CGAA 2TIOA 1E38B 1DWEH 1AHTH 2C8WB 1UO6A 1AU8A 2BD4A 3OSYA 5F03A 1ELCA 2A45B 1AFQC 2ZQ2A 4YT6H 1V2NT 1YPGH 3RXGA 3ZVCA 3M36A 1P03A 3TLOA 4CH2B 3A85A 4ZKNU 3A8DA 2ESTE 1K0HA 3BG8A 5T1VA 4K5ZA 1YPMH 3E3TA 3RXDA 2J38A 1ABJH 2A0QB 1FQ3A 1JWTA 1O3PB 1OX1A 1KXFA 4RSPA 2QC2A 2STAE 3BG4C 5AFZH 1FAKH 3DFLA 3FAOA 1NPMA 1LQDB 4UDWH 4DT4A 2H9EH 4CBOA 1FMGA 1SQRA 4I7YH 1WOFA 3U28C 1BMLA 3DUXH 3GDUA 3RP2A 2PKSC 2GX4A 4D9QA 1KYNA 2BM2A 3BIUH 4DY7B 2QXJA 3I78A 1Q31A 1T8MA 3SJ8A 1C2KA 2AIPA 1GJ8B 1MKXK 2BY9X 2JETB 1V2WT 1GJAB 4BNRA 4RT0A 1QB6A 1FY8E 1C5PA 1O36A 4YESB 5HIZA 3MO9A 1GMDG 4O3UA 1C1NA 5DP7A 1VZQH 2BDAA 1TQ7B 4I32A 1BMMH 3KF2A 1G3BA 4OS7A 2P8OB 2LNCA 1RIWC 3UPEA 1H9IE 1A3EH 1SGFA 3GICB 3TK5A 3PV4A 2FPZA 3NCLA 3ZZCA 3SV9A 1OWIA 1MD7A 3LGYA 2BQ7B 4ISNA 2BD5A 2EQNA 4CR9A 1DDJA 5EQRA 1DT2A 1DSTA 4ZKRU 3SNBA 1KDQA 4X8SH 3SQEE 1P02A 4DIIH 1EX3A 2A5AA 1VR1H 4CHAC 4Q63A 3A86A 2PFEA 5T6FA 1TMBH 2DUCA 5E0HA 1O34A 5HKKD 4O03A 2O8WA 1E34B 3DD2H 1GI5A 3T2NA 3SHCH 5DP8A 1TRMA 1DS2E 1TALA 1UHBA 2M2AA 1AVXA 4IGDA 2P3TB 3KQ5A 1AKSB 5KGOA 1P2OA 3PLPA 3GOVB 1AI8H 1JBUH 2G52A 2V3OH 2FI5E 2FLBH 1JIRA 1S5SA 4KELA 3F9GA 2Z6BD 4R0IA 1EZXC 1SGFG 1EJAA 1BTPA 3BTEE 1ZSKA 3VEQB 2ILNA 4FVBA 5EJLA 4ZKSU 2BVSH 3MNSA 1V2ST 2FODA 4BAKB 3QTOH 3RXPA 4B2AA 4OS1A 2CHAB 1IQIA 1SHHB 8GCHG 1N8OC 3A88A 1GBKA 3E91A 1EPTA 4X1RU 1O2PA 3PLBA 2P16A 2ZTXA 2EI8A 1W7GH 1XUHA 4IC6A 1HJ9A 2BOKA 3QK1A 2LP6A 1YLNA 1T4VH 2F9PA 1XVOA 3LU9B 1O2VA 5KECA 4ABFA 1VJAU 4UFGH 3M7TA 1QURH 4NFEA 3ZZBA 4KP0A 1HXFH 1VKYA 4OS5A 4X2XA 1C2GA 1NRPH 2GDDA 3GY5A 1FDPA 3JZ2B 5EXNA 1C2LA 1O31A 1QTFA 2LPRA 3VGCC 2R2MB 1GBHA 2ZHEH 2KCYA 3KN2A 5FX6A 1HGTH 2RA0A 1GL0E 4IBLH 1ZTKA 3NWUA 5I25A 2BZ6H 1UVSH 1ETSH 2WINI 2AS9A 1KTSB 2EY4C 3N99A 3TH2H 3MU0A 4ABIA 3H7TA 4X1PU 2TGTA 1OOKB 3TJVA 1KXEA 1T7CA 1BBRH 2A32A 1HAVA 2FMJA 3PM3A 2THFB 3UWJH 1O2WA 1S6LA 4DVAU 3PRDA 1QBOA 2BDBA 2BX3A 2VIVA 3U8RH 3TJOA 1TMUH 2ODPA 4BOHA 3G01A 1GG6B 1KXDA 1C1RA 3LGWA 1J9CH 1O3OA 1TGBA 2WPDD 2QIQA 3F68H 3N7DA 4D8NA 1DLKB 4FXGH 1N6YA 3PWBA 1ELEE 1P2KA 1ZGVA 1P2IA 1K9OE 2QXIA 2BOHB 1OSSA 1ELGA 4K69A 3EE0B 4CH8B 5JBCS 1BDAA 1FY1A 1FIZA 2P94A 3UB0A 3BSQA 4IMQA 2ZC9H 4K60A 5FCRA 2V0BA 1O2LA 2BVRH 3E0PB 3MOCA 1TGCA 3RXSA 1FN6A 1IAUA 1NROH 2D1JA 4A92A 1SLVB 1D4PB 2XBXA 4UFEH 2JDID 2GJGA 3BTGE 2RDEA 2Z9KA 3L33A 1BTYA 1ELVA 2PW8H 1MCVA 4ISOA 2KM0A 4ABEA 3RLYH 1GBMA 3MU8A 1TOMH 1QRZA 3GYMA 1O35A 1C1PA 2G00A 1Z71A 1O3EA 3P92A 1HAZB 1NBME 1SG8B 2NU0E 1H1BA 1GVKB 5PTPA 3ZV9A 1TNIA 2BLWA 2QN5T 5DG6A 1GI4A 2SGAA 3MH7A 2HWLB 2G5VA 3SQHE 5GCHF 1CT2E 1PQ7A 4DURA 1AQ7A 1OYTH 2KZ4A 4FUCA 2F3CE 2OP9A 4ABAA 2VVVA 3UOUA 1SGNE 2VIPA 3V3MA 1SQTA 2WV4A 2OC0A 1YKTA 2BYAX 2QXGA 1ZPZA 3W94A 1SB1H 3ATIA 2VJ1A 3W95A 3OAAD 3ZIAD 1DVAH 2H6MA 1EFRD 3A8CA 1E37B 1CO7E 1XUJA 3ATWA 4KKDA 1W11U 2ZU5A 3KYFA 4QT8C 1V2VT 3RU4T 2HPPH 1GVLA 2ZFSA 1QL9A 1UTKA 3OTPA 2VBCA 1AWFH 3BTDE 2ZEBA 5TJXA 2VWOA 3URDA 3K65B 3EYDA 3S7HB 5DO4H 1P01A 2GT7A 1GI1A 3LGVA 2OQUA 1J8AA 1CT4E 3CS7A 2BX4A 3SV6A 4H6SB 1LQEA 2D2DA 4FUJA 1BCUH 2KCOA 4ABBA 1FONA 2XBYA 2YMSB 4D7GA 3MWIU 1Z8IB 2OXSA 1GDUA 3FN8A 3ODDA 5EPNA 6CHAB 2CHAC 4B76A 4OGYA 2FOGA 4A1TA 1S84A 4IC5A 5L2ZH 1PPGE 1BMNH 1YY3A 2AGIX 2L74A 2A31A 4U2WA 1BRBE 1SBWA 2R3UA 1V2RT 2ZDLA 2V7QD 3PB1E 3SNAA 1SOTA 2F9OA 1EP5A 1RTFB 1FLEE 2NU3E 1W8BH 1MBQA 1TONA 3AK5A 3RU4D 3VG8A 1H8ED 1CBWB 3VFEA 1NZQH 3RXMA 2GP9B 4X2YA 1AWHB 1Y5BT 3LH1A 4XD7D 1MU8B 3MMGA 2ZZUH 3F2GA 1QCPA 1WTHD 3GISB 4AX9H 1QL7A 1TX6A 2ZNKH 1LO6A 2F4LA 2VH6A 3OEED 3R0FA 5C0UA 2Q1JA 3ITIA 2YMSD 3KQEA 1HIAB 1KY9A 1OP2A 3DCLA 1BTWA 1CGJE 3LONA 4X6OA 1LVBA 5DSFA 3KGPA 3UR6A 3Q76A 1T32A 2Z3EA 1C5YB 1VCPA 1EB2A 4K1SA 3ZV8A 1SGCA 2BY8X 4GHTA 1BRCE 3SHAH 2AGGX 1BTHH 4SGAE 8GCHF 4O97A 2ASUB 3UNRA 3ZVEA 1O2GH 2B8OH 1KLJH 2JH5D 1BMFD 3RXHA 5JBAS 3QO6A 1DUAA 4X6MA 3ZVAA 2ZWLH 1GCDA 3RC6A 2VGCB
chains in the Genus database with same CATH topology
3ENSB 1GG6C 2PKSB 1F0UA 4DW2U 1O2ZA 1PPZA 1W12U 4PROA 3K2UA 1V2QT 1FY3A 3RXIA 2WV5A 3D49H 2ZECA 4BAQB 2WPKS 5FHTA 3BIVH 1O2UA 1P04A 3FP6E 3M3SA 2B0FA 4Y8XA 3ELAH 1XUIA 1K21H 2ZGBH 2J94A 4Y79A 1MH0A 1CA0C 1N6XA 1ZSLA 3QZQA 1AUJA 1MTUA 1HAGE 2WPMS 4MG3A 1GHWH 3GCTF 1GBCA 7ESTE 5L2YH 2D26C 2FI3E 3LDXH 1HJ8A 4ABGA 4AB9A 1YGCH 1O39A 3BTTE 1GJ7B 2YNAA 2WPLS 1FZZA 2BQWB 2F91A 3ATMA 1G37A 4NSYA 1SGIB 3L3TA 4Y7AA 4ZXYH 1V2OT 1AUTC 2FX6A 4HFPB 1MUEB 2ZU3A 2BHGA 4MNYA 2FZZA 2VVCA 3KEEA 1CGIE 1S85A 2GTBA 4AORA 1DFPA 2OQ5A 1XVMA 1C1WH 1Y3UA 2HRVA 4JYVH 4FU8A 1RRKA 1G3DA 1TNLA 3M5NA 1IQLA 1WTGH 3ZYDA 1EZSC 4WVPE 3A83A 5EW1H 3KCGH 4I8KA 2XYAA 5C2ZA 1V2KT 5C5OA 3HKIB 1HYLA 1XX9A 5F6MA 1VGCB 3FANA 2WPIS 2FOBA 3DFJA 2FX4A 4X2VA 1TB6H 5E0GA 5FCKA 3SU3A 3KQBA 3WY8A 4IN1A 1T8NA 4ESTE 3S9BA 3ZZ6A 1LHCH 1YPHC 4I31A 1O5GH 1C1TA 1ZPCA 2ODQA 5SGAE 3F9HA 2B9LA 3E16B 2G81E 1N8OB 3BEIB 2BLOA 1QB9A 2IPHA 4UONA 4E06H 4GCHF 1TPPA 2HOBA 1P3CA 1ZJKA 3UFAA 1O0DH 1P2MA 1TNGA 2ZGJA 1VITG 1SLUB 1UTJA 1SQOA 3T27A 3U8TH 2ZP0H 4ZAEA 1ELBA 5DPAA 5EXMA 2QXHA 3R3GB 4B2BA 8KME2 2AYWA 5LPFA 3RM0H 4FUFA 3F9FA 2AMQA 1BZXE 1QBNA 2PSYA 3HK3B 1CGHA 1D6RA 1AB9B 2A5KA 3B9FH 1G30B 2Z94A 2GZ7A 3MNXA 3FZZA 1DLEA 5L30H 2GV7A 3MU5A 1GHAF 2XC0A 1TGSZ 1L4ZA 2G4TA 3GYLB 4WF8A 3SO3A 1QJ7B 2QA9E 4MPXA 7GCHF 3Q3YA 3RLWH 5GIBA 3P6ZB 3LGTA 1SI5H 1WQSA 2BDCA 1O3JA 2GVFA 5F8ZA 1K1OA 3BTQE 1AD8H 3GCHC 1PPHE 1IQJA 3ZVGA 3BTKE 3VXEH 1TQ0B 1BHXF 1TA2A 2O8MA 3T62A 5A8YA 3V13A 1T4UH 1TNKA 5C1YA 3RXLA 3QGNB 4R8TB 1ARBA 1UTNA 3UNSA 1QIXB 3RXFA 5FPYA 1OWHA 2FEQH 4OS2A 1MQ6A 4YZUA 1GI6A 3Q00A 1TRNA 5CMXH 1HRTH 1EOLA 2A1DB 2B5TB 3NKKA 2AH4X 2XXLA 5DGJA 1CHOG 2YOLA 2VGCC 4CR5A 2R0KA 1P2JA 4KTUA 1C5TA 1E35B 1ABIH 1Q2WA 3GY3A 5DP9A 1GBDA 1ZYOA 3AAVA 4ZKOU 4Y11E 1DPOA 1UCYE 1GJ9B 3SNCA 4AFSA 2GD4B 1W7XH 1XXFA 2Q6DA 1ANCA 4K1TA 3MYWA 4TYDA 2FWWA 2AIQA 3FVFB 1O38A 1YPLH 2FOCA 5LH8A 3OTJE 5BPEA 3UQVA 2VIDA 3B23B 1IQNA 1K1NA 3KHVA 1O32A 4X0WU 4HZHA 4FVDA 4YT7H 3LGUA 1EUFA 1XKAC 2F9UA 3GCOA 1C4V2 3O8BA 3HPTB 2FP7B 1RJXB 1SGRE 3AVZA 4ISHH 3SGQE 4THNH 1EAIA 2A4RA 1C5SA 1GGDC 2J4IA 1K1MA 1NRRH 3ZVDA 1C1UH 1GHVH 4Y7BA 1LPKB 1QQ4A 1O5BB 5HMAA 3RMMH 3T29A 2C3SA 2OD3B 4JZFH 3TJUA 5C1UA 5HGGA 2AERH 2XCNA 1MTVA 1RFNA 1ELDE 1UTMA 3UREA 1BMAA 2UWOA 3AASA 2UUFB 3PWCA 2OUAA 1M9UA 4A1VA 3UTUH 1OWKA 4E7RG 1PPBH 4XFQA 2XRCA 5GWZA 1H9LB 3RMLH 3MH6A 1J15A 1GPZA 1O37A 3STIA 5EU8A 1Z8RA 4HTCH 4ZMAH 5AFYH 2GGVB 1VGCC 4D7FA 3M7UA 4AN7A 1MZDA 1CT0E 2ANKH 3GDSA 1EASA 2OTVA 5E0JA 1MTSA 2ZDAH 3A7XA 2I6QA 2IN2A 1AE8H 3RU4E 4NA7A 1RTLA 1MU6B 1Y8TA 3AAUA 1BTUA 5F8TA 2R3YA 1C5VA 1QR3E 2F9VA 9ESTA 1VJ9U 4A6LA 2P3UB 3MO6A 1ZRBA 2J34A 2FYQA 1Y3YA 5LPEA 4NIYA 1O5CB 1C4Y2 1NM6A 2XC4A 1SOZA 1QA7A 1NRNH 1O33A 3ZVBA 1UVPA 4MVNA 1K1JA 2RCEA 4FUDA 2GCTB 1A4WH 2Z9LA 1P0SH 4X1SU 1ESTA 3EAJA 3M37A 5A0AE 1G3CA 1UMAH 3ZYEA 1NU9A 3P8OA 1DITH 3VB4A 1NY22 2RG3A 1QFKH 4I8JA 1O3DA 1Q3XA 1GI3A 2ZDNA 1K1LA 3LOXA 6GCHF 3H7OA 1AB9C 1THSH 1ZMLA 1PYTC 2K1QA 3TK6A 4NFFA 4WXIA 4BXWA 4WJG2 3SU5A 4CREA 1MAXA 1BHXB 1PPFE 1SR5C 1ZOMA 1EJNA 1RXPA 2TGAA 1EJMA 1QNJA 2CF9H 4MNWA 4AFZA 2D8WA 5FPTA 3DHKH 2HPQH 4I8LA 1SLWB 2PKAB 2PGBB 3UUZA 5GXPA 1IHTH 4X6NA 1SFIA 4I33A 4ZH8A 2BXUH 2ZF0H 2Y6TA 3FZDA 1FAXA 1F2SE 1Z8GA 1CSOE 1BQYA 8LPRA 3UOPA 2VWLA 4DIHH 2EEKA 1DSUA 4YLUA 2PLXA 5ESTE 1GHBF 5E2OA 3M61U 1GMCG 2R2WU 1AKSA 3GY7A 2BLQA 2HVXA 1G32B 3V12A 1V2UT 2BY6X 5EQQA 3RC5A 1AN1E 2OC7A 3A7ZA 3GCNA 4AFUA 1CA0B 2G51A 1GJDB 5GPIB 1G36A 1L1GA 3VXFH 1BTXA 1AVWA 1BBRK 4K8BA 3UR9A 1OWJA 2ZPSA 1CU1A 1GMHG 1GWAA 3ZZAA 3ZZ7A 2NWNA 1AZ8A 2BMGB 3EA9A 1JMOH 3E90B 5EW2H 4GAWA 2FM2A 3NK8A 3NUMA 1HAOH 1YPEH 2OLGA 1W13U 1RD3B 3P8FA 1TE0A 1QJ1B 3A81A 4ASHA 5FAHA 1EXFA 4WH8A 3MH4A 2Y7ZA 3OX7U 4BAHB 5K7RA 3UQOA 5ETXA 5FBIA 1OP0A 3K9XB 2BD2A 3QWCH 4Y0YE 2A7CA 2BDHA 2QV1A 3RXUA 1TA6A 1TPOA 1KSNA 4GSOA 1KXBA 3QTVH 5EPYA 1Z1IA 2KAIA 1EB1H 2ZU4A 3BTFE 1IQMA 1OKXA 3QGJA 1AIXH 8ESTE 1LCYA 3ZVFA 1EZQA 3F9EA 3SI3H 3UWIA 4MLFB 1TX8A 1B0EA 5C20A 1P8VC 4AGJA 2FYRA 4DCDA 1ANEA 4GUXA 1SPJA 1PJPA 3U8OH 1C4U2 1ELTA 1KLIH 1O3MA 4H6TA 4IMZA 5DP6A 4Y10E 4NIXA 2Z3DA 1FN8A 1PPEE 1ACBE 2BDGA 2Z9IA 2F9BH 4B73A 1C5XB 2A2QH 3V0XA 4AZ2B 1ZR0A 1MTWA 4JZ1A 4BTUB 1HAIH 4YOJA 1GMDF 4Q7ZA 1P2NA 2WPHS 3SU6A 2H1UA 2NU1E 2GCHG 2VH0A 4YOGA 1MTNC 1OP8A 2A7HA 3M3VA 4SGBE 4YM9A 3TITA 1TGNA 3BEUA 2SFAA 1HAPH 2C8XB 1KXAA 2A4GA 1C5RA 1HUTH 4E7NA 2NU4E 1GBJA 2BVXH 3TJNA 2HNTC 3RXTA 4NZQA 3S69A 1ELAA 3PLKA 1NO9H 2FTMA 4WXVA 5A2MH 1T31A 3MFJA 3LKWA 2O9QA 1F0RA 4JMYA 1GJ6A 2F83A 2EI7A 2FOAA 2DE8A 2VINA 1L4DA 3UIRA 1Y3VA 1DWBH 3KNXA 5A09A 3QLPH 4ZHMU 1AZZA 4Y8YA 2GCTC 1C2EA 5CHAC 1GHXH 4DG4A 2WUBA 2C8ZB 3TIUA 1OWEA 1Z1JA 1O30A 1O3CA 5DJ7A 1F7ZA 1GI2A 3MI4A 1P3EA 2ZKSA 2SGEE 2VU8E 3BTHE 5DP3A 1SQAA 1YP9A 1H8DH 4AG1A 2ZGCA 1PFXC 1AE5A 1UK3A 2UWPA 1EAXA 1JRTA 3GCHB 3PTNA 1GI9B 2ANMH 2QYIA 2W3IA 1EOJA 2SGFE 1UK4A 1FPHH 1H8IH 1DANH 1HB0B 5JB8S 2OINA 4LZ1H 1UVOA 2BD7A 1FIWA 1AGJA 5TCAA 5EXLA 3M3TA 1ANBA 1E36B 4JZEH 5JBBS 1RS0A 5A8ZA 4BXSA 1GL1A 4WY3A 3SBKA 4KGAA 1WYKA 1YLDA 1ESAA 4OS6A 4A1XA 2Y7XA 1UCYH 3TGJE 1O5FH 1OYQA 4MDSA 4IS5A 1LHDH 4Y71A 1O2KA 4BTTB 2UUKB 3EGKH 1C2DA 1O2QA 3A80A 2ZCHP 5T6GA 2Y81A 1O5AB 5T3HA 1C1MA 3C1KA 4XBCA 3S9AA 1S83A 3BN9A 1F5KU 2P95A 4CRGA 1QHRB 2GMTB 2J92A 4FUIA 3RXQA 1QJ6B 1V2LT 3BTME 4TWYA 3T25A 1MCTA 3P8GA 1PQ8A 2UWLA 4K2YA 2ZDMA 1P9UA 1S6FA 1L1JA 1A7SA 1F92A 3ZZ8A 2DE9A 3S9CA 1J17T 1BRUP 1JRSA 1C5MD 2ZHFH 1UVTH 2ZDVH 3OY5U 3P8NA 1ORFA 1W3CA 5G4BA 1YF4A 1LKAA 1Y59T 1XXDA 1D3PB 2PTNA 3SJOA 4XOJA 1BBRE 1Z6EA 1OPHB 1A3BH 2Z7FE 3RXAA 4AYVB 1WSSH 1VCQA 2O8TA 1NFYA 2RA3A 1G2MA 2TGDA 1GBAA 4GLYA 2FOHA 4NGAH 3VB3A 3SN8A 4K1EA 4Y6DA 1UK2A 4CRAA 2O8UA 1GGDB 2R9PA 3KQDA 1BTZA 4BAOB 1J16A 1ZMNA 1TRYA 1GHYH 4X6PA 1F5LA 1YBWA 1WQVH 1FXYA 3TH3H 3K6ZA 4TY7A 3RXCA 4ZHLU 2XNIA 2BD3A 2G8TA 4INLA 1O2HA 2OC8A 3M35A 4X2WA 2FI4E 1S6HA 4UFFH 3SI4H 3FP7E 1TMTH 1V2PT 1NFWA 5DP5A 1QA0A 1YC0A 1L0ZA 1YCPH 3GY6A 4AGKA 1GVZA 3RMOH 1AO5A 3A82A 4MNXA 1NN6A 1HIAA 1A61H 1HJAC 4UE7H 3TU7H 3PTBA 1U6QA 5EQSA 2CV3A 3D65E 2C93B 4RKOB 4MPUA 1A1RA 1B5GH 1GBTA 2OC1A 3P95A 2XTTB 5JB9S 5C3NA 1DE7H 5E8EH 1N1LA 2GDEH 3MH5A 2GKVE 1S82A 4O3TA 1EP6A 3A7YA 1IHSH 1CE5A 1LVOA 4HI3A 3SGAE 2IJOB 4AOQA 3PROA 3HGPA 1G9IE 4MNVA 1TPSA 1GHZA 4BANB 1LMWB 1C1OA 3SUGA 1IQGA 2ANWA 1FY5A 1A0JA 4NA8A 1GBBA 1XMNB 3V7TA 3NZIA 1PQ5A 1CQQA 1VITH 3LJJA 1BUIA 4F49A 5J4SA 5C1XA 2PGQB 2BZAA 4ISIH 1O5DH 4UFDH 4OGXA 1LHFH 2HNTF 3RXJA 1DY8A 1GJ4H 1HPGA 2ZU1A 1GI8B 4GVUA 2XBVA 2VVUA 3A7TA 1V6DA 1ZTLA 1S81A 3MU1A 3SV7A 3KL6A 3NPSA 1O3LA 3QZRA 1ZHMA 5EOKA 1WV7H 3AW0A 1ZHPA 3VPKA 1KDQB 4GHQA 2ZCLP 1EATA 1KIGH 4KTSA 4LK4A 1K1PA 3SUEA 1ZJDA 4NCYA 2EA3A 4ISLA 4Y0ZE 3B8JA 2VB0A 3RXKA 1BA8B 2WYGA 4WMFA 1UHBB 1C1QA 2W7UA 1UVUH 1PPCE 4CRDA 1MD8A 2ZFTA 3I29A 4X8TH 3TVJB 3M7QA 4X1NU 1FUJA 1MBMA 1Z6JH 3BV9B 2JH0D 2BY7X 4WMEA 1YCPM 1PYTD 2BD8A 3ESTA 1O2OA 3K6YA 4YOIA 1P12E 2ZHDA 1C2FA 2CF8H 1UTOA 3MNCA 1C5LH 4CRCA 1GBIA 1K28D 1NFXA 3CS0A 2ZGHA 5EG4A 1SC8U 3LJOA 1K2I1 1O2NA 2ZIQH 4K3JA 1ZMJA 1MKXH 2QF3A 3SOSA 4O9VA 1OS8A 2PSXA 1O3KA 1LDTT 1SFQB 5CE1A 2GMTC 1DWDH 1V2TT 1K22H 2B7DH 1GDQA 3KIDU 1A5IA 1O2TA 4DOQA 4LZ4B 2GZ9A 3SZNA 1EPTB 1YPKH 3HK6B 3PMAB 5GCHG 6ESTA 1THRH 1VCWA 4A5TS 3QDZB 2CXVA 3O8RA 4WMDA 1S0RA 1LKBA 5FBEA 4Z6AH 3OYPA 1O2RA 2ZCKP 5HM9A 4U01A 4I8GA 5T6DA 1EQ9A 3RXBA 4WWYA 4WH6A 2V3HH 1V3XA 2SNVA 4HGCA 1OXGA 4ZHAA 1YYY1 2PR3A 1D3QB 5FPSA 2ZI2H 2ZPQA 5GDSH 1THPB 4AG2A 2BD9A 1H4WA 1O2YA 3IITA 4JK6A 4NWKA 1V2MT 2J9NA 1TAWA 2O8LA 2VIWA 2Z3CA 3VB5A 5I46H 5HXFA 4ZXXH 2CN0H 3T26A 1P9SA 1FJSA 4RKJB 4VGCC 1TIOA 1X7AC 1TNHA 2BY5X 1EZUC 2FOMB 5L6NH 4XBBA 7KMEH 1HAVB 2XC5A 1BB0B 1SGQE 1FY4A 2PUQH 3VB7A 1DOJA 1C5WB 2W26A 3S0NA 5IYTA 1MKWH 4H4FA 1O3HA 1ETRH 2NU2E 1DWCH 2PWXA 2ANYA 3MHWU 4X1QU 1MTNB 1YPHE 3EDXB 3A7VA 4INKA 2H5DA 3KQCA 3ATLA