1NN6A

Human pro-chymase
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
224
structure length
222
Chain Sequence
GGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human pro-chymase: a model for the activating transition of granule-associated proteases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Chymase
total genus 52
structure length 222
sequence length 224
ec nomenclature ec 3.4.21.39: Chymase.
pdb deposition date 2003-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nn6A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1nn6A02
5A0CA 1HYLA 1KXBA 1UO6A 2G55A 4X8TH 2QXGA 2GMTB 2F9BH 3KHVA 1HV7A 3A7VA 4FUFA 1LO6A 4GCHF 3SI4H 2HNTE 4R8TB 5E8EH 3RXRA 5L2ZH 2ANMH 3LONA 2BQ6B 4TY7A 2XWAA 1W13U 4NSVA 1P2OA 3QK1A 5BRRE 2R3YA 3SUGA 3PO1C 2QF3A 1F0SA 1SQAA 2XYAA 4XBBA 4A1TA 1MBQA 1GHZA 2BD2A 1P02A 4D9RA 1XKBC 1XUKA 2VIWA 1XKAC 3VPKA 1G3CA 1V2PT 3PV4A 1MQ5A 4OS4A 5AVDA 1LTOA 4K3JA 3FZZA 3ZZCA 4FUJA 2ZCKP 2GV6A 3Q3KA 1OWJA 3ENSB 1ZOMA 1LPZB 3FANA 4NGAH 1HAVB 3LPRA 2Y82A 1Z6JH 2BLVA 1D3QB 3RC5A 4IN2A 1C2FA 1DOJA 1ELGA 1O38A 2OQUA 1B7XB 1O2YA 2LPRA 2Z9LA 5C67A 1OXGA 1GJDB 2LNCA 3PROA 4TPYA 1F7ZA 1BMNH 1Z8IB 1G37A 1CBWB 1Z8JB 2BDBA 1OYTH 2ZF0H 2V3OH 5K0HA 1AFQC 2BDGA 1O2LA 3LC3A 2V3HH 1O3OA 1W0ZU 4AYVB 1W11U 2ODPA 1C2JA 2GTBA 3UWIA 1HJAB 3VFEA 3O8BA 1C9TA 1V2QT 2G5NA 2ZU3A 5HM2A 3T28A 2EEKA 2FX4A 1UTQA 4U2WA 2BDYA 3BTHE 1A61H 1D3DB 4B71A 2VU8E 1Y8TA 3F6UH 2GVFA 2A0QB 2R9PA 5HXFA 1K1NA 2BDCA 3ZVCA 1PQ8A 2FOHA 1JIMA 2CF8H 4IC6A 2A2QH 2XW9A 4SGAE 2BD7A 1SGYE 1YPGH 1CGHA 1EATA 1L1GA 1O5GH 2ANYA 5FPTA 3LC5A 1Y5BT 1NRPH 3BTME 3TJVA 4B2BA 2BVXH 1YF4A 1ZLRA 2VVVA 3T62A 1HJ9A 3GDVA 1GG6C 1O2RA 1FY3A 4MG3A 1ESTA 3TGIE 1GHWH 2H6MA 5T6GA 3URCA 2ZU4A 5DK1A 3SGAE 3MNBA 1SGRE 1T7CA 1ETTH 4AZ2B 3F68H 1O3AA 2OC7A 2VNTA 2J92A 2HWLB 1MZDA 1EPTC 3BTEE 1EXFA 3LDXH 5TCAA 1O2VA 2ZGHA 4AFZA 4FUCA 4D7GA 1ETRH 2ZPRA 4HTCH 5C1UA 1O2QA 1SGFG 1HPGA 4ABGA 3V13A 2F83A 1WBGB 5E0HA 2C8XB 5HM9A 2IPHA 2SGFE 3TH4H 1P10A 1LHEH 2B7DH 1ARBA 1KXEA 2FOFA 4AGJA 2HLCA 1BQYA 1EJAA 4I33A 8GCHG 2BX3A 1NRSH 4X2WA 1B5GH 3BTKE 3LJOA 1NS3A 3M3SA 1K1OA 1LPKB 3M5LA 3UNRA 3U8RH 1P12E 1RS0A 2C3SA 3HK6B 3T29A 4YT7H 3LGUA 2BY7X 2QV1A 2ZFFH 2R2MB 5SGAE 1Z71A 2C8WB 3EE0B 1QQ4A 3RXLA 1EX3A 1EJNA 5I25A 1AIXH 4LXBH 1CGJE 1P2QA 2QCYA 3GCTF 1S83A 5C1XA 3A87A 1FXYA 5FCKA 2J4IA 3KNXA 5JBTA 4MNXA 3MU8A 4ABIA 1C5OH 1HUTH 1A5IA 1KLIH 2EA3A 2BB4A 2ZZUH 2BYAX 4FUIA 2FOEA 4HFPB 4CRDA 2WPHS 3SJOA 2WINI 4NWKA 4Y10E 1J9CH 5JB8S 1EPTA 1GJ5H 2WPLS 4D9QA 4WMDA 3RMMH 2BLQA 1K1LA 1S0RA 1YPLH 1TOCB 2OCVB 1CE5A 2ANKH 3AASA 2FI3E 4ESTE 1O34A 1SHYA 1VZQH 4NWLA 4BNRA 3RXPA 1MKXK 3RMOH 3Q3XA 2GZ8A 1UK2A 4DURA 1C1QA 2C8ZB 1W3CA 1MKWK 3QTVH 1GJCB 1WTGH 3RXQA 2EI8A 3VGCB 5LPRA 3CS0A 1QURH 4GHTA 2F9NA 1QBVH 3BG4B 3V0XA 3QGJA 3BTFE 3SJKA 2ZDAH 2CJIA 3O8CA 4O03A 2RG3A 3TH3H 1YCPH 1MTUA 1X7AC 3ODFA 1GI9B 1A0HB 1GMDF 2A2XH 1GDUA 2IOTA 4AFUA 1FZZA 3RMNH 3A89A 2XC5A 1W2KH 1SGQE 4JZFH 4K5ZA 4WXIA 1D3PB 1O3DA 1O2NA 5HYOA 3SV2H 3P8NA 4OS1A 1TPSA 1GJ6A 3GCNA 2DE9A 2FX6A 2P3TB 1HDTH 1PPCE 1O3BA 3A85A 4OS5A 2BQ7B 3I78A 5DPAA 1ORFA 3M7QA 1BRUP 1H8DH 2A31A 4I7YH 1GBKA 1WTHD 5FAHA 1O5DH 5CHAB 1GHBF 1EAIA 3EAJA 1HAOH 2J9NA 2QYIA 1TFXA 3MU5A 1V2TT 3FP7E 3RXKA 1HJ8A 1THPB 1BHXF 2O8TA 1QL7A 1TBQH 2BTCE 3BTDE 1S6HA 4UONA 2P16A 1H1BA 1JXPA 3OYPA 1DXWA 3MFJA 2FLRH 3Q76A 4ZXYH 1Q31A 1ZGIA 1C5RA 2BDIA 1EB1H 4B2AA 2D1JA 1HAIH 1MD8A 1J15A 2ZWLH 1YC0A 2FS8A 2NU1E 4AB9A 1AUJA 1BUIA 4X6OA 4E05H 7GCHG 1O3MA 1JWTA 3TGJE 4B2CA 4Y79A 1P57B 1BRCE 4WXVA 5DO4H 1TLDA 1EP6A 3MMGA 3VB3A 1AHTH 6CHAB 4ABDA 1KIGH 1UK4A 1OPHB 1BRBE 2OP9A 3ZVAA 3SORA 4BAHB 1UTNA 1A5GH 4DG4A 1FDPA 2O9QA 1C1OA 2XCNA 5EODA 1C5XB 3HKIB 1BA8B 4IS5A 4TWWA 2ZHFH 1UVSH 3ZVGA 1C5VA 1HAHH 2CF9H 1GBEA 2PKSB 4AYYB 1GI1A 1Y3UA 1AO5A 1F5KU 3DA9B 3VB5A 3RU4E 4YO9A 2BLWA 3RXGA 1TPAE 3RLYH 1GVLA 1JOUB 1GJ9B 4X0WU 1L2EA 1TMBH 4J1YA 2P3FH 4Y7BA 1K28D 1CT2E 1PFXC 2GDDA 2YOLA 3A8DA 1M9UA 1HXFH 1N6YA 2UWOA 1V2KT 2A1DB 4K2YA 4YESB 4NA8A 1V2OT 1O33A 5HGGA 3SNCA 4WWYA 3TLOA 1BTHH 4LOYH 1IQFA 1IQNA 3LU9B 5EG4A 4CREA 2DUCA 1O3KA 2FXRA 1HIAA 2SGAA 2ZCLP 1VJAU 2XBVA 1EASA 3A81A 1AU8A 2FYRA 1DX5M 1QBNA 3HK3B 3M61U 1UK3A 3QZRA 1CO7E 1BTWA 1TX8A 1GJ8B 6GCHF 1TYNA 3GYLB 3OX7U 1EAUA 2AS9A 2R0KA 1UTMA 2QY0B 2G00A 1FONA 4DW2U 2Y5FA 4HGCA 1GWAA 1VCWA 4OS6A 4MLFB 3RXTA 2H9HA 5EW2H 5G4BA 1B0FA 4B73A 3A8AA 4JZIA 2FESH 5EU8A 2GD4B 1MAYA 1PQ7A 3PYHA 1N6XA 3S7HB 1TMTH 3MH6A 1TE0A 2D8WA 4Y0YE 4AX9H 2GZ9A 2BXUH 4NZQA 3NCLA 2WPKS 4GVUA 2G4TA 3SU5A 1CA8B 1VGCC 1YGCH 3D23A 4Y71A 1KYNA 4YLUA 1TB6H 1ZSJA 3A7XA 1FAXA 2A5AA 3UNQA 3SO3A 2QIQA 2CXVA 1S85A 3S69A 4H42U 1EQ9A 1FY5A 2BY5X 5A8YA 1O5FH 5PTPA 1CVWH 1EZQA 1SFIA 2XCFA 1YPMH 2AIQA 1XXFA 1BTZA 4YM9A 3LH3A 2SGQE 3UQVA 1FMGA 3M3VA 4Y11E 4Q7YA 1O3JA 3PMAB 4X1PU 1PPGE 4A5TS 1QBOA 1QA0A 1C2EA 2ZGCA 2ZPQA 2BXTH 5JYIA 2C93B 3LOXA 1W10U 3SU3A 3R0FA 1MKXH 2G52A 7LPRA 1K22H 2FP7B 1XUHA 1GGDB 1BJVA 1ZPBA 4HZHA 5JBBS 2Y6TA 4ABFA 1QQUA 2NU2E 2HPQH 1P01A 1SLWB 2FOGA 5E0GA 3S9BA 2Z3EA 1P2KA 3ZZ9A 4GCHG 3TGKE 4O3TA 4IMQA 1Y3XA 4OS2A 2HOBA 4AFQA 2OBOA 2ZFQH 1O30A 3STIA 4YOIA 1GI2A 3W94A 2HPPH 2BY8X 3PMBB 1Q2WA 1WCZA 5GDSH 1NN6A 1ZRBA 1BMLA 1ESAA 3IITA 4INKA 2GGVB 1BIOA 1KLJH 3C27B 5A09A 4FUHA 3BV9B 2BM2A 2JH0D 2FLBH 1KXCA 1KY9A 1GBDA 2ZHQH 5T3HA 1MTWA 2CMYA 1UTOA 5ABWA 1DVAH 3SHAH 3MH4A 5JPMH 1C4U2 1T4VH 3V12A 4MTBA 4DIHH 2FTMA 3EA9A 3SBKA 1DANH 3U9AH 1O3IA 1EJMA 3SHCH 3PWCA 4VGCC 1VITF 3I29A 1C5TA 1P11E 5FX5A 3TU7H 3MO3A 1QY6A 2R2WU 1C1TA 1D3TB 2SGPE 3S0NA 2J38A 1GI8B 5TCCA 3QZQA 1F2SE 1LHFH 1P3CA 3NWUA 1CA0B 1S6FA 2Y80A 1NRRH 3KF2A 4UFFH 5B6OA 1O2ZA 2VH6A 1GHXH 5F8ZA 5C5NA 1A0JA 2WYJA 1BOQA 1O3GA 5FX6A 1E38B 3M36A 1ZPCA 4CR9A 1AGJA 3QN7A 2ASUB 1TQ0B 3VB6A 1G30B 4BTIB 1SGNE 3GDUA 1SFQB 2Y7XA 3BG4C 4ZAEA 1IQJA 4AGKA 1O32A 2AGEX 1V2WT 2ZDVH 1RIWC 2A7CA 2P3UB 3NPSA 2QXIA 2XWBI 2ZP0H 1N8OB 5FPYA 3LGIA 3A82A 4BXSA 1O3EA 1DY9A 2XC0A 2V6NA 4KGAA 1DWDH 2W3IA 4CRBA 1FPHH 1BTPA 2ZU2A 3TJNA 1ZMJA 3A7TA 1O2WA 3SW2B 2GCHF 5GIBA 3GOVB 2FOCA 1V2LT 1FQ3A 1Y3YA 2AMQA 2VIPA 3T2NA 2Z9JA 3P17H 5EQQA 5A8XA 5H4IB 2VIQA 1DDJA 3MO9A 1GBBA 1OP2A 1TNKA 1C2GA 1TNLA 3SV7A 1SPJA 1ZR0A 1AI8H 1BMAA 3FZDA 1EZSC 2FMJA 4RKJB 1RXPA 3RUOA 2F9PA 1G36A 1IOEA 2A4QA 1IHTH 2F9OA 1W8BH 1P05A 2TPIZ 4BOHA 1QB9A 2FM2A 1LQEA 3FFGA 3T26A 1MUEB 1P2JA 2ILNA 1O35A 8KME2 1GBJA 1YYY1 5GJ4B 4CRAA 4NFEA 5FPSA 1O2XA 5GXPA 1EB2A 1MU8B 2A4OA 3K9XB 1ZRKA 3RDZA 3ZVBA 3MU0A 2F91A 4D76A 2DE8A 1NC6A 2ULLA 3MWIU 1NT1A 4X8VH 2A45B 1LKAA 5C1YA 2ZGXH 4XBDA 1SLVB 3NK8A 1HAZB 1O2OA 4K69A 2BY9X 2AYWA 1UTPA 2FS9A 1FIWA 4CRFA 3EA8A 2C90B 2JETC 1L4DA 1SSXA 1ZTJA 1O2GH 1O37A 3A88A 4Y8XA 1YPJH 1ARCA 4ZMAH 2FI4E 3RU4D 1W0YH 4BAKB 1P2IA 1NU9A 3ATMA 1C1UH 3S9CA 2WUBA 4WMFA 3OY5U 1PJPA 1TNGA 4Y0ZE 2B8OH 2Z94A 3RM0H 4O9VA 2V35A 1YP9A 1OP0A 1AKSB 1P04A 3IWMA 1E35B 3ZZ8A 8LPRA 1E36B 1O2SA 3LKWA 1WSSH 3PLKA 5DP7A 1SGTA 1TGNA 2D2DA 4I31A 5LGOA 4KTCA 3VB4A 4AN7A 1FY1A 1J8AA 2ZCHP 4ABHA 3DFLA 1Z8RA 1KTSB 1C5WB 2A4RA 4CHAB 1GBTA 1BCUH 3UUZA 1G2MA 1UCYE 2Y81A 5AFYH 3URDA 4XSKU 1F0TA 3KQEA 1UTLM 2ZDKA 1O2MA 1GHBG 1P2NA 3UQOA 2ANWA 1OX1A 3VXEH 1V2RT 4TYDA 1RIWB 2YNAA 3OSYA 1SQTA 1QRZA 2OLGA 1C1PA 1K2I1 1S0QA 2ZFSA 2VINA 1TNIA 2TRMA 3SJIA 4BTTB 1MU6B 3T27A 2UUKB 3L33A 2AIPA 4OGYA 3B8JA 1TRYA 4Z6AH 3ITIA 2A5IA 1O2UA 1PPHE 1KDQB 2QAAA 1H9IE 1YCPM 8GCHF 1C2MA 3MH5A 2FI5E 4MPXA 5J4SA 4DCDA 3UFAA 3LH1A 4GSOA 1Y59T 4TWYA 1G3BA 1QTFA 2Y5GA 3TIUA 1OWHA 5J4QA 4AFSA 1W14U 3HGNA 1QIXB 3RXAA 1DWBH 4ABBA 2PFEA 3WY8A 1QR3E 1W12U 2OC0A 1CU1A 2IN2A 4YZUA 1ZMNA 2ZEBA 3KQCA 1AB9C 3M35A 3SGQE 5T6FA 3U8OH 2BLOA 3AAUA 4X2XA 4KKDA 1TABE 1A3EH 3A7ZA 2HNTC 2ZQ2A 4DOQA 1O36A 1PYTC 1UHBA 1SGDE 7GCHF 1IAUA 3TPIZ 1YBWA 1V2UT 2CHAC 2VGCB 1CHOG 1TX7A 4B74A 1W7XH 5EPYA 2V0BA 3RC4A 1A1RA 1AE8H 2THFB 1A0LA 3FAOA 4JCNA 1GBLA 3MOCA 1T8MA 1C2IA 1Y3WA 3MNXA 1ZJKA 4FVBA 3ZZBA 1V2MT 1O0DH 4Q7XA 1DE7H 4QT8C 4BXWA 5LPEA 1NESE 4O3UA 2BQWB 3A7WA 1XUIA 3M5NA 4YTAA 1ZMLA 2OTVA 1JIRA 1OKXA 2QXHA 5EGMA 2BVRH 2P93A 1O3CA 3O8RA 1C2HA 1C1WH 3ZYEA 1GI4A 2AMPA 1GVZA 1DWEH 1FIZA 3SQHE 2GT7A 1YPEH 2ZU5A 3LT3A 3SNBA 2VVCA 1EAWA 4ZUHA 3SV6A 1C5YB 1HGTH 1H4WA 1HB0B 4ZHAA 2GT8A 1GG6B 5EXLA 1T32A 3TK9A 4I8GA 2UUFB 4I8LA 3E16B 1OWEA 2I6QA 1HJAC 4FUGA 1A46H 2IJOB 2CV3A 1SBWA 1QNJA 1GJ4H 3SUFA 1LHGH 1WQVH 3DUXH 2BD3A 1PPEE 2JH5D 2H1UA 1NO9H 4I8JA 1OSSA 2STAE 3K2UA 3PTNA 1PPBH 1F5LA 2F3CE 1GCDA 2VH0A 4X6MA 1P9SA 2P59A 4YLQH 4AORA 1AWFH 3H7TA 3PMJA 9LPRA 2XBYA 4KP0A 2VIDA 2I6SA 1SOTA 3TK6A 1C5UA 3MU1A 2BD9A 3RXVA 1YPHE 1AB9B 4Y8ZA 5FCRA 1TIOA 3VGCC 1Z1IA 1O3NA 1O3LA 2NWNA 4THNH 2ZA5A 4RKOB 1K1PA 4YOJA 2PSYA 4CRCA 1HAXB 3EDXB 1H9HE 2PTCE 1CBWC 3DFJA 3GDSA 1AVGH 2XRCA 1ESBA 4JK5A 1ID5H 2PGBB 1E0FD 3NUMA 4I8HA 5LPFA 1AE5A 4CH8B 4UFDH 1C4Y2 1FY8E 1TX6A 4CBNA 1UJ1A 3KCGH 5EQRA 3RP2A 4ZKNU 4MPUA 1LHCH 4ABAA 1DXPA 4IW4E 3E6PH 1AUTC 3PM3A 4I8KA 2B9LA 1RFNA 2G81E 1YM0A 4NG9H 5GCHG 1C1SA 1VCQA 1GMCF 4YOGA 4MPWA 3QUMP 3LGWA 3K6ZA 1DM4B 4X6PA 2D26C 3GICB 5E0JA 1HAPH 3UNSA 3RXHA 3ATIA 1GI6A 1EUFA 3P70B 2HALA 3STJA 3P92A 1O5EH 2BOHB 2Y7ZA 1S82A 1GBFA 1ANCA 4DIIH 1BDAA 4WH8A 2OINA 2XTTB 2XC4A 1MTVA 2AERH 2EI6A 1SGCA 1V2NT 3SI3H 2ZGBH 2P95A 1GBMA 3BIUH 5GWZA 1ZSKA 3DHKH 1WYKA 1UMAH 3BTTE 1LVYA 2ALPA 3M7TA 2PUXB 3TJUA 3GY4A 4K8BA 2BY6X 1AD8H 1NROH 1UTKA 1GMCG 2RCEA 3U8TH 5L30H 3V3MA 1TRMA 1DSUA 2PW8H 1NFUA 1YLCA 1TMUH 1P3EA 1EOJA 3SUEA 5TJXA 5JB9S 2SFAA 3TNSA 1D4PB 2Q6FA 4UFGH 2Z3DA 2ZHWH 3RXEA 3ATLA 1O3FA 1O5CB 2ZTXA 1FI8A 4MNYA 2ZPSA 4J2YB 2VWNA 2CN0H 3HATH 2KAIA 3K65B 1GVKB 1ZSLA 4D7FA 1O3HA 1XVMA 2QA9E 3BSQA 4XOJA 1CQQA 2WV5A 3NZIA 3VB7A 4AOQA 4U30A 4Y76A 3SNAA 1KXAA 2BHGA 1A3BH 4WY3A 5GPIB 2AMDA 2CHAB 2VGCC 3RXCA 1VITG 1GL1A 1TBRH 2TGPZ 3ZZ3A 1DUEA 4FU9A 4NIYA 1SC8U 1ELCA 1Y5AT 2HVXA 3RXMA 1TGTA 5I46H 2PV9B 1O5BB 3UWJH 3S9AA 2AGGX 2JKHA 5FHTA 1ZHPA 4JYVH 4X6NA 2ZFTA 2BDAA 1SGEE 3O8DA 3Q00A 4Q80A 1ANBA 1ZYOA 1C5MD 3R3GB 1FJSA 1FAKH 1LPGB 2SGEE 3NKKA 1BTYA 4ABJA 1QB6A 1IQKA 4ZKSU 3K6YA 3KIDU 5L2YH 1K1IA 2BOKA 3RM2H 3BTGE 1PQ5A 3E0PB 3MI4A 1TAWA 4B75A 2ZHDA 1S5SA 3JZ2B 5FBIA 1RJXB 1KXFA 3Q77A 4H6TA 4CRGA 1NM6A 3GCTG 2R3UA 3PWBA 1JMOH 2GCTC 2FWWA 1GGDC 4WJG2 1UTJA 1CGIE 4CBOA 4Q7ZA 2PR3A 2OBQA 3ZV9A 3PO1B 4UD9H 3CENA 1FPCH 2TGDA 3ZVFA 2BX4A 3ATKA 3TH2H 3LJJA 3GY7A 1EAXA 1GHVH 1T8OA 2QGRA 3KN2A 2AH4X 2UUYA 4F4OC 2ZC9H 1ABJH 4AG1A 1AVXA 1C4V2 3AW0A 3KEEA 3P95A 3UOUA 3NXPA 1Q3XA 4YT6H 4K60A 1CT0E 4JZEH 1DITH 1OWIA 1TBZH 4K1EA 4K1SA 1MAXA 2ZTYA 3Q3YA 4XBCA 1SLXB 1GMDG 3GCHB 1LVMA 1HNEE 2GKVE 4BAQB 4DVAU 1J16A 2BMGB 5DGJA 5EXMA 1CA0C 1HAGE 4D8NA 6GCHG 5DP9A 4BAOB 1H9LB 3SNDA 3F9GA 4Q2KA 2FTLE 1J17T 1TGCA 2W26A 5A8ZA 4WVPE 1XM1A 4NA7A 1TQ7B 1CHGA 4A1VA 5AF9H 1YKTA 2J95A 4VGCB 1C5NH 4X1SU 3P6ZB 3SJ9A 2FZZA 5ESBA 3HPTB 2FPZA 1G2LA 2A5KA 1V2ST 4XDEA 4U32A 1BZXE 1L4ZA 1V6DA 1RRKA 1V3XA 1V2VT 2XBXA 4HI3A 3DD2H 2Q6DA 2SGDE 2W7UA 1SOZA 1OYQA 5EQSA 5ESTE 4KELA 1QL8A 5DP5A 3ZVEA 2JH6D 1HAYB 1MH0A 2XXLA 2GP9B 1BITA 3N7OA 3QWCH 1FV9A 5CHAC 3P8FA 5DJ7A 4GPGA 2NU4E 1C5SA 1KDQA 1ACBE 9ESTA 1ZJDA 3BIVH 2GV7A 1EP5A 1BB0B 1AZ8A 3T5FH 3ZZ4A 1QCPA 2WPJS 3BEIB 1VJ9U 4JZ1A 1YLDA 3UIRA 1AZZA 2PWXA 1AQ7A 1RTLA 2G4UA 5A2MH 3KQDA 1UVTH 1FLEE 4X2YA 1MTSA 3ZYDA 3ODDA 2OC1A 1P8VC 1F5RA 1D6RA 4F49A 1MMJN 4H6SB 1AWHB 1LQDB 1G3EA 1ETSH 1TNHA 2O8MA 1A4WH 1HAVA 2BD4A 4E06H 1BBRE 2PGQB 4Y8YA 3BF6H 3RXIA 1NZQH 2WV4A 3U1JB 3QTOH 1N8OC 1NFYA 4ISOA 4ZXXH 5DP3A 1EOLA 2GX4A 1ZGVA 1SGFA 3FVFB 2QC2A 2WPIS 4BAMB 3A80A 1ELEE 2Q1JA 2BZAA 5F03A 3ZZDA 2A7JA 1TOMH 2ZECA 1BBRH 1YCPK 3PMHB 4ABEA 1O2PA 3CS7A 1HRTH 1HLTH 1BBRK 3P8OA 1TA6A 1GJBB 4H4FA 1L0ZA 1XUJA 2J2UA 2QXJA 2VWOA 1ANDA 3VEQB 1C1RA 4OS7A 1TPOA 4MNVA 2O8LA 4ZROA 4B76A 1V2JT 3MO6A 1MTNB 1NY22 1L1NA 1AN1E 1O2JA 1BTXA 1INCA 1O39A 2H5DA 3EQ0H 3MU4A 2R0LA 1XVOA 2ZTZA 4SGBE 3GY8A 4IN1A 5F6MA 1HIAB 1L1JA 3FP6E 4ZH8A 1ELFA 2OXSA 3DT0H 4UE7H 2C8YB 1IQHA 4JYUH 1GBHA 1GHYH 1DS2E 1QA7A 1AFQB 4XE4A 4WH6A 1SR5C 4XFQA 2A32A 3ZZ6A 1U6QA 4UFEH 1O2IA 2VIVA 1QJ1B 4X1QU 1GBCA 2A4GA 3A8BA 1TGSZ 1Z6EA 2HGTH 2ZI2H 1MZAA 1SHHB 4WF8A 2GCTB 3VXFH 1ELDE 3AVZA 4ISHH 1Y3VA 3M37A 1D6WA 1GL0E 1KTTB 1QJ7B 2XBWA 3A86A 3E91A 2H9TH 3ZV8A 4INLA 3V7TA 3KGPA 1ANEA 1Z1JA 1W7GH 2OQ5A 2B0FA 3IG6B 3SV9A 4R0IA 4ZHLU 4FUEA 5CMXH 1GBAA 1D9IA 3G01A 2ZDMA 3F9FA 3M7UA 1IQMA 3U1IB 5DG6A 3BTQE 4X8UH 4CHAC 3UPEA 3RMLH 1DICA 2FYQA 4RN6A 3AAVA 3SV8A 4FU8A 4KTUA 4FVDA 1O2TA 4INHA 1SMFE 1TA2A 3ELAH 1UCYK 1IQEA 3ZZ7A 3UTUH 1GI0A 1KXDA 1OWDA 1UVUH 1IQLA 2YNBA 1P03A 5DP4A 2AGIX 6CHAC 3E8LA 4X1NU 5DKMA 5AFZH 4OGXA 4NZLA 2W7SA 1WUNH 2EI7A 5GCHF 3SQEE 1PYTD 1BMMH 2TBSA 1LHDH 2ZIQH 3CP7A 5C20A 3A83A 2PUQH 1BJUA 3LIWA 5EW1H 1G32B 4JMYA 2ZO3H 3QLPH 1GDQA 4LZ1H 1P09A 4MQAA 1GMHF 3BTWE 2Q6GA 2P8OC 3UOPA 1ZTKA 4JYTA 5IYTA 1UHBB 4FU7A 1GHAG 2ESTE 4A1XA 2K1QA 1Z8GA 1TWXB 3SU6A 2RA0A 1TNJA 4NSYA 1G9IE 1DT2A 4DY7B 2AEIH 4UEHH 1VGCB 1GI3A 1K9OE 1DWCH 4Z0KA 4JZDH 2WPMS 6ESTA 2VWLA 1C9PA 1C5QA 2B5TB 1QHRB 2Y5HA 3PTBA 2JETB 2NU0E 4M7GA 3GY5A 3F9HA 1MCVA 1HCGA 5E2OA 4E7RG 2ZFRH 1F92A 4IGDA 4I32A 3GY6A 2H9EH 4K1TA 1GCTB 1LVOA 2G51A 3M5OA 3E0NB 2O8WA 3SU2A 1Y5UT 3FP8E 2GDEH 5C2ZA 3L6PA 1XUFA 2FODA 2XNIA 2GZ7A 2HNTF 4NIXA 3EYDA 1SI5H 1FY4A 1GMHG 3RXJA 1YPHC 3AW1A 5BPEA 1GHAF 1DY8A 3RLWH 3HKJB 1O2HA 2VIOA 1NU7B 3H7OA 1BHXB 1P2MA 1O31A 2C4FH 2PKAA 3OY6U 2TGTA 5JBCS 1YPKH 1NTPA 5DP8A 3TK5A 1NRNH 1O3PB 3ZZAA 1THRH 3UY9A 1F0RA 4X2VA 3SU4A 4BTUB 2ZFPH 2ZU1A 2FOMB 2NU3E 4MVNA 3MHWU 2BZ6H 1GI5A 4IMZA 1F0UA 1NFWA 2KAIB 2WUCA 7KMEH 3RU4T 2Z9KA 1XX9A 3TNTA 1GDNA 5EOKA 1C2KA 1C1VH 3RXBA 3LGYA 4NFFA 1QL9A 2F9UA 3PLPA 1AY6H 1EKBB 1DUAA 4UDWH 1ZHRA 3MTYA 1QGFA 1EZUC 3GISB 3ZVDA 1SLUB 5FBEA 2QF0A 2TGAA 4E7NA 4LK4A 1SB1H 2FEQH 3I77A 1S84A 1DPOA 4ISIH 1T8LA 4DGJA 3RXOA 1B0EA 4A6LA 5C3NA 2OC8A 1C5ZB 5C5OA 1J14A 3KQBA 3QDZB 1DLEA 2GCHG 3D62A 2ZNKH 2UWPA 1MQ6A 3TITA 1WU1A 4DJZB 1TRNA 5EPNA 2W5EA 4NCYA 2RDLA 1HXEH 1JRTA 1P9UA 2VB0A 4LZ4B 2BD5A 4ASHA 4TY6A 4X8SH 3E90B 2PKAB 4O97A 3SOSA 1TALA 3E1XB 3QO6A 1MCTA 3GY2A 4ZHMU 2G5VA 1MKWH 1IQGA 4GAWA 3ESTA 2J34A 1GJ7B 1FNIA 3OTJE 1BT7A 2UWLA 1G3DA 1QB1A 2QN5T 1XUGA 3S7KB 1DSTA 1WOFA 2Z7FE 3QGNB 1H8IH 3D65E 1C5LH 1QJ6B 1O2KA 2M5TA 2WYGA 5LH8A 2FO9A 2SNWA 4MPVA 1E34B 4NIWA 1ELVA 3JZ1B 2ZKSA 3ATWA 1MBMA 3A8CA 1TPPA 1IQIA 1P06A 4B1TA 2UUJB 2ODYB 3QX5H 2ZGJA 3HGPA 3SJ8A 2Z6BD 1KSNA 1KLTA 1LKBA 7ESTE 2ZDNA 1SG8B 1GBIA 2FOBA 2RA3A 1UCYH 1XXDA 1ELBA 1K21H 3OU0A 1SVPA 2FOAA 3F1SB 3EGKH 2F9VA 1C1MA 3TVJB 1FUJA 1SGIB 2VVUA 3SNEA 2AFQB 2ZDLA 4PROA 1A2CH 2PSXA 4Y7AA 3U98H 4GLYA 1A5HA 5A0AE 1GI7B 4A92A 2FIRH 3ZZ5A 4CR5A 5JBAS 1K1JA 2EC9H 1VCPA 4KTSA 4U01A 3A7YA 3L3TA 3BEUA 3A84A 4NIVA 4GHQA 3D49H 1N1LA 1VITH 1P0SH 3GY3A 4ZKOU 3E3TA 1E37B 1C2DA 1THSH 3GCOA 4FXGH 5JDUB 1JRSA 3MH7A 3MNSA 4RSPA 1ZZZA 3B9FH 3TJOA 2ZQ1A 1PPFE 1ZHMA 3UR9A 4DT7B 1NFXA 2W3KA 3SU0A 2CGAA 2A7HA 2ZHEH 5ETXA 4NA9H 2PKSC 2VWMA 1PQAA 1GPZA 4ISNA 3RXUA 4Y6DA 4CH2B 1RTFB 3F9EA 1T31A 1VR1H 2HRVA 1HFDA 2OD3B 5E2PA 4ISLA 4BANB 2H5CA 2GMTC 1LMWB 1HBTH 1EZXC 4MNWA 1OP8A 1PPZA 1QFKH 1GCTC 1T4UH 8ESTE 2Z9GA 1WAYB 1UVOA 1RGQA 3GYMA 1SGPE 1SL3A 2SNVA 2Z9IA 5A0BA 6LPRA 3W95A 1TGBA 2PTNA 1RTKA 3PB1E 1IHSH 2O8UA 2OUAA 1WQSA 3MYWA 1NPMA 1BRAA 2H2ZA 1T8NA 2G8TA 1AMHA 2STBE 5HMAA 5K7RA 5IDKA 1OWKA 4JK6A 4K8YA 3UREA 5AHGH 2P94A 2VJ1A 1QRWA 4GUXA 2PHBA 1AKSA 1ELAA 5DP6A 1DLKB 3RXFA 2ODQA 4X1RU 2BVSH 3KL6A 4FUBA 5F8XA 1CSOE 4A7IB 1AVWA 3P8GA 4AG2A 3RXSA 1LVBA 1OS8A 3UR6A 1ABIH 3GCHC 1O5AB 1ELTA 3BN9A 4MDSA 5T6DA 3SGBE 3SUDA 1C1NA 1MTNC 1WV7H 1NRQH 3BG8A 1C5PA 1LCYA 1XMNB 3SZNA 1S81A 1LDTT 4WMEA 3U69H 2BD8A 5FXLA 2PLXA 3BEFB 1QRXA 1RD3B 4IC5A 1CHOF 1TONA 3MNCA 1ZTLA 3SU1A 1DFPA 2J94A 1MD7A 5F8TA 1ZPZA 2P8OB 2ALVA 4FUDA 2BDHA 4IBLH 1FN6A 5L6NH 3H5CB 1K1MA 3PLBA 3T25A 4AB8A 1SQOA 3M5MA 3RC6A 3RXDA 1FN8A 3M3TA 3SN8A 1A7SA 4TPIZ 5EXNA 1UVPA 3LGVA 3B23B 1C2LA 3LGTA 3EA7A 1BTUA 2FDAA 2TIOA 5CE1A 2ZG0H 1Z7KA 3C1KA 1OOKB 1GJAB 2Z3CA 1JBUH 1AFEH 1EPTB 4ZKRU 1CT4E
chains in the Genus database with same CATH superfamily
5A0CA 1HYLA 1KXBA 1UO6A 2G55A 4X8TH 2QXGA 2GMTB 2F9BH 4B6EA 3KHVA 1HV7A 3A7VA 4FUFA 1LO6A 3CNRA 4GCHF 3SI4H 2HNTE 4R8TB 5E8EH 3RXRA 5L2ZH 2ANMH 3LONA 2BQ6B 4TY7A 2XWAA 1W13U 4NSVA 1P2OA 3QK1A 5BRRE 2R3YA 3SUGA 3PO1C 2QF3A 1F0SA 1SQAA 2XYAA 4XBBA 4A1TA 1MBQA 1GHZA 2BD2A 1P02A 4D9RA 1XKBC 1XUKA 2VIWA 1XKAC 3VPKA 1G3CA 1V2PT 3PV4A 1MQ5A 4OS4A 5AVDA 1LTOA 4K3JA 3FZZA 3ZZCA 4FUJA 2ZCKP 2GV6A 3Q3KA 1OWJA 3ENSB 4FOUC 1ZOMA 1LPZB 3FANA 4NGAH 1HAVB 3LPRA 2Y82A 1Z6JH 2BLVA 1D3QB 3RC5A 4IN2A 1C2FA 1DOJA 1ELGA 1O38A 2OQUA 1B7XB 1O2YA 2LPRA 2Z9LA 5C67A 1OXGA 1GJDB 2LNCA 3PROA 4TPYA 1F7ZA 1BMNH 1Z8IB 1G37A 1CBWB 1Z8JB 2BDBA 1OYTH 2ZF0H 2V3OH 4Q63A 5K0HA 1AFQC 2BDGA 1O2LA 3LC3A 2V3HH 1O3OA 1W0ZU 4AYVB 1W11U 2ODPA 1C2JA 2GTBA 3UWIA 1QZ8A 1HJAB 3VFEA 3O8BA 2WSSD 1C9TA 1V2QT 4AC9A 2G5NA 2ZU3A 5HM2A 3T28A 2EEKA 2FX4A 1UTQA 5CDFE 4U2WA 2BDYA 3BTHE 1A61H 1D3DB 3WWFA 4B71A 2V7QD 2VU8E 1Y8TA 3F6UH 2GVFA 2A0QB 3FKSD 2R9PA 5HXFA 1K1NA 2BDCA 3W1EA 3ZVCA 1PQ8A 1VKYA 2FOHA 1JIMA 2CF8H 4IC6A 2A2QH 2XW9A 4SGAE 2BD7A 1SGYE 1YPGH 1CGHA 1EATA 1L1GA 1NBMD 1O5GH 2ANYA 3LC5A 1Y5BT 1NRPH 3BTME 5FPTA 3TJVA 4B2BA 2BVXH 1YF4A 1ZLRA 2VVVA 3T62A 1HJ9A 3GDVA 1GG6C 1O2RA 1FY3A 4MG3A 1ESTA 3TGIE 3WWBA 2AHME 1GHWH 2H6MA 5T6GA 3URCA 2ZU4A 5DK1A 3SGAE 3MNBA 1SGRE 1T7CA 1ETTH 4AZ2B 3F68H 1O3AA 2OC7A 2VNTA 2J92A 2HWLB 1MZDA 1EPTC 3BTEE 1EXFA 3LDXH 5TCAA 1O2VA 2ZGHA 2OK5A 4AFZA 4FUCA 4D7GA 1ETRH 2ZPRA 4HTCH 5C1UA 1O2QA 1SGFG 1HPGA 4ABGA 3V13A 2F83A 1WBGB 5E0HA 2C8XB 5HM9A 2IPHA 2SGFE 3TH4H 1P10A 3U28C 1LHEH 2B7DH 1ARBA 1KXEA 2FOFA 4AGJA 1W0KD 2HLCA 1BQYA 1E1QD 1EJAA 4I33A 8GCHG 2BX3A 1NRSH 5CHBA 1YLNA 4X2WA 1B5GH 3BTKE 3LJOA 1NS3A 3M3SA 1K1OA 1LPKB 3M5LA 3UNRA 3U8RH 1P12E 1RS0A 2C3SA 3HK6B 3OE7D 3T29A 4YT7H 3LGUA 2BY7X 2QV1A 2ZFFH 2R2MB 5SGAE 1Z71A 2C8WB 3EE0B 1QQ4A 3RXLA 1EX3A 1EJNA 5I25A 1AIXH 4LXBH 1CGJE 1P2QA 2QCYA 3GCTF 1S83A 5C1XA 3A87A 1FXYA 4TSFD 5FCKA 2J4IA 3KNXA 5JBTA 4MNXA 3MU8A 4ABIA 1C5OH 1HUTH 1A5IA 1KLIH 2EA3A 2BB4A 2ZZUH 2BYAX 4FUIA 2FOEA 4HFPB 4CRDA 2WPHS 3SJOA 2WINI 4NWKA 4Y10E 1J9CH 2J97A 5JB8S 1EPTA 1GJ5H 2WPLS 4ACAA 4WMDA 3RMMH 4D9QA 1E1RD 2EY4C 2BLQA 1K1LA 1S0RA 1YPLH 1TOCB 2OCVB 1CE5A 1EFRD 2ANKH 3AASA 2FI3E 4ESTE 1O34A 1SHYA 1VZQH 4NWLA 4BNRA 3RXPA 1MKXK 3RMOH 3Q3XA 2GZ8A 1UK2A 4DURA 1C1QA 2C8ZB 1W3CA 1MKWK 3QTVH 1GJCB 1WTGH 3RXQA 2EI8A 3OEED 3VGCB 3CS0A 5LPRA 1QURH 4GHTA 2F9NA 1QBVH 3BG4B 3V0XA 3QGJA 3BTFE 3SJKA 2ZDAH 2CJIA 3O8CA 4O03A 2RG3A 3TH3H 2IJD1 1YCPH 1MTUA 1X7AC 3ODFA 1GI9B 1A0HB 1GMDF 2A2XH 1GDUA 2IOTA 4AFUA 1FZZA 3RMNH 3A89A 2XC5A 1W2KH 1SGQE 4JZFH 4K5ZA 4WXIA 1D3PB 1O3DA 1O2NA 5HYOA 3SV2H 3P8NA 4OS1A 1TPSA 1GJ6A 3GCNA 4HG6A 2DE9A 1E79D 2FX6A 1HDTH 2P3TB 1PPCE 1O3BA 3A85A 4OS5A 2BQ7B 3I78A 5DPAA 1ORFA 3M7QA 1BRUP 1H8DH 2A31A 4I7YH 1GBKA 1WTHD 5FAHA 1O5DH 5CHAB 2XNDD 1GHBF 1EAIA 3EAJA 3PRBA 1HAOH 2J9NA 2QYIA 1TFXA 3MU5A 1V2TT 3FP7E 3RXKA 4ASUD 1HJ8A 1THPB 1BHXF 2O8TA 1QL7A 1TBQH 2BTCE 3BTDE 1S6HA 4UONA 2P16A 1H1BA 1JXPA 3OYPA 1DXWA 3MFJA 2FLRH 3Q76A 4ZXYH 1Q31A 1ZGIA 1C5RA 2BDIA 1EB1H 4B2AA 2D1JA 1HAIH 1MD8A 1J15A 2ZWLH 1YC0A 2FS8A 2NU1E 4AB9A 1AUJA 2KFWA 1BUIA 4X6OA 4E05H 7GCHG 1O3MA 1JWTA 3TGJE 4B2CA 4Y79A 1P57B 1BRCE 4WXVA 5DO4H 1TLDA 1EP6A 3MMGA 3VB3A 1AHTH 6CHAB 5EIYA 4ABDA 1KIGH 1UK4A 1OPHB 1BRBE 2OP9A 3ZVAA 3SORA 4BAHB 1UTNA 1A5GH 4DG4A 1FDPA 2O9QA 1C1OA 2XCNA 5EODA 1C5XB 3HKIB 1W0JD 1BA8B 4IS5A 4TWWA 2ZHFH 1UVSH 3ZVGA 3AK5A 1C5VA 1HAHH 2CF9H 5C0UA 1GBEA 2PKSB 4AYYB 1GI1A 1Y3UA 4ACBA 1AO5A 1F5KU 4XRNA 3DA9B 3VB5A 3RU4E 4YO9A 2BLWA 3RXGA 1TPAE 3RLYH 1GVLA 1JOUB 1GJ9B 4X0WU 1L2EA 1TMBH 4J1YA 2P3FH 4Y7BA 1K28D 1CT2E 1PFXC 2GDDA 2YOLA 3A8DA 1M9UA 1HXFH 1N6YA 2UWOA 1V2KT 2A1DB 4K2YA 4YESB 4NA8A 1V2OT 1O33A 5HGGA 3SNCA 4WWYA 3TLOA 1BTHH 3NRLA 4LOYH 1IQFA 1IQNA 3LU9B 5EG4A 4CREA 2DUCA 1O3KA 2FXRA 1HIAA 2SGAA 2ZCLP 1VJAU 2XBVA 1EASA 3A81A 1AU8A 2FYRA 1DX5M 1QBNA 3HK3B 3M61U 1UK3A 3QZRA 1CO7E 1BTWA 1TX8A 1GJ8B 6GCHF 1TYNA 3GYLB 3OX7U 1EAUA 2CK3D 2AS9A 2R0KA 1UTMA 2QY0B 2G00A 1FONA 4DW2U 2Y5FA 4HGCA 1GWAA 1VCWA 4OS6A 4MLFB 3RXTA 2H9HA 5EW2H 5G4BA 1B0FA 4B73A 3A8AA 4JZIA 2FESH 3PV2A 5EU8A 2GD4B 1MAYA 1PQ7A 3PYHA 1N6XA 3S7HB 1TMTH 3MH6A 1TE0A 2D8WA 3FN8A 4Y0YE 4AX9H 2GZ9A 2BXUH 4NZQA 3NCLA 2WPKS 4GVUA 2G4TA 3SU5A 1CA8B 1VGCC 1YGCH 3D23A 4Y71A 1KYNA 3H09A 4YLUA 1TB6H 1ZSJA 3A7XA 1FAXA 2A5AA 3UNQA 3SO3A 2QIQA 2CXVA 1S85A 5EJZA 3S69A 4H42U 1EQ9A 1FY5A 2BY5X 5A8YA 1O5FH 5PTPA 1OHHD 1CVWH 1EZQA 1SFIA 2XCFA 1YPMH 2AIQA 1XXFA 1BTZA 4YM9A 3LH3A 2SGQE 3UQVA 1FMGA 3M3VA 4Y11E 4Q7YA 1O3JA 3PMAB 4X1PU 1PPGE 4A5TS 1QBOA 1QA0A 1C2EA 2ZGCA 2ZPQA 2BXTH 5JYIA 2C93B 3LOXA 1W10U 3SU3A 2WPDD 3R0FA 1MKXH 2G52A 7LPRA 1K22H 2W6JD 2FP7B 1XUHA 1GGDB 1BJVA 1ZPBA 4HZHA 5JBBS 2Y6TA 4ABFA 1QQUA 2NU2E 2HPQH 2YMSB 1P01A 1SLWB 2FOGA 5E0GA 3S9BA 2Z3EA 1P2KA 3ZZ9A 5HIZA 4GCHG 3TGKE 4O3TA 4IMQA 1Y3XA 4OS2A 2HOBA 4AFQA 2OBOA 2ZFQH 1O30A 3STIA 4YOIA 2L6OA 1GI2A 3W94A 2HPPH 2BY8X 3PMBB 1Q2WA 1WCZA 5GDSH 1NN6A 1ZRBA 1BMLA 1ESAA 3IITA 4INKA 2GGVB 1BIOA 1KLJH 3C27B 4Q4LA 5A09A 4FUHA 3BV9B 2BM2A 2JH0D 2FLBH 1KXCA 1KY9A 1GBDA 2ZHQH 5T3HA 1MTWA 2CMYA 1UTOA 5ABWA 1DVAH 3SHAH 3MH4A 5JPMH 1C4U2 1T4VH 3V12A 4MTBA 4DIHH 2FTMA 3EA9A 3SBKA 1DANH 3U9AH 1O3IA 1EJMA 3SHCH 3PWCA 4VGCC 1VITF 3I29A 1C5TA 1P11E 5FX5A 3TU7H 3MO3A 1QY6A 2R2WU 1C1TA 1D3TB 2SGPE 2LELA 2J38A 3S0NA 1GI8B 1S6LA 5TCCA 3QZQA 1F2SE 1LHFH 1P3CA 3NWUA 1CA0B 1S6FA 2Y80A 1NRRH 3KF2A 4UFFH 5B6OA 1O2ZA 2VH6A 1GHXH 5F8ZA 5C5NA 1A0JA 2WYJA 1BOQA 1O3GA 5FX6A 1E38B 3M36A 1ZPCA 4CR9A 1AGJA 3QN7A 2ASUB 1TQ0B 3VB6A 1G30B 4BTIB 1SGNE 3GDUA 1SFQB 2Y7XA 3BG4C 4ZAEA 3SYJA 1IQJA 4AGKA 1O32A 2AGEX 1V2WT 2ZDVH 1RIWC 2A7CA 4Z1MD 2P3UB 3NPSA 2QXIA 2XWBI 2ZP0H 1N8OB 5FPYA 5HKKD 3LGIA 3A82A 4BXSA 1O3EA 1DY9A 2EQNA 2V6NA 2XC0A 4KGAA 1DWDH 2W3IA 4CRBA 1FPHH 1BTPA 2ZU2A 3TJNA 1ZMJA 3A7TA 1O2WA 3SW2B 2GCHF 5GIBA 3GOVB 2FOCA 1V2LT 1FQ3A 1Y3YA 2AMQA 2VIPA 3T2NA 2Z9JA 3P17H 5EQQA 5A8XA 5H4IB 2VIQA 2WHXA 1DDJA 3MO9A 1GBBA 1OP2A 1TNKA 1C2GA 1TNLA 3SV7A 1SPJA 1ZR0A 1AI8H 1BMAA 3FZDA 1EZSC 2FMJA 4RKJB 1RXPA 3RUOA 2F9PA 1G36A 1IOEA 2A4QA 1IHTH 2F9OA 3FOAA 1W8BH 1P05A 2TPIZ 4BOHA 1QB9A 2FM2A 1LQEA 3FFGA 3T26A 1MUEB 4P00A 1P2JA 2ILNA 1O35A 8KME2 1GBJA 1YYY1 5GJ4B 4CRAA 4NFEA 5FPSA 1O2XA 5GXPA 1EB2A 1MU8B 2A4OA 3K9XB 1ZRKA 3RDZA 3ZVBA 3MU0A 2F91A 4D76A 2DE8A 1NC6A 2ULLA 3MWIU 1NT1A 4X8VH 2A45B 1LKAA 5C1YA 2ZGXH 4XBDA 1SLVB 3NK8A 5HIYA 2IPQX 1HAZB 1O2OA 4K69A 2BY9X 2AYWA 3OFND 1UTPA 2FS9A 1FIWA 4OM9A 4CRFA 3EA8A 2C90B 2JETC 1L4DA 1SSXA 1ZTJA 1O2GH 1O37A 3A88A 4Y8XA 1YPJH 1ARCA 4ZMAH 2FI4E 3RU4D 1W0YH 4BAKB 1P2IA 1UW7A 1NU9A 3ATMA 1C1UH 3S9CA 2WUBA 4WMFA 3OY5U 1PJPA 1TNGA 4Y0ZE 2B8OH 2Z94A 3RM0H 4O9VA 2V35A 1YP9A 1OP0A 1AKSB 1P04A 3IWMA 1E35B 2F43B 3ZZ8A 8LPRA 1E36B 1O2SA 3LKWA 1WSSH 3PLKA 5DP7A 1SGTA 1TGNA 2D2DA 4I31A 5LGOA 4KTCA 3VB4A 4AN7A 1FY1A 1J8AA 2ZCHP 4ABHA 3DFLA 5IK2D 1Z8RA 1KTSB 1C5WB 2A4RA 5F53A 1GBTA 4CHAB 1BCUH 3UUZA 1G2MA 1UCYE 2Y81A 5AFYH 3URDA 1SQRA 4XSKU 1F0TA 3KQEA 1UTLM 2ZDKA 1O2MA 1GHBG 4F55A 1P2NA 3UQOA 2ANWA 1OX1A 2QE7D 1V2RT 4TYDA 3VXEH 1RIWB 2YNAA 3OSYA 1SQTA 1QRZA 2OLGA 1C1PA 1K2I1 1S0QA 2ZFSA 2VINA 3F0PA 1TNIA 2TRMA 3SJIA 4BTTB 1MU6B 3T27A 2UUKB 3L33A 2AIPA 4OGYA 3B8JA 1TRYA 4Z6AH 3ITIA 2A5IA 1O2UA 1PPHE 1KDQB 2QAAA 1H9IE 1YCPM 8GCHF 1C2MA 3MH5A 2FI5E 4MPXA 5J4SA 4DCDA 3UFAA 3LH1A 4GSOA 1Y59T 4TWYA 1G3BA 1QTFA 2Y5GA 3TIUA 1OWHA 5J4QA 4AFSA 1W14U 3HGNA 1QIXB 3RXAA 1DWBH 4ABBA 2PFEA 3WY8A 1QR3E 1W12U 2OC0A 3DSGA 1CU1A 2IN2A 4XD7D 4YZUA 1ZMNA 2ZEBA 3KQCA 1AB9C 3M35A 3SGQE 5T6FA 3U8OH 2BLOA 3AAUA 4X2XA 4KKDA 1TABE 1A3EH 3A7ZA 2HLDD 2HNTC 2ZQ2A 4DOQA 1O36A 1PYTC 1UHBA 1SGDE 7GCHF 1IAUA 3TPIZ 2KX4A 1YBWA 1V2UT 2CHAC 2VGCB 1CHOG 2K0QA 4RT1A 1TX7A 4B74A 1W7XH 5EPYA 2K8IA 2V0BA 1A1RA 2JJ1D 3RC4A 1AE8H 2THFB 1A0LA 3FAOA 4JCNA 1GBLA 3MOCA 1T8MA 1C2IA 1Y3WA 3MNXA 1ZJKA 4FVBA 3ZZBA 1V2MT 1O0DH 4Q7XA 4YXWD 1DE7H 4QT8C 4BXWA 5LPEA 1NESE 4O3UA 2YMSD 3F0OA 2BQWB 3A7WA 4DT4A 1XUIA 3M5NA 4YTAA 1ZMLA 2OTVA 1JIRA 1OKXA 2QXHA 5EGMA 2BVRH 3N99A 2P93A 1O3CA 2KM0A 3O8RA 1C2HA 1C1WH 3ZYEA 1GI4A 2AMPA 1GVZA 1DWEH 1FIZA 3SQHE 2GT7A 1YPEH 2ZU5A 3LT3A 3PV5A 3SNBA 3F2FA 2VVCA 1EAWA 4ZUHA 3SV6A 1C5YB 1HGTH 1H4WA 1HB0B 4ZHAA 2GT8A 1GG6B 5EXLA 1T32A 3TK9A 4I8GA 2KCOA 2UUFB 3E16B 4I8LA 1H8ED 1OWEA 2I6QA 1HJAC 4FUGA 1A46H 3OAAD 2IJOB 5EJLA 2CV3A 1SBWA 1QNJA 1GJ4H 3SUFA 4FETA 1LHGH 1WQVH 3DUXH 2BD3A 1PPEE 4M9FA 5GNDA 2JH5D 2H1UA 2KZ4A 1NO9H 4I8JA 1OSSA 2STAE 3K2UA 3PTNA 5C17A 1PPBH 1F5LA 2F3CE 1GCDA 1BMFD 2VH0A 4X6MA 1P9SA 2P59A 4YLQH 4AORA 1AWFH 3H7TA 3PMJA 9LPRA 2XBYA 4KP0A 2VIDA 2I6SA 1SOTA 3TK6A 1C5UA 3MU1A 2BD9A 3RXVA 1YPHE 1AB9B 4Y8ZA 5FCRA 1TIOA 3VGCC 1Z1IA 1O3NA 1O3LA 2NWNA 4THNH 2ZA5A 2JDID 1K1PA 4RKOB 4YOJA 2PSYA 4CRCA 1HAXB 3EDXB 1H9HE 2PTCE 1CBWC 3DFJA 3GDSA 1AVGH 2XRCA 1ESBA 4JK5A 1ID5H 2PGBB 1E0FD 3NUMA 4I8HA 5LPFA 1AE5A 4CH8B 4I86A 3KYGA 4UFDH 1C4Y2 1FY8E 1TX6A 4CBNA 1UJ1A 3KCGH 5EQRA 3RP2A 4ZKNU 4MPUA 1LHCH 4ABAA 1DXPA 4IW4E 3E6PH 1AUTC 3PM3A 4I8KA 2B9LA 1RFNA 2G81E 1YM0A 4NG9H 2L74A 1C1SA 1VCQA 5GCHG 1GMCF 4YOGA 4MPWA 3QUMP 3LGWA 3K6ZA 1DM4B 4X6PA 2D26C 3GICB 5E0JA 1HAPH 3UNSA 3RXHA 3ATIA 1GI6A 1EUFA 3P70B 2QF5A 2HALA 3N7DA 3STJA 3P92A 1O5EH 2BOHB 2Y7ZA 1S82A 1GBFA 1ANCA 4DIIH 1BDAA 4WH8A 2OINA 2XTTB 2XC4A 1MTVA 2AERH 2EI6A 1SGCA 1V2NT 3SI3H 3WW7A 2ZGBH 2P95A 3SZEA 1GBMA 3BIUH 5GWZA 3KQ5A 1ZSKA 3DHKH 5DSFA 1WYKA 1UMAH 3BTTE 1LVYA 2ALPA 3M7TA 2PUXB 3TJUA 3GY4A 4K8BA 2BY6X 1AD8H 1NROH 1UTKA 1GMCG 2RCEA 3U8TH 5KECA 3V3MA 5L30H 3OEHD 1TRMA 1DSUA 2PW8H 1NFUA 1YLCA 2RFKC 1TMUH 1P3EA 1EOJA 3SUEA 5TJXA 5JB9S 3KYFA 5KGOA 2SFAA 3TNSA 1D4PB 2Q6FA 4UFGH 2Z3DA 2ZHWH 2KCPA 3RXEA 3ATLA 1O3FA 1O5CB 2ZTXA 1FI8A 4MNYA 2ZPSA 4J2YB 2VWNA 2CN0H 3HATH 2KAIA 3K65B 1GVKB 1ZSLA 4D7FA 1O3HA 1XVMA 2QA9E 3BSQA 4XOJA 3PRDA 1CQQA 2WV5A 3NZIA 3VB7A 4AOQA 1WDIA 4U30A 4Y76A 3SNAA 1KXAA 2BHGA 1A3BH 4WY3A 5GPIB 2AMDA 2CHAB 2VGCC 3RXCA 1VITG 1GL1A 1TBRH 2TGPZ 3ZZ3A 3EE7A 1DUEA 4FU9A 4NIYA 1SC8U 1ELCA 1Y5AT 2HVXA 3RXMA 1TGTA 5I46H 2PV9B 1O5BB 3UWJH 3S9AA 2AGGX 2JKHA 4P02A 5FHTA 1ZHPA 4JYVH 2QF4A 4X6NA 2ZFTA 2BDAA 1SGEE 3O8DA 3Q00A 4Q80A 1ANBA 1ZYOA 1C5MD 5FL7D 3R3GB 1FJSA 1FAKH 1LPGB 2SGEE 3NKKA 1BTYA 4ABJA 1QB6A 1IQKA 4ZKSU 3K6YA 3KIDU 5L2YH 1K1IA 2BOKA 3RM2H 3BTGE 1PQ5A 3E0PB 3MI4A 1TAWA 4B75A 4ZCNA 2ZHDA 1S5SA 3JZ2B 5FBIA 1RJXB 1KXFA 3Q77A 4H6TA 4CRGA 1NM6A 3GCTG 2R3UA 3PWBA 1JMOH 2GCTC 2FWWA 1GGDC 4WJG2 1UTJA 1CGIE 4CBOA 4Q7ZA 2PR3A 2OBQA 3ZV9A 3PO1B 4UD9H 3CENA 1FPCH 2TGDA 3ZVFA 2BX4A 3ATKA 3TH2H 3LJJA 3GY7A 1EAXA 1GHVH 1T8OA 2QGRA 3KN2A 2AH4X 2UUYA 4F4OC 2ZC9H 1ABJH 4AG1A 1AVXA 1C4V2 3AW0A 3KEEA 3P95A 5T1VA 3UOUA 3NXPA 1Q3XA 4YT6H 4K60A 1CT0E 4JZEH 2YMSC 1DITH 1OWIA 1TBZH 4K1EA 4K1SA 1MAXA 2ZTYA 3Q3YA 4XBCA 1SLXB 1GMDG 3GCHB 1LVMA 1HNEE 2GKVE 4BAQB 4DVAU 1J16A 2BMGB 5DGJA 5EXMA 1CA0C 1HAGE 4D8NA 6GCHG 5DP9A 4BAOB 1H9LB 3SNDA 3F9GA 4Q2KA 2FTLE 1J17T 1TGCA 2W26A 5A8ZA 4WVPE 1XM1A 4NA7A 1TQ7B 1CHGA 4A1VA 5AF9H 1YKTA 2J95A 4VGCB 1C5NH 4X1SU 3P6ZB 3SJ9A 2FZZA 5ESBA 3HPTB 2FPZA 1G2LA 2A5KA 1V2ST 4XDEA 4U32A 1BZXE 1L4ZA 1V6DA 1RRKA 1V3XA 1V2VT 2XBXA 4HI3A 3DD2H 2Q6DA 2SGDE 2W7UA 1SOZA 1OYQA 5EQSA 5ESTE 4KELA 1QL8A 5DP5A 3ZVEA 2JH6D 1HAYB 1MH0A 1FX0B 2XXLA 2GP9B 1BITA 1WXRA 3N7OA 3QWCH 1FV9A 5CHAC 3P8FA 5DJ7A 4GPGA 2NU4E 1C5SA 1KDQA 1ACBE 9ESTA 1ZJDA 3BIVH 2GV7A 1EP5A 1BB0B 1AZ8A 3T5FH 3ZZ4A 1QCPA 2WPJS 3BEIB 1VJ9U 4JZ1A 1YLDA 3UIRA 1AZZA 2PWXA 1AQ7A 1RTLA 2G4UA 5A2MH 3KQDA 1UVTH 1FLEE 4X2YA 1MTSA 3ZYDA 1SKYE 2LP6A 3ODDA 2OC1A 1P8VC 1F5RA 1D6RA 4F49A 1MMJN 4H6SB 1AWHB 1LQDB 1G3EA 1ETSH 1TNHA 2O8MA 1A4WH 1HAVA 2BD4A 4E06H 1BBRE 2PGQB 4Y8YA 3BF6H 3F2HA 3RXIA 1NZQH 2WV4A 3U1JB 3QTOH 1N8OC 1NFYA 4ISOA 4ZXXH 5DP3A 1EOLA 2GX4A 1ZGVA 3VG8A 1SGFA 3FVFB 2QC2A 2WPIS 4BAMB 3A80A 1ELEE 2Q1JA 2BZAA 5F03A 3ZZDA 2A7JA 1TOMH 2ZECA 1BBRH 1YCPK 3PMHB 4ABEA 1O2PA 3CS7A 1HRTH 1HLTH 1BBRK 3P8OA 3DSPA 1TA6A 1GJBB 4H4FA 1L0ZA 1XUJA 2J2UA 2QXJA 2VWOA 1ANDA 3N7EA 3UB0A 1C1RA 3VEQB 4OS7A 1TPOA 4MNVA 2O8LA 4ZROA 4B76A 1V2JT 3MO6A 1MTNB 1NY22 1YWUA 1L1NA 1AN1E 1O2JA 1BTXA 1INCA 1O39A 2H5DA 3EQ0H 3MU4A 2R0LA 3DSOA 1XVOA 2ZTZA 4SGBE 5C0TA 3GY8A 4IN1A 5F6MA 1HIAB 1L1JA 1MABB 3FP6E 4ZH8A 1ELFA 2OXSA 3DT0H 4UE7H 2C8YB 1IQHA 4JYUH 1GBHA 1GHYH 1DS2E 1QA7A 1AFQB 4XE4A 4WH6A 1SR5C 4XFQA 2A32A 3ZZ6A 1U6QA 4UFEH 1O2IA 2VIVA 1QJ1B 4X1QU 1NBME 1GBCA 2A4GA 3GS9A 3A8BA 1TGSZ 1Z6EA 2HGTH 2ZI2H 1MZAA 1SHHB 4WF8A 2GCTB 3VXFH 1ELDE 1H8HD 3AVZA 4ISHH 1Y3VA 3M37A 1D6WA 1GL0E 1KTTB 1QJ7B 2XBWA 3A86A 3E91A 2H9TH 3ZV8A 4INLA 3V7TA 4F48B 3KGPA 1ANEA 1Z1JA 1W7GH 2OQ5A 2B0FA 3IG6B 4RI0A 5C94A 2JJ2D 3SV9A 4R0IA 4ZHLU 4FUEA 5CMXH 1GBAA 1D9IA 3G01A 2ZDMA 3F9FA 3M7UA 1IQMA 3U1IB 5DG6A 3BTQE 4X8UH 4CHAC 3UPEA 3RMLH 5B6LA 1DICA 2FYQA 4RN6A 3AAVA 3SV8A 4FU8A 4KTUA 4FVDA 1O2TA 4INHA 1SMFE 1TA2A 3ELAH 1UCYK 1IQEA 3ZZ7A 3UTUH 1GI0A 1KXDA 1OWDA 1UVUH 1IQLA 2YNBA 1P03A 5DP4A 2AGIX 6CHAC 3E8LA 4X1NU 5DKMA 5AFZH 4OGXA 4NZLA 2W7SA 1WUNH 2EI7A 5GCHF 3SQEE 1PYTD 1BMMH 2TBSA 1LHDH 2ZIQH 3CP7A 5C20A 2GJGA 3A83A 2PUQH 1BJUA 3LIWA 5EW1H 1G32B 4JMYA 2ZO3H 3QLPH 1GDQA 2M2AA 4LZ1H 1P09A 4MQAA 1GMHF 3BTWE 2Q6GA 2P8OC 3UOPA 1ZTKA 4JYTA 5IYTA 1UHBB 4FU7A 1GHAG 2ESTE 4A1XA 2K1QA 1Z8GA 1TWXB 3DCLA 3SU6A 2KCAA 2RA0A 1TNJA 4NSYA 1G9IE 1DT2A 4DY7B 2AEIH 4UEHH 1VGCB 1GI3A 1K9OE 1DWCH 4Z0KA 4JZDH 2WPMS 2WV9A 6ESTA 2VWLA 1C9PA 1C5QA 2B5TB 1QHRB 2Y5HA 3PTBA 2JETB 2NU0E 4M7GA 3GY5A 3F9HA 1MCVA 1HCGA 5E2OA 4E7RG 2ZFRH 1F92A 4IGDA 4I32A 3GY6A 4RT0A 2H9EH 4K1TA 1GCTB 1LVOA 2G51A 3M5OA 3E0NB 2O8WA 3SU2A 1Y5UT 3FP8E 2GDEH 5C2ZA 3L6PA 1XUFA 2FODA 2XNIA 2GZ7A 2HNTF 4NIXA 3EYDA 1SI5H 1FY4A 1GMHG 3RXJA 1YPHC 3AW1A 2F4LA 5BPEA 1GHAF 1DY8A 3RLWH 3HKJB 1O2HA 2VIOA 1NU7B 3H7OA 1BHXB 1P2MA 1O31A 2C4FH 2PKAA 3OY6U 2TGTA 5JBCS 1YPKH 1NTPA 5DP8A 3TK5A 1NRNH 2V3MA 1O3PB 3ZZAA 1THRH 3UY9A 1F0RA 4X2VA 3SU4A 4BTUB 2ZFPH 2ZU1A 2FOMB 2NU3E 4MVNA 3MHWU 2BZ6H 1GI5A 4IMZA 1F0UA 1NFWA 2KAIB 2WUCA 7KMEH 3RU4T 1YY3A 2Z9KA 1XX9A 3TNTA 1GDNA 5EOKA 1C2KA 1C1VH 3RXBA 3LGYA 4NFFA 1QL9A 2F9UA 2KR7A 3PLPA 1AY6H 1EKBB 1DUAA 4UDWH 1ZHRA 3MTYA 1QGFA 1EZUC 3GISB 2J98B 3ZVDA 1SLUB 5FBEA 2QF0A 2TGAA 4E7NA 4LK4A 1SB1H 2FEQH 3I77A 1S84A 1DPOA 4ISIH 1T8LA 4DGJA 3RXOA 1B0EA 4A6LA 5C3NA 2OC8A 1C5ZB 5C5OA 1J14A 3KQBA 3QDZB 1DLEA 2GCHG 3D62A 2ZNKH 2UWPA 1MQ6A 3TITA 1WU1A 4DJZB 1TRNA 5EPNA 2W5EA 4NCYA 2RDLA 1HXEH 1JRTA 1P9UA 2VB0A 4LZ4B 2BD5A 2J5UA 4ASHA 4TY6A 4X8SH 3E90B 3MQKC 2PKAB 4O97A 3SOSA 1TALA 3E1XB 3QO6A 1MCTA 3GY2A 4ZHMU 2G5VA 1MKWH 1IQGA 4GAWA 3ESTA 2J34A 1GJ7B 1FNIA 3OTJE 2J98A 1BT7A 2UWLA 1G3DA 1QB1A 2QN5T 1XUGA 3S7KB 1DSTA 1WOFA 2Z7FE 3QGNB 1H8IH 3D65E 1C5LH 1QJ6B 1O2KA 2M5TA 2WYGA 5LH8A 2FO9A 2SNWA 4MPVA 1E34B 5EJ1A 2VBCA 4NIWA 1ELVA 3JZ1B 2ZKSA 3ATWA 1MBMA 3A8CA 1TPPA 1IQIA 1P06A 4B1TA 2UUJB 2ODYB 3QX5H 2ZGJA 3HGPA 2HVYB 2WZQA 2Z6BD 3SJ8A 1KSNA 1KLTA 1LKBA 7ESTE 2ZDNA 1SG8B 1GBIA 2FOBA 2RA3A 1UCYH 1XXDA 1ELBA 1K21H 3OU0A 1SVPA 2FOAA 3F1SB 3EGKH 1COWD 2F9VA 1C1MA 3TVJB 1FUJA 1SGIB 2VVUA 3SNEA 2AFQB 2ZDLA 4PROA 1A2CH 2PSXA 4Y7AA 3U98H 4GLYA 1A5HA 5A0AE 1GI7B 4A92A 2FIRH 3ZZ5A 4CR5A 5JBAS 1K1JA 2EC9H 2JIZD 1VCPA 2RDEA 4KTSA 4U01A 3A7YA 3L3TA 1KMHB 3BEUA 3A84A 4NIVA 4GHQA 3D49H 1N1LA 1VITH 3F2GA 1P0SH 3GY3A 4ZKOU 3E3TA 1E37B 2W6ID 1C2DA 1THSH 3GCOA 4FXGH 5JDUB 1JRSA 3MH7A 3MNSA 4RSPA 1ZZZA 3B9FH 3TJOA 2ZQ1A 1PPFE 1ZHMA 3UR9A 4TT3D 4DT7B 1NFXA 2W3KA 3SU0A 2CGAA 2A7HA 2ZHEH 5ETXA 4NA9H 2PKSC 2VWMA 1PQAA 1GPZA 4ISNA 3RXUA 4Y6DA 4CH2B 1RTFB 3F9EA 2PP6A 3F3BA 1T31A 1VR1H 2HRVA 1HFDA 2OD3B 5E2PA 4ISLA 4BANB 2H5CA 2GMTC 1LMWB 1HBTH 1EZXC 4MNWA 1OP8A 1PPZA 1QFKH 1GCTC 1T4UH 8ESTE 2Z9GA 1WAYB 1UVOA 1RGQA 3GYMA 1SGPE 1SL3A 2SNVA 2Z9IA 5A0BA 6LPRA 3W95A 1TGBA 5KEDA 2PTNA 1RTKA 3PB1E 1IHSH 2O8UA 2OUAA 1WQSA 3MYWA 1NPMA 1BRAA 2H2ZA 1T8NA 2G8TA 1AMHA 2STBE 5HMAA 5K7RA 5IDKA 1OWKA 4JK6A 4K8YA 3UREA 5AHGH 2P94A 2VJ1A 1QRWA 4GUXA 2PHBA 1AKSA 1ELAA 5DP6A 4B6FA 1DLKB 3RXFA 2ODQA 4X1RU 2BVSH 3KL6A 4FUBA 5F8XA 1CSOE 4A7IB 1AVWA 3P8GA 4AG2A 3RXSA 1LVBA 1OS8A 3UR6A 3UAIC 1ABIH 3GCHC 1O5AB 1ELTA 3BN9A 4MDSA 5T6DA 3SGBE 3SUDA 1C1NA 1MTNC 1WV7H 1NRQH 3BG8A 1C5PA 1LCYA 1XMNB 3SZNA 1S81A 1LDTT 4WMEA 3U69H 2BD8A 5FXLA 2PLXA 3BEFB 1QRXA 5DN6D 1RD3B 4IC5A 1K0HA 3OTPA 1CHOF 1TONA 3MNCA 1ZTLA 3SU1A 1DFPA 2J94A 1MD7A 5F8TA 3ZIAD 1ZPZA 2P8OB 2ALVA 4FUDA 2BDHA 4IBLH 1FN6A 5L6NH 3H5CB 1K1MA 3PLBA 3T25A 4AB8A 1SQOA 3M5MA 3RC6A 3RXDA 1FN8A 3M3TA 3SN8A 1A7SA 4TPIZ 5EXNA 1UVPA 3LGVA 3B23B 1C2LA 2XOKD 3LGTA 3EA7A 1BTUA 2FDAA 2TIOA 5CE1A 2ZG0H 3FO8D 1Z7KA 3C1KA 1OOKB 1GJAB 2Z3CA 2KCYA 1JBUH 1AFEH 1EPTB 4ZKRU 1CT4E
chains in the Genus database with same CATH topology
5A0CA 1HYLA 1KXBA 1UO6A 2G55A 4X8TH 2QXGA 2GMTB 2F9BH 3KHVA 1HV7A 3A7VA 4FUFA 1LO6A 4GCHF 3SI4H 2HNTE 4R8TB 5E8EH 3RXRA 5L2ZH 2ANMH 3LONA 2BQ6B 4TY7A 2XWAA 1W13U 4NSVA 1P2OA 3QK1A 5BRRE 2R3YA 3SUGA 3PO1C 2QF3A 1F0SA 1SQAA 2XYAA 4XBBA 4A1TA 1MBQA 1GHZA 2BD2A 1P02A 4D9RA 1XKBC 1XUKA 2VIWA 1XKAC 3VPKA 1G3CA 1V2PT 3PV4A 1MQ5A 4OS4A 5AVDA 1LTOA 4K3JA 3FZZA 3ZZCA 4FUJA 2ZCKP 2GV6A 3Q3KA 1OWJA 3ENSB 1ZOMA 1LPZB 3FANA 4NGAH 1HAVB 3LPRA 2Y82A 1Z6JH 2BLVA 1D3QB 3RC5A 4IN2A 1C2FA 1DOJA 1ELGA 1O38A 2OQUA 1B7XB 1O2YA 2LPRA 2Z9LA 5C67A 1OXGA 1GJDB 2LNCA 3PROA 4TPYA 1F7ZA 1BMNH 1Z8IB 1G37A 1CBWB 1Z8JB 2BDBA 1OYTH 2ZF0H 2V3OH 5K0HA 1AFQC 2BDGA 1O2LA 3LC3A 2V3HH 1O3OA 1W0ZU 4AYVB 1W11U 2ODPA 1C2JA 2GTBA 3UWIA 1HJAB 3VFEA 3O8BA 1C9TA 1V2QT 2G5NA 2ZU3A 5HM2A 3T28A 2EEKA 2FX4A 1UTQA 4U2WA 2BDYA 3BTHE 1A61H 1D3DB 4B71A 2VU8E 1Y8TA 3F6UH 2GVFA 2A0QB 2R9PA 5HXFA 1K1NA 2BDCA 3ZVCA 1PQ8A 2FOHA 1JIMA 2CF8H 4IC6A 2A2QH 2XW9A 4SGAE 2BD7A 1SGYE 1YPGH 1CGHA 1EATA 1L1GA 1O5GH 2ANYA 5FPTA 3LC5A 1Y5BT 1NRPH 3BTME 3TJVA 4B2BA 2BVXH 1YF4A 1ZLRA 2VVVA 3T62A 1HJ9A 3GDVA 1GG6C 1O2RA 1FY3A 4MG3A 1ESTA 3TGIE 1GHWH 2H6MA 5T6GA 3URCA 2ZU4A 5DK1A 3SGAE 3MNBA 1SGRE 1T7CA 1ETTH 4AZ2B 3F68H 1O3AA 2OC7A 2VNTA 2J92A 2HWLB 1MZDA 1EPTC 3BTEE 1EXFA 3LDXH 5TCAA 1O2VA 2ZGHA 4AFZA 4FUCA 4D7GA 1ETRH 2ZPRA 4HTCH 5C1UA 1O2QA 1SGFG 1HPGA 4ABGA 3V13A 2F83A 1WBGB 5E0HA 2C8XB 5HM9A 2IPHA 2SGFE 3TH4H 1P10A 1LHEH 2B7DH 1ARBA 1KXEA 2FOFA 4AGJA 2HLCA 1BQYA 1EJAA 4I33A 8GCHG 2BX3A 1NRSH 4X2WA 1B5GH 3BTKE 3LJOA 1NS3A 3M3SA 1K1OA 1LPKB 3M5LA 3UNRA 3U8RH 1P12E 1RS0A 2C3SA 3HK6B 3T29A 4YT7H 3LGUA 2BY7X 2QV1A 2ZFFH 2R2MB 5SGAE 1Z71A 2C8WB 3EE0B 1QQ4A 3RXLA 1EX3A 1EJNA 5I25A 1AIXH 4LXBH 1CGJE 1P2QA 2QCYA 3GCTF 1S83A 5C1XA 3A87A 1FXYA 5FCKA 2J4IA 3KNXA 5JBTA 4MNXA 3MU8A 4ABIA 1C5OH 1HUTH 1A5IA 1KLIH 2EA3A 2BB4A 2ZZUH 2BYAX 4FUIA 2FOEA 4HFPB 4CRDA 2WPHS 3SJOA 2WINI 4NWKA 4Y10E 1J9CH 5JB8S 1EPTA 1GJ5H 2WPLS 4D9QA 4WMDA 3RMMH 2BLQA 1K1LA 1S0RA 1YPLH 1TOCB 2OCVB 1CE5A 2ANKH 3AASA 2FI3E 4ESTE 1O34A 1SHYA 1VZQH 4NWLA 4BNRA 3RXPA 1MKXK 3RMOH 3Q3XA 2GZ8A 1UK2A 4DURA 1C1QA 2C8ZB 1W3CA 1MKWK 3QTVH 1GJCB 1WTGH 3RXQA 2EI8A 3VGCB 5LPRA 3CS0A 1QURH 4GHTA 2F9NA 1QBVH 3BG4B 3V0XA 3QGJA 3BTFE 3SJKA 2ZDAH 2CJIA 3O8CA 4O03A 2RG3A 3TH3H 1YCPH 1MTUA 1X7AC 3ODFA 1GI9B 1A0HB 1GMDF 2A2XH 1GDUA 2IOTA 4AFUA 1FZZA 3RMNH 3A89A 2XC5A 1W2KH 1SGQE 4JZFH 4K5ZA 4WXIA 1D3PB 1O3DA 1O2NA 5HYOA 3SV2H 3P8NA 4OS1A 1TPSA 1GJ6A 3GCNA 2DE9A 2FX6A 2P3TB 1HDTH 1PPCE 1O3BA 3A85A 4OS5A 2BQ7B 3I78A 5DPAA 1ORFA 3M7QA 1BRUP 1H8DH 2A31A 4I7YH 1GBKA 1WTHD 5FAHA 1O5DH 5CHAB 1GHBF 1EAIA 3EAJA 1HAOH 2J9NA 2QYIA 1TFXA 3MU5A 1V2TT 3FP7E 3RXKA 1HJ8A 1THPB 1BHXF 2O8TA 1QL7A 1TBQH 2BTCE 3BTDE 1S6HA 4UONA 2P16A 1H1BA 1JXPA 3OYPA 1DXWA 3MFJA 2FLRH 3Q76A 4ZXYH 1Q31A 1ZGIA 1C5RA 2BDIA 1EB1H 4B2AA 2D1JA 1HAIH 1MD8A 1J15A 2ZWLH 1YC0A 2FS8A 2NU1E 4AB9A 1AUJA 1BUIA 4X6OA 4E05H 7GCHG 1O3MA 1JWTA 3TGJE 4B2CA 4Y79A 1P57B 1BRCE 4WXVA 5DO4H 1TLDA 1EP6A 3MMGA 3VB3A 1AHTH 6CHAB 4ABDA 1KIGH 1UK4A 1OPHB 1BRBE 2OP9A 3ZVAA 3SORA 4BAHB 1UTNA 1A5GH 4DG4A 1FDPA 2O9QA 1C1OA 2XCNA 5EODA 1C5XB 3HKIB 1BA8B 4IS5A 4TWWA 2ZHFH 1UVSH 3ZVGA 1C5VA 1HAHH 2CF9H 1GBEA 2PKSB 4AYYB 1GI1A 1Y3UA 1AO5A 1F5KU 3DA9B 3VB5A 3RU4E 4YO9A 2BLWA 3RXGA 1TPAE 3RLYH 1GVLA 1JOUB 1GJ9B 4X0WU 1L2EA 1TMBH 4J1YA 2P3FH 4Y7BA 1K28D 1CT2E 1PFXC 2GDDA 2YOLA 3A8DA 1M9UA 1HXFH 1N6YA 2UWOA 1V2KT 2A1DB 4K2YA 4YESB 4NA8A 1V2OT 1O33A 5HGGA 3SNCA 4WWYA 3TLOA 1BTHH 4LOYH 1IQFA 1IQNA 3LU9B 5EG4A 4CREA 2DUCA 1O3KA 2FXRA 1HIAA 2SGAA 2ZCLP 1VJAU 2XBVA 1EASA 3A81A 1AU8A 2FYRA 1DX5M 1QBNA 3HK3B 3M61U 1UK3A 3QZRA 1CO7E 1BTWA 1TX8A 1GJ8B 6GCHF 1TYNA 3GYLB 3OX7U 1EAUA 2AS9A 2R0KA 1UTMA 2QY0B 2G00A 1FONA 4DW2U 2Y5FA 4HGCA 1GWAA 1VCWA 4OS6A 4MLFB 3RXTA 2H9HA 5EW2H 5G4BA 1B0FA 4B73A 3A8AA 4JZIA 2FESH 5EU8A 2GD4B 1MAYA 1PQ7A 3PYHA 1N6XA 3S7HB 1TMTH 3MH6A 1TE0A 2D8WA 4Y0YE 4AX9H 2GZ9A 2BXUH 4NZQA 3NCLA 2WPKS 4GVUA 2G4TA 3SU5A 1CA8B 1VGCC 1YGCH 3D23A 4Y71A 1KYNA 4YLUA 1TB6H 1ZSJA 3A7XA 1FAXA 2A5AA 3UNQA 3SO3A 2QIQA 2CXVA 1S85A 3S69A 4H42U 1EQ9A 1FY5A 2BY5X 5A8YA 1O5FH 5PTPA 1CVWH 1EZQA 1SFIA 2XCFA 1YPMH 2AIQA 1XXFA 1BTZA 4YM9A 3LH3A 2SGQE 3UQVA 1FMGA 3M3VA 4Y11E 4Q7YA 1O3JA 3PMAB 4X1PU 1PPGE 4A5TS 1QBOA 1QA0A 1C2EA 2ZGCA 2ZPQA 2BXTH 5JYIA 2C93B 3LOXA 1W10U 3SU3A 3R0FA 1MKXH 2G52A 7LPRA 1K22H 2FP7B 1XUHA 1GGDB 1BJVA 1ZPBA 4HZHA 5JBBS 2Y6TA 4ABFA 1QQUA 2NU2E 2HPQH 1P01A 1SLWB 2FOGA 5E0GA 3S9BA 2Z3EA 1P2KA 3ZZ9A 4GCHG 3TGKE 4O3TA 4IMQA 1Y3XA 4OS2A 2HOBA 4AFQA 2OBOA 2ZFQH 1O30A 3STIA 4YOIA 1GI2A 3W94A 2HPPH 2BY8X 3PMBB 1Q2WA 1WCZA 5GDSH 1NN6A 1ZRBA 1BMLA 1ESAA 3IITA 4INKA 2GGVB 1BIOA 1KLJH 3C27B 5A09A 4FUHA 3BV9B 2BM2A 2JH0D 2FLBH 1KXCA 1KY9A 1GBDA 2ZHQH 5T3HA 1MTWA 2CMYA 1UTOA 5ABWA 1DVAH 3SHAH 3MH4A 5JPMH 1C4U2 1T4VH 3V12A 4MTBA 4DIHH 2FTMA 3EA9A 3SBKA 1DANH 3U9AH 1O3IA 1EJMA 3SHCH 3PWCA 4VGCC 1VITF 3I29A 1C5TA 1P11E 5FX5A 3TU7H 3MO3A 1QY6A 2R2WU 1C1TA 1D3TB 2SGPE 3S0NA 2J38A 1GI8B 5TCCA 3QZQA 1F2SE 1LHFH 1P3CA 3NWUA 1CA0B 1S6FA 2Y80A 1NRRH 3KF2A 4UFFH 5B6OA 1O2ZA 2VH6A 1GHXH 5F8ZA 5C5NA 1A0JA 2WYJA 1BOQA 1O3GA 5FX6A 1E38B 3M36A 1ZPCA 4CR9A 1AGJA 3QN7A 2ASUB 1TQ0B 3VB6A 1G30B 4BTIB 1SGNE 3GDUA 1SFQB 2Y7XA 3BG4C 4ZAEA 1IQJA 4AGKA 1O32A 2AGEX 1V2WT 2ZDVH 1RIWC 2A7CA 2P3UB 3NPSA 2QXIA 2XWBI 2ZP0H 1N8OB 5FPYA 3LGIA 3A82A 4BXSA 1O3EA 1DY9A 2XC0A 2V6NA 4KGAA 1DWDH 2W3IA 4CRBA 1FPHH 1BTPA 2ZU2A 3TJNA 1ZMJA 3A7TA 1O2WA 3SW2B 2GCHF 5GIBA 3GOVB 2FOCA 1V2LT 1FQ3A 1Y3YA 2AMQA 2VIPA 3T2NA 2Z9JA 3P17H 5EQQA 5A8XA 5H4IB 2VIQA 1DDJA 3MO9A 1GBBA 1OP2A 1TNKA 1C2GA 1TNLA 3SV7A 1SPJA 1ZR0A 1AI8H 1BMAA 3FZDA 1EZSC 2FMJA 4RKJB 1RXPA 3RUOA 2F9PA 1G36A 1IOEA 2A4QA 1IHTH 2F9OA 1W8BH 1P05A 2TPIZ 4BOHA 1QB9A 2FM2A 1LQEA 3FFGA 3T26A 1MUEB 1P2JA 2ILNA 1O35A 8KME2 1GBJA 1YYY1 5GJ4B 4CRAA 4NFEA 5FPSA 1O2XA 5GXPA 1EB2A 1MU8B 2A4OA 3K9XB 1ZRKA 3RDZA 3ZVBA 3MU0A 2F91A 4D76A 2DE8A 1NC6A 2ULLA 3MWIU 1NT1A 4X8VH 2A45B 1LKAA 5C1YA 2ZGXH 4XBDA 1SLVB 3NK8A 1HAZB 1O2OA 4K69A 2BY9X 2AYWA 1UTPA 2FS9A 1FIWA 4CRFA 3EA8A 2C90B 2JETC 1L4DA 1SSXA 1ZTJA 1O2GH 1O37A 3A88A 4Y8XA 1YPJH 1ARCA 4ZMAH 2FI4E 3RU4D 1W0YH 4BAKB 1P2IA 1NU9A 3ATMA 1C1UH 3S9CA 2WUBA 4WMFA 3OY5U 1PJPA 1TNGA 4Y0ZE 2B8OH 2Z94A 3RM0H 4O9VA 2V35A 1YP9A 1OP0A 1AKSB 1P04A 3IWMA 1E35B 3ZZ8A 8LPRA 1E36B 1O2SA 3LKWA 1WSSH 3PLKA 5DP7A 1SGTA 1TGNA 2D2DA 4I31A 5LGOA 4KTCA 3VB4A 4AN7A 1FY1A 1J8AA 2ZCHP 4ABHA 3DFLA 1Z8RA 1KTSB 1C5WB 2A4RA 4CHAB 1GBTA 1BCUH 3UUZA 1G2MA 1UCYE 2Y81A 5AFYH 3URDA 4XSKU 1F0TA 3KQEA 1UTLM 2ZDKA 1O2MA 1GHBG 1P2NA 3UQOA 2ANWA 1OX1A 3VXEH 1V2RT 4TYDA 1RIWB 2YNAA 3OSYA 1SQTA 1QRZA 2OLGA 1C1PA 1K2I1 1S0QA 2ZFSA 2VINA 1TNIA 2TRMA 3SJIA 4BTTB 1MU6B 3T27A 2UUKB 3L33A 2AIPA 4OGYA 3B8JA 1TRYA 4Z6AH 3ITIA 2A5IA 1O2UA 1PPHE 1KDQB 2QAAA 1H9IE 1YCPM 8GCHF 1C2MA 3MH5A 2FI5E 4MPXA 5J4SA 4DCDA 3UFAA 3LH1A 4GSOA 1Y59T 4TWYA 1G3BA 1QTFA 2Y5GA 3TIUA 1OWHA 5J4QA 4AFSA 1W14U 3HGNA 1QIXB 3RXAA 1DWBH 4ABBA 2PFEA 3WY8A 1QR3E 1W12U 2OC0A 1CU1A 2IN2A 4YZUA 1ZMNA 2ZEBA 3KQCA 1AB9C 3M35A 3SGQE 5T6FA 3U8OH 2BLOA 3AAUA 4X2XA 4KKDA 1TABE 1A3EH 3A7ZA 2HNTC 2ZQ2A 4DOQA 1O36A 1PYTC 1UHBA 1SGDE 7GCHF 1IAUA 3TPIZ 1YBWA 1V2UT 2CHAC 2VGCB 1CHOG 1TX7A 4B74A 1W7XH 5EPYA 2V0BA 3RC4A 1A1RA 1AE8H 2THFB 1A0LA 3FAOA 4JCNA 1GBLA 3MOCA 1T8MA 1C2IA 1Y3WA 3MNXA 1ZJKA 4FVBA 3ZZBA 1V2MT 1O0DH 4Q7XA 1DE7H 4QT8C 4BXWA 5LPEA 1NESE 4O3UA 2BQWB 3A7WA 1XUIA 3M5NA 4YTAA 1ZMLA 2OTVA 1JIRA 1OKXA 2QXHA 5EGMA 2BVRH 2P93A 1O3CA 3O8RA 1C2HA 1C1WH 3ZYEA 1GI4A 2AMPA 1GVZA 1DWEH 1FIZA 3SQHE 2GT7A 1YPEH 2ZU5A 3LT3A 3SNBA 2VVCA 1EAWA 4ZUHA 3SV6A 1C5YB 1HGTH 1H4WA 1HB0B 4ZHAA 2GT8A 1GG6B 5EXLA 1T32A 3TK9A 4I8GA 2UUFB 4I8LA 3E16B 1OWEA 2I6QA 1HJAC 4FUGA 1A46H 2IJOB 2CV3A 1SBWA 1QNJA 1GJ4H 3SUFA 1LHGH 1WQVH 3DUXH 2BD3A 1PPEE 2JH5D 2H1UA 1NO9H 4I8JA 1OSSA 2STAE 3K2UA 3PTNA 1PPBH 1F5LA 2F3CE 1GCDA 2VH0A