1NNUC

Crystal structure analysis of plasmodium falciparum enoyl-acyl-carrier-protein reductase with triclosan analog
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
60
structure length
60
Chain Sequence
b'YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords enoyl-acyl carrier reductase
publication title Structural Elucidation of the Specificity of the Antibacterial Agent Triclosan for Malarial Enoyl Acyl Carrier Protein Reductase
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
total genus 16
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2003-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.400 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nnuC00
2FOIC 1NHWC 2NQ8C 1NNUC 1NHGC
chains in the Genus database with same CATH superfamily
1C1KA 2R0IA 4GEWA 5KO3A 2C5RA 2Z3XA 3M0EA 4PDGA 1WJ7A 3NBIA 5ITRA 2GNOA 2JXNA 5ITUA 2LWXA 3W0FA 1K3WA 4NRWA 3FRHA 2CV0A 4WURA 5FTKA 1G4AE 4NL4H 2R4JA 2F5SA 3KOWE 4IBEA 4R7GA 4JI8M 1SXJC 3GRYA 4LF4M 1ZV1A 2JWSA 2ZTDA 4L6V6 1G8PA 1XC8A 1IN4A 1DGBA 1QAMA 2BWBA 4QOZC 4AQYM 3K9PA 3L27A 1OJLA 2A5YB 3UZUA 3KOXE 3MMPA 3Q8XA 1UM8A 3C3EA 1IY0A 1A5TA 2V6ZM 3FRIA 3GQ5A 1HT1E 4OVZB 1DGHA 3C9PA 4I4LA 4LZJA 4NC6A 3GPXA 3FE3A 2F4VM 4RKUF 3D8LA 4OU7A 3CTWB 4GRIA 2GQFA 2DWLA 3L2AA 2QENA 3SC3A 2OQ4A 4IBGA 4JI7M 1VDLA 2CEAA 1D0LA 4FCVA 3AOGA 2CP8A 2L4EA 4PD2A 4LF9M 1PJSA 4DR6M 1J5EM 2DAEA 3J81S 3SHGB 4GC9A 3VLFB 3MHVC 3KFUG 3GRUA 2L6OA 3FD9A 3DOAA 2QPAA 2Y0QA 2C96A 1G3IA 4X64M 1NJFA 3GPYA 1IM2A 3M6AA 3L25A 1IXZA 3B74A 2JY6B 4LFCM 4KO8A 2CFOA 4P16A 4AG5A 3GLHB 2R44A 2RKOA 4JN6A 2AHMA 4RNAA 5EP3A 5IZ7D 2QQ8A 1X37A 4G4RA 1JR3A 4JI1M 3IHPA 1OTRA 3KSXA 2MROB 3AV0A 1IN8A 4HLQA 3U6EA 1DGGA 5FTLA 3AOEC 4PT5A 5LMUM 1QANA 4DR4M 1NSFA 2XSZD 5JI2E 2L7HA 3GLFB 3F92A 4QNMA 3U6PA 2UXDM 3LVWA 4CGYB 3GO8A 4JI2M 4XBOA 1K82A 1L2BA 1PRBA 2DI0A 2EJSA 3VK7A 2DWNA 1MU5A 3GLGA 4X66M 3SATA 1IXSA 4B3SM 2XZUA 2R62A 3HU2A 2D7EA 4JYAM 3E21A 1N77A 3K1JA 4BBAA 3K9OA 2DKLA 2ZBKB 4LRTA 3KP1E 4NSOB 4DV2M 1R5LA 1TDZA 1IBMM 3LQQA 4MH0E 2DHRA 4CIZA 4GC5A 1KYIA 2F5PA 2N35A 2DNAA 3HZJA 1LTMA 1DO2A 4JI6M 1D0KA 3KOZE 1L1ZA 2DVWB 3KSJA 1MJGM 3HHXA 2G3QA 1V34A 1XMOM 4AZFA 3EIHA 5EP1A 2P5TA 3BOSA 3GRVA 4IBCA 4P17A 2LVQD 2X4AA 3M7GA 1WGNA 3RE8A 3H4MA 1QDRA 2RGOA 5DYIA 3CGWA 4PCZA 2HCBA 1SXJD 2FE8A 4DV0M 4JI4M 3FTDA 3GLIE 3SARA 3FTEA 3HHYA 2WSEF 1ZAEA 3U61B 4JI5M 1GLNA 1NV8A 4KLNA 1EFUB 1XB2B 1C7YA 1Q3BA 3I01M 4ANRA 2K0BX 1IN6A 3UK6A 2L4FA 5E6JA 2KDLA 2V1CA 3SAVA 5ITXE 2R45A 2KW0A 3L29A 2L7IA 3K2LA 2WSFF 4LGMA 3VFDA 2DAMA 4A3VB 2NQ8C 4NRVA 1TH2A 4LCBA 1ZMWA 4B3RM 4FW9A 2QBYB 4B3MM 1GL6A 2DHYA 1TGUA 2BJVA 2DWMA 4WW0A 1QAQA 4CHTB 4JI0M 3FYDA 3AJIB 4DR2M 3I4VA 4B7GA 4FWHA 2ZAOA 4FD2A 3U6LA 1NY6A 2UUBM 4MGZE 3B7ZA 1NV9A 3SYLA 3TWLA 2R18A 5FSWA 2KRKA 1PJIA 1FNNA 1YUBA 2R46A 4NXNM 3KW6A 2FS1A 3ZCBB 1IXRC 4IBKA 2FFJA 2UXBM 2Y20A 1HNZM 2KNVA 3QYBA 2QHOB 3FTCA 2FOIC 2C98A 3HX3A 4TUWA 2MR9A 5DFLA 1H6UA 2DXIA 4GIPA 1VEGA 4BB9A 8CATA 3U6CA 4W5WA 5DYGA 5BR8M 2KZUA 2K9DA 3K8ZA 3ILKA 1RU3A 4AKHA 2HWJA 3CF0A 4Q7JA 1WHCA 3NBXX 4HL4A 1ZQ9A 1GO5A 1I94M 3KDSE 3V76A 1Y8GA 5EXPA 2H1RA 2HHHM 2JZ1A 2CHGA 3U6OA 5H37D 5KPRA 2XGNA 2VQFM 4LFBM 3U5ZA 3SAUA 1E32A 4JXJA 1Z5AA 4LF7M 4IBFA 4D80A 3FUUA 3T15A 4LF5M 4FWGA 4XK8F 1TDHA 1ORYB 2L09A 1R6BX 1XWIA 4MM3B 3C58A 3TWMA 2JUJA 1QUTA 3A45A 5C18A 5ITQA 1GL7A 2G8LA 4IBBA 2VIIA 4LG2A 4LGYA 3TE6A 4AKGA 2O01F 3FUWA 3AKZA 3VDUA 2EKKA 4GKKM 1TH3A 4DBGB 1N36M 2YR0A 3U60B 2LBCA 1XNQM 1SXJB 4L8RC 2YFQA 3GRRA 4LJ7A 1IQPA 3HGIA 1MN3A 2JY5A 3IG8A 3TQSA 3GLIA 2WZJA 4OW0A 4DR7M 2QZ4A 3U6DA 4FCTA 1R7RA 3B89A 1PJJA 2JA2A 1AUAA 4B08A 4DV3M 2M60A 5E26A 2EUCA 3PFIA 1JB0F 3TWKA 2MGWA 1CUKA 1IY2A 3WHKA 4DV4M 1ZMUA 3HKPA 3J2PB 1VEJA 2XZFA 2J7OA 1HJPA 1XXHB 3E4RA 3KOYE 4GH9A 2XH9A 4Y28F 5ITXA 1E94E 4LZZA 3CF6E 4ITQA 2JZ0A 2K47A 3GLHE 2Z7JA 4X65M 3U6QA 5A2QS 1NY5A 3CF2A 2XLJA 4CISA 4IIWA 2V1UA 4L78A 3HJSA 5ITYA 2DAGA 2XFSA 3AL0C 4YY3M 3KS4A 3JR5A 3W67A 4II7A 2DZOB 1Z5BA 3LCUA 1OKSA 4Z6YA 4IJEA 1DGHB 1HNXM 5KQ8A 5GKNA 2LVNC 3GLFE 2EO2A 1V33A 1IFYA 3QYEA 1YSYA 4GKJM 2LVAA 4QNRA 1W5SA 5JI3E 1Z6TA 3LW5F 2FH0A 3GP1A 3TPZA 4QHTA 2DZNB 2UUCM 1NHGC 5KPZA 3J7AS 1Z59A 3W68A 1ZMVA 5LMNM 1OIZA 4LJ8A 3H4JA 1TF0B 1NJGA 1Z5CA 2MJ5B 2O5RA 1QZEA 4MGHA 3DZDA 4F2LA 1GKIA 3KS8A 3UJNA 2UXCM 1D2NA 2CHQA 3T1YM 1PGYA 3T38A 3J80S 4LY6A 3TL4X 3VKGA 2LVPC 3GPUA 4LJ6A 5FTNA 1T43A 5F3WA 2BJWA 3LCVB 1TTEA 3SBJA 3W0LB 1DO0A 3LQRA 2C9OA 3I4YA 3K92A 3D8BA 4MGYE 3THGA 4B7FA 2KZSA 4NSRA 3HHWA 2I7PA 3GPPA 2CHVA 1N32M 4AI6A 4LF6M 2DAIA 1IN5A 4MGIE 4OVZA 2KEBA 1L8QA 4UN2B 3GQ3A 2ZANA 2G5GX 4G3OA 3A98B 5EXTA 4I81A 3NWLA 2LVOC 3Q8GA 2WSCF 1L2CA 1Q3CA 1TH4A 1QYRA 4M0WA 4AG6A 2JY8A 3T6PA 4IBDA 2F5OA 5EXSA 3ZC7B 3GLGB 1IXSB 1R2YA 1OIPA 4MGKE 1Q02A 4QOSA 4IBJA 4G4QA 5FTJA 3IG5A 2KHHA 1P3QQ 1L1TA 4IJFA 5EXXA 2D7GA 2H5XA 3FYCA 2JP7A 3AFHA 4L16A 3GQ4A 4ZPXA 2L2DA 2ERCA 2R65A 4G4NA 3HWSA 2F5QA 4LRSA 4FWDA 4NOOB 3FKEA 2O25A 4DUZM 3PNVA 3GLHA 4DR5M 4GMQA 1JQJC 1OQYA 2JNHA 2LH0A 2Z4SA 2LTUA 1MX0A 3EIEA 1J09A 4M9XA 3SAWA 2LXEA 2OPFA 3SMSA 3A42A 1KSFX 2UUAM 2HAKA 1VG5A 2D7HA 1VQ1A 4HEOA 4DV5M 1OFIA 3QAUA 2B3TA 2J5YA 4JI3M 1DV0A 3QWLA 1XXHA 2LHCA 2CRUA 3FUTA 1E9RA 5EQTA 4BLCA 1HR0M 1HNWM 3GLFA 1JR3D 3SASA 2OOBA 1NO1A 5L8RF 2C99A 4JV5M 4AKIA 2LNHC 2DAKA 2QNJA 3SFZA 3I04M 3UGJA 1OAOC 4LJ9A 1GVNA 1SG9A 1TR8A 2FNAA 4GITA 1OFHA 2VDBB 4G4OA 1T3TA 3L28A 3R8FA 4NXMM 1PJQA 2X8AA 3E9SA 5EP4A 5IWAM 5KPTA 1J7KA 4YHHM 2ZM6M 1IY1A 4WP2A 2CV2A 1NHWC 3FUVA 1WR1B 3HU3A 1YLAA 2W82A 4DUYM 2XFTA 2KA6B 1N78A 3KP0E 4DV6M 2YQZA 3BBZA 2QCUA 2APLA 2C9CA 3KXEC 3DFZA 4M0DA 4REZA 2EKFA 3PXGA 3JAMS 4I5SA 4DR3M 4R3DA 2CV1A 1QUSA 4OX9M 3R9XB 2OOAA 2OO9A 3MJ5A 3SHFA 5C1BA 4GHAA 3JR4A 1FJGM 3VKHA 1EIJA 1R4GA 1SXJE 2K6BA 2KNAA 4G6ZA 4KODA 3UMMA 1HQCA 3AOEA 3BXWA 3L26A 7CATA 1WXQA 4MB7A 2YNMD 2RGHA 3WHLA 1E9SA 2VQEM 1K3XA 3U61A 1F4IA 1AIPC 4IBIA 2MH8A 3VDPA 1XNRM 1R2ZA 1G59A 5EP2A 2Y0TA 2VF7A 4RF1A 4DV7M 1IBKM 2R6FA 3HY5A 4RF0A 3HHZA 4L4UA 3E46A 4KT0F 1XXHE 3RGSA 1XHBA 1OAIA 2HKJA 2I7NA 2QP9X 2EA0A 1GJSA 1HQYE 3U5ZB 4KHPM 3PNYA 5DNYA 1I4WA 5KQDA 2QBYA 2ZTCA 3OTOM 4CJ6A 2QSFX 2KXEA 3PVSA 4FCWA 4S12A 4F1IA 4DR1M 5FLXS 3SMPA 3MK6A 1WIVA 2LHGA 3B9PA 1N33M 1QAOA 1WGLA 1EE8A 1HT2E 4LJAA 3U6SA 3ZQJA 4L15A 1N34M 5FTMA 1VEKA 2BNKA 1BVSA 1QZMA 2ZAMA 1PJTA 1S3SA 4LFAM 2UU9M 1DGFA 1Q39A 1T6OA 3GLIB 1NVMA 2J7NA 5EJCA 4GHLA 4Z8XA 3HU1A 2CE7A 2XSZA 4D81A 2Y21A 2Z4RA 4K0KM 3B7NA 4M9ZA 1KFVA 3FTFA 1QVRA 4FVMA 2Z8YM 4EIWA 5IREB 1G41A 5ITTA 3DA1A 1YE9A 3T1HM 1W5TA 2CUZA 3B7QA 2F5NA 5BPVA 2R4EA 3FUXA 4PDIA 1NNJA 3C3DA 1QDTA 2RRUA 4LJ4A 1IN7A 3VK8A 3A46A 5IT9S 2XF3A 1NNUC 2DENA 1VDDA 4XGIA 4B7HA 3I51A 1GJTA 1JR3E 1QQWA 1V92A 3ZH9B 1D0MA 2KRUA 2XEPA 2CWBA 1PM5A 2E5LM 3SYKA 3J7BA 2X49A 3KVWA 3U6MA 4LJ5A 4AW4A 4LF8M 3J27B 2JY7A 3IECA 1LV7A 2HL7A 2Q2EB 2DWZB 3HJ8A 1GABA 3LVVA 3U60A 1N75A 2DZLA 2BWEA 2VF8A 4QHSA 1SXJA 3HJQA 4I8OA 3RFWA 2M5ZA 3GLGE 1UFZA 4R71A 1G71A 3LMMA 4M9SA 1IBLM 4B3TM 3RGPA 4X62M 1XMQM 1L2DA 4DV1M 2KNZA 4D82A
chains in the Genus database with same CATH topology
1C1KA 5KO3A 2C5RA 2Z3XA 3M0EA 4PDGA 3NBIA 5ITRA 5ITUA 2LWXA 3W0FA 1K3WA 4NRWA 2CV0A 4WURA 5FTKA 1G4AE 4NL4H 2R4JA 2F5SA 3KOWE 4IBEA 4R7GA 4JI8M 1SXJC 3GRYA 4LF4M 1G8PA 1XC8A 1IN4A 1DGBA 1QAMA 4QOZC 4AQYM 3L27A 1OJLA 2A5YB 3UZUA 3KOXE 3Q8XA 1UM8A 1IY0A 2V6ZM 3GQ5A 1HT1E 4OVZB 1DGHA 4I4LA 4LZJA 3GPXA 2F4VM 3D8LA 4OU7A 3CTWB 4GRIA 2DWLA 3L2AA 2QENA 3SC3A 2OQ4A 4IBGA 4JI7M 2CEAA 4FCVA 3AOGA 4PD2A 4LF9M 4DR6M 1J5EM 3J81S 3SHGB 4GC9A 3VLFB 3MHVC 3KFUG 3GRUA 2L6OA 3FD9A 3DOAA 2QPAA 2Y0QA 2C96A 1G3IA 4X64M 1NJFA 3GPYA 1IM2A 3M6AA 3L25A 1IXZA 4LFCM 4KO8A 2CFOA 4P16A 4AG5A 3GLHB 2RKOA 4JN6A 2AHMA 4RNAA 5EP3A 5IZ7D 1X37A 4G4RA 1JR3A 4JI1M 3KSXA 3AV0A 1IN8A 4HLQA 3U6EA 1DGGA 5FTLA 3AOEC 4PT5A 5LMUM 1QANA 4DR4M 1NSFA 2XSZD 5JI2E 2L7HA 3GLFB 4QNMA 3U6PA 2UXDM 3LVWA 4CGYB 3GO8A 4JI2M 4XBOA 1K82A 1L2BA 3VK7A 2DWNA 1MU5A 3GLGA 4X66M 3SATA 4B3SM 2XZUA 2R62A 3HU2A 2D7EA 4JYAM 1N77A 3K1JA 4BBAA 4NSOB 2ZBKB 4LRTA 3KP1E 4DV2M 1TDZA 1IBMM 3LQQA 4MH0E 2DHRA 4GC5A 1KYIA 2F5PA 1DO2A 4JI6M 3KOZE 1L1ZA 3KSJA 2DVWB 3HHXA 1XMOM 4AZFA 3EIHA 5EP1A 2P5TA 3BOSA 3GRVA 4IBCA 2X4AA 3M7GA 3RE8A 3H4MA 2RGOA 5DYIA 4PCZA 2HCBA 1SXJD 2FE8A 4DV0M 4JI4M 3FTDA 3SARA 3FTEA 3HHYA 4JI5M 1ZAEA 3U61B 1GLNA 4KLNA 1Q3BA 1IN6A 3UK6A 5E6JA 3SAVA 2V1CA 5ITXE 2R45A 2KW0A 3L29A 2L7IA 3K2LA 4LGMA 3VFDA 4A3VB 2NQ8C 4NRVA 1TH2A 4LCBA 4B3RM 4FW9A 2QBYB 4B3MM 1GL6A 1TGUA 2BJVA 2DWMA 4WW0A 1QAQA 4CHTB 4JI0M 3FYDA 3AJIB 4DR2M 3I4VA 4B7GA 4FWHA 2ZAOA 4FD2A 3U6LA 1NY6A 2UUBM 4MGZE 3SYLA 3TWLA 2R18A 5FSWA 2KRKA 1PJIA 1FNNA 1YUBA 2R46A 4NXNM 3KW6A 3ZCBB 1IXRC 4IBKA 2FFJA 2UXBM 2Y20A 1HNZM 3FTCA 2FOIC 2C98A 4TUWA 1H6UA 2DXIA 4GIPA 3U6CA 4BB9A 8CATA 4W5WA 5DYGA 5BR8M 2KZUA 3K8ZA 3ILKA 4AKHA 3CF0A 4HL4A 1ZQ9A 1I94M 3KDSE 5EXPA 2H1RA 2HHHM 2CHGA 3U6OA 5H37D 5KPRA 2XGNA 2VQFM 4LFBM 3U5ZA 3SAUA 1E32A 4JXJA 1Z5AA 4LF7M 4IBFA 4D80A 3FUUA 3T15A 4LF5M 4FWGA 1TDHA 1ORYB 2L09A 1R6BX 1XWIA 4MM3B 3C58A 3TWMA 3A45A 1PJJA 5C18A 5ITQA 1GL7A 2G8LA 4IBBA 2VIIA 4LG2A 4LGYA 3TE6A 4AKGA 3FUWA 3AKZA 3VDUA 4GKKM 1TH3A 1N36M 2YR0A 3U60B 1XNQM 1SXJB 4L8RC 2YFQA 3GRRA 4LJ7A 1IQPA 3HGIA 3IG8A 3TQSA 3GLIA 4OW0A 4DR7M 2QZ4A 3U6DA 4FCTA 1R7RA 2JA2A 4DV3M 4B08A 2M60A 5E26A 2EUCA 3PFIA 3TWKA 3WHKA 4DV4M 1IY2A 3HKPA 3J2PB 2XZFA 2J7OA 1XXHB 3E4RA 3KOYE 4GH9A 2XH9A 5ITXA 1E94E 4LZZA 3CF6E 4ITQA 2K47A 2Z7JA 4X65M 3U6QA 5A2QS 1NY5A 3CF2A 2XLJA 4CISA 4IIWA 2V1UA 4L78A 3HJSA 5ITYA 2XFSA 3AL0C 4YY3M 3KS4A 3JR5A 4II7A 2DZOB 1Z5BA 4Z6YA 4IJEA 1DGHB 1HNXM 5KQ8A 5GKNA 2EO2A 1YSYA 4GKJM 4QNRA 1W5SA 5JI3E 1Z6TA 3GP1A 3TPZA 4QHTA 2DZNB 2UUCM 1NHGC 5KPZA 3J7AS 1Z59A 5LMNM 4LJ8A 1NJGA 1Z5CA 2O5RA 4MGHA 3DZDA 1GKIA 3KS8A 3UJNA 2UXCM 1D2NA 2CHQA 3T1YM 3T38A 3J80S 4LY6A 3TL4X 3VKGA 3GPUA 4LJ6A 5FTNA 5F3WA 2BJWA 3SBJA 3W0LB 1DO0A 3LQRA 2C9OA 3I4YA 3K92A 3D8BA 4MGYE 3THGA 4B7FA 2KZSA 4NSRA 3HHWA 2I7PA 3GPPA 2CHVA 1N32M 4AI6A 4LF6M 1IN5A 4MGIE 4OVZA 2KEBA 1L8QA 3GQ3A 2ZANA 2G5GX 5EXTA 3A98B 4I81A 3NWLA 1L2CA 1Q3CA 1TH4A 1QYRA 4M0WA 4AG6A 4IBDA 2F5OA 5EXSA 3ZC7B 3GLGB 1IXSB 1R2YA 4MGKE 4QOSA 4IBJA 4G4QA 5FTJA 3IG5A 1L1TA 4IJFA 5EXXA 2D7GA 3FYCA 3AFHA 4L16A 3GQ4A 4ZPXA 2R65A 2ERCA 4G4NA 2F5QA 3HWSA 4LRSA 4FWDA 4NOOB 3FKEA 4DUZM 3PNVA 3GLHA 4DR5M 4GMQA 1JQJC 2Z4SA 2LH0A 1MX0A 3EIEA 1J09A 4M9XA 3SAWA 2LXEA 2OPFA 3SMSA 3A42A 1KSFX 2UUAM 2D7HA 4DV5M 1OFIA 3QAUA 4JI3M 3QWLA 1XXHA 3FUTA 5EQTA 4BLCA 1E9RA 1HR0M 1HNWM 3GLFA 1JR3D 3SASA 4AKIA 2C99A 4JV5M 2LNHC 3SFZA 3UGJA 4LJ9A 1GVNA 2FNAA 4GITA 1OFHA 4G4OA 1T3TA 3L28A 3R8FA 4NXMM 5EP4A 2X8AA 3E9SA 5IWAM 5KPTA 1J7KA 4YHHM 2ZM6M 1IY1A 2CV2A 1NHWC 3FUVA 3HU3A 2W82A 4DUYM 2XFTA 2KA6B 1N78A 3KP0E 4DV6M 2YQZA 2QCUA 3KXEC 2C9CA 3DFZA 4M0DA 4REZA 3PXGA 3JAMS 4I5SA 4DR3M 4R3DA 2CV1A 4OX9M 3R9XB 3VKHA 4GHAA 3MJ5A 3SHFA 5C1BA 3JR4A 1FJGM 1SXJE 4G6ZA 4KODA 3UMMA 1HQCA 3AOEA 3L26A 7CATA 1WXQA 4MB7A 2YNMD 2RGHA 3WHLA 1E9SA 2VQEM 1K3XA 3U61A 4IBIA 3VDPA 1XNRM 1R2ZA 1G59A 5EP2A 2Y0TA 4RF1A 4DV7M 1IBKM 3HHZA 4RF0A 4L4UA 3RGSA 1XHBA 2HKJA 2I7NA 2QP9X 2EA0A 1HQYE 3U5ZB 4KHPM 3PNYA 5DNYA 1I4WA 5KQDA 2QBYA 3OTOM 2KXEA 3PVSA 4FCWA 4S12A 4DR1M 5FLXS 3SMPA 3MK6A 3B9PA 1N33M 1QAOA 1EE8A 1HT2E 4LJAA 3U6SA 4L15A 1N34M 5FTMA 2BNKA 1QZMA 2ZAMA 1S3SA 4LFAM 2UU9M 1DGFA 1Q39A 3GLIB 1NVMA 2J7NA 5EJCA 4GHLA 4Z8XA 3HU1A 2CE7A 2XSZA 4D81A 2Y21A 2Z4RA 4K0KM 4M9ZA 1KFVA 3FTFA 1QVRA 4FVMA 4EIWA 5IREB 1G41A 5ITTA 3DA1A 1YE9A 3T1HM 1W5TA 2CUZA 2F5NA 5BPVA 2R4EA 3FUXA 4PDIA 1NNJA 4LJ4A 1IN7A 3VK8A 3A46A 5IT9S 2XF3A 1NNUC 1VDDA 4XGIA 4B7HA 3I51A 1QQWA 3ZH9B 2KRUA 2XEPA 1PM5A 2E5LM 3SYKA 3J7BA 2X49A 3KVWA 3U6MA 4LJ5A 4AW4A 4LF8M 3J27B 1LV7A 2HL7A 2Q2EB 2DWZB 3HJ8A 3LVVA 3U60A 1N75A 4QHSA 1SXJA 3HJQA 4I8OA 3RFWA 2M5ZA 1IBLM 3LMMA 4M9SA 4B3TM 3RGPA 4X62M 1XMQM 1L2DA 4DV1M 4D82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FOI C;  1NHW C;  2NQ8 C;  1NNU C;  1NHG C; 
#chains in the Genus database with same CATH topology
 1C1K A;  2R0I A;  4GEW A;  5KO3 A;  2C5R A;  2Z3X A;  3M0E A;  4PDG A;  1WJ7 A;  3NBI A;  5ITR A;  2GNO A;  2JXN A;  5ITU A;  2LWX A;  3W0F A;  1K3W A;  4NRW A;  3FRH A;  2CV0 A;  4WUR A;  5FTK A;  1G4A E;  4NL4 H;  2R4J A;  2F5S A;  3KOW E;  4IBE A;  4R7G A;  4JI8 M;  1SXJ C;  3GRY A;  4LF4 M;  1ZV1 A;  2JWS A;  2ZTD A;  4L6V 6;  1G8P A;  1XC8 A;  1IN4 A;  1DGB A;  1QAM A;  2BWB A;  4QOZ C;  4AQY M;  3K9P A;  3L27 A;  1OJL A;  2A5Y B;  3UZU A;  3KOX E;  3MMP A;  3Q8X A;  1UM8 A;  3C3E A;  1IY0 A;  1A5T A;  2V6Z M;  3FRI A;  3GQ5 A;  1HT1 E;  4OVZ B;  1DGH A;  3C9P A;  4I4L A;  4LZJ A;  4NC6 A;  3GPX A;  3FE3 A;  2F4V M;  4RKU F;  3D8L A;  4OU7 A;  3CTW B;  4GRI A;  2GQF A;  2DWL A;  3L2A A;  2QEN A;  3SC3 A;  2OQ4 A;  4IBG A;  4JI7 M;  1VDL A;  2CEA A;  1D0L A;  4FCV A;  3AOG A;  2CP8 A;  2L4E A;  4PD2 A;  4LF9 M;  1PJS A;  4DR6 M;  1J5E M;  2DAE A;  3J81 S;  3SHG B;  4GC9 A;  3VLF B;  3MHV C;  3KFU G;  3GRU A;  2L6O A;  3FD9 A;  3DOA A;  2QPA A;  2Y0Q A;  2C96 A;  1G3I A;  4X64 M;  1NJF A;  3GPY A;  1IM2 A;  3M6A A;  3L25 A;  1IXZ A;  3B74 A;  2JY6 B;  4LFC M;  4KO8 A;  2CFO A;  4P16 A;  4AG5 A;  3GLH B;  2R44 A;  2RKO A;  4JN6 A;  2AHM A;  4RNA A;  5EP3 A;  5IZ7 D;  2QQ8 A;  1X37 A;  4G4R A;  1JR3 A;  4JI1 M;  3IHP A;  1OTR A;  3KSX A;  2MRO B;  3AV0 A;  1IN8 A;  4HLQ A;  3U6E A;  1DGG A;  5FTL A;  3AOE C;  4PT5 A;  5LMU M;  1QAN A;  4DR4 M;  1NSF A;  2XSZ D;  5JI2 E;  2L7H A;  3GLF B;  3F92 A;  4QNM A;  3U6P A;  2UXD M;  3LVW A;  4CGY B;  3GO8 A;  4JI2 M;  4XBO A;  1K82 A;  1L2B A;  1PRB A;  2DI0 A;  2EJS A;  3VK7 A;  2DWN A;  1MU5 A;  3GLG A;  4X66 M;  3SAT A;  1IXS A;  4B3S M;  2XZU A;  2R62 A;  3HU2 A;  2D7E A;  4JYA M;  3E21 A;  1N77 A;  3K1J A;  4BBA A;  3K9O A;  2DKL A;  2ZBK B;  4LRT A;  3KP1 E;  4NSO B;  4DV2 M;  1R5L A;  1TDZ A;  1IBM M;  3LQQ A;  4MH0 E;  2DHR A;  4CIZ A;  4GC5 A;  1KYI A;  2F5P A;  2N35 A;  2DNA A;  3HZJ A;  1LTM A;  1DO2 A;  4JI6 M;  1D0K A;  3KOZ E;  1L1Z A;  2DVW B;  3KSJ A;  1MJG M;  3HHX A;  2G3Q A;  1V34 A;  1XMO M;  4AZF A;  3EIH A;  5EP1 A;  2P5T A;  3BOS A;  3GRV A;  4IBC A;  4P17 A;  2LVQ D;  2X4A A;  3M7G A;  1WGN A;  3RE8 A;  3H4M A;  1QDR A;  2RGO A;  5DYI A;  3CGW A;  4PCZ A;  2HCB A;  1SXJ D;  2FE8 A;  4DV0 M;  4JI4 M;  3FTD A;  3GLI E;  3SAR A;  3FTE A;  3HHY A;  2WSE F;  1ZAE A;  3U61 B;  4JI5 M;  1GLN A;  1NV8 A;  4KLN A;  1EFU B;  1XB2 B;  1C7Y A;  1Q3B A;  3I01 M;  4ANR A;  2K0B X;  1IN6 A;  3UK6 A;  2L4F A;  5E6J A;  2KDL A;  2V1C A;  3SAV A;  5ITX E;  2R45 A;  2KW0 A;  3L29 A;  2L7I A;  3K2L A;  2WSF F;  4LGM A;  3VFD A;  2DAM A;  4A3V B;  2NQ8 C;  4NRV A;  1TH2 A;  4LCB A;  1ZMW A;  4B3R M;  4FW9 A;  2QBY B;  4B3M M;  1GL6 A;  2DHY A;  1TGU A;  2BJV A;  2DWM A;  4WW0 A;  1QAQ A;  4CHT B;  4JI0 M;  3FYD A;  3AJI B;  4DR2 M;  3I4V A;  4B7G A;  4FWH A;  2ZAO A;  4FD2 A;  3U6L A;  1NY6 A;  2UUB M;  4MGZ E;  3B7Z A;  1NV9 A;  3SYL A;  3TWL A;  2R18 A;  5FSW A;  2KRK A;  1PJI A;  1FNN A;  1YUB A;  2R46 A;  4NXN M;  3KW6 A;  2FS1 A;  3ZCB B;  1IXR C;  4IBK A;  2FFJ A;  2UXB M;  2Y20 A;  1HNZ M;  2KNV A;  3QYB A;  2QHO B;  3FTC A;  2FOI C;  2C98 A;  3HX3 A;  4TUW A;  2MR9 A;  5DFL A;  1H6U A;  2DXI A;  4GIP A;  1VEG A;  4BB9 A;  8CAT A;  3U6C A;  4W5W A;  5DYG A;  5BR8 M;  2KZU A;  2K9D A;  3K8Z A;  3ILK A;  1RU3 A;  4AKH A;  2HWJ A;  3CF0 A;  4Q7J A;  1WHC A;  3NBX X;  4HL4 A;  1ZQ9 A;  1GO5 A;  1I94 M;  3KDS E;  3V76 A;  1Y8G A;  5EXP A;  2H1R A;  2HHH M;  2JZ1 A;  2CHG A;  3U6O A;  5H37 D;  5KPR A;  2XGN A;  2VQF M;  4LFB M;  3U5Z A;  3SAU A;  1E32 A;  4JXJ A;  1Z5A A;  4LF7 M;  4IBF A;  4D80 A;  3FUU A;  3T15 A;  4LF5 M;  4FWG A;  4XK8 F;  1TDH A;  1ORY B;  2L09 A;  1R6B X;  1XWI A;  4MM3 B;  3C58 A;  3TWM A;  2JUJ A;  1QUT A;  3A45 A;  5C18 A;  5ITQ A;  1GL7 A;  2G8L A;  4IBB A;  2VII A;  4LG2 A;  4LGY A;  3TE6 A;  4AKG A;  2O01 F;  3FUW A;  3AKZ A;  3VDU A;  2EKK A;  4GKK M;  1TH3 A;  4DBG B;  1N36 M;  2YR0 A;  3U60 B;  2LBC A;  1XNQ M;  1SXJ B;  4L8R C;  2YFQ A;  3GRR A;  4LJ7 A;  1IQP A;  3HGI A;  1MN3 A;  2JY5 A;  3IG8 A;  3TQS A;  3GLI A;  2WZJ A;  4OW0 A;  4DR7 M;  2QZ4 A;  3U6D A;  4FCT A;  1R7R A;  3B89 A;  1PJJ A;  2JA2 A;  1AUA A;  4B08 A;  4DV3 M;  2M60 A;  5E26 A;  2EUC A;  3PFI A;  1JB0 F;  3TWK A;  2MGW A;  1CUK A;  1IY2 A;  3WHK A;  4DV4 M;  1ZMU A;  3HKP A;  3J2P B;  1VEJ A;  2XZF A;  2J7O A;  1HJP A;  1XXH B;  3E4R A;  3KOY E;  4GH9 A;  2XH9 A;  4Y28 F;  5ITX A;  1E94 E;  4LZZ A;  3CF6 E;  4ITQ A;  2JZ0 A;  2K47 A;  3GLH E;  2Z7J A;  4X65 M;  3U6Q A;  5A2Q S;  1NY5 A;  3CF2 A;  2XLJ A;  4CIS A;  4IIW A;  2V1U A;  4L78 A;  3HJS A;  5ITY A;  2DAG A;  2XFS A;  3AL0 C;  4YY3 M;  3KS4 A;  3JR5 A;  3W67 A;  4II7 A;  2DZO B;  1Z5B A;  3LCU A;  1OKS A;  4Z6Y A;  4IJE A;  1DGH B;  1HNX M;  5KQ8 A;  5GKN A;  2LVN C;  3GLF E;  2EO2 A;  1V33 A;  1IFY A;  3QYE A;  1YSY A;  4GKJ M;  2LVA A;  4QNR A;  1W5S A;  5JI3 E;  1Z6T A;  3LW5 F;  2FH0 A;  3GP1 A;  3TPZ A;  4QHT A;  2DZN B;  2UUC M;  1NHG C;  5KPZ A;  3J7A S;  1Z59 A;  3W68 A;  1ZMV A;  5LMN M;  1OIZ A;  4LJ8 A;  3H4J A;  1TF0 B;  1NJG A;  1Z5C A;  2MJ5 B;  2O5R A;  1QZE A;  4MGH A;  3DZD A;  4F2L A;  1GKI A;  3KS8 A;  3UJN A;  2UXC M;  1D2N A;  2CHQ A;  3T1Y M;  1PGY A;  3T38 A;  3J80 S;  4LY6 A;  3TL4 X;  3VKG A;  2LVP C;  3GPU A;  4LJ6 A;  5FTN A;  1T43 A;  5F3W A;  2BJW A;  3LCV B;  1TTE A;  3SBJ A;  3W0L B;  1DO0 A;  3LQR A;  2C9O A;  3I4Y A;  3K92 A;  3D8B A;  4MGY E;  3THG A;  4B7F A;  2KZS A;  4NSR A;  3HHW A;  2I7P A;  3GPP A;  2CHV A;  1N32 M;  4AI6 A;  4LF6 M;  2DAI A;  1IN5 A;  4MGI E;  4OVZ A;  2KEB A;  1L8Q A;  4UN2 B;  3GQ3 A;  2ZAN A;  2G5G X;  4G3O A;  3A98 B;  5EXT A;  4I81 A;  3NWL A;  2LVO C;  3Q8G A;  2WSC F;  1L2C A;  1Q3C A;  1TH4 A;  1QYR A;  4M0W A;  4AG6 A;  2JY8 A;  3T6P A;  4IBD A;  2F5O A;  5EXS A;  3ZC7 B;  3GLG B;  1IXS B;  1R2Y A;  1OIP A;  4MGK E;  1Q02 A;  4QOS A;  4IBJ A;  4G4Q A;  5FTJ A;  3IG5 A;  2KHH A;  1P3Q Q;  1L1T A;  4IJF A;  5EXX A;  2D7G A;  2H5X A;  3FYC A;  2JP7 A;  3AFH A;  4L16 A;  3GQ4 A;  4ZPX A;  2L2D A;  2ERC A;  2R65 A;  4G4N A;  3HWS A;  2F5Q A;  4LRS A;  4FWD A;  4NOO B;  3FKE A;  2O25 A;  4DUZ M;  3PNV A;  3GLH A;  4DR5 M;  4GMQ A;  1JQJ C;  1OQY A;  2JNH A;  2LH0 A;  2Z4S A;  2LTU A;  1MX0 A;  3EIE A;  1J09 A;  4M9X A;  3SAW A;  2LXE A;  2OPF A;  3SMS A;  3A42 A;  1KSF X;  2UUA M;  2HAK A;  1VG5 A;  2D7H A;  1VQ1 A;  4HEO A;  4DV5 M;  1OFI A;  3QAU A;  2B3T A;  2J5Y A;  4JI3 M;  1DV0 A;  3QWL A;  1XXH A;  2LHC A;  2CRU A;  3FUT A;  1E9R A;  5EQT A;  4BLC A;  1HR0 M;  1HNW M;  3GLF A;  1JR3 D;  3SAS A;  2OOB A;  1NO1 A;  5L8R F;  2C99 A;  4JV5 M;  4AKI A;  2LNH C;  2DAK A;  2QNJ A;  3SFZ A;  3I04 M;  3UGJ A;  1OAO C;  4LJ9 A;  1GVN A;  1SG9 A;  1TR8 A;  2FNA A;  4GIT A;  1OFH A;  2VDB B;  4G4O A;  1T3T A;  3L28 A;  3R8F A;  4NXM M;  1PJQ A;  2X8A A;  3E9S A;  5EP4 A;  5IWA M;  5KPT A;  1J7K A;  4YHH M;  2ZM6 M;  1IY1 A;  4WP2 A;  2CV2 A;  1NHW C;  3FUV A;  1WR1 B;  3HU3 A;  1YLA A;  2W82 A;  4DUY M;  2XFT A;  2KA6 B;  1N78 A;  3KP0 E;  4DV6 M;  2YQZ A;  3BBZ A;  2QCU A;  2APL A;  2C9C A;  3KXE C;  3DFZ A;  4M0D A;  4REZ A;  2EKF A;  3PXG A;  3JAM S;  4I5S A;  4DR3 M;  4R3D A;  2CV1 A;  1QUS A;  4OX9 M;  3R9X B;  2OOA A;  2OO9 A;  3MJ5 A;  3SHF A;  5C1B A;  4GHA A;  3JR4 A;  1FJG M;  3VKH A;  1EIJ A;  1R4G A;  1SXJ E;  2K6B A;  2KNA A;  4G6Z A;  4KOD A;  3UMM A;  1HQC A;  3AOE A;  3BXW A;  3L26 A;  7CAT A;  1WXQ A;  4MB7 A;  2YNM D;  2RGH A;  3WHL A;  1E9S A;  2VQE M;  1K3X A;  3U61 A;  1F4I A;  1AIP C;  4IBI A;  2MH8 A;  3VDP A;  1XNR M;  1R2Z A;  1G59 A;  5EP2 A;  2Y0T A;  2VF7 A;  4RF1 A;  4DV7 M;  1IBK M;  2R6F A;  3HY5 A;  4RF0 A;  3HHZ A;  4L4U A;  3E46 A;  4KT0 F;  1XXH E;  3RGS A;  1XHB A;  1OAI A;  2HKJ A;  2I7N A;  2QP9 X;  2EA0 A;  1GJS A;  1HQY E;  3U5Z B;  4KHP M;  3PNY A;  5DNY A;  1I4W A;  5KQD A;  2QBY A;  2ZTC A;  3OTO M;  4CJ6 A;  2QSF X;  2KXE A;  3PVS A;  4FCW A;  4S12 A;  4F1I A;  4DR1 M;  5FLX S;  3SMP A;  3MK6 A;  1WIV A;  2LHG A;  3B9P A;  1N33 M;  1QAO A;  1WGL A;  1EE8 A;  1HT2 E;  4LJA A;  3U6S A;  3ZQJ A;  4L15 A;  1N34 M;  5FTM A;  1VEK A;  2BNK A;  1BVS A;  1QZM A;  2ZAM A;  1PJT A;  1S3S A;  4LFA M;  2UU9 M;  1DGF A;  1Q39 A;  1T6O A;  3GLI B;  1NVM A;  2J7N A;  5EJC A;  4GHL A;  4Z8X A;  3HU1 A;  2CE7 A;  2XSZ A;  4D81 A;  2Y21 A;  2Z4R A;  4K0K M;  3B7N A;  4M9Z A;  1KFV A;  3FTF A;  1QVR A;  4FVM A;  2Z8Y M;  4EIW A;  5IRE B;  1G41 A;  5ITT A;  3DA1 A;  1YE9 A;  3T1H M;  1W5T A;  2CUZ A;  3B7Q A;  2F5N A;  5BPV A;  2R4E A;  3FUX A;  4PDI A;  1NNJ A;  3C3D A;  1QDT A;  2RRU A;  4LJ4 A;  1IN7 A;  3VK8 A;  3A46 A;  5IT9 S;  2XF3 A;  1NNU C;  2DEN A;  1VDD A;  4XGI A;  4B7H A;  3I51 A;  1GJT A;  1JR3 E;  1QQW A;  1V92 A;  3ZH9 B;  1D0M A;  2KRU A;  2XEP A;  2CWB A;  1PM5 A;  2E5L M;  3SYK A;  3J7B A;  2X49 A;  3KVW A;  3U6M A;  4LJ5 A;  4AW4 A;  4LF8 M;  3J27 B;  2JY7 A;  3IEC A;  1LV7 A;  2HL7 A;  2Q2E B;  2DWZ B;  3HJ8 A;  1GAB A;  3LVV A;  3U60 A;  1N75 A;  2DZL A;  2BWE A;  2VF8 A;  4QHS A;  1SXJ A;  3HJQ A;  4I8O A;  3RFW A;  2M5Z A;  3GLG E;  1UFZ A;  4R71 A;  1G71 A;  3LMM A;  4M9S A;  1IBL M;  4B3T M;  3RGP A;  4X62 M;  1XMQ M;  1L2D A;  4DV1 M;  2KNZ A;  4D82 A; 
#chains in the Genus database with same CATH homology
 1C1K A;  5KO3 A;  2C5R A;  2Z3X A;  3M0E A;  4PDG A;  3NBI A;  5ITR A;  5ITU A;  2LWX A;  3W0F A;  1K3W A;  4NRW A;  2CV0 A;  4WUR A;  5FTK A;  1G4A E;  4NL4 H;  2R4J A;  2F5S A;  3KOW E;  4IBE A;  4R7G A;  4JI8 M;  1SXJ C;  3GRY A;  4LF4 M;  1G8P A;  1XC8 A;  1IN4 A;  1DGB A;  1QAM A;  4QOZ C;  4AQY M;  3L27 A;  1OJL A;  2A5Y B;  3UZU A;  3KOX E;  3Q8X A;  1UM8 A;  1IY0 A;  2V6Z M;  3GQ5 A;  1HT1 E;  4OVZ B;  1DGH A;  4I4L A;  4LZJ A;  3GPX A;  2F4V M;  3D8L A;  4OU7 A;  3CTW B;  4GRI A;  2DWL A;  3L2A A;  2QEN A;  3SC3 A;  2OQ4 A;  4IBG A;  4JI7 M;  2CEA A;  4FCV A;  3AOG A;  4PD2 A;  4LF9 M;  4DR6 M;  1J5E M;  3J81 S;  3SHG B;  4GC9 A;  3VLF B;  3MHV C;  3KFU G;  3GRU A;  2L6O A;  3FD9 A;  3DOA A;  2QPA A;  2Y0Q A;  2C96 A;  1G3I A;  4X64 M;  1NJF A;  3GPY A;  1IM2 A;  3M6A A;  3L25 A;  1IXZ A;  4LFC M;  4KO8 A;  2CFO A;  4P16 A;  4AG5 A;  3GLH B;  2RKO A;  4JN6 A;  2AHM A;  4RNA A;  5EP3 A;  5IZ7 D;  1X37 A;  4G4R A;  1JR3 A;  4JI1 M;  3KSX A;  3AV0 A;  1IN8 A;  4HLQ A;  3U6E A;  1DGG A;  5FTL A;  3AOE C;  4PT5 A;  5LMU M;  1QAN A;  4DR4 M;  1NSF A;  2XSZ D;  5JI2 E;  2L7H A;  3GLF B;  4QNM A;  3U6P A;  2UXD M;  3LVW A;  4CGY B;  3GO8 A;  4JI2 M;  4XBO A;  1K82 A;  1L2B A;  3VK7 A;  2DWN A;  1MU5 A;  3GLG A;  4X66 M;  3SAT A;  4B3S M;  2XZU A;  2R62 A;  3HU2 A;  2D7E A;  4JYA M;  1N77 A;  3K1J A;  4BBA A;  4NSO B;  2ZBK B;  4LRT A;  3KP1 E;  4DV2 M;  1TDZ A;  1IBM M;  3LQQ A;  4MH0 E;  2DHR A;  4GC5 A;  1KYI A;  2F5P A;  1DO2 A;  4JI6 M;  3KOZ E;  1L1Z A;  3KSJ A;  2DVW B;  3HHX A;  1XMO M;  4AZF A;  3EIH A;  5EP1 A;  2P5T A;  3BOS A;  3GRV A;  4IBC A;  2X4A A;  3M7G A;  3RE8 A;  3H4M A;  2RGO A;  5DYI A;  4PCZ A;  2HCB A;  1SXJ D;  2FE8 A;  4DV0 M;  4JI4 M;  3FTD A;  3SAR A;  3FTE A;  3HHY A;  4JI5 M;  1ZAE A;  3U61 B;  1GLN A;  4KLN A;  1Q3B A;  1IN6 A;  3UK6 A;  5E6J A;  3SAV A;  2V1C A;  5ITX E;  2R45 A;  2KW0 A;  3L29 A;  2L7I A;  3K2L A;  4LGM A;  3VFD A;  4A3V B;  2NQ8 C;  4NRV A;  1TH2 A;  4LCB A;  4B3R M;  4FW9 A;  2QBY B;  4B3M M;  1GL6 A;  1TGU A;  2BJV A;  2DWM A;  4WW0 A;  1QAQ A;  4CHT B;  4JI0 M;  3FYD A;  3AJI B;  4DR2 M;  3I4V A;  4B7G A;  4FWH A;  2ZAO A;  4FD2 A;  3U6L A;  1NY6 A;  2UUB M;  4MGZ E;  3SYL A;  3TWL A;  2R18 A;  5FSW A;  2KRK A;  1PJI A;  1FNN A;  1YUB A;  2R46 A;  4NXN M;  3KW6 A;  3ZCB B;  1IXR C;  4IBK A;  2FFJ A;  2UXB M;  2Y20 A;  1HNZ M;  3FTC A;  2FOI C;  2C98 A;  4TUW A;  1H6U A;  2DXI A;  4GIP A;  3U6C A;  4BB9 A;  8CAT A;  4W5W A;  5DYG A;  5BR8 M;  2KZU A;  3K8Z A;  3ILK A;  4AKH A;  3CF0 A;  4HL4 A;  1ZQ9 A;  1I94 M;  3KDS E;  5EXP A;  2H1R A;  2HHH M;  2CHG A;  3U6O A;  5H37 D;  5KPR A;  2XGN A;  2VQF M;  4LFB M;  3U5Z A;  3SAU A;  1E32 A;  4JXJ A;  1Z5A A;  4LF7 M;  4IBF A;  4D80 A;  3FUU A;  3T15 A;  4LF5 M;  4FWG A;  1TDH A;  1ORY B;  2L09 A;  1R6B X;  1XWI A;  4MM3 B;  3C58 A;  3TWM A;  3A45 A;  1PJJ A;  5C18 A;  5ITQ A;  1GL7 A;  2G8L A;  4IBB A;  2VII A;  4LG2 A;  4LGY A;  3TE6 A;  4AKG A;  3FUW A;  3AKZ A;  3VDU A;  4GKK M;  1TH3 A;  1N36 M;  2YR0 A;  3U60 B;  1XNQ M;  1SXJ B;  4L8R C;  2YFQ A;  3GRR A;  4LJ7 A;  1IQP A;  3HGI A;  3IG8 A;  3TQS A;  3GLI A;  4OW0 A;  4DR7 M;  2QZ4 A;  3U6D A;  4FCT A;  1R7R A;  2JA2 A;  4DV3 M;  4B08 A;  2M60 A;  5E26 A;  2EUC A;  3PFI A;  3TWK A;  3WHK A;  4DV4 M;  1IY2 A;  3HKP A;  3J2P B;  2XZF A;  2J7O A;  1XXH B;  3E4R A;  3KOY E;  4GH9 A;  2XH9 A;  5ITX A;  1E94 E;  4LZZ A;  3CF6 E;  4ITQ A;  2K47 A;  2Z7J A;  4X65 M;  3U6Q A;  5A2Q S;  1NY5 A;  3CF2 A;  2XLJ A;  4CIS A;  4IIW A;  2V1U A;  4L78 A;  3HJS A;  5ITY A;  2XFS A;  3AL0 C;  4YY3 M;  3KS4 A;  3JR5 A;  4II7 A;  2DZO B;  1Z5B A;  4Z6Y A;  4IJE A;  1DGH B;  1HNX M;  5KQ8 A;  5GKN A;  2EO2 A;  1YSY A;  4GKJ M;  4QNR A;  1W5S A;  5JI3 E;  1Z6T A;  3GP1 A;  3TPZ A;  4QHT A;  2DZN B;  2UUC M;  1NHG C;  5KPZ A;  3J7A S;  1Z59 A;  5LMN M;  4LJ8 A;  1NJG A;  1Z5C A;  2O5R A;  4MGH A;  3DZD A;  1GKI A;  3KS8 A;  3UJN A;  2UXC M;  1D2N A;  2CHQ A;  3T1Y M;  3T38 A;  3J80 S;  4LY6 A;  3TL4 X;  3VKG A;  3GPU A;  4LJ6 A;  5FTN A;  5F3W A;  2BJW A;  3SBJ A;  3W0L B;  1DO0 A;  3LQR A;  2C9O A;  3I4Y A;  3K92 A;  3D8B A;  4MGY E;  3THG A;  4B7F A;  2KZS A;  4NSR A;  3HHW A;  2I7P A;  3GPP A;  2CHV A;  1N32 M;  4AI6 A;  4LF6 M;  1IN5 A;  4MGI E;  4OVZ A;  2KEB A;  1L8Q A;  3GQ3 A;  2ZAN A;  2G5G X;  5EXT A;  3A98 B;  4I81 A;  3NWL A;  1L2C A;  1Q3C A;  1TH4 A;  1QYR A;  4M0W A;  4AG6 A;  4IBD A;  2F5O A;  5EXS A;  3ZC7 B;  3GLG B;  1IXS B;  1R2Y A;  4MGK E;  4QOS A;  4IBJ A;  4G4Q A;  5FTJ A;  3IG5 A;  1L1T A;  4IJF A;  5EXX A;  2D7G A;  3FYC A;  3AFH A;  4L16 A;  3GQ4 A;  4ZPX A;  2R65 A;  2ERC A;  4G4N A;  2F5Q A;  3HWS A;  4LRS A;  4FWD A;  4NOO B;  3FKE A;  4DUZ M;  3PNV A;  3GLH A;  4DR5 M;  4GMQ A;  1JQJ C;  2Z4S A;  2LH0 A;  1MX0 A;  3EIE A;  1J09 A;  4M9X A;  3SAW A;  2LXE A;  2OPF A;  3SMS A;  3A42 A;  1KSF X;  2UUA M;  2D7H A;  4DV5 M;  1OFI A;  3QAU A;  4JI3 M;  3QWL A;  1XXH A;  3FUT A;  5EQT A;  4BLC A;  1E9R A;  1HR0 M;  1HNW M;  3GLF A;  1JR3 D;  3SAS A;  4AKI A;  2C99 A;  4JV5 M;  2LNH C;  3SFZ A;  3UGJ A;  4LJ9 A;  1GVN A;  2FNA A;  4GIT A;  1OFH A;  4G4O A;  1T3T A;  3L28 A;  3R8F A;  4NXM M;  5EP4 A;  2X8A A;  3E9S A;  5IWA M;  5KPT A;  1J7K A;  4YHH M;  2ZM6 M;  1IY1 A;  2CV2 A;  1NHW C;  3FUV A;  3HU3 A;  2W82 A;  4DUY M;  2XFT A;  2KA6 B;  1N78 A;  3KP0 E;  4DV6 M;  2YQZ A;  2QCU A;  3KXE C;  2C9C A;  3DFZ A;  4M0D A;  4REZ A;  3PXG A;  3JAM S;  4I5S A;  4DR3 M;  4R3D A;  2CV1 A;  4OX9 M;  3R9X B;  3VKH A;  4GHA A;  3MJ5 A;  3SHF A;  5C1B A;  3JR4 A;  1FJG M;  1SXJ E;  4G6Z A;  4KOD A;  3UMM A;  1HQC A;  3AOE A;  3L26 A;  7CAT A;  1WXQ A;  4MB7 A;  2YNM D;  2RGH A;  3WHL A;  1E9S A;  2VQE M;  1K3X A;  3U61 A;  4IBI A;  3VDP A;  1XNR M;  1R2Z A;  1G59 A;  5EP2 A;  2Y0T A;  4RF1 A;  4DV7 M;  1IBK M;  3HHZ A;  4RF0 A;  4L4U A;  3RGS A;  1XHB A;  2HKJ A;  2I7N A;  2QP9 X;  2EA0 A;  1HQY E;  3U5Z B;  4KHP M;  3PNY A;  5DNY A;  1I4W A;  5KQD A;  2QBY A;  3OTO M;  2KXE A;  3PVS A;  4FCW A;  4S12 A;  4DR1 M;  5FLX S;  3SMP A;  3MK6 A;  3B9P A;  1N33 M;  1QAO A;  1EE8 A;  1HT2 E;  4LJA A;  3U6S A;  4L15 A;  1N34 M;  5FTM A;  2BNK A;  1QZM A;  2ZAM A;  1S3S A;  4LFA M;  2UU9 M;  1DGF A;  1Q39 A;  3GLI B;  1NVM A;  2J7N A;  5EJC A;  4GHL A;  4Z8X A;  3HU1 A;  2CE7 A;  2XSZ A;  4D81 A;  2Y21 A;  2Z4R A;  4K0K M;  4M9Z A;  1KFV A;  3FTF A;  1QVR A;  4FVM A;  4EIW A;  5IRE B;  1G41 A;  5ITT A;  3DA1 A;  1YE9 A;  3T1H M;  1W5T A;  2CUZ A;  2F5N A;  5BPV A;  2R4E A;  3FUX A;  4PDI A;  1NNJ A;  4LJ4 A;  1IN7 A;  3VK8 A;  3A46 A;  5IT9 S;  2XF3 A;  1NNU C;  1VDD A;  4XGI A;  4B7H A;  3I51 A;  1QQW A;  3ZH9 B;  2KRU A;  2XEP A;  1PM5 A;  2E5L M;  3SYK A;  3J7B A;  2X49 A;  3KVW A;  3U6M A;  4LJ5 A;  4AW4 A;  4LF8 M;  3J27 B;  1LV7 A;  2HL7 A;  2Q2E B;  2DWZ B;  3HJ8 A;  3LVV A;  3U60 A;  1N75 A;  4QHS A;  1SXJ A;  3HJQ A;  4I8O A;  3RFW A;  2M5Z A;  1IBL M;  3LMM A;  4M9S A;  4B3T M;  3RGP A;  4X62 M;  1XMQ M;  1L2D A;  4DV1 M;  4D82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...