1NNUC

Crystal structure analysis of plasmodium falciparum enoyl-acyl-carrier-protein reductase with triclosan analog
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
60
structure length
60
Chain Sequence
YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Elucidation of the Specificity of the Antibacterial Agent Triclosan for Malarial Enoyl Acyl Carrier Protein Reductase
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords enoyl-acyl carrier reductase
total genus 16
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2003-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.400 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nnuC00
1NHGC 1NHWC 1NNUC 2NQ8C 2FOIC
chains in the Genus database with same CATH superfamily
1DGBA 3AL0C 1L8QA 4XGIA 2Z4RA 2MR9A 3J2PB 1ZMVA 1FNNA 4OVZA 1OAOC 7CATA 3KSJA 3HU2A 1WJ7A 1YUBA 2O5RA 2DHRA 4IBCA 3V76A 1G4AE 3A42A 1Z6TA 2O01F 1OFHA 4M0DA 2CHQA 1QQWA 4D82A 4LCBA 4XK8F 3PNVA 1RU3A 1TF0B 1N78A 4LF8M 2LVPC 2J7OA 3J81S 4BBAA 3GO8A 1MU5A 1G41A 3FUUA 3H4MA 3IECA 2LXEA 4CHTB 1NVMA 2CP8A 1BVSA 2BWBA 3KS8A 3FE3A 1DV0A 4YY3M 2BNKA 3E46A 3HHXA 4JXJA 4LJ6A 2JUJA 4W5WA 3QWLA 1NNUC 1DGFA 1GJTA 1KSFX 2DAIA 2QBYA 2CEAA 1MJGM 3HJSA 1KYIA 4IIWA 1N33M 1OKSA 4X62M 2WSCF 3LVVA 2BJVA 2DAGA 2ZM6M 4NRVA 1IXRC 4OW0A 1K3XA 4ITQA 4AI6A 4LGMA 1XMOM 1WIVA 4TUWA 1WXQA 2OO9A 4FCWA 3PXGA 2X8AA 1AIPC 2VDBB 4JI5M 2QENA 2DNAA 2Z7JA 3AV0A 3SBJA 4GC9A 1MN3A 4X64M 3R9XB 4LJ4A 1TH2A 3KP1E 4CGYB 2JNHA 3GLHB 1PJTA 2ZTDA 4NOOB 1E94E 3EIHA 1TDHA 1Z5CA 2Y20A 3UJNA 1HNWM 4JI6M 3W0LB 4X65M 4NL4H 3D8BA 2L6OA 3GP1A 2Y21A 1NHWC 4MGKE 4LZJA 3TPZA 2L09A 1L2BA 1D0MA 5GKNA 2KW0A 3B74A 3U60B 1FJGM 4DUZM 3KP0E 1P3QQ 2KRUA 3FRIA 4GIPA 5EXSA 4B3SM 1GKIA 2QPAA 1F4IA 1AUAA 3VFDA 1GLNA 3R8FA 4JI8M 1IBLM 1NO1A 4HL4A 2DI0A 4LJAA 3J7AS 4BLCA 1VDDA 2KA6B 3GLIA 2DENA 1VEKA 3GLHA 1IBKM 1L1TA 1QZEA 3FUVA 2J7NA 4JV5M 1GJSA 1IY2A 2DVWB 2F4VM 2B3TA 2JA2A 4HLQA 3U6DA 1PJJA 2R4EA 1GL7A 4L8RC 4B3RM 2DZOB 3CF6E 1G8PA 2R0IA 1T43A 2WSFF 4L78A 4DV6M 1DGHB 3GPXA 2UUBM 1EFUB 2LVOC 2MH8A 4FWDA 3SARA 1JQJC 3VKHA 3JAMS 4QOSA 1Z59A 3RGPA 2QBYB 2UXCM 3LW5F 5BR8M 3MK6A 1NY5A 4MH0E 5IZ7D 2ZAOA 4JYAM 1GABA 4FCVA 1HT2E 4DR7M 2C99A 2JY7A 2XFSA 2W82A 3K92A 3L27A 4G6ZA 2R4JA 3SMPA 2EA0A 1SXJB 2CHGA 4IBJA 4NSRA 3TE6A 1WR1B 3KOXE 1YE9A 3JR4A 3PNYA 2QZ4A 3GLGE 3KDSE 2DXIA 2QCUA 2DAKA 3SASA 2KRKA 2LHGA 3W0FA 3TL4X 2DKLA 1QUSA 4RKUF 2X4AA 3LCVB 2APLA 2YFQA 1HJPA 2Y0TA 5DYIA 4X66M 3GPYA 2K0BX 2N35A 4CISA 2HCBA 4I8OA 1IN5A 3GLIB 2H1RA 3FTDA 5LMNM 1R5LA 2CUZA 2KNAA 2RGHA 3HKPA 4FCTA 3HU3A 2H5XA 1IY0A 4IBBA 1J7KA 3HJQA 4BB9A 4Z6YA 3GLGB 4JI7M 1J09A 2R18A 1WHCA 3U61B 2V1UA 4JI0M 1KFVA 2M5ZA 2JXNA 1R2ZA 3L25A 2KNZA 4WP2A 1CUKA 5C18A 4DV1M 2F5SA 4D81A 3HU1A 1X37A 1ZV1A 3T6PA 2JP7A 4LFBM 1OQYA 4CJ6A 2VIIA 5EP1A 5DNYA 3SATA 1IN8A 5FTJA 3IG8A 3KS4A 5EJCA 2DWZB 3TWLA 4B08A 4QHTA 2CWBA 4G4QA 1TGUA 1JR3E 1K82A 2QHOB 4LF7M 1JR3A 3HHZA 1N77A 4II7A 4GHLA 2FH0A 3T1YM 5JI2E 4AZFA 1QVRA 1HNZM 2G5GX 4CIZA 2C5RA 4KT0F 4KHPM 3DOAA 1NV8A 1UM8A 3T15A 1R7RA 3GRVA 2ZANA 4DR5M 4GKKM 3PVSA 3DFZA 3I4YA 5ITXE 4WW0A 4FWGA 5IWAM 5FLXS 1V33A 2VQFM 3U61A 1S3SA 8CATA 1NJFA 2G8LA 3GQ4A 3K2LA 1SXJC 2LHCA 4MM3B 3D8LA 1MX0A 2EUCA 2LNHC 2ZAMA 3NWLA 3THGA 4DR6M 2UXBM 1IQPA 3K1JA 3FYDA 3FUWA 4EIWA 4PDIA 4AQYM 4JI4M 3IG5A 3SYKA 4DV7M 4IBDA 1VEJA 4QNRA 2CV0A 3W68A 3J80S 1ZMUA 3I51A 5FTLA 1N36M 1D2NA 2YQZA 1QZMA 2X49A 2XSZA 5EQTA 4IJEA 2LH0A 1NHGC 4LRTA 5DYGA 5KPTA 3U6EA 3GPUA 3VK8A 1K3WA 4LFCM 2D7HA 1D0LA 4NXNM 1QDTA 2XZUA 2AHMA 1QAQA 4KO8A 1H6UA 4F1IA 5IT9S 5EP3A 1T6OA 4YHHM 2V1CA 1IXSB 5EP4A 1C7YA 1PJSA 5LMUM 3T1HM 3VDUA 1V92A 4LGYA 3BBZA 3U5ZA 3C58A 5EXPA 4DR2M 3E4RA 4LY6A 4OU7A 3TWMA 1Y8GA 1L1ZA 2OOAA 1TTEA 4D80A 3M6AA 2HKJA 1GO5A 2GQFA 2R45A 2MJ5B 4M0WA 1IXSA 3U6QA 3CTWB 1IN4A 1LTMA 1SG9A 2RRUA 3C3DA 2A5YB 3LVWA 3GLFA 4NXMM 4B7HA 3H4JA 1N34M 2LVNC 3AOGA 3J27B 3UGJA 2EO2A 5L8RF 1E32A 2WZJA 4QOZC 3LQRA 2LVAA 3T38A 4M9SA 2XZFA 1HQCA 1W5SA 4NC6A 1PGYA 5EXTA 4A3VB 4AG5A 4NRWA 2LTUA 5JI3E 2Q2EB 1HQYE 5DFLA 3U6CA 3FTFA 3L2AA 3GQ5A 1XXHB 4I81A 1WGLA 2O25A 4Q7JA 4MGYE 1PRBA 3AOEA 3FUXA 4MGZE 1IY1A 3FKEA 4I5SA 2R65A 3NBIA 2FOIC 2DHYA 2G3QA 3I01M 2DZLA 2L7IA 3U60A 4P17A 3U6LA 1QDRA 1IM2A 2LVQD 2YR0A 3GRYA 4R3DA 5E26A 2L7HA 4DBGB 2XFTA 4G4NA 2Y0QA 3ZC7B 2FE8A 1XNQM 4LJ8A 3OTOM 4AKIA 3FD9A 3QYEA 3AKZA 2K47A 2R6FA 2DAEA 3L26A 2KXEA 3I4VA 3I04M 4Y28F 4LF4M 1QUTA 3A46A 1ORYB 2EKFA 3Q8GA 4GH9A 1TH3A 5ITXA 1Q02A 3KW6A 5FTNA 1PJQA 4F2LA 2UUCM 5EXXA 1NSFA 2XSZD 4IBIA 3L28A 2KZUA 3IHPA 4OX9M 2F5NA 3MHVC 4IBFA 1IN6A 3RE8A 2RGOA 5IREB 3CGWA 4WURA 4PDGA 4Z8XA 1QYRA 3DZDA 3W67A 1L2CA 2ERCA 1N75A 3FYCA 1PJIA 3HWSA 4R71A 4B7FA 2L4FA 2XH9A 2ZBKB 4L6V6 1VQ1A 3F92A 3FUTA 2L4EA 4B3TM 4GRIA 4LJ5A 1OFIA 1GVNA 4NSOB 4KODA 4L4UA 3LQQA 4HEOA 4AG6A 1VDLA 2KNVA 3HX3A 4GITA 2KZSA 1YSYA 4REZA 4DV4M 1I4WA 2UU9M 3CF2A 4GMQA 2C96A 4JI2M 1OIZA 5KPRA 1TDZA 3MJ5A 3B9PA 3GLFE 3GPPA 3VDPA 1JB0F 2D7GA 4MGIE 4LF5M 4LF9M 2HL7A 2QSFX 1UFZA 2EJSA 5EP2A 4AW4A 4DR3M 2VF7A 2HWJA 2DWNA 4RF1A 1JR3D 1HT1E 4DUYM 2R44A 3U6OA 3HGIA 3M7GA 4R7GA 1PM5A 1R6BX 5KO3A 4DV2M 4B3MM 3EIEA 1E9SA 1NNJA 3ZCBB 3GLHE 4AKHA 2OOBA 3KSXA 1GL6A 1OAIA 3SHFA 3DA1A 2P5TA 3PFIA 3SFZA 3SAWA 2HAKA 1T3TA 3U6PA 2KDLA 2DAMA 4DR4M 4LG2A 1E9RA 2BWEA 3UZUA 2VQEM 3SYLA 3UK6A 5KQDA 2CFOA 4DV0M 2CRUA 1IXZA 2Z4SA 4B7GA 4RNAA 1XHBA 2CV1A 3E21A 2QQ8A 1NY6A 4LJ7A 5KQ8A 1VEGA 4AKGA 1XXHA 1OJLA 3U5ZB 2FNAA 4ANRA 4LZZA 2BJWA 1N32M 1V34A 4DV5M 3ILKA 4JN6A 3SAUA 3QYBA 3B89A 3LCUA 4JI3M 5ITUA 2MGWA 2FFJA 3BXWA 3U6MA 1IFYA 3K9PA 3SHGB 4UN2B 3TWKA 3UMMA 2KHHA 4KLNA 2KEBA 1VG5A 3RGSA 2V6ZM 2F5OA 1Z5BA 3C9PA 1XB2B 1IBMM 2CV2A 2Z3XA 3FRHA 4LJ9A 1HR0M 1ZQ9A 3LMMA 3RFWA 3GLIE 5FTMA 1A5TA 2L2DA 3SMSA 3GQ3A 2Z8YM 2DWLA 3BOSA 3KOYE 2QP9X 3VK7A 2JZ0A 3HHWA 1C1KA 3GRUA 3QAUA 4GKJM 1DGGA 1IN7A 1SXJA 1XWIA 1OIPA 1G71A 2MROB 2FS1A 3AFHA 5ITYA 1SXJD 1EIJA 2LWXA 1LV7A 2RKOA 2K6BA 1DO2A 3KVWA 3VLFB 3B7ZA 2JWSA 2M60A 2OQ4A 4PT5A 2K9DA 5BPVA 1Q3CA 1WGNA 3Q8XA 3KFUG 5FSWA 2R46A 3CF0A 1SXJE 1ZMWA 4DR1M 2UUAM 2JZ1A 1QAOA 3B7NA 4G4OA 2F5QA 3AOEC 1J5EM 1QAMA 3AJIB 3SC3A 2DZNB 1Q39A 2OPFA 5F3WA 1L2DA 4LF6M 2C9CA 1DO0A 3HHYA 2ZTCA 5FTKA 1HNXM 4G3OA 3E9SA 4LFAM 2QNJA 2LBCA 3HJ8A 4MGHA 1TR8A 1NJGA 1DGHA 3M0EA 3ZQJA 5ITTA 1R4GA 2VF8A 3KXEC 4L16A 4OVZB 4IBEA 2E5LM 4L15A 4MB7A 4DV3M 2F5PA 3A98B 2CHVA 1TH4A 2I7PA 2XEPA 4IBKA 2XLJA 4FVMA 4I4LA 3L29A 3FTEA 1QANA 3SAVA 2WSEF 3K9OA 2CE7A 4QNMA 2JY8A 4QHSA 1ZAEA 4RF0A 3B7QA 5C1BA 2XGNA 4LRSA 4PD2A 4GHAA 1YLAA 1D0KA 2YNMD 5H37D 4JI1M 4M9ZA 3MMPA 3GLGA 4FWHA 3WHLA 2JY5A 3JR5A 3K8ZA 1W5TA 1EE8A 2J5YA 1XXHE 4FD2A 2UXDM 3U6SA 1Q3BA 4K0KM 4FW9A 3GLFB 2I7NA 1I94M 5E6JA 1XNRM 4IBGA 2C98A 1OTRA 4XBOA 4PCZA 4IJFA 3A45A 4S12A 1Z5AA 4GEWA 5ITRA 3HY5A 3HZJA 4ZPXA 5A2QS 2C9OA 3WHKA 5KPZA 2HHHM 1G59A 3NBXX 2R62A 3KOWE 4M9XA 3TQSA 2NQ8C 3J7BA 4GC5A 2D7EA 2XF3A 1XC8A 3C3EA 3ZH9B 2JY6B 2DWMA 3GRRA 1NV9A 4P16A 5ITQA 2GNOA 3VKGA 4G4RA 3KOZE 2EKKA 1XMQM 1G3IA 1R2YA 3FTCA
chains in the Genus database with same CATH topology
1DGBA 3AL0C 1L8QA 4XGIA 2Z4RA 3J2PB 1FNNA 4OVZA 7CATA 3KSJA 3HU2A 1YUBA 2O5RA 2DHRA 4IBCA 1G4AE 3A42A 1Z6TA 1OFHA 4M0DA 2CHQA 1QQWA 4D82A 4LCBA 3PNVA 1N78A 4LF8M 2J7OA 3J81S 4BBAA 3GO8A 1MU5A 1G41A 3FUUA 3H4MA 4CHTB 2LXEA 1NVMA 3KS8A 4YY3M 2BNKA 3HHXA 4JXJA 4LJ6A 4W5WA 3QWLA 1KSFX 1DGFA 1NNUC 2QBYA 2CEAA 4IIWA 3HJSA 1KYIA 1N33M 4X62M 3LVVA 2BJVA 2ZM6M 1K3XA 4NRVA 1IXRC 4OW0A 4ITQA 4AI6A 4LGMA 1XMOM 4TUWA 1WXQA 4FCWA 3PXGA 2X8AA 3R9XB 4JI5M 2QENA 2Z7JA 3AV0A 3SBJA 4GC9A 4X64M 4LJ4A 1TH2A 3KP1E 4CGYB 3GLHB 4NOOB 1E94E 3EIHA 1TDHA 1Z5CA 2Y20A 3UJNA 1HNWM 4JI6M 3W0LB 4X65M 4NL4H 3D8BA 2L6OA 3GP1A 2Y21A 1NHWC 4MGKE 4LZJA 3TPZA 2L09A 1L2BA 5GKNA 2KW0A 3U60B 1FJGM 4DUZM 3KP0E 2KRUA 4GIPA 5EXSA 4B3SM 1GKIA 2QPAA 3VFDA 1GLNA 3R8FA 4JI8M 1IBLM 4HL4A 4LJAA 3J7AS 4BLCA 1VDDA 2KA6B 3GLIA 3GLHA 1IBKM 1L1TA 3FUVA 2J7NA 4JV5M 1IY2A 2DVWB 2F4VM 2JA2A 4HLQA 3U6DA 1PJJA 2R4EA 1GL7A 4L8RC 4B3RM 2DZOB 3CF6E 1G8PA 4L78A 4DV6M 1DGHB 3GPXA 2UUBM 4FWDA 3SARA 1JQJC 3VKHA 3JAMS 4QOSA 1Z59A 3RGPA 2QBYB 2UXCM 5BR8M 3MK6A 1NY5A 4MH0E 5IZ7D 2ZAOA 4JYAM 4FCVA 1HT2E 4DR7M 2C99A 3K92A 2XFSA 3L27A 2W82A 4G6ZA 2EA0A 2R4JA 3SMPA 1SXJB 2CHGA 4IBJA 4NSRA 3TE6A 3KOXE 1YE9A 3JR4A 3PNYA 2QZ4A 2DXIA 3KDSE 2QCUA 3SASA 2KRKA 3W0FA 3TL4X 2X4AA 2YFQA 4X66M 2Y0TA 5DYIA 3GPYA 4CISA 4NXMM 4OX9M 2HCBA 4I8OA 1IN5A 3GLIB 2H1RA 3FTDA 5LMNM 2CUZA 3HKPA 4FCTA 2RGHA 3HU3A 1IY0A 4IBBA 1J7KA 3HJQA 4BB9A 4Z6YA 3GLGB 4JI7M 1J09A 2R18A 3U61B 2V1UA 4JI0M 1KFVA 2M5ZA 1R2ZA 3L25A 5C18A 4DV1M 2F5SA 4D81A 3HU1A 1X37A 4LFBM 2VIIA 5EP1A 5DNYA 3SATA 1IN8A 5FTJA 3IG8A 3KS4A 5EJCA 2DWZB 3TWLA 4B08A 4QHTA 4G4QA 1TGUA 1K82A 4LF7M 1JR3A 3HHZA 1N77A 4II7A 4GHLA 3T1YM 5JI2E 4AZFA 1QVRA 1HNZM 2G5GX 2C5RA 4KHPM 3DOAA 1UM8A 3T15A 1R7RA 3GRVA 2ZANA 4DR5M 4GKKM 3PVSA 3DFZA 3I4YA 5ITXE 4WW0A 4FWGA 5IWAM 5FLXS 2VQFM 3U61A 1S3SA 8CATA 1NJFA 2G8LA 3GQ4A 3K2LA 1SXJC 4MM3B 3D8LA 1MX0A 2EUCA 2LNHC 2ZAMA 3NWLA 3THGA 4DR6M 2UXBM 1IQPA 3K1JA 3FYDA 3FUWA 4EIWA 4PDIA 4AQYM 4JI4M 3IG5A 3SYKA 4DV7M 4IBDA 2CV0A 4QNRA 3J80S 3I51A 5FTLA 1N36M 1D2NA 2YQZA 1QZMA 2X49A 2XSZA 5EQTA 4IJEA 2LH0A 1NHGC 4LRTA 5DYGA 5KPTA 3U6EA 3GPUA 3VK8A 1K3WA 4LFCM 2D7HA 4NXNM 2XZUA 2AHMA 1QAQA 4KO8A 1H6UA 5IT9S 5EP3A 4YHHM 2V1CA 1IXSB 5EP4A 5LMUM 3T1HM 3VDUA 4LGYA 3U5ZA 3C58A 5EXPA 4DR2M 3E4RA 4LY6A 4OU7A 3TWMA 1L1ZA 4D80A 3M6AA 2HKJA 2R45A 4M0WA 3U6QA 3CTWB 1IN4A 2A5YB 3LVWA 3GLFA 4B7HA 1N34M 3AOGA 3UGJA 3J27B 2EO2A 1E32A 4QOZC 3LQRA 3T38A 4M9SA 2XZFA 1HQCA 1W5SA 4NRWA 5EXTA 4A3VB 4AG5A 5JI3E 2Q2EB 1HQYE 3U6CA 3FTFA 3L2AA 3GQ5A 1XXHB 4I81A 4MGYE 3AOEA 3FUXA 4MGZE 1IY1A 3FKEA 4I5SA 2R65A 3NBIA 2FOIC 2L7IA 3U60A 3U6LA 1IM2A 2YR0A 3GRYA 4R3DA 5E26A 2L7HA 2XFTA 4G4NA 2Y0QA 3ZC7B 2FE8A 1XNQM 4LJ8A 3OTOM 4AKIA 3FD9A 3AKZA 2K47A 3L26A 2KXEA 3I4VA 4LF4M 3A46A 1ORYB 4GH9A 1TH3A 5ITXA 3KW6A 5FTNA 2UUCM 5EXXA 1NSFA 2XSZD 4IBIA 3L28A 2KZUA 2F5NA 3MHVC 4IBFA 1IN6A 3RE8A 2RGOA 5IREB 4WURA 4PDGA 4Z8XA 1QYRA 3DZDA 1L2CA 2ERCA 1N75A 3FYCA 1PJIA 3HWSA 4B7FA 2XH9A 2ZBKB 3FUTA 4B3TM 4GRIA 4LJ5A 1OFIA 1GVNA 4NSOB 4KODA 4L4UA 3LQQA 4AG6A 4GITA 2KZSA 1YSYA 4REZA 4DV4M 1I4WA 2UU9M 3CF2A 4GMQA 2C96A 4JI2M 5KPRA 1TDZA 3MJ5A 3B9PA 3GPPA 3VDPA 2D7GA 4MGIE 4LF5M 4LF9M 2HL7A 5EP2A 4AW4A 4DR3M 2DWNA 4RF1A 1JR3D 1HT1E 4DUYM 3U6OA 3HGIA 3M7GA 4R7GA 1PM5A 1R6BX 5KO3A 4DV2M 4B3MM 3EIEA 1E9SA 1NNJA 3ZCBB 4AKHA 3KSXA 1GL6A 3SHFA 3SFZA 3DA1A 2P5TA 3PFIA 3SAWA 1T3TA 3U6PA 4DR4M 4LG2A 1E9RA 4DV0M 3UZUA 2VQEM 3SYLA 3UK6A 5KQDA 2CFOA 2Z4SA 1IXZA 4B7GA 4RNAA 1XHBA 2CV1A 1NY6A 4LJ7A 5KQ8A 4AKGA 1XXHA 1OJLA 3U5ZB 2FNAA 4LZZA 2BJWA 1N32M 4DV5M 3ILKA 4JN6A 3SAUA 4JI3M 5ITUA 2FFJA 3U6MA 3SHGB 3TWKA 3UMMA 4KLNA 2KEBA 3RGSA 2V6ZM 2F5OA 1Z5BA 1IBMM 2CV2A 2Z3XA 4LJ9A 1HR0M 1ZQ9A 3LMMA 3RFWA 5FTMA 3SMSA 3GQ3A 2DWLA 3BOSA 3KOYE 2QP9X 3VK7A 3HHWA 1C1KA 3GRUA 3QAUA 4GKJM 1DGGA 1IN7A 1SXJA 1XWIA 3AFHA 5ITYA 1SXJD 2LWXA 1LV7A 2RKOA 1DO2A 3KVWA 3VLFB 2M60A 2OQ4A 4PT5A 5BPVA 1Q3CA 3Q8XA 3KFUG 5FSWA 2R46A 3CF0A 1SXJE 4DR1M 2UUAM 1QAOA 4G4OA 2F5QA 3AOEC 1J5EM 1QAMA 3AJIB 3SC3A 2DZNB 1Q39A 2OPFA 5F3WA 1L2DA 4LF6M 2C9CA 1DO0A 3HHYA 1HNXM 5FTKA 3E9SA 4LFAM 3HJ8A 4MGHA 3M0EA 1NJGA 1DGHA 5ITTA 3KXEC 4L16A 4OVZB 4IBEA 2E5LM 4L15A 4MB7A 4DV3M 2F5PA 3A98B 2CHVA 1TH4A 2I7PA 2XEPA 4IBKA 2XLJA 4FVMA 4I4LA 3L29A 3FTEA 1QANA 3SAVA 2CE7A 4QNMA 4QHSA 1ZAEA 4RF0A 5C1BA 4GHAA 2XGNA 4LRSA 4PD2A 4JI1M 2YNMD 5H37D 4M9ZA 3GLGA 4FWHA 3WHLA 3JR5A 3K8ZA 1W5TA 1EE8A 4FD2A 2UXDM 3U6SA 1Q3BA 4K0KM 4FW9A 3GLFB 2I7NA 1I94M 5E6JA 1XNRM 4IBGA 2C98A 4XBOA 4PCZA 4IJFA 3A45A 4S12A 1Z5AA 5ITRA 4ZPXA 5A2QS 2C9OA 3WHKA 5KPZA 2HHHM 1G59A 2R62A 3KOWE 4M9XA 3TQSA 4GC5A 2NQ8C 3J7BA 2D7EA 2XF3A 1XC8A 3ZH9B 2DWMA 3GRRA 4P16A 5ITQA 3VKGA 4G4RA 3KOZE 1XMQM 1G3IA 1R2YA 3FTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHG C;  1NHW C;  1NNU C;  2NQ8 C;  2FOI C; 
#chains in the Genus database with same CATH topology
 1DGB A;  3AL0 C;  1L8Q A;  4XGI A;  2Z4R A;  2MR9 A;  3J2P B;  1ZMV A;  1FNN A;  4OVZ A;  1OAO C;  7CAT A;  3KSJ A;  3HU2 A;  1WJ7 A;  1YUB A;  2O5R A;  2DHR A;  4IBC A;  3V76 A;  1G4A E;  3A42 A;  1Z6T A;  2O01 F;  1OFH A;  4M0D A;  2CHQ A;  1QQW A;  4D82 A;  4LCB A;  4XK8 F;  3PNV A;  1RU3 A;  1TF0 B;  1N78 A;  4LF8 M;  2LVP C;  2J7O A;  3J81 S;  4BBA A;  3GO8 A;  1MU5 A;  1G41 A;  3FUU A;  3H4M A;  3IEC A;  2LXE A;  4CHT B;  1NVM A;  2CP8 A;  1BVS A;  2BWB A;  3KS8 A;  3FE3 A;  1DV0 A;  4YY3 M;  2BNK A;  3E46 A;  3HHX A;  4JXJ A;  4LJ6 A;  2JUJ A;  4W5W A;  3QWL A;  1NNU C;  1DGF A;  1GJT A;  1KSF X;  2DAI A;  2QBY A;  2CEA A;  1MJG M;  3HJS A;  1KYI A;  4IIW A;  1N33 M;  1OKS A;  4X62 M;  2WSC F;  3LVV A;  2BJV A;  2DAG A;  2ZM6 M;  4NRV A;  1IXR C;  4OW0 A;  1K3X A;  4ITQ A;  4AI6 A;  4LGM A;  1XMO M;  1WIV A;  4TUW A;  1WXQ A;  2OO9 A;  4FCW A;  3PXG A;  2X8A A;  1AIP C;  2VDB B;  4JI5 M;  2QEN A;  2DNA A;  2Z7J A;  3AV0 A;  3SBJ A;  4GC9 A;  1MN3 A;  4X64 M;  3R9X B;  4LJ4 A;  1TH2 A;  3KP1 E;  4CGY B;  2JNH A;  3GLH B;  1PJT A;  2ZTD A;  4NOO B;  1E94 E;  3EIH A;  1TDH A;  1Z5C A;  2Y20 A;  3UJN A;  1HNW M;  4JI6 M;  3W0L B;  4X65 M;  4NL4 H;  3D8B A;  2L6O A;  3GP1 A;  2Y21 A;  1NHW C;  4MGK E;  4LZJ A;  3TPZ A;  2L09 A;  1L2B A;  1D0M A;  5GKN A;  2KW0 A;  3B74 A;  3U60 B;  1FJG M;  4DUZ M;  3KP0 E;  1P3Q Q;  2KRU A;  3FRI A;  4GIP A;  5EXS A;  4B3S M;  1GKI A;  2QPA A;  1F4I A;  1AUA A;  3VFD A;  1GLN A;  3R8F A;  4JI8 M;  1IBL M;  1NO1 A;  4HL4 A;  2DI0 A;  4LJA A;  3J7A S;  4BLC A;  1VDD A;  2KA6 B;  3GLI A;  2DEN A;  1VEK A;  3GLH A;  1IBK M;  1L1T A;  1QZE A;  3FUV A;  2J7N A;  4JV5 M;  1GJS A;  1IY2 A;  2DVW B;  2F4V M;  2B3T A;  2JA2 A;  4HLQ A;  3U6D A;  1PJJ A;  2R4E A;  1GL7 A;  4L8R C;  4B3R M;  2DZO B;  3CF6 E;  1G8P A;  2R0I A;  1T43 A;  2WSF F;  4L78 A;  4DV6 M;  1DGH B;  3GPX A;  2UUB M;  1EFU B;  2LVO C;  2MH8 A;  4FWD A;  3SAR A;  1JQJ C;  3VKH A;  3JAM S;  4QOS A;  1Z59 A;  3RGP A;  2QBY B;  2UXC M;  3LW5 F;  5BR8 M;  3MK6 A;  1NY5 A;  4MH0 E;  5IZ7 D;  2ZAO A;  4JYA M;  1GAB A;  4FCV A;  1HT2 E;  4DR7 M;  2C99 A;  2JY7 A;  2XFS A;  2W82 A;  3K92 A;  3L27 A;  4G6Z A;  2R4J A;  3SMP A;  2EA0 A;  1SXJ B;  2CHG A;  4IBJ A;  4NSR A;  3TE6 A;  1WR1 B;  3KOX E;  1YE9 A;  3JR4 A;  3PNY A;  2QZ4 A;  3GLG E;  3KDS E;  2DXI A;  2QCU A;  2DAK A;  3SAS A;  2KRK A;  2LHG A;  3W0F A;  3TL4 X;  2DKL A;  1QUS A;  4RKU F;  2X4A A;  3LCV B;  2APL A;  2YFQ A;  1HJP A;  2Y0T A;  5DYI A;  4X66 M;  3GPY A;  2K0B X;  2N35 A;  4CIS A;  2HCB A;  4I8O A;  1IN5 A;  3GLI B;  2H1R A;  3FTD A;  5LMN M;  1R5L A;  2CUZ A;  2KNA A;  2RGH A;  3HKP A;  4FCT A;  3HU3 A;  2H5X A;  1IY0 A;  4IBB A;  1J7K A;  3HJQ A;  4BB9 A;  4Z6Y A;  3GLG B;  4JI7 M;  1J09 A;  2R18 A;  1WHC A;  3U61 B;  2V1U A;  4JI0 M;  1KFV A;  2M5Z A;  2JXN A;  1R2Z A;  3L25 A;  2KNZ A;  4WP2 A;  1CUK A;  5C18 A;  4DV1 M;  2F5S A;  4D81 A;  3HU1 A;  1X37 A;  1ZV1 A;  3T6P A;  2JP7 A;  4LFB M;  1OQY A;  4CJ6 A;  2VII A;  5EP1 A;  5DNY A;  3SAT A;  1IN8 A;  5FTJ A;  3IG8 A;  3KS4 A;  5EJC A;  2DWZ B;  3TWL A;  4B08 A;  4QHT A;  2CWB A;  4G4Q A;  1TGU A;  1JR3 E;  1K82 A;  2QHO B;  4LF7 M;  1JR3 A;  3HHZ A;  1N77 A;  4II7 A;  4GHL A;  2FH0 A;  3T1Y M;  5JI2 E;  4AZF A;  1QVR A;  1HNZ M;  2G5G X;  4CIZ A;  2C5R A;  4KT0 F;  4KHP M;  3DOA A;  1NV8 A;  1UM8 A;  3T15 A;  1R7R A;  3GRV A;  2ZAN A;  4DR5 M;  4GKK M;  3PVS A;  3DFZ A;  3I4Y A;  5ITX E;  4WW0 A;  4FWG A;  5IWA M;  5FLX S;  1V33 A;  2VQF M;  3U61 A;  1S3S A;  8CAT A;  1NJF A;  2G8L A;  3GQ4 A;  3K2L A;  1SXJ C;  2LHC A;  4MM3 B;  3D8L A;  1MX0 A;  2EUC A;  2LNH C;  2ZAM A;  3NWL A;  3THG A;  4DR6 M;  2UXB M;  1IQP A;  3K1J A;  3FYD A;  3FUW A;  4EIW A;  4PDI A;  4AQY M;  4JI4 M;  3IG5 A;  3SYK A;  4DV7 M;  4IBD A;  1VEJ A;  4QNR A;  2CV0 A;  3W68 A;  3J80 S;  1ZMU A;  3I51 A;  5FTL A;  1N36 M;  1D2N A;  2YQZ A;  1QZM A;  2X49 A;  2XSZ A;  5EQT A;  4IJE A;  2LH0 A;  1NHG C;  4LRT A;  5DYG A;  5KPT A;  3U6E A;  3GPU A;  3VK8 A;  1K3W A;  4LFC M;  2D7H A;  1D0L A;  4NXN M;  1QDT A;  2XZU A;  2AHM A;  1QAQ A;  4KO8 A;  1H6U A;  4F1I A;  5IT9 S;  5EP3 A;  1T6O A;  4YHH M;  2V1C A;  1IXS B;  5EP4 A;  1C7Y A;  1PJS A;  5LMU M;  3T1H M;  3VDU A;  1V92 A;  4LGY A;  3BBZ A;  3U5Z A;  3C58 A;  5EXP A;  4DR2 M;  3E4R A;  4LY6 A;  4OU7 A;  3TWM A;  1Y8G A;  1L1Z A;  2OOA A;  1TTE A;  4D80 A;  3M6A A;  2HKJ A;  1GO5 A;  2GQF A;  2R45 A;  2MJ5 B;  4M0W A;  1IXS A;  3U6Q A;  3CTW B;  1IN4 A;  1LTM A;  1SG9 A;  2RRU A;  3C3D A;  2A5Y B;  3LVW A;  3GLF A;  4NXM M;  4B7H A;  3H4J A;  1N34 M;  2LVN C;  3AOG A;  3J27 B;  3UGJ A;  2EO2 A;  5L8R F;  1E32 A;  2WZJ A;  4QOZ C;  3LQR A;  2LVA A;  3T38 A;  4M9S A;  2XZF A;  1HQC A;  1W5S A;  4NC6 A;  1PGY A;  5EXT A;  4A3V B;  4AG5 A;  4NRW A;  2LTU A;  5JI3 E;  2Q2E B;  1HQY E;  5DFL A;  3U6C A;  3FTF A;  3L2A A;  3GQ5 A;  1XXH B;  4I81 A;  1WGL A;  2O25 A;  4Q7J A;  4MGY E;  1PRB A;  3AOE A;  3FUX A;  4MGZ E;  1IY1 A;  3FKE A;  4I5S A;  2R65 A;  3NBI A;  2FOI C;  2DHY A;  2G3Q A;  3I01 M;  2DZL A;  2L7I A;  3U60 A;  4P17 A;  3U6L A;  1QDR A;  1IM2 A;  2LVQ D;  2YR0 A;  3GRY A;  4R3D A;  5E26 A;  2L7H A;  4DBG B;  2XFT A;  4G4N A;  2Y0Q A;  3ZC7 B;  2FE8 A;  1XNQ M;  4LJ8 A;  3OTO M;  4AKI A;  3FD9 A;  3QYE A;  3AKZ A;  2K47 A;  2R6F A;  2DAE A;  3L26 A;  2KXE A;  3I4V A;  3I04 M;  4Y28 F;  4LF4 M;  1QUT A;  3A46 A;  1ORY B;  2EKF A;  3Q8G A;  4GH9 A;  1TH3 A;  5ITX A;  1Q02 A;  3KW6 A;  5FTN A;  1PJQ A;  4F2L A;  2UUC M;  5EXX A;  1NSF A;  2XSZ D;  4IBI A;  3L28 A;  2KZU A;  3IHP A;  4OX9 M;  2F5N A;  3MHV C;  4IBF A;  1IN6 A;  3RE8 A;  2RGO A;  5IRE B;  3CGW A;  4WUR A;  4PDG A;  4Z8X A;  1QYR A;  3DZD A;  3W67 A;  1L2C A;  2ERC A;  1N75 A;  3FYC A;  1PJI A;  3HWS A;  4R71 A;  4B7F A;  2L4F A;  2XH9 A;  2ZBK B;  4L6V 6;  1VQ1 A;  3F92 A;  3FUT A;  2L4E A;  4B3T M;  4GRI A;  4LJ5 A;  1OFI A;  1GVN A;  4NSO B;  4KOD A;  4L4U A;  3LQQ A;  4HEO A;  4AG6 A;  1VDL A;  2KNV A;  3HX3 A;  4GIT A;  2KZS A;  1YSY A;  4REZ A;  4DV4 M;  1I4W A;  2UU9 M;  3CF2 A;  4GMQ A;  2C96 A;  4JI2 M;  1OIZ A;  5KPR A;  1TDZ A;  3MJ5 A;  3B9P A;  3GLF E;  3GPP A;  3VDP A;  1JB0 F;  2D7G A;  4MGI E;  4LF5 M;  4LF9 M;  2HL7 A;  2QSF X;  1UFZ A;  2EJS A;  5EP2 A;  4AW4 A;  4DR3 M;  2VF7 A;  2HWJ A;  2DWN A;  4RF1 A;  1JR3 D;  1HT1 E;  4DUY M;  2R44 A;  3U6O A;  3HGI A;  3M7G A;  4R7G A;  1PM5 A;  1R6B X;  5KO3 A;  4DV2 M;  4B3M M;  3EIE A;  1E9S A;  1NNJ A;  3ZCB B;  3GLH E;  4AKH A;  2OOB A;  3KSX A;  1GL6 A;  1OAI A;  3SHF A;  3DA1 A;  2P5T A;  3PFI A;  3SFZ A;  3SAW A;  2HAK A;  1T3T A;  3U6P A;  2KDL A;  2DAM A;  4DR4 M;  4LG2 A;  1E9R A;  2BWE A;  3UZU A;  2VQE M;  3SYL A;  3UK6 A;  5KQD A;  2CFO A;  4DV0 M;  2CRU A;  1IXZ A;  2Z4S A;  4B7G A;  4RNA A;  1XHB A;  2CV1 A;  3E21 A;  2QQ8 A;  1NY6 A;  4LJ7 A;  5KQ8 A;  1VEG A;  4AKG A;  1XXH A;  1OJL A;  3U5Z B;  2FNA A;  4ANR A;  4LZZ A;  2BJW A;  1N32 M;  1V34 A;  4DV5 M;  3ILK A;  4JN6 A;  3SAU A;  3QYB A;  3B89 A;  3LCU A;  4JI3 M;  5ITU A;  2MGW A;  2FFJ A;  3BXW A;  3U6M A;  1IFY A;  3K9P A;  3SHG B;  4UN2 B;  3TWK A;  3UMM A;  2KHH A;  4KLN A;  2KEB A;  1VG5 A;  3RGS A;  2V6Z M;  2F5O A;  1Z5B A;  3C9P A;  1XB2 B;  1IBM M;  2CV2 A;  2Z3X A;  3FRH A;  4LJ9 A;  1HR0 M;  1ZQ9 A;  3LMM A;  3RFW A;  3GLI E;  5FTM A;  1A5T A;  2L2D A;  3SMS A;  3GQ3 A;  2Z8Y M;  2DWL A;  3BOS A;  3KOY E;  2QP9 X;  3VK7 A;  2JZ0 A;  3HHW A;  1C1K A;  3GRU A;  3QAU A;  4GKJ M;  1DGG A;  1IN7 A;  1SXJ A;  1XWI A;  1OIP A;  1G71 A;  2MRO B;  2FS1 A;  3AFH A;  5ITY A;  1SXJ D;  1EIJ A;  2LWX A;  1LV7 A;  2RKO A;  2K6B A;  1DO2 A;  3KVW A;  3VLF B;  3B7Z A;  2JWS A;  2M60 A;  2OQ4 A;  4PT5 A;  2K9D A;  5BPV A;  1Q3C A;  1WGN A;  3Q8X A;  3KFU G;  5FSW A;  2R46 A;  3CF0 A;  1SXJ E;  1ZMW A;  4DR1 M;  2UUA M;  2JZ1 A;  1QAO A;  3B7N A;  4G4O A;  2F5Q A;  3AOE C;  1J5E M;  1QAM A;  3AJI B;  3SC3 A;  2DZN B;  1Q39 A;  2OPF A;  5F3W A;  1L2D A;  4LF6 M;  2C9C A;  1DO0 A;  3HHY A;  2ZTC A;  5FTK A;  1HNX M;  4G3O A;  3E9S A;  4LFA M;  2QNJ A;  2LBC A;  3HJ8 A;  4MGH A;  1TR8 A;  1NJG A;  1DGH A;  3M0E A;  3ZQJ A;  5ITT A;  1R4G A;  2VF8 A;  3KXE C;  4L16 A;  4OVZ B;  4IBE A;  2E5L M;  4L15 A;  4MB7 A;  4DV3 M;  2F5P A;  3A98 B;  2CHV A;  1TH4 A;  2I7P A;  2XEP A;  4IBK A;  2XLJ A;  4FVM A;  4I4L A;  3L29 A;  3FTE A;  1QAN A;  3SAV A;  2WSE F;  3K9O A;  2CE7 A;  4QNM A;  2JY8 A;  4QHS A;  1ZAE A;  4RF0 A;  3B7Q A;  5C1B A;  2XGN A;  4LRS A;  4PD2 A;  4GHA A;  1YLA A;  1D0K A;  2YNM D;  5H37 D;  4JI1 M;  4M9Z A;  3MMP A;  3GLG A;  4FWH A;  3WHL A;  2JY5 A;  3JR5 A;  3K8Z A;  1W5T A;  1EE8 A;  2J5Y A;  1XXH E;  4FD2 A;  2UXD M;  3U6S A;  1Q3B A;  4K0K M;  4FW9 A;  3GLF B;  2I7N A;  1I94 M;  5E6J A;  1XNR M;  4IBG A;  2C98 A;  1OTR A;  4XBO A;  4PCZ A;  4IJF A;  3A45 A;  4S12 A;  1Z5A A;  4GEW A;  5ITR A;  3HY5 A;  3HZJ A;  4ZPX A;  5A2Q S;  2C9O A;  3WHK A;  5KPZ A;  2HHH M;  1G59 A;  3NBX X;  2R62 A;  3KOW E;  4M9X A;  3TQS A;  2NQ8 C;  3J7B A;  4GC5 A;  2D7E A;  2XF3 A;  1XC8 A;  3C3E A;  3ZH9 B;  2JY6 B;  2DWM A;  3GRR A;  1NV9 A;  4P16 A;  5ITQ A;  2GNO A;  3VKG A;  4G4R A;  3KOZ E;  2EKK A;  1XMQ M;  1G3I A;  1R2Y A;  3FTC A; 
#chains in the Genus database with same CATH homology
 1DGB A;  3AL0 C;  1L8Q A;  4XGI A;  2Z4R A;  3J2P B;  1FNN A;  4OVZ A;  7CAT A;  3KSJ A;  3HU2 A;  1YUB A;  2O5R A;  2DHR A;  4IBC A;  1G4A E;  3A42 A;  1Z6T A;  1OFH A;  4M0D A;  2CHQ A;  1QQW A;  4D82 A;  4LCB A;  3PNV A;  1N78 A;  4LF8 M;  2J7O A;  3J81 S;  4BBA A;  3GO8 A;  1MU5 A;  1G41 A;  3FUU A;  3H4M A;  4CHT B;  2LXE A;  1NVM A;  3KS8 A;  4YY3 M;  2BNK A;  3HHX A;  4JXJ A;  4LJ6 A;  4W5W A;  3QWL A;  1KSF X;  1DGF A;  1NNU C;  2QBY A;  2CEA A;  4IIW A;  3HJS A;  1KYI A;  1N33 M;  4X62 M;  3LVV A;  2BJV A;  2ZM6 M;  1K3X A;  4NRV A;  1IXR C;  4OW0 A;  4ITQ A;  4AI6 A;  4LGM A;  1XMO M;  4TUW A;  1WXQ A;  4FCW A;  3PXG A;  2X8A A;  3R9X B;  4JI5 M;  2QEN A;  2Z7J A;  3AV0 A;  3SBJ A;  4GC9 A;  4X64 M;  4LJ4 A;  1TH2 A;  3KP1 E;  4CGY B;  3GLH B;  4NOO B;  1E94 E;  3EIH A;  1TDH A;  1Z5C A;  2Y20 A;  3UJN A;  1HNW M;  4JI6 M;  3W0L B;  4X65 M;  4NL4 H;  3D8B A;  2L6O A;  3GP1 A;  2Y21 A;  1NHW C;  4MGK E;  4LZJ A;  3TPZ A;  2L09 A;  1L2B A;  5GKN A;  2KW0 A;  3U60 B;  1FJG M;  4DUZ M;  3KP0 E;  2KRU A;  4GIP A;  5EXS A;  4B3S M;  1GKI A;  2QPA A;  3VFD A;  1GLN A;  3R8F A;  4JI8 M;  1IBL M;  4HL4 A;  4LJA A;  3J7A S;  4BLC A;  1VDD A;  2KA6 B;  3GLI A;  3GLH A;  1IBK M;  1L1T A;  3FUV A;  2J7N A;  4JV5 M;  1IY2 A;  2DVW B;  2F4V M;  2JA2 A;  4HLQ A;  3U6D A;  1PJJ A;  2R4E A;  1GL7 A;  4L8R C;  4B3R M;  2DZO B;  3CF6 E;  1G8P A;  4L78 A;  4DV6 M;  1DGH B;  3GPX A;  2UUB M;  4FWD A;  3SAR A;  1JQJ C;  3VKH A;  3JAM S;  4QOS A;  1Z59 A;  3RGP A;  2QBY B;  2UXC M;  5BR8 M;  3MK6 A;  1NY5 A;  4MH0 E;  5IZ7 D;  2ZAO A;  4JYA M;  4FCV A;  1HT2 E;  4DR7 M;  2C99 A;  3K92 A;  2XFS A;  3L27 A;  2W82 A;  4G6Z A;  2EA0 A;  2R4J A;  3SMP A;  1SXJ B;  2CHG A;  4IBJ A;  4NSR A;  3TE6 A;  3KOX E;  1YE9 A;  3JR4 A;  3PNY A;  2QZ4 A;  2DXI A;  3KDS E;  2QCU A;  3SAS A;  2KRK A;  3W0F A;  3TL4 X;  2X4A A;  2YFQ A;  4X66 M;  2Y0T A;  5DYI A;  3GPY A;  4CIS A;  4NXM M;  4OX9 M;  2HCB A;  4I8O A;  1IN5 A;  3GLI B;  2H1R A;  3FTD A;  5LMN M;  2CUZ A;  3HKP A;  4FCT A;  2RGH A;  3HU3 A;  1IY0 A;  4IBB A;  1J7K A;  3HJQ A;  4BB9 A;  4Z6Y A;  3GLG B;  4JI7 M;  1J09 A;  2R18 A;  3U61 B;  2V1U A;  4JI0 M;  1KFV A;  2M5Z A;  1R2Z A;  3L25 A;  5C18 A;  4DV1 M;  2F5S A;  4D81 A;  3HU1 A;  1X37 A;  4LFB M;  2VII A;  5EP1 A;  5DNY A;  3SAT A;  1IN8 A;  5FTJ A;  3IG8 A;  3KS4 A;  5EJC A;  2DWZ B;  3TWL A;  4B08 A;  4QHT A;  4G4Q A;  1TGU A;  1K82 A;  4LF7 M;  1JR3 A;  3HHZ A;  1N77 A;  4II7 A;  4GHL A;  3T1Y M;  5JI2 E;  4AZF A;  1QVR A;  1HNZ M;  2G5G X;  2C5R A;  4KHP M;  3DOA A;  1UM8 A;  3T15 A;  1R7R A;  3GRV A;  2ZAN A;  4DR5 M;  4GKK M;  3PVS A;  3DFZ A;  3I4Y A;  5ITX E;  4WW0 A;  4FWG A;  5IWA M;  5FLX S;  2VQF M;  3U61 A;  1S3S A;  8CAT A;  1NJF A;  2G8L A;  3GQ4 A;  3K2L A;  1SXJ C;  4MM3 B;  3D8L A;  1MX0 A;  2EUC A;  2LNH C;  2ZAM A;  3NWL A;  3THG A;  4DR6 M;  2UXB M;  1IQP A;  3K1J A;  3FYD A;  3FUW A;  4EIW A;  4PDI A;  4AQY M;  4JI4 M;  3IG5 A;  3SYK A;  4DV7 M;  4IBD A;  2CV0 A;  4QNR A;  3J80 S;  3I51 A;  5FTL A;  1N36 M;  1D2N A;  2YQZ A;  1QZM A;  2X49 A;  2XSZ A;  5EQT A;  4IJE A;  2LH0 A;  1NHG C;  4LRT A;  5DYG A;  5KPT A;  3U6E A;  3GPU A;  3VK8 A;  1K3W A;  4LFC M;  2D7H A;  4NXN M;  2XZU A;  2AHM A;  1QAQ A;  4KO8 A;  1H6U A;  5IT9 S;  5EP3 A;  4YHH M;  2V1C A;  1IXS B;  5EP4 A;  5LMU M;  3T1H M;  3VDU A;  4LGY A;  3U5Z A;  3C58 A;  5EXP A;  4DR2 M;  3E4R A;  4LY6 A;  4OU7 A;  3TWM A;  1L1Z A;  4D80 A;  3M6A A;  2HKJ A;  2R45 A;  4M0W A;  3U6Q A;  3CTW B;  1IN4 A;  2A5Y B;  3LVW A;  3GLF A;  4B7H A;  1N34 M;  3AOG A;  3UGJ A;  3J27 B;  2EO2 A;  1E32 A;  4QOZ C;  3LQR A;  3T38 A;  4M9S A;  2XZF A;  1HQC A;  1W5S A;  4NRW A;  5EXT A;  4A3V B;  4AG5 A;  5JI3 E;  2Q2E B;  1HQY E;  3U6C A;  3FTF A;  3L2A A;  3GQ5 A;  1XXH B;  4I81 A;  4MGY E;  3AOE A;  3FUX A;  4MGZ E;  1IY1 A;  3FKE A;  4I5S A;  2R65 A;  3NBI A;  2FOI C;  2L7I A;  3U60 A;  3U6L A;  1IM2 A;  2YR0 A;  3GRY A;  4R3D A;  5E26 A;  2L7H A;  2XFT A;  4G4N A;  2Y0Q A;  3ZC7 B;  2FE8 A;  1XNQ M;  4LJ8 A;  3OTO M;  4AKI A;  3FD9 A;  3AKZ A;  2K47 A;  3L26 A;  2KXE A;  3I4V A;  4LF4 M;  3A46 A;  1ORY B;  4GH9 A;  1TH3 A;  5ITX A;  3KW6 A;  5FTN A;  2UUC M;  5EXX A;  1NSF A;  2XSZ D;  4IBI A;  3L28 A;  2KZU A;  2F5N A;  3MHV C;  4IBF A;  1IN6 A;  3RE8 A;  2RGO A;  5IRE B;  4WUR A;  4PDG A;  4Z8X A;  1QYR A;  3DZD A;  1L2C A;  2ERC A;  1N75 A;  3FYC A;  1PJI A;  3HWS A;  4B7F A;  2XH9 A;  2ZBK B;  3FUT A;  4B3T M;  4GRI A;  4LJ5 A;  1OFI A;  1GVN A;  4NSO B;  4KOD A;  4L4U A;  3LQQ A;  4AG6 A;  4GIT A;  2KZS A;  1YSY A;  4REZ A;  4DV4 M;  1I4W A;  2UU9 M;  3CF2 A;  4GMQ A;  2C96 A;  4JI2 M;  5KPR A;  1TDZ A;  3MJ5 A;  3B9P A;  3GPP A;  3VDP A;  2D7G A;  4MGI E;  4LF5 M;  4LF9 M;  2HL7 A;  5EP2 A;  4AW4 A;  4DR3 M;  2DWN A;  4RF1 A;  1JR3 D;  1HT1 E;  4DUY M;  3U6O A;  3HGI A;  3M7G A;  4R7G A;  1PM5 A;  1R6B X;  5KO3 A;  4DV2 M;  4B3M M;  3EIE A;  1E9S A;  1NNJ A;  3ZCB B;  4AKH A;  3KSX A;  1GL6 A;  3SHF A;  3SFZ A;  3DA1 A;  2P5T A;  3PFI A;  3SAW A;  1T3T A;  3U6P A;  4DR4 M;  4LG2 A;  1E9R A;  4DV0 M;  3UZU A;  2VQE M;  3SYL A;  3UK6 A;  5KQD A;  2CFO A;  2Z4S A;  1IXZ A;  4B7G A;  4RNA A;  1XHB A;  2CV1 A;  1NY6 A;  4LJ7 A;  5KQ8 A;  4AKG A;  1XXH A;  1OJL A;  3U5Z B;  2FNA A;  4LZZ A;  2BJW A;  1N32 M;  4DV5 M;  3ILK A;  4JN6 A;  3SAU A;  4JI3 M;  5ITU A;  2FFJ A;  3U6M A;  3SHG B;  3TWK A;  3UMM A;  4KLN A;  2KEB A;  3RGS A;  2V6Z M;  2F5O A;  1Z5B A;  1IBM M;  2CV2 A;  2Z3X A;  4LJ9 A;  1HR0 M;  1ZQ9 A;  3LMM A;  3RFW A;  5FTM A;  3SMS A;  3GQ3 A;  2DWL A;  3BOS A;  3KOY E;  2QP9 X;  3VK7 A;  3HHW A;  1C1K A;  3GRU A;  3QAU A;  4GKJ M;  1DGG A;  1IN7 A;  1SXJ A;  1XWI A;  3AFH A;  5ITY A;  1SXJ D;  2LWX A;  1LV7 A;  2RKO A;  1DO2 A;  3KVW A;  3VLF B;  2M60 A;  2OQ4 A;  4PT5 A;  5BPV A;  1Q3C A;  3Q8X A;  3KFU G;  5FSW A;  2R46 A;  3CF0 A;  1SXJ E;  4DR1 M;  2UUA M;  1QAO A;  4G4O A;  2F5Q A;  3AOE C;  1J5E M;  1QAM A;  3AJI B;  3SC3 A;  2DZN B;  1Q39 A;  2OPF A;  5F3W A;  1L2D A;  4LF6 M;  2C9C A;  1DO0 A;  3HHY A;  1HNX M;  5FTK A;  3E9S A;  4LFA M;  3HJ8 A;  4MGH A;  3M0E A;  1NJG A;  1DGH A;  5ITT A;  3KXE C;  4L16 A;  4OVZ B;  4IBE A;  2E5L M;  4L15 A;  4MB7 A;  4DV3 M;  2F5P A;  3A98 B;  2CHV A;  1TH4 A;  2I7P A;  2XEP A;  4IBK A;  2XLJ A;  4FVM A;  4I4L A;  3L29 A;  3FTE A;  1QAN A;  3SAV A;  2CE7 A;  4QNM A;  4QHS A;  1ZAE A;  4RF0 A;  5C1B A;  4GHA A;  2XGN A;  4LRS A;  4PD2 A;  4JI1 M;  2YNM D;  5H37 D;  4M9Z A;  3GLG A;  4FWH A;  3WHL A;  3JR5 A;  3K8Z A;  1W5T A;  1EE8 A;  4FD2 A;  2UXD M;  3U6S A;  1Q3B A;  4K0K M;  4FW9 A;  3GLF B;  2I7N A;  1I94 M;  5E6J A;  1XNR M;  4IBG A;  2C98 A;  4XBO A;  4PCZ A;  4IJF A;  3A45 A;  4S12 A;  1Z5A A;  5ITR A;  4ZPX A;  5A2Q S;  2C9O A;  3WHK A;  5KPZ A;  2HHH M;  1G59 A;  2R62 A;  3KOW E;  4M9X A;  3TQS A;  4GC5 A;  2NQ8 C;  3J7B A;  2D7E A;  2XF3 A;  1XC8 A;  3ZH9 B;  2DWM A;  3GRR A;  4P16 A;  5ITQ A;  3VKG A;  4G4R A;  3KOZ E;  1XMQ M;  1G3I A;  1R2Y A;  3FTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...