1NNUC

Crystal structure analysis of plasmodium falciparum enoyl-acyl-carrier-protein reductase with triclosan analog
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
60
structure length
60
Chain Sequence
b'YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords enoyl-acyl carrier reductase
molecule tags Oxidoreductase
source organism Plasmodium falciparum
publication title Structural Elucidation of the Specificity of the Antibacterial Agent Triclosan for Malarial Enoyl Acyl Carrier Protein Reductase
pubmed doi rcsb
total genus 16
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2003-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.400 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nnuC00
2FOIC 1NHWC 1NHGC 1NNUC 2NQ8C
chains in the Genus database with same CATH superfamily
2DZLA 4FCTA 4R7GA 2R65A 2VDBB 2UUCM 4GHLA 2KNZA 1WHCA 4M9XA 1SXJA 5LMUM 3DOAA 3NWLA 4GHAA 3T15A 4L8RC 1L8QA 4DV1M 4M0DA 5JI2E 3UMMA 2ZANA 4BLCA 1UM8A 1Z59A 2MGWA 3U6LA 3MMPA 3MJ5A 2KRUA 2DWMA 2F5QA 1HNWM 4DR4M 3U61B 3OTOM 4S12A 4CISA 3TQSA 1NJFA 3H4MA 2ZAMA 3AJIB 2FOIC 4GMQA 1NNJA 1ZAEA 1E94E 2QPAA 1WXQA 5ITUA 2Z8YM 2CV0A 2F5SA 1VQ1A 4JI1M 3BOSA 2WSEF 2WZJA 2D7GA 2Z7JA 2M60A 2O25A 5IWAM 3GLHB 3HJSA 2H1RA 5BR8M 2EUCA 1N36M 1PJSA 3LW5F 1XMQM 3Q8XA 1N32M 3HGIA 1QAOA 4M0WA 1EFUB 3B7QA 2VQFM 4QNMA 4LGMA 4OW0A 1VDLA 1SXJC 1Z5BA 4F1IA 4IIWA 2JY7A 2HKJA 1YSYA 3CGWA 3LQQA 2DAEA 2DI0A 3GLIA 4DV0M 3U61A 1VEKA 2F5OA 1HNXM 1L1ZA 4DR3M 3CF0A 3GLFA 3UGJA 2Z3XA 1ZMVA 3FE3A 3GRRA 4LF6M 1RU3A 4DR1M 2J7OA 4OVZB 4BB9A 4XK8F 2JA2A 3PFIA 3EIHA 4FD2A 4HLQA 1K3WA 3C3EA 3GLHA 3LCVB 4LF4M 2QZ4A 1QQWA 3B7ZA 2R0IA 1TH3A 5ITXE 2CEAA 2LXEA 4LRTA 3M6AA 1XHBA 3EIEA 4Y28F 3GLGA 4ITQA 4X64M 4L16A 4MB7A 5DNYA 4B3MM 2APLA 2B3TA 2KHHA 2XH9A 4JN6A 1SXJD 2QNJA 1WIVA 3FUXA 2DWNA 1OIPA 1PJIA 3K8ZA 4LY6A 4I81A 1GL7A 1XXHA 1Z5CA 4IBDA 5DFLA 3GPXA 2EJSA 3F92A 1PRBA 2R4JA 2LVPC 1OJLA 3HHZA 2DHRA 3KOZE 1L2DA 3T38A 1JR3D 2DZNB 5C1BA 3SAUA 4JI3M 4FWDA 3W68A 2XZFA 4JYAM 2DENA 2L4EA 1Q39A 4IBBA 2L4FA 4LGYA 3HU3A 4NRVA 3FUTA 5EP4A 1QZMA 2CV2A 1G4AE 2ZTDA 4HL4A 3RGPA 4IBIA 3J7AS 3T1YM 1XNQM 4JI8M 2R45A 3VDUA 1QDRA 4LFBM 1L2BA 2EKKA 3JR4A 2EKFA 2VF8A 4LFAM 4REZA 4AZFA 2I7NA 1VDDA 3HHXA 4DBGB 1G3IA 1OAOC 5IREB 3NBXX 4NOOB 4NL4H 4FVMA 2HAKA 2HCBA 2R6FA 2GNOA 1IXSA 4LJ7A 4Z6YA 2ZTCA 1NV8A 2CE7A 4IJEA 4KO8A 5FTMA 4DR5M 4YY3M 5DYGA 1E9RA 2O01F 1K3XA 1XWIA 2K0BX 4KLNA 1HT1E 2L6OA 1VEJA 4K0KM 5EXSA 2JXNA 5KPZA 1N78A 1T3TA 4CHTB 1D0KA 3W0LB 3SAWA 2BNKA 4DV2M 2UXBM 4JI0M 4DV5M 1F4IA 4M9ZA 4B7GA 3TPZA 3FTCA 4NSRA 3PXGA 4F2LA 3CF6E 1IN5A 1D0LA 3RGSA 3ZCBB 1HQYE 4DR7M 4DV3M 3FD9A 4PT5A 4BBAA 3FUVA 4JI7M 2UXCM 2L7IA 4MGKE 1YE9A 4CIZA 2KDLA 4YHHM 1IY1A 3R8FA 1G8PA 1QDTA 2XGNA 4D82A 5LMNM 1IN4A 1N77A 2QENA 3KOXE 4QHSA 2GQFA 1IXZA 1EIJA 3CTWB 3J27B 1G71A 1TF0B 3WHLA 3HU2A 1R4GA 4LFCM 2P5TA 7CATA 4LCBA 1HQCA 4GC9A 4AG6A 2DZOB 1ZMUA 2XFTA 2KZUA 4LJ4A 2KXEA 4CGYB 4LZZA 2V1CA 1D0MA 3W0FA 3M7GA 4X62M 4KT0F 1GL6A 1J09A 4B3TM 2FFJA 4G6ZA 4DV6M 3SATA 1G59A 3GPYA 1SXJE 3I51A 1T6OA 2OPFA 1ZV1A 1C7YA 2DAGA 2QHOB 2KEBA 4I4LA 5IT9S 3U6MA 4OX9M 3SARA 3FTEA 2JY5A 2KA6B 2XSZA 1V92A 2LTUA 3J7BA 3A46A 2KZSA 4AW4A 3VFDA 4B7FA 3AL0C 1AIPC 2QSFX 1HT2E 3KW6A 1DO2A 2N35A 3T6PA 2JZ1A 4AG5A 3C3DA 3LMMA 3J2PB 3HX3A 2ZM6M 4DR6M 3KP0E 1TH2A 4WP2A 4LJ8A 2LH0A 3AKZA 2WSFF 2JP7A 3K92A 3GP1A 1SG9A 3GLGB 2DAKA 2I7PA 2LVNC 3QAUA 4WURA 2CHGA 3K9OA 3SC3A 3KSXA 3U6OA 3L28A 5FLXS 3SYKA 1GABA 4KHPM 2NQ8C 3PVSA 5ITQA 4FW9A 3SHFA 4B08A 2L7HA 1JB0F 3KS8A 2LNHC 1E32A 3AOGA 2XSZD 4G4OA 2L2DA 2BJVA 2C96A 2DVWB 3R9XB 4MH0E 1OFHA 5H37D 3T1HM 1VEGA 3RE8A 2QBYA 4PDIA 4AI6A 4IBFA 2F5PA 1Q3BA 1J5EM 1QYRA 2YFQA 1Z6TA 1DGHA 4NC6A 4LZJA 5EXPA 2RGHA 2CHVA 1XXHB 1CUKA 3AOEA 3HJ8A 2XF3A 2RKOA 5F3WA 1IN6A 1OTRA 3FRHA 1GJTA 4IBKA 3A42A 2FE8A 3L29A 1IBMM 4AKHA 2Y21A 1DGBA 3FUUA 4DV4M 2HL7A 2W82A 3H4JA 8CATA 4M9SA 4GEWA 3U6QA 1KFVA 2ZBKB 3L26A 3TWLA 2HWJA 4II7A 3SMSA 1EE8A 3GPPA 3JAMS 3GQ4A 2C5RA 3UK6A 4GIPA 4P17A 4B7HA 2OOBA 3U6EA 3CF2A 2UUAM 1TTEA 1QANA 3GRVA 3QYBA 4W5WA 3L2AA 4R71A 1QVRA 4MGIE 2OOAA 3A45A 4OU7A 3VKGA 2VF7A 3B74A 1HR0M 1J7KA 3IHPA 3C9PA 4AKGA 3M0EA 4XGIA 2WSCF 4LF7M 1N34M 1DGHB 3U6CA 2FS1A 3GLIB 2YNMD 1NVMA 1I94M 1XMOM 1A5TA 2OO9A 5E26A 5BPVA 3B9PA 4JV5M 3VKHA 4Q7JA 4LJ5A 1PJTA 4D81A 2R46A 2C9OA 1QUSA 2X49A 2QP9X 3E4RA 3ZQJA 4NXNM 1IXSB 3HZJA 3GLFE 4TUWA 1Q3CA 2DHYA 4PCZA 1IN7A 5GKNA 4LRSA 2M5ZA 3U60B 3FKEA 3FTDA 1DGFA 2R44A 2LVQD 4RKUF 4MGYE 4G3OA 2MJ5B 3D8BA 3I4VA 5KO3A 3QWLA 2XLJA 1ZMWA 5IZ7D 2CP8A 2EO2A 3HHYA 3PNVA 2C99A 2K47A 3C58A 3U5ZA 3U6SA 4JI4M 3GQ5A 1OIZA 1SXJB 2RRUA 3I04M 3QYEA 1BVSA 1XB2B 2XFSA 5FTLA 2LVOC 2DXIA 1QUTA 1IFYA 4IBEA 5DYIA 1XXHE 4FWHA 2VQEM 4NXMM 1WJ7A 5EP3A 5EJCA 1IM2A 2J5YA 4DR2M 2ERCA 3Q8GA 2CRUA 3KVWA 3SHGB 4L78A 1IY0A 1LV7A 2C9CA 4D80A 4LF9M 2UXDM 1FNNA 2Y0QA 3I4YA 2QQ8A 4I8OA 1V34A 2YQZA 1MJGM 4NSOB 3GLFB 3U60A 3E46A 4CJ6A 1FJGM 1OKSA 2G8LA 2UUBM 1VG5A 1JR3A 3DA1A 4MGHA 4DUZM 4MM3B 3FYCA 2CV1A 4MGZE 3SYLA 2LHGA 3GO8A 1DO0A 1IBLM 1YLAA 4KODA 1PM5A 2X4AA 3GRUA 5ITYA 2CFOA 2JUJA 2R18A 4IBCA 1V33A 4EIWA 2JY6B 4RF0A 1T43A 1QAMA 4G4NA 2JNHA 2ZAOA 1IXRC 3GLIE 1WGLA 2JWSA 3GRYA 2BWEA 3KOWE 1PGYA 3RFWA 3ZC7B 4X66M 1L2CA 3TE6A 3FTFA 3LQRA 4HEOA 4L15A 2BWBA 1N75A 2L09A 2LHCA 2X8AA 4I5SA 2Z4SA 4X65M 4JI2M 3IG5A 5KQ8A 5FSWA 3NBIA 2EA0A 3WHKA 5ITXA 3I01M 4L6V6 1NY5A 3GLGE 2XZUA 1R7RA 2CUZA 1TDZA 2F4VM 5EXTA 3MK6A 4Z8XA 4PDGA 2DKLA 4IJFA 1OFIA 1TH4A 1XNRM 3A98B 1MU5A 1NHWC 1W5SA 5FTNA 3FYDA 1Q02A 3GLHE 3KDSE 4AQYM 3HJQA 1N33M 1R6BX 4GH9A 3VK7A 2JY8A 1W5TA 4R3DA 1DV0A 2E5LM 3KFUG 2YR0A 5KQDA 2Y0TA 1KYIA 1IBKM 1WR1B 2LBCA 2KNVA 1MX0A 3L27A 3VLFB 4QNRA 3L25A 1H6UA 2OQ4A 2A5YB 4LJAA 2G3QA 2JZ0A 1KSFX 1YUBA 1JR3E 3W67A 3TWMA 5KPRA 1GKIA 1X37A 1IN8A 3DFZA 1R2YA 4XBOA 2DAMA 3SBJA 5FTKA 4G4RA 1NNUC 3HU1A 4LF8M 4L4UA 3KS4A 2MR9A 2MROB 3GQ3A 3K2LA 3UJNA 4NRWA 4QHTA 3IECA 3ILKA 4LF5M 4ZPXA 4JI5M 2XEPA 3U5ZB 2DWLA 1GJSA 3VK8A 3K1JA 2BJWA 3B89A 2Q2EB 4DUYM 1D2NA 3BXWA 1OAIA 2H5XA 3E21A 4UN2B 5E6JA 2DNAA 1QZEA 4ANRA 1GLNA 2V1UA 4JI6M 4RF1A 5JI3E 3DZDA 1GO5A 3J81S 3J80S 4P16A 4GKKM 2VIIA 1C1KA 4FWGA 4B3RM 3FUWA 4LG2A 1AUAA 1DGGA 2QCUA 3UZUA 3GPUA 3AOEC 1ORYB 3TL4X 3B7NA 1NY6A 3SMPA 3HY5A 1XC8A 3U6PA 2D7HA 3E9SA 4PD2A 3KOYE 3IG8A 4JXJA 2Y20A 2Z4RA 2D7EA 3PNYA 2KRKA 1GVNA 3LCUA 1HNZM 3AFHA 3D8LA 2MH8A 1JQJC 1TR8A 2LVAA 3HKPA 2K9DA 1E9SA 1NO1A 2HHHM 1G41A 1P3QQ 2FNAA 5EP1A 1R2ZA 5EP2A 3SFZA 1NSFA 1I4WA 2CWBA 3LVVA 1UFZA 4GITA 4RNAA 3TWKA 2O5RA 1TGUA 3THGA 2RGOA 4FCVA 2QBYB 1PJQA 4GKJM 4GC5A 5FTJA 2J7NA 1Y8GA 4IBGA 4LJ9A 2CHQA 1PJJA 1S3SA 1TDHA 4AKIA 4QOSA 2R62A 3SAVA 3JR5A 4WW0A 3LVWA 1NHGC 1NJGA 5EQTA 5L8RF 1MN3A 2FH0A 5A2QS 4DV7M 5KPTA 4B3SM 4FCWA 3BBZA 3K9PA 4OVZA 5C18A 1OQYA 4GRIA 2V6ZM 2KW0A 1Z5AA 3FRIA 2LWXA 3KP1E 4LJ6A 5ITRA 1L1TA 2DWZB 1IQPA 2K6BA 2C98A 5ITTA 3HWSA 2UU9M 1K82A 1HJPA 2DAIA 1WGNA 1R5LA 2R4EA 3VDPA 2F5NA 3SASA 1IY2A 3KXEC 4IBJA 3V76A 3ZH9B 3MHVC 4A3VB 1ZQ9A 1NV9A 4QOZC 3KSJA 5EXXA 3AV0A 3HHWA 4G4QA 2G5GX 1LTMA 3U6DA 2AHMA 1QAQA 2KNAA
chains in the Genus database with same CATH topology
4FCTA 4R7GA 2R65A 2UUCM 4GHLA 4M9XA 1SXJA 5LMUM 3DOAA 3NWLA 4GHAA 3T15A 4L8RC 1L8QA 4DV1M 4M0DA 5JI2E 3UMMA 2ZANA 4BLCA 1UM8A 1Z59A 3U6LA 3MJ5A 2KRUA 2DWMA 2F5QA 1HNWM 4DR4M 3U61B 3OTOM 4S12A 4CISA 3TQSA 1NJFA 3H4MA 2ZAMA 3AJIB 2FOIC 4GMQA 1NNJA 1ZAEA 1E94E 2QPAA 1WXQA 5ITUA 2CV0A 2F5SA 4JI1M 3BOSA 2Z7JA 2D7GA 2M60A 5IWAM 3GLHB 3HJSA 2H1RA 5BR8M 2EUCA 1N36M 1XMQM 3Q8XA 1N32M 3HGIA 1QAOA 4M0WA 2VQFM 4QNMA 4LGMA 4OW0A 1SXJC 1Z5BA 4IIWA 2HKJA 1YSYA 3U61A 3LQQA 3GLIA 4DV0M 2F5OA 1HNXM 1L1ZA 4DR3M 3CF0A 3GLFA 3UGJA 2Z3XA 3GRRA 4LF6M 4DR1M 2J7OA 4OVZB 4BB9A 2JA2A 3PFIA 3EIHA 4FD2A 4HLQA 1K3WA 3GLHA 4LF4M 2QZ4A 1QQWA 1TH3A 5ITXE 2CEAA 2LXEA 4LRTA 3M6AA 1XHBA 3EIEA 3GLGA 4ITQA 4X64M 4L16A 4MB7A 5DNYA 4B3MM 2XH9A 4JN6A 1SXJD 3FUXA 2DWNA 1PJIA 3K8ZA 4LY6A 4I81A 1GL7A 1XXHA 1Z5CA 4IBDA 3GPXA 2R4JA 1OJLA 3HHZA 2DHRA 3KOZE 1L2DA 3T38A 1JR3D 2DZNB 5C1BA 3SAUA 4JI3M 4FWDA 2XZFA 4JYAM 1Q39A 4IBBA 4LGYA 3HU3A 4NRVA 3FUTA 5EP4A 1QZMA 2CV2A 1G4AE 4HL4A 3RGPA 4IBIA 3J7AS 3T1YM 1XNQM 4JI8M 2R45A 3VDUA 4LFBM 1L2BA 3JR4A 4LFAM 4REZA 4AZFA 2I7NA 1VDDA 3HHXA 1G3IA 5IREB 4NOOB 4NL4H 4FVMA 2HCBA 4LJ7A 4Z6YA 4KO8A 2CE7A 4IJEA 5FTMA 1K3XA 4DR5M 4YY3M 5DYGA 1E9RA 1XWIA 4KLNA 1HT1E 2L6OA 4K0KM 5EXSA 5KPZA 1N78A 1T3TA 4CHTB 3W0LB 3SAWA 2BNKA 4DV2M 2UXBM 4JI0M 4DV5M 4M9ZA 4B7GA 3TPZA 3FTCA 4NSRA 3PXGA 3CF6E 1IN5A 3RGSA 3ZCBB 1HQYE 4DR7M 4DV3M 3FD9A 4PT5A 4BBAA 3FUVA 4JI7M 2UXCM 2L7IA 4MGKE 1YE9A 4YHHM 1IY1A 3R8FA 1G8PA 2XGNA 4D82A 5LMNM 1IN4A 1N77A 2QENA 3KOXE 4QHSA 1IXZA 3CTWB 3J27B 3WHLA 3HU2A 4LFCM 2P5TA 7CATA 4LCBA 1HQCA 4GC9A 4AG6A 2DZOB 2XFTA 2KZUA 4LJ4A 2KXEA 4CGYB 4LZZA 2V1CA 3W0FA 3M7GA 4X62M 1GL6A 1J09A 4B3TM 2FFJA 4G6ZA 4DV6M 3SATA 1G59A 3GPYA 1SXJE 3I51A 2OPFA 4I4LA 2KEBA 5IT9S 3U6MA 4OX9M 3SARA 3FTEA 2KA6B 2XSZA 3J7BA 3A46A 2KZSA 4AW4A 3VFDA 4B7FA 3AL0C 1HT2E 3KW6A 1DO2A 4AG5A 3LMMA 3J2PB 2ZM6M 4DR6M 3KP0E 1TH2A 3AKZA 4LJ8A 2LH0A 3K92A 3GP1A 3GLGB 2I7PA 3QAUA 3U6OA 4WURA 2CHGA 3SC3A 3KSXA 3L28A 5FLXS 3SYKA 4KHPM 2NQ8C 3PVSA 5ITQA 4FW9A 3SHFA 4B08A 2L7HA 3KS8A 2LNHC 1E32A 3AOGA 2XSZD 4G4OA 3R9XB 2BJVA 2C96A 2DVWB 4MH0E 1OFHA 5H37D 3T1HM 2QBYA 3RE8A 4PDIA 4AI6A 4IBFA 2F5PA 1Q3BA 1J5EM 1QYRA 2YFQA 1Z6TA 1DGHA 4LZJA 5EXPA 2RGHA 2CHVA 1XXHB 3HJ8A 3AOEA 2XF3A 2RKOA 5F3WA 1IN6A 4IBKA 3A42A 2FE8A 3L29A 1IBMM 4AKHA 2Y21A 1DGBA 3FUUA 4DV4M 2HL7A 2W82A 8CATA 4M9SA 3U6QA 1KFVA 2ZBKB 3L26A 3TWLA 4II7A 3SMSA 1EE8A 3GPPA 3JAMS 3GQ4A 2C5RA 3UK6A 4GIPA 4B7HA 3U6EA 3CF2A 2UUAM 1QANA 3GRVA 4W5WA 3L2AA 4OU7A 1QVRA 4MGIE 3A45A 3VKGA 1HR0M 1J7KA 4AKGA 3M0EA 4XGIA 4LF7M 1N34M 1DGHB 3U6CA 3GLIB 2YNMD 1NVMA 1I94M 1XMOM 5E26A 5BPVA 3B9PA 4JV5M 3VKHA 4LJ5A 4D81A 2R46A 2C9OA 2X49A 2QP9X 3E4RA 4NXNM 1IXSB 4TUWA 1Q3CA 4PCZA 1IN7A 5GKNA 4LRSA 2M5ZA 3U60B 3FKEA 3FTDA 1DGFA 4MGYE 3D8BA 3I4VA 5KO3A 3QWLA 2XLJA 5IZ7D 2F4VM 2EO2A 3HHYA 3C58A 3PNVA 2C99A 2K47A 3U5ZA 3U6SA 4JI4M 3GQ5A 1SXJB 2XFSA 5FTLA 4IBEA 5DYIA 4FWHA 2VQEM 4NXMM 5EP3A 5EJCA 1IM2A 4DR2M 2ERCA 3KVWA 3SHGB 4L78A 1IY0A 1LV7A 2C9CA 4D80A 4LF9M 2UXDM 1FNNA 2Y0QA 3I4YA 4I8OA 2YQZA 3U60A 4NSOB 3GLFB 1FJGM 2G8LA 2UUBM 4DUZM 1JR3A 3DA1A 4MGHA 4MM3B 3FYCA 2CV1A 4MGZE 3SYLA 3GO8A 1DO0A 1IBLM 4KODA 1PM5A 2X4AA 3GRUA 5ITYA 2CFOA 2R18A 4IBCA 4EIWA 4RF0A 1QAMA 4G4NA 2ZAOA 1IXRC 3GRYA 3KOWE 3RFWA 3ZC7B 4X66M 1L2CA 3TE6A 3FTFA 3LQRA 4L15A 2X8AA 1N75A 2L09A 4X65M 4I5SA 4JI2M 2Z4SA 3IG5A 5KQ8A 5FSWA 3NBIA 2EA0A 3WHKA 5ITXA 1NY5A 2XZUA 1R7RA 2CUZA 1TDZA 5EXTA 3MK6A 4Z8XA 4PDGA 4IJFA 1OFIA 1TH4A 1XNRM 3A98B 1MU5A 1NHWC 1W5SA 5FTNA 3FYDA 3KDSE 4AQYM 3HJQA 1N33M 1R6BX 4GH9A 3VK7A 4R3DA 1W5TA 2E5LM 3KFUG 2YR0A 5KQDA 2Y0TA 1KYIA 1IBKM 1MX0A 3L27A 3VLFB 4QNRA 3L25A 1H6UA 2OQ4A 2A5YB 4LJAA 1KSFX 1YUBA 3TWMA 5KPRA 1GKIA 1X37A 1IN8A 3DFZA 1R2YA 4XBOA 3SBJA 5FTKA 4G4RA 1NNUC 3HU1A 4L4UA 3KS4A 3GQ3A 3K2LA 3UJNA 4NRWA 4QHTA 3ILKA 4LF5M 4ZPXA 4JI5M 2XEPA 3U5ZB 2DWLA 3VK8A 3K1JA 2BJWA 2Q2EB 4DUYM 1D2NA 5E6JA 4JI6M 2V1UA 1GLNA 4RF1A 5JI3E 3DZDA 3J81S 3J80S 4P16A 4GKKM 2VIIA 4FWGA 1C1KA 4B3RM 3FUWA 4LG2A 1DGGA 3UZUA 2QCUA 3GPUA 3AOEC 1ORYB 3TL4X 1NY6A 3SMPA 1XC8A 3U6PA 2D7HA 3E9SA 4PD2A 3KOYE 3IG8A 4JXJA 2Y20A 2Z4RA 2D7EA 3PNYA 2KRKA 1GVNA 1HNZM 3AFHA 3D8LA 1JQJC 3HKPA 1E9SA 2HHHM 1G41A 2FNAA 5EP1A 1R2ZA 5EP2A 3SFZA 1NSFA 1I4WA 3LVVA 4GITA 4RNAA 3TWKA 2O5RA 1TGUA 3THGA 2RGOA 4FCVA 2QBYB 4GKJM 4GC5A 5FTJA 2J7NA 4IBGA 4LJ9A 2CHQA 1PJJA 1S3SA 1TDHA 4AKIA 4QOSA 2R62A 3SAVA 3JR5A 4WW0A 3LVWA 1NHGC 1NJGA 5EQTA 5A2QS 4DV7M 5KPTA 4B3SM 4FCWA 4OVZA 5C18A 4GRIA 2V6ZM 2KW0A 1Z5AA 3KP1E 2LWXA 4LJ6A 5ITRA 1L1TA 2DXIA 2DWZB 1IQPA 4LF8M 2C98A 5ITTA 3HWSA 2UU9M 1K82A 2R4EA 3VDPA 2F5NA 3SASA 1IY2A 3KXEC 4IBJA 3ZH9B 3MHVC 4A3VB 1ZQ9A 4QOZC 3KSJA 5EXXA 3AV0A 3HHWA 4G4QA 2G5GX 3U6DA 2AHMA 1QAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FOI C;  1NHW C;  1NHG C;  1NNU C;  2NQ8 C; 
#chains in the Genus database with same CATH topology
 2DZL A;  4FCT A;  4R7G A;  2R65 A;  2VDB B;  2UUC M;  4GHL A;  2KNZ A;  1WHC A;  4M9X A;  1SXJ A;  5LMU M;  3DOA A;  3NWL A;  4GHA A;  3T15 A;  4L8R C;  1L8Q A;  4DV1 M;  4M0D A;  5JI2 E;  3UMM A;  2ZAN A;  4BLC A;  1UM8 A;  1Z59 A;  2MGW A;  3U6L A;  3MMP A;  3MJ5 A;  2KRU A;  2DWM A;  2F5Q A;  1HNW M;  4DR4 M;  3U61 B;  3OTO M;  4S12 A;  4CIS A;  3TQS A;  1NJF A;  3H4M A;  2ZAM A;  3AJI B;  2FOI C;  4GMQ A;  1NNJ A;  1ZAE A;  1E94 E;  2QPA A;  1WXQ A;  5ITU A;  2Z8Y M;  2CV0 A;  2F5S A;  1VQ1 A;  4JI1 M;  3BOS A;  2WSE F;  2WZJ A;  2D7G A;  2Z7J A;  2M60 A;  2O25 A;  5IWA M;  3GLH B;  3HJS A;  2H1R A;  5BR8 M;  2EUC A;  1N36 M;  1PJS A;  3LW5 F;  1XMQ M;  3Q8X A;  1N32 M;  3HGI A;  1QAO A;  4M0W A;  1EFU B;  3B7Q A;  2VQF M;  4QNM A;  4LGM A;  4OW0 A;  1VDL A;  1SXJ C;  1Z5B A;  4F1I A;  4IIW A;  2JY7 A;  2HKJ A;  1YSY A;  3CGW A;  3LQQ A;  2DAE A;  2DI0 A;  3GLI A;  4DV0 M;  3U61 A;  1VEK A;  2F5O A;  1HNX M;  1L1Z A;  4DR3 M;  3CF0 A;  3GLF A;  3UGJ A;  2Z3X A;  1ZMV A;  3FE3 A;  3GRR A;  4LF6 M;  1RU3 A;  4DR1 M;  2J7O A;  4OVZ B;  4BB9 A;  4XK8 F;  2JA2 A;  3PFI A;  3EIH A;  4FD2 A;  4HLQ A;  1K3W A;  3C3E A;  3GLH A;  3LCV B;  4LF4 M;  2QZ4 A;  1QQW A;  3B7Z A;  2R0I A;  1TH3 A;  5ITX E;  2CEA A;  2LXE A;  4LRT A;  3M6A A;  1XHB A;  3EIE A;  4Y28 F;  3GLG A;  4ITQ A;  4X64 M;  4L16 A;  4MB7 A;  5DNY A;  4B3M M;  2APL A;  2B3T A;  2KHH A;  2XH9 A;  4JN6 A;  1SXJ D;  2QNJ A;  1WIV A;  3FUX A;  2DWN A;  1OIP A;  1PJI A;  3K8Z A;  4LY6 A;  4I81 A;  1GL7 A;  1XXH A;  1Z5C A;  4IBD A;  5DFL A;  3GPX A;  2EJS A;  3F92 A;  1PRB A;  2R4J A;  2LVP C;  1OJL A;  3HHZ A;  2DHR A;  3KOZ E;  1L2D A;  3T38 A;  1JR3 D;  2DZN B;  5C1B A;  3SAU A;  4JI3 M;  4FWD A;  3W68 A;  2XZF A;  4JYA M;  2DEN A;  2L4E A;  1Q39 A;  4IBB A;  2L4F A;  4LGY A;  3HU3 A;  4NRV A;  3FUT A;  5EP4 A;  1QZM A;  2CV2 A;  1G4A E;  2ZTD A;  4HL4 A;  3RGP A;  4IBI A;  3J7A S;  3T1Y M;  1XNQ M;  4JI8 M;  2R45 A;  3VDU A;  1QDR A;  4LFB M;  1L2B A;  2EKK A;  3JR4 A;  2EKF A;  2VF8 A;  4LFA M;  4REZ A;  4AZF A;  2I7N A;  1VDD A;  3HHX A;  4DBG B;  1G3I A;  1OAO C;  5IRE B;  3NBX X;  4NOO B;  4NL4 H;  4FVM A;  2HAK A;  2HCB A;  2R6F A;  2GNO A;  1IXS A;  4LJ7 A;  4Z6Y A;  2ZTC A;  1NV8 A;  2CE7 A;  4IJE A;  4KO8 A;  5FTM A;  4DR5 M;  4YY3 M;  5DYG A;  1E9R A;  2O01 F;  1K3X A;  1XWI A;  2K0B X;  4KLN A;  1HT1 E;  2L6O A;  1VEJ A;  4K0K M;  5EXS A;  2JXN A;  5KPZ A;  1N78 A;  1T3T A;  4CHT B;  1D0K A;  3W0L B;  3SAW A;  2BNK A;  4DV2 M;  2UXB M;  4JI0 M;  4DV5 M;  1F4I A;  4M9Z A;  4B7G A;  3TPZ A;  3FTC A;  4NSR A;  3PXG A;  4F2L A;  3CF6 E;  1IN5 A;  1D0L A;  3RGS A;  3ZCB B;  1HQY E;  4DR7 M;  4DV3 M;  3FD9 A;  4PT5 A;  4BBA A;  3FUV A;  4JI7 M;  2UXC M;  2L7I A;  4MGK E;  1YE9 A;  4CIZ A;  2KDL A;  4YHH M;  1IY1 A;  3R8F A;  1G8P A;  1QDT A;  2XGN A;  4D82 A;  5LMN M;  1IN4 A;  1N77 A;  2QEN A;  3KOX E;  4QHS A;  2GQF A;  1IXZ A;  1EIJ A;  3CTW B;  3J27 B;  1G71 A;  1TF0 B;  3WHL A;  3HU2 A;  1R4G A;  4LFC M;  2P5T A;  7CAT A;  4LCB A;  1HQC A;  4GC9 A;  4AG6 A;  2DZO B;  1ZMU A;  2XFT A;  2KZU A;  4LJ4 A;  2KXE A;  4CGY B;  4LZZ A;  2V1C A;  1D0M A;  3W0F A;  3M7G A;  4X62 M;  4KT0 F;  1GL6 A;  1J09 A;  4B3T M;  2FFJ A;  4G6Z A;  4DV6 M;  3SAT A;  1G59 A;  3GPY A;  1SXJ E;  3I51 A;  1T6O A;  2OPF A;  1ZV1 A;  1C7Y A;  2DAG A;  2QHO B;  2KEB A;  4I4L A;  5IT9 S;  3U6M A;  4OX9 M;  3SAR A;  3FTE A;  2JY5 A;  2KA6 B;  2XSZ A;  1V92 A;  2LTU A;  3J7B A;  3A46 A;  2KZS A;  4AW4 A;  3VFD A;  4B7F A;  3AL0 C;  1AIP C;  2QSF X;  1HT2 E;  3KW6 A;  1DO2 A;  2N35 A;  3T6P A;  2JZ1 A;  4AG5 A;  3C3D A;  3LMM A;  3J2P B;  3HX3 A;  2ZM6 M;  4DR6 M;  3KP0 E;  1TH2 A;  4WP2 A;  4LJ8 A;  2LH0 A;  3AKZ A;  2WSF F;  2JP7 A;  3K92 A;  3GP1 A;  1SG9 A;  3GLG B;  2DAK A;  2I7P A;  2LVN C;  3QAU A;  4WUR A;  2CHG A;  3K9O A;  3SC3 A;  3KSX A;  3U6O A;  3L28 A;  5FLX S;  3SYK A;  1GAB A;  4KHP M;  2NQ8 C;  3PVS A;  5ITQ A;  4FW9 A;  3SHF A;  4B08 A;  2L7H A;  1JB0 F;  3KS8 A;  2LNH C;  1E32 A;  3AOG A;  2XSZ D;  4G4O A;  2L2D A;  2BJV A;  2C96 A;  2DVW B;  3R9X B;  4MH0 E;  1OFH A;  5H37 D;  3T1H M;  1VEG A;  3RE8 A;  2QBY A;  4PDI A;  4AI6 A;  4IBF A;  2F5P A;  1Q3B A;  1J5E M;  1QYR A;  2YFQ A;  1Z6T A;  1DGH A;  4NC6 A;  4LZJ A;  5EXP A;  2RGH A;  2CHV A;  1XXH B;  1CUK A;  3AOE A;  3HJ8 A;  2XF3 A;  2RKO A;  5F3W A;  1IN6 A;  1OTR A;  3FRH A;  1GJT A;  4IBK A;  3A42 A;  2FE8 A;  3L29 A;  1IBM M;  4AKH A;  2Y21 A;  1DGB A;  3FUU A;  4DV4 M;  2HL7 A;  2W82 A;  3H4J A;  8CAT A;  4M9S A;  4GEW A;  3U6Q A;  1KFV A;  2ZBK B;  3L26 A;  3TWL A;  2HWJ A;  4II7 A;  3SMS A;  1EE8 A;  3GPP A;  3JAM S;  3GQ4 A;  2C5R A;  3UK6 A;  4GIP A;  4P17 A;  4B7H A;  2OOB A;  3U6E A;  3CF2 A;  2UUA M;  1TTE A;  1QAN A;  3GRV A;  3QYB A;  4W5W A;  3L2A A;  4R71 A;  1QVR A;  4MGI E;  2OOA A;  3A45 A;  4OU7 A;  3VKG A;  2VF7 A;  3B74 A;  1HR0 M;  1J7K A;  3IHP A;  3C9P A;  4AKG A;  3M0E A;  4XGI A;  2WSC F;  4LF7 M;  1N34 M;  1DGH B;  3U6C A;  2FS1 A;  3GLI B;  2YNM D;  1NVM A;  1I94 M;  1XMO M;  1A5T A;  2OO9 A;  5E26 A;  5BPV A;  3B9P A;  4JV5 M;  3VKH A;  4Q7J A;  4LJ5 A;  1PJT A;  4D81 A;  2R46 A;  2C9O A;  1QUS A;  2X49 A;  2QP9 X;  3E4R A;  3ZQJ A;  4NXN M;  1IXS B;  3HZJ A;  3GLF E;  4TUW A;  1Q3C A;  2DHY A;  4PCZ A;  1IN7 A;  5GKN A;  4LRS A;  2M5Z A;  3U60 B;  3FKE A;  3FTD A;  1DGF A;  2R44 A;  2LVQ D;  4RKU F;  4MGY E;  4G3O A;  2MJ5 B;  3D8B A;  3I4V A;  5KO3 A;  3QWL A;  2XLJ A;  1ZMW A;  5IZ7 D;  2CP8 A;  2EO2 A;  3HHY A;  3PNV A;  2C99 A;  2K47 A;  3C58 A;  3U5Z A;  3U6S A;  4JI4 M;  3GQ5 A;  1OIZ A;  1SXJ B;  2RRU A;  3I04 M;  3QYE A;  1BVS A;  1XB2 B;  2XFS A;  5FTL A;  2LVO C;  2DXI A;  1QUT A;  1IFY A;  4IBE A;  5DYI A;  1XXH E;  4FWH A;  2VQE M;  4NXM M;  1WJ7 A;  5EP3 A;  5EJC A;  1IM2 A;  2J5Y A;  4DR2 M;  2ERC A;  3Q8G A;  2CRU A;  3KVW A;  3SHG B;  4L78 A;  1IY0 A;  1LV7 A;  2C9C A;  4D80 A;  4LF9 M;  2UXD M;  1FNN A;  2Y0Q A;  3I4Y A;  2QQ8 A;  4I8O A;  1V34 A;  2YQZ A;  1MJG M;  4NSO B;  3GLF B;  3U60 A;  3E46 A;  4CJ6 A;  1FJG M;  1OKS A;  2G8L A;  2UUB M;  1VG5 A;  1JR3 A;  3DA1 A;  4MGH A;  4DUZ M;  4MM3 B;  3FYC A;  2CV1 A;  4MGZ E;  3SYL A;  2LHG A;  3GO8 A;  1DO0 A;  1IBL M;  1YLA A;  4KOD A;  1PM5 A;  2X4A A;  3GRU A;  5ITY A;  2CFO A;  2JUJ A;  2R18 A;  4IBC A;  1V33 A;  4EIW A;  2JY6 B;  4RF0 A;  1T43 A;  1QAM A;  4G4N A;  2JNH A;  2ZAO A;  1IXR C;  3GLI E;  1WGL A;  2JWS A;  3GRY A;  2BWE A;  3KOW E;  1PGY A;  3RFW A;  3ZC7 B;  4X66 M;  1L2C A;  3TE6 A;  3FTF A;  3LQR A;  4HEO A;  4L15 A;  2BWB A;  1N75 A;  2L09 A;  2LHC A;  2X8A A;  4I5S A;  2Z4S A;  4X65 M;  4JI2 M;  3IG5 A;  5KQ8 A;  5FSW A;  3NBI A;  2EA0 A;  3WHK A;  5ITX A;  3I01 M;  4L6V 6;  1NY5 A;  3GLG E;  2XZU A;  1R7R A;  2CUZ A;  1TDZ A;  2F4V M;  5EXT A;  3MK6 A;  4Z8X A;  4PDG A;  2DKL A;  4IJF A;  1OFI A;  1TH4 A;  1XNR M;  3A98 B;  1MU5 A;  1NHW C;  1W5S A;  5FTN A;  3FYD A;  1Q02 A;  3GLH E;  3KDS E;  4AQY M;  3HJQ A;  1N33 M;  1R6B X;  4GH9 A;  3VK7 A;  2JY8 A;  1W5T A;  4R3D A;  1DV0 A;  2E5L M;  3KFU G;  2YR0 A;  5KQD A;  2Y0T A;  1KYI A;  1IBK M;  1WR1 B;  2LBC A;  2KNV A;  1MX0 A;  3L27 A;  3VLF B;  4QNR A;  3L25 A;  1H6U A;  2OQ4 A;  2A5Y B;  4LJA A;  2G3Q A;  2JZ0 A;  1KSF X;  1YUB A;  1JR3 E;  3W67 A;  3TWM A;  5KPR A;  1GKI A;  1X37 A;  1IN8 A;  3DFZ A;  1R2Y A;  4XBO A;  2DAM A;  3SBJ A;  5FTK A;  4G4R A;  1NNU C;  3HU1 A;  4LF8 M;  4L4U A;  3KS4 A;  2MR9 A;  2MRO B;  3GQ3 A;  3K2L A;  3UJN A;  4NRW A;  4QHT A;  3IEC A;  3ILK A;  4LF5 M;  4ZPX A;  4JI5 M;  2XEP A;  3U5Z B;  2DWL A;  1GJS A;  3VK8 A;  3K1J A;  2BJW A;  3B89 A;  2Q2E B;  4DUY M;  1D2N A;  3BXW A;  1OAI A;  2H5X A;  3E21 A;  4UN2 B;  5E6J A;  2DNA A;  1QZE A;  4ANR A;  1GLN A;  2V1U A;  4JI6 M;  4RF1 A;  5JI3 E;  3DZD A;  1GO5 A;  3J81 S;  3J80 S;  4P16 A;  4GKK M;  2VII A;  1C1K A;  4FWG A;  4B3R M;  3FUW A;  4LG2 A;  1AUA A;  1DGG A;  2QCU A;  3UZU A;  3GPU A;  3AOE C;  1ORY B;  3TL4 X;  3B7N A;  1NY6 A;  3SMP A;  3HY5 A;  1XC8 A;  3U6P A;  2D7H A;  3E9S A;  4PD2 A;  3KOY E;  3IG8 A;  4JXJ A;  2Y20 A;  2Z4R A;  2D7E A;  3PNY A;  2KRK A;  1GVN A;  3LCU A;  1HNZ M;  3AFH A;  3D8L A;  2MH8 A;  1JQJ C;  1TR8 A;  2LVA A;  3HKP A;  2K9D A;  1E9S A;  1NO1 A;  2HHH M;  1G41 A;  1P3Q Q;  2FNA A;  5EP1 A;  1R2Z A;  5EP2 A;  3SFZ A;  1NSF A;  1I4W A;  2CWB A;  3LVV A;  1UFZ A;  4GIT A;  4RNA A;  3TWK A;  2O5R A;  1TGU A;  3THG A;  2RGO A;  4FCV A;  2QBY B;  1PJQ A;  4GKJ M;  4GC5 A;  5FTJ A;  2J7N A;  1Y8G A;  4IBG A;  4LJ9 A;  2CHQ A;  1PJJ A;  1S3S A;  1TDH A;  4AKI A;  4QOS A;  2R62 A;  3SAV A;  3JR5 A;  4WW0 A;  3LVW A;  1NHG C;  1NJG A;  5EQT A;  5L8R F;  1MN3 A;  2FH0 A;  5A2Q S;  4DV7 M;  5KPT A;  4B3S M;  4FCW A;  3BBZ A;  3K9P A;  4OVZ A;  5C18 A;  1OQY A;  4GRI A;  2V6Z M;  2KW0 A;  1Z5A A;  3FRI A;  2LWX A;  3KP1 E;  4LJ6 A;  5ITR A;  1L1T A;  2DWZ B;  1IQP A;  2K6B A;  2C98 A;  5ITT A;  3HWS A;  2UU9 M;  1K82 A;  1HJP A;  2DAI A;  1WGN A;  1R5L A;  2R4E A;  3VDP A;  2F5N A;  3SAS A;  1IY2 A;  3KXE C;  4IBJ A;  3V76 A;  3ZH9 B;  3MHV C;  4A3V B;  1ZQ9 A;  1NV9 A;  4QOZ C;  3KSJ A;  5EXX A;  3AV0 A;  3HHW A;  4G4Q A;  2G5G X;  1LTM A;  3U6D A;  2AHM A;  1QAQ A;  2KNA A; 
#chains in the Genus database with same CATH homology
 4FCT A;  4R7G A;  2R65 A;  2UUC M;  4GHL A;  4M9X A;  1SXJ A;  5LMU M;  3DOA A;  3NWL A;  4GHA A;  3T15 A;  4L8R C;  1L8Q A;  4DV1 M;  4M0D A;  5JI2 E;  3UMM A;  2ZAN A;  4BLC A;  1UM8 A;  1Z59 A;  3U6L A;  3MJ5 A;  2KRU A;  2DWM A;  2F5Q A;  1HNW M;  4DR4 M;  3U61 B;  3OTO M;  4S12 A;  4CIS A;  3TQS A;  1NJF A;  3H4M A;  2ZAM A;  3AJI B;  2FOI C;  4GMQ A;  1NNJ A;  1ZAE A;  1E94 E;  2QPA A;  1WXQ A;  5ITU A;  2CV0 A;  2F5S A;  4JI1 M;  3BOS A;  2Z7J A;  2D7G A;  2M60 A;  5IWA M;  3GLH B;  3HJS A;  2H1R A;  5BR8 M;  2EUC A;  1N36 M;  1XMQ M;  3Q8X A;  1N32 M;  3HGI A;  1QAO A;  4M0W A;  2VQF M;  4QNM A;  4LGM A;  4OW0 A;  1SXJ C;  1Z5B A;  4IIW A;  2HKJ A;  1YSY A;  3U61 A;  3LQQ A;  3GLI A;  4DV0 M;  2F5O A;  1HNX M;  1L1Z A;  4DR3 M;  3CF0 A;  3GLF A;  3UGJ A;  2Z3X A;  3GRR A;  4LF6 M;  4DR1 M;  2J7O A;  4OVZ B;  4BB9 A;  2JA2 A;  3PFI A;  3EIH A;  4FD2 A;  4HLQ A;  1K3W A;  3GLH A;  4LF4 M;  2QZ4 A;  1QQW A;  1TH3 A;  5ITX E;  2CEA A;  2LXE A;  4LRT A;  3M6A A;  1XHB A;  3EIE A;  3GLG A;  4ITQ A;  4X64 M;  4L16 A;  4MB7 A;  5DNY A;  4B3M M;  2XH9 A;  4JN6 A;  1SXJ D;  3FUX A;  2DWN A;  1PJI A;  3K8Z A;  4LY6 A;  4I81 A;  1GL7 A;  1XXH A;  1Z5C A;  4IBD A;  3GPX A;  2R4J A;  1OJL A;  3HHZ A;  2DHR A;  3KOZ E;  1L2D A;  3T38 A;  1JR3 D;  2DZN B;  5C1B A;  3SAU A;  4JI3 M;  4FWD A;  2XZF A;  4JYA M;  1Q39 A;  4IBB A;  4LGY A;  3HU3 A;  4NRV A;  3FUT A;  5EP4 A;  1QZM A;  2CV2 A;  1G4A E;  4HL4 A;  3RGP A;  4IBI A;  3J7A S;  3T1Y M;  1XNQ M;  4JI8 M;  2R45 A;  3VDU A;  4LFB M;  1L2B A;  3JR4 A;  4LFA M;  4REZ A;  4AZF A;  2I7N A;  1VDD A;  3HHX A;  1G3I A;  5IRE B;  4NOO B;  4NL4 H;  4FVM A;  2HCB A;  4LJ7 A;  4Z6Y A;  4KO8 A;  2CE7 A;  4IJE A;  5FTM A;  1K3X A;  4DR5 M;  4YY3 M;  5DYG A;  1E9R A;  1XWI A;  4KLN A;  1HT1 E;  2L6O A;  4K0K M;  5EXS A;  5KPZ A;  1N78 A;  1T3T A;  4CHT B;  3W0L B;  3SAW A;  2BNK A;  4DV2 M;  2UXB M;  4JI0 M;  4DV5 M;  4M9Z A;  4B7G A;  3TPZ A;  3FTC A;  4NSR A;  3PXG A;  3CF6 E;  1IN5 A;  3RGS A;  3ZCB B;  1HQY E;  4DR7 M;  4DV3 M;  3FD9 A;  4PT5 A;  4BBA A;  3FUV A;  4JI7 M;  2UXC M;  2L7I A;  4MGK E;  1YE9 A;  4YHH M;  1IY1 A;  3R8F A;  1G8P A;  2XGN A;  4D82 A;  5LMN M;  1IN4 A;  1N77 A;  2QEN A;  3KOX E;  4QHS A;  1IXZ A;  3CTW B;  3J27 B;  3WHL A;  3HU2 A;  4LFC M;  2P5T A;  7CAT A;  4LCB A;  1HQC A;  4GC9 A;  4AG6 A;  2DZO B;  2XFT A;  2KZU A;  4LJ4 A;  2KXE A;  4CGY B;  4LZZ A;  2V1C A;  3W0F A;  3M7G A;  4X62 M;  1GL6 A;  1J09 A;  4B3T M;  2FFJ A;  4G6Z A;  4DV6 M;  3SAT A;  1G59 A;  3GPY A;  1SXJ E;  3I51 A;  2OPF A;  4I4L A;  2KEB A;  5IT9 S;  3U6M A;  4OX9 M;  3SAR A;  3FTE A;  2KA6 B;  2XSZ A;  3J7B A;  3A46 A;  2KZS A;  4AW4 A;  3VFD A;  4B7F A;  3AL0 C;  1HT2 E;  3KW6 A;  1DO2 A;  4AG5 A;  3LMM A;  3J2P B;  2ZM6 M;  4DR6 M;  3KP0 E;  1TH2 A;  3AKZ A;  4LJ8 A;  2LH0 A;  3K92 A;  3GP1 A;  3GLG B;  2I7P A;  3QAU A;  3U6O A;  4WUR A;  2CHG A;  3SC3 A;  3KSX A;  3L28 A;  5FLX S;  3SYK A;  4KHP M;  2NQ8 C;  3PVS A;  5ITQ A;  4FW9 A;  3SHF A;  4B08 A;  2L7H A;  3KS8 A;  2LNH C;  1E32 A;  3AOG A;  2XSZ D;  4G4O A;  3R9X B;  2BJV A;  2C96 A;  2DVW B;  4MH0 E;  1OFH A;  5H37 D;  3T1H M;  2QBY A;  3RE8 A;  4PDI A;  4AI6 A;  4IBF A;  2F5P A;  1Q3B A;  1J5E M;  1QYR A;  2YFQ A;  1Z6T A;  1DGH A;  4LZJ A;  5EXP A;  2RGH A;  2CHV A;  1XXH B;  3HJ8 A;  3AOE A;  2XF3 A;  2RKO A;  5F3W A;  1IN6 A;  4IBK A;  3A42 A;  2FE8 A;  3L29 A;  1IBM M;  4AKH A;  2Y21 A;  1DGB A;  3FUU A;  4DV4 M;  2HL7 A;  2W82 A;  8CAT A;  4M9S A;  3U6Q A;  1KFV A;  2ZBK B;  3L26 A;  3TWL A;  4II7 A;  3SMS A;  1EE8 A;  3GPP A;  3JAM S;  3GQ4 A;  2C5R A;  3UK6 A;  4GIP A;  4B7H A;  3U6E A;  3CF2 A;  2UUA M;  1QAN A;  3GRV A;  4W5W A;  3L2A A;  4OU7 A;  1QVR A;  4MGI E;  3A45 A;  3VKG A;  1HR0 M;  1J7K A;  4AKG A;  3M0E A;  4XGI A;  4LF7 M;  1N34 M;  1DGH B;  3U6C A;  3GLI B;  2YNM D;  1NVM A;  1I94 M;  1XMO M;  5E26 A;  5BPV A;  3B9P A;  4JV5 M;  3VKH A;  4LJ5 A;  4D81 A;  2R46 A;  2C9O A;  2X49 A;  2QP9 X;  3E4R A;  4NXN M;  1IXS B;  4TUW A;  1Q3C A;  4PCZ A;  1IN7 A;  5GKN A;  4LRS A;  2M5Z A;  3U60 B;  3FKE A;  3FTD A;  1DGF A;  4MGY E;  3D8B A;  3I4V A;  5KO3 A;  3QWL A;  2XLJ A;  5IZ7 D;  2F4V M;  2EO2 A;  3HHY A;  3C58 A;  3PNV A;  2C99 A;  2K47 A;  3U5Z A;  3U6S A;  4JI4 M;  3GQ5 A;  1SXJ B;  2XFS A;  5FTL A;  4IBE A;  5DYI A;  4FWH A;  2VQE M;  4NXM M;  5EP3 A;  5EJC A;  1IM2 A;  4DR2 M;  2ERC A;  3KVW A;  3SHG B;  4L78 A;  1IY0 A;  1LV7 A;  2C9C A;  4D80 A;  4LF9 M;  2UXD M;  1FNN A;  2Y0Q A;  3I4Y A;  4I8O A;  2YQZ A;  3U60 A;  4NSO B;  3GLF B;  1FJG M;  2G8L A;  2UUB M;  4DUZ M;  1JR3 A;  3DA1 A;  4MGH A;  4MM3 B;  3FYC A;  2CV1 A;  4MGZ E;  3SYL A;  3GO8 A;  1DO0 A;  1IBL M;  4KOD A;  1PM5 A;  2X4A A;  3GRU A;  5ITY A;  2CFO A;  2R18 A;  4IBC A;  4EIW A;  4RF0 A;  1QAM A;  4G4N A;  2ZAO A;  1IXR C;  3GRY A;  3KOW E;  3RFW A;  3ZC7 B;  4X66 M;  1L2C A;  3TE6 A;  3FTF A;  3LQR A;  4L15 A;  2X8A A;  1N75 A;  2L09 A;  4X65 M;  4I5S A;  4JI2 M;  2Z4S A;  3IG5 A;  5KQ8 A;  5FSW A;  3NBI A;  2EA0 A;  3WHK A;  5ITX A;  1NY5 A;  2XZU A;  1R7R A;  2CUZ A;  1TDZ A;  5EXT A;  3MK6 A;  4Z8X A;  4PDG A;  4IJF A;  1OFI A;  1TH4 A;  1XNR M;  3A98 B;  1MU5 A;  1NHW C;  1W5S A;  5FTN A;  3FYD A;  3KDS E;  4AQY M;  3HJQ A;  1N33 M;  1R6B X;  4GH9 A;  3VK7 A;  4R3D A;  1W5T A;  2E5L M;  3KFU G;  2YR0 A;  5KQD A;  2Y0T A;  1KYI A;  1IBK M;  1MX0 A;  3L27 A;  3VLF B;  4QNR A;  3L25 A;  1H6U A;  2OQ4 A;  2A5Y B;  4LJA A;  1KSF X;  1YUB A;  3TWM A;  5KPR A;  1GKI A;  1X37 A;  1IN8 A;  3DFZ A;  1R2Y A;  4XBO A;  3SBJ A;  5FTK A;  4G4R A;  1NNU C;  3HU1 A;  4L4U A;  3KS4 A;  3GQ3 A;  3K2L A;  3UJN A;  4NRW A;  4QHT A;  3ILK A;  4LF5 M;  4ZPX A;  4JI5 M;  2XEP A;  3U5Z B;  2DWL A;  3VK8 A;  3K1J A;  2BJW A;  2Q2E B;  4DUY M;  1D2N A;  5E6J A;  4JI6 M;  2V1U A;  1GLN A;  4RF1 A;  5JI3 E;  3DZD A;  3J81 S;  3J80 S;  4P16 A;  4GKK M;  2VII A;  4FWG A;  1C1K A;  4B3R M;  3FUW A;  4LG2 A;  1DGG A;  3UZU A;  2QCU A;  3GPU A;  3AOE C;  1ORY B;  3TL4 X;  1NY6 A;  3SMP A;  1XC8 A;  3U6P A;  2D7H A;  3E9S A;  4PD2 A;  3KOY E;  3IG8 A;  4JXJ A;  2Y20 A;  2Z4R A;  2D7E A;  3PNY A;  2KRK A;  1GVN A;  1HNZ M;  3AFH A;  3D8L A;  1JQJ C;  3HKP A;  1E9S A;  2HHH M;  1G41 A;  2FNA A;  5EP1 A;  1R2Z A;  5EP2 A;  3SFZ A;  1NSF A;  1I4W A;  3LVV A;  4GIT A;  4RNA A;  3TWK A;  2O5R A;  1TGU A;  3THG A;  2RGO A;  4FCV A;  2QBY B;  4GKJ M;  4GC5 A;  5FTJ A;  2J7N A;  4IBG A;  4LJ9 A;  2CHQ A;  1PJJ A;  1S3S A;  1TDH A;  4AKI A;  4QOS A;  2R62 A;  3SAV A;  3JR5 A;  4WW0 A;  3LVW A;  1NHG C;  1NJG A;  5EQT A;  5A2Q S;  4DV7 M;  5KPT A;  4B3S M;  4FCW A;  4OVZ A;  5C18 A;  4GRI A;  2V6Z M;  2KW0 A;  1Z5A A;  3KP1 E;  2LWX A;  4LJ6 A;  5ITR A;  1L1T A;  2DXI A;  2DWZ B;  1IQP A;  4LF8 M;  2C98 A;  5ITT A;  3HWS A;  2UU9 M;  1K82 A;  2R4E A;  3VDP A;  2F5N A;  3SAS A;  1IY2 A;  3KXE C;  4IBJ A;  3ZH9 B;  3MHV C;  4A3V B;  1ZQ9 A;  4QOZ C;  3KSJ A;  5EXX A;  3AV0 A;  3HHW A;  4G4Q A;  2G5G X;  3U6D A;  2AHM A;  1QAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...