1NNUC

Crystal structure analysis of plasmodium falciparum enoyl-acyl-carrier-protein reductase with triclosan analog
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
60
structure length
60
Chain Sequence
YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Elucidation of the Specificity of the Antibacterial Agent Triclosan for Malarial Enoyl Acyl Carrier Protein Reductase
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords enoyl-acyl carrier reductase
total genus 16
structure length 60
sequence length 60
chains with identical sequence D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2003-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.400 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nnuC00
1NHGC 1NNUC 1NHWC 2FOIC 2NQ8C
chains in the Genus database with same CATH superfamily
2DHRA 1NV8A 3HHYA 3LVWA 3JAMS 2XF3A 1D0MA 5KO3A 1VQ1A 3SMPA 3L26A 4DR6M 3FUTA 4II7A 3NBIA 4MH0E 2VQEM 1QDRA 3VKGA 1IN5A 2DAEA 4DUYM 3SHGB 1QAMA 2CUZA 2DZLA 1VG5A 3GRUA 3HHWA 3T6PA 3KS4A 3QYEA 4DR2M 4K0KM 2N35A 4XGIA 4AI6A 1YSYA 1V34A 1R4GA 2R46A 3HJQA 1KYIA 1NHWC 1ZV1A 3AJIB 4PT5A 2EKKA 2JZ0A 2KHHA 1VEKA 1JR3A 2Q2EB 2LVAA 5IZ7D 4DBGB 3PNYA 1WJ7A 2DHYA 1Q3BA 2CHGA 4LCBA 4B7HA 1DGHB 4LJ5A 2C9CA 1PJJA 3TE6A 2KNAA 3GLHB 1IY1A 1IN8A 2OQ4A 1PJQA 3TPZA 4PDIA 4RKUF 1GKIA 4IBJA 4JI6M 5ITRA 1E9SA 3RFWA 1ZMWA 3I01M 4G4NA 2ZM6M 1OTRA 3CF2A 3TQSA 2UU9M 2L7HA 1N78A 4AKGA 1C7YA 1IM2A 3LW5F 4Z6YA 3T38A 3IHPA 3KP0E 1TH3A 4GEWA 1N32M 3QWLA 1F4IA 2AHMA 4IBBA 1R7RA 3A46A 2FS1A 2QNJA 2LWXA 1H6UA 3FKEA 2RRUA 4GC9A 4LRSA 2ZTCA 1ZQ9A 4LJ8A 2C98A 4B3MM 4QOSA 7CATA 3B74A 2MH8A 3L25A 4BBAA 1G71A 3C3EA 1JR3E 3GLFB 4AG5A 2O01F 2KXEA 2QBYA 1NNUC 2RGHA 4GC5A 2XSZA 3BOSA 2Y0QA 2HL7A 1J5EM 4D80A 1PGYA 2NQ8C 1R2YA 2QSFX 3I51A 4FW9A 4X64M 3KOYE 4DR1M 3R8FA 1OAOC 1TDZA 2X49A 3GO8A 2KA6B 1XNRM 1Z5BA 3SYKA 2O5RA 4LFCM 1NJGA 1NHGC 3KW6A 4S12A 2C5RA 2K6BA 2QPAA 4EIWA 1GVNA 4JI7M 1N33M 2F4VM 3I4YA 1R6BX 4B3SM 1DGBA 3EIHA 1EE8A 3QAUA 2DZNB 5L8RF 3BXWA 4M9SA 3WHLA 4AZFA 3GPXA 3KS8A 2UXBM 2DXIA 3L28A 2J7NA 3FTEA 4WP2A 3DZDA 4MGKE 2DWNA 2D7EA 1L2BA 1VDLA 2JXNA 2KEBA 2R45A 2EJSA 4AKHA 3GPPA 4NSOB 3CGWA 1T6OA 1ZAEA 2DWMA 3SASA 1AIPC 1QUTA 1XNQM 3FRIA 2ERCA 3B7QA 2UXDM 3FUWA 3B9PA 5C18A 4JI3M 1VEJA 2I7PA 2L6OA 4AKIA 3M0EA 4FCVA 1GJTA 4JI5M 1SXJB 4M0WA 3J7BA 1MJGM 1OAIA 3FTFA 2L7IA 2JY7A 4L4UA 1D2NA 2EO2A 3GPUA 5ITYA 2E5LM 4CHTB 1C1KA 3QYBA 4DV6M 1NO1A 4LJAA 4LJ6A 2DZOB 4IBIA 2EUCA 2Z8YM 2KDLA 3E46A 4QNMA 1DGFA 2KRKA 1YUBA 4M0DA 3C58A 4F1IA 3U6LA 1WXQA 1VDDA 1WR1B 4P16A 5EQTA 5FTNA 1UM8A 1I94M 2ZBKB 3U60A 4X62M 4KHPM 2Z7JA 3J27B 2VQFM 3U5ZA 1NY5A 1L2DA 2J7OA 2G8LA 3B7ZA 3HGIA 4FWGA 3RE8A 2XGNA 3FRHA 3SARA 4OVZA 1J7KA 3D8LA 2VDBB 3U6PA 1E32A 1XMQM 1EIJA 1G41A 1TH2A 2FFJA 2XFSA 3MJ5A 1QYRA 3I4VA 5EXSA 3GRVA 2Z4RA 4NRWA 5KPZA 3GRRA 3DOAA 3GQ3A 2C99A 2KZUA 5E6JA 1R5LA 2WSFF 3Q8GA 2XSZD 2MR9A 4IBEA 1IXZA 2GNOA 4LJ4A 2JNHA 4RF0A 4NOOB 3UMMA 4DR7M 4G4OA 5EP2A 1HQYE 3D8BA 4G4RA 3KDSE 5LMNM 3F92A 1ZMVA 3GLGB 2X4AA 3B89A 3E9SA 3U6OA 3U60B 1IBKM 3GLGE 1HT1E 1XB2B 1OQYA 3GQ5A 3W0FA 4CGYB 1L1ZA 1HT2E 1DO0A 2XZUA 4LG2A 2CV0A 2LVPC 3KOZE 2OO9A 1R2ZA 4JI4M 4GHAA 4B08A 1JR3D 2QBYB 3FYCA 2C9OA 3KSJA 1CUKA 2R4EA 4GKJM 1MU5A 4NRVA 1I4WA 1G59A 1J09A 2K9DA 2L09A 1LV7A 3HJ8A 3T1YM 5IT9S 2APLA 3SFZA 1LTMA 5EJCA 2DAGA 2GQFA 3TWMA 4LJ7A 1SXJC 4RF1A 5KPTA 4FWHA 4LF6M 2LVNC 3MMPA 4AQYM 1G8PA 2Y20A 4FWDA 1OIPA 3SMSA 1XXHA 3J80S 4GITA 2LXEA 1N34M 1QUSA 2F5OA 5FSWA 1NNJA 3U6QA 3GLIB 4JI2M 1QANA 4OW0A 3FE3A 2QP9X 2K0BX 4OVZB 4AW4A 2CWBA 4LZZA 4XBOA 2Z3XA 4KODA 1ORYB 3U5ZB 4LRTA 2KRUA 4Z8XA 3GLFE 1E94E 4NXMM 3T1HM 2R0IA 3H4JA 2K47A 2MROB 2CHVA 2ZAOA 3UK6A 5EP4A 1HNZM 1E9RA 1V92A 3K92A 3R9XB 2WSCF 4JI8M 5JI2E 1OJLA 1IFYA 3W68A 3VLFB 4FVMA 2Y21A 3HJSA 2D7GA 3W67A 1Z59A 1TR8A 2O25A 4I5SA 3U61B 2UUAM 2CEAA 1DGHA 1K3XA 2QCUA 2I7NA 4R3DA 2HKJA 2DWLA 5ITTA 3H4MA 3CTWB 4FCWA 2EKFA 1IBLM 4CISA 8CATA 2YNMD 4HEOA 2L4FA 4JN6A 3VKHA 1NVMA 2R4JA 2MJ5B 3ZH9B 4X66M 1RU3A 1L8QA 1Z5CA 2UUBM 4MGZE 2W82A 1IY2A 4DR3M 1NJFA 3I04M 4BLCA 1QAOA 1QAQA 1OFHA 2VIIA 4IBDA 5JI3E 5ITXE 5A2QS 2CV2A 2F5QA 4B3TM 3GLIE 1DV0A 3LVVA 3THGA 2KNVA 2ZANA 2WSEF 2JY5A 1TGUA 5KQ8A 3VK7A 3LCUA 1OKSA 2QHOB 2V1CA 3HU1A 3J7AS 3J81S 1PJSA 2HWJA 1L2CA 3JR4A 4I4LA 1SXJD 4GH9A 1FJGM 1IXSB 1MN3A 2DAMA 2DI0A 4R71A 2OPFA 2JWSA 3KSXA 4LFBM 3K9OA 2HAKA 1Z5AA 4GKKM 4F2LA 2G5GX 1KFVA 4JYAM 3GLGA 3SAWA 1NY6A 3L27A 5C1BA 2R6FA 1QQWA 3UGJA 3GLHA 4L8RC 1D0KA 4I81A 2CE7A 2JZ1A 3IG8A 3AOEC 4G6ZA 3DFZA 3K8ZA 3UZUA 4IIWA 1OIZA 2LVOC 3KP1E 4JI0M 4X65M 5F3WA 2X8AA 4IBCA 1W5SA 3FUVA 3LMMA 4YHHM 1Z6TA 2DAIA 4DV7M 1V33A 2L4EA 4DV1M 3ZC7B 2D7HA 1UFZA 4LF7M 2F5NA 1IN7A 4HLQA 3E4RA 2OOBA 3LQQA 1JB0F 3M6AA 4FCTA 4G3OA 2JP7A 5GKNA 3OTOM 3CF6E 3SAUA 4KLNA 4LF4M 1EFUB 2FH0A 4LF9M 2LHGA 4QHTA 4LF8M 1TH4A 3U6EA 1IQPA 2BWEA 3AOGA 1HR0M 1N75A 3SATA 1MX0A 3A45A 4L78A 4G4QA 2FE8A 2G3QA 3M7GA 4W5WA 4ZPXA 1SG9A 4QNRA 3AV0A 4PCZA 4LF5M 1XC8A 3UJNA 2QQ8A 3CF0A 2CV1A 1XHBA 2LH0A 4I8OA 3U6CA 1IN6A 3KOXE 3AL0C 5FTJA 4TUWA 2F5PA 3SHFA 1QDTA 2DVWB 3C9PA 2CFOA 2FNAA 2M60A 4DV4M 3FTCA 4NC6A 1TF0B 3U6SA 4REZA 4Q7JA 5ITUA 5EXTA 4ITQA 2R18A 1N36M 2DAKA 2Z4SA 5BR8M 1HJPA 1NSFA 5BPVA 1K3WA 3KXEC 3FTDA 2XLJA 1XMOM 4DR4M 1QVRA 2EA0A 2JA2A 3GLIA 3L2AA 4LJ9A 4HL4A 1IXSA 2J5YA 1YLAA 1FNNA 1Q39A 3BBZA 3DA1A 2RKOA 3LCVB 3MK6A 2A5YB 1SXJE 2WZJA 2VF8A 1P3QQ 3FUXA 4A3VB 1WHCA 4M9XA 4KO8A 4WURA 2JY6B 1ZMUA 1OFIA 3HU3A 3MHVC 4L6V6 1GJSA 5EP1A 2VF7A 3GLFA 2DWZB 2R65A 1XXHE 3W0LB 5E26A 3KFUG 1GABA 2LBCA 3HY5A 4MB7A 1Q3CA 1S3SA 2QENA 1TTEA 2YFQA 3KOWE 4Y28F 4AG6A 1TDHA 5LMUM 4JI1M 2OOAA 3B7NA 1T3TA 3PNVA 1WIVA 2HHHM 2CP8A 4PD2A 4XK8F 1G3IA 2MGWA 1PRBA 2XEPA 3GPYA 1KSFX 3RGSA 3U6DA 5FLXS 4OU7A 3VFDA 2ZAMA 3U61A 3C3DA 3HZJA 3IG5A 5FTKA 5KQDA 2ZTDA 3ILKA 4DV3M 1IN4A 4QHSA 4L15A 4ANRA 2LVQD 2RGOA 5FTMA 4GMQA 3ZQJA 3JR5A 2V6ZM 3RGPA 4JV5M 3L29A 3PXGA 4DR5M 1JQJC 4B7GA 2UXCM 3GQ4A 3V76A 4CIZA 4DV5M 2CHQA 2P5TA 4IJEA 1DO2A 2FOIC 2H1RA 1W5TA 4GRIA 1G4AE 4LGYA 4MGHA 5EXPA 2JUJA 2LNHC 4IBKA 4QOZC 2KNZA 3IECA 1XXHB 1AUAA 2XFTA 4LY6A 1HNXM 5DFLA 2UUCM 3EIEA 4IBFA 5KPRA 3HHZA 4R7GA 4WW0A 4GHLA 3NBXX 4M9ZA 1N77A 2KZSA 4KT0F 1GO5A 2C96A 2JY8A 4P17A 3VDUA 3HX3A 3NWLA 4LGMA 4MM3B 4D81A 5IREB 2M5ZA 1T43A 4JXJA 2YR0A 4YY3M 4B7FA 2HCBA 3LQRA 3AFHA 1QZMA 1GL7A 3VDPA 1PJTA 2F5SA 3HWSA 4MGYE 3SBJA 4B3RM 3SC3A 4LZJA 4BB9A 1NV9A 5DYIA 2B3TA 3HU2A 1D0LA 4L16A 3Q8XA 3PFIA 3U6MA 4DUZM 2BJVA 1IXRC 3FUUA 4MGIE 2DNAA 3E21A 1QZEA 3T15A 5FTLA 1DGGA 4NXNM 2BWBA 1PJIA 3GLHE 1WGNA 2XZFA 1SXJA 2KW0A 3FYDA 1L1TA 2XH9A 5EXXA 3A98B 1XWIA 3AOEA 3KVWA 3FD9A 4D82A 3SAVA 2R44A 5H37D 2DENA 1VEGA 3ZCBB 1Q02A 1PM5A 3A42A 3TWKA 3PVSA 4UN2B 3K9PA 3GP1A 4DV0M 2QZ4A 2YQZA 3SYLA 4FD2A 4NL4H 2Y0TA 5EP3A 5ITQA 3AKZA 2LTUA 3HHXA 3WHKA 1IBMM 2V1UA 1X37A 2LHCA 3TWLA 5IWAM 4PDGA 4NSRA 3TL4X 3K2LA 4DV2M 4LFAM 4IBGA 1WGLA 4OX9M 4GIPA 1K82A 5DYGA 3J2PB 2L2DA 3VK8A 2CRUA 3GRYA 4RNAA 2BJWA 1GL6A 1Y8GA 3K1JA 2DKLA 3HKPA 4IJFA 5DNYA 2BNKA 5ITXA 2H5XA 1BVSA 1IY0A 1HQCA 1YE9A 1A5TA 1GLNA 4CJ6A 1HNWM 2R62A
chains in the Genus database with same CATH topology
2DHRA 3HHYA 3LVWA 3JAMS 2XF3A 5KO3A 3SMPA 3L26A 4DR6M 3FUTA 4II7A 3NBIA 4MH0E 2VQEM 3VKGA 1IN5A 4DUYM 3SHGB 1QAMA 2CUZA 3GRUA 3HHWA 3KS4A 4DR2M 4K0KM 4XGIA 4AI6A 1YSYA 2R46A 3HJQA 1KYIA 1NHWC 3AJIB 4PT5A 1JR3A 2Q2EB 5IZ7D 3PNYA 1Q3BA 2CHGA 4LCBA 4B7HA 1DGHB 4LJ5A 2C9CA 1PJJA 3TE6A 3GLHB 1IY1A 1IN8A 2OQ4A 3TPZA 4PDIA 1GKIA 4IBJA 4JI6M 5ITRA 1E9SA 3RFWA 4G4NA 2ZM6M 3CF2A 3TQSA 2UU9M 2L7HA 1N78A 1IM2A 4Z6YA 3T38A 3KP0E 1TH3A 1N32M 3QWLA 2AHMA 4IBBA 1R7RA 3A46A 2LWXA 1H6UA 3FKEA 4GC9A 4LRSA 1ZQ9A 4LJ8A 2C98A 4B3MM 4QOSA 7CATA 3L25A 4BBAA 3GLFB 4AG5A 2QBYA 2KXEA 1NNUC 2RGHA 4GC5A 2XSZA 3BOSA 2Y0QA 2HL7A 1J5EM 4D80A 2NQ8C 1R2YA 3I51A 4FW9A 4X64M 3KOYE 4DR1M 3R8FA 1TDZA 2X49A 3GO8A 2KA6B 1XNRM 1Z5BA 3SYKA 2O5RA 4LFCM 1NJGA 1NHGC 3KW6A 4S12A 2C5RA 2QPAA 4EIWA 1GVNA 4JI7M 1N33M 2F4VM 3I4YA 1R6BX 4B3SM 1DGBA 3EIHA 1EE8A 3QAUA 2DZNB 3GPXA 3WHLA 4M9SA 4AZFA 3KS8A 2UXBM 2DXIA 3L28A 2J7NA 3FTEA 3DZDA 4MGKE 2DWNA 2D7EA 1L2BA 2KEBA 2R45A 4AKHA 3GPPA 4NSOB 1ZAEA 2DWMA 3SASA 1XNQM 2ERCA 2UXDM 3FUWA 3B9PA 5C18A 4JI3M 2I7PA 2L6OA 4AKIA 3M0EA 4FCVA 4JI5M 1SXJB 4M0WA 3J7BA 3FTFA 2L7IA 4L4UA 1D2NA 2EO2A 3GPUA 5ITYA 2E5LM 4CHTB 1C1KA 4DV6M 4LJAA 4LJ6A 2DZOB 4IBIA 2EUCA 4QNMA 1DGFA 2KRKA 1YUBA 4M0DA 3C58A 3U6LA 1WXQA 1VDDA 4P16A 5EQTA 5FTNA 1UM8A 1I94M 2ZBKB 3U60A 4X62M 4KHPM 2Z7JA 3J27B 2VQFM 3U5ZA 1NY5A 1L2DA 2J7OA 2G8LA 3HGIA 4FWGA 3RE8A 2XGNA 3SARA 4OVZA 1J7KA 3D8LA 1XMQM 3U6PA 1E32A 1G41A 1TH2A 2FFJA 2XFSA 3MJ5A 1QYRA 3I4VA 5EXSA 3GRVA 2Z4RA 4NRWA 5KPZA 3GRRA 3DOAA 3GQ3A 2C99A 2KZUA 5E6JA 2XSZD 4IBEA 1IXZA 4RF0A 4LJ4A 3UMMA 4NOOB 4DR7M 4G4OA 5EP2A 1HQYE 3D8BA 4G4RA 3KDSE 5LMNM 3GLGB 2X4AA 3U6OA 3E9SA 3U60B 1IBKM 1HT1E 3GQ5A 3W0FA 4CGYB 1L1ZA 1HT2E 1DO0A 2XZUA 4LG2A 2CV0A 3KOZE 1R2ZA 4JI4M 4GHAA 4B08A 1JR3D 2QBYB 3FYCA 2C9OA 3KSJA 4GKJM 2R4EA 1MU5A 4NRVA 1I4WA 1G59A 1J09A 2L09A 3HJ8A 1LV7A 3T1YM 5IT9S 3SFZA 5EJCA 3TWMA 4LJ7A 1SXJC 4RF1A 5KPTA 4FWHA 4LF6M 4AQYM 1G8PA 2Y20A 4FWDA 3SMSA 1XXHA 3J80S 4GITA 2LXEA 1N34M 2F5OA 5FSWA 1NNJA 3U6QA 3GLIB 4JI2M 1QANA 4OW0A 2QP9X 4OVZB 4AW4A 4LZZA 4XBOA 2Z3XA 4KODA 1ORYB 3U5ZB 4LRTA 2KRUA 4Z8XA 1E94E 4NXMM 3T1HM 2K47A 2CHVA 2ZAOA 3UK6A 5EP4A 1HNZM 1E9RA 3K92A 3R9XB 4JI8M 5JI2E 1OJLA 3VLFB 4FVMA 2Y21A 3HJSA 2D7GA 1Z59A 4I5SA 3U61B 2UUAM 2CEAA 1DGHA 1K3XA 2QCUA 2I7NA 4R3DA 2HKJA 2DWLA 5ITTA 3H4MA 3CTWB 4FCWA 1IBLM 4CISA 8CATA 2YNMD 4JN6A 3VKHA 1NVMA 2R4JA 3ZH9B 4X66M 1L8QA 1Z5CA 2UUBM 4MGZE 2W82A 1IY2A 4DR3M 1NJFA 4BLCA 1QAOA 1QAQA 1OFHA 2VIIA 4IBDA 5JI3E 5ITXE 5A2QS 2CV2A 2F5QA 4B3TM 3LVVA 3THGA 2ZANA 1TGUA 5KQ8A 3VK7A 2V1CA 3HU1A 3J7AS 3J81S 1L2CA 3JR4A 4I4LA 1SXJD 4GH9A 1FJGM 1IXSB 4LFBM 2OPFA 3KSXA 4GKKM 1Z5AA 2G5GX 1KFVA 4JYAM 3GLGA 3SAWA 1NY6A 3L27A 5C1BA 1QQWA 3UGJA 3GLHA 4L8RC 4I81A 2CE7A 4G6ZA 3IG8A 3AOEC 3DFZA 3K8ZA 3UZUA 4IIWA 3KP1E 4JI0M 4X65M 5F3WA 2X8AA 4IBCA 1W5SA 3FUVA 3LMMA 4YHHM 1Z6TA 4DV7M 4DV1M 3ZC7B 2D7HA 4LF7M 2F5NA 1IN7A 4HLQA 3E4RA 3M6AA 3LQQA 4FCTA 3OTOM 3SAUA 4LF4M 5GKNA 4AKGA 3CF6E 4LF8M 4KLNA 4LF9M 4QHTA 1TH4A 3U6EA 1IQPA 1HR0M 3AOGA 1N75A 3SATA 1MX0A 3A45A 4L78A 4G4QA 2FE8A 3M7GA 4W5WA 4ZPXA 4QNRA 3AV0A 4PCZA 4LF5M 1XC8A 3UJNA 3CF0A 2CV1A 1XHBA 2LH0A 4I8OA 3U6CA 1IN6A 3KOXE 3AL0C 5FTJA 2F5PA 3SHFA 2DVWB 2CFOA 2FNAA 2M60A 4DV4M 3FTCA 3U6SA 4REZA 5ITUA 5EXTA 4ITQA 2R18A 1N36M 2Z4SA 5BR8M 1NSFA 5BPVA 1K3WA 3KXEC 3FTDA 2XLJA 1XMOM 4DR4M 1QVRA 2EA0A 2JA2A 3GLIA 3L2AA 4LJ9A 4HL4A 1FNNA 1Q39A 3DA1A 2RKOA 3MK6A 2A5YB 1SXJE 4A3VB 3FUXA 4M9XA 4KO8A 4WURA 1OFIA 3HU3A 3MHVC 5EP1A 3GLFA 2DWZB 2R65A 3W0LB 5E26A 3KFUG 4MB7A 1Q3CA 1S3SA 2QENA 2YFQA 3KOWE 4AG6A 4JI1M 5LMUM 1TDHA 1T3TA 3PNVA 2HHHM 4PD2A 1G3IA 2XEPA 3GPYA 1KSFX 3RGSA 3U6DA 5FLXS 4OU7A 3VFDA 2ZAMA 3U61A 3IG5A 5FTKA 5KQDA 3ILKA 4DV3M 1IN4A 4QHSA 4L15A 5FTMA 2RGOA 4GMQA 3JR5A 2V6ZM 3RGPA 4JV5M 3L29A 3PXGA 4DR5M 1JQJC 4B7GA 2UXCM 3GQ4A 4DV5M 2CHQA 2P5TA 4IJEA 1DO2A 2FOIC 2H1RA 1W5TA 4GRIA 1G4AE 4LGYA 4MGHA 5EXPA 4IBKA 2LNHC 4TUWA 4QOZC 1XXHB 2XFTA 4LY6A 1HNXM 2UUCM 3EIEA 4IBFA 5KPRA 3HHZA 4R7GA 4WW0A 4GHLA 4M9ZA 1N77A 2KZSA 2C96A 3VDUA 3NWLA 4LGMA 4MM3B 4D81A 5IREB 2M5ZA 4JXJA 2YR0A 4YY3M 4B7FA 2HCBA 3LQRA 3AFHA 1QZMA 1GL7A 3VDPA 2F5SA 3HWSA 4MGYE 3SBJA 4B3RM 3SC3A 4LZJA 4BB9A 5DYIA 3HU2A 4L16A 3Q8XA 3PFIA 3U6MA 4DUZM 2BJVA 1IXRC 3FUUA 4MGIE 5FTLA 3T15A 1DGGA 4NXNM 1PJIA 2XZFA 1SXJA 2KW0A 3FYDA 1L1TA 2XH9A 5EXXA 3A98B 1XWIA 3AOEA 3KVWA 3FD9A 4D82A 3SAVA 5H37D 3ZCBB 1PM5A 3A42A 3TWKA 3PVSA 3GP1A 4DV0M 2QZ4A 2YQZA 3SYLA 4FD2A 4NL4H 2Y0TA 5EP3A 5ITQA 3AKZA 3HHXA 3WHKA 1IBMM 2V1UA 1X37A 3TWLA 5IWAM 4PDGA 4NSRA 3TL4X 3K2LA 4DV2M 4LFAM 4IBGA 4OX9M 4GIPA 1K82A 5DYGA 3J2PB 3VK8A 3GRYA 4RNAA 2BJWA 1GL6A 4IJFA 3K1JA 3HKPA 5DNYA 2BNKA 5ITXA 1IY0A 1HQCA 1YE9A 1GLNA 1HNWM 2R62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHG C;  1NNU C;  1NHW C;  2FOI C;  2NQ8 C; 
#chains in the Genus database with same CATH topology
 2DHR A;  1NV8 A;  3HHY A;  3LVW A;  3JAM S;  2XF3 A;  1D0M A;  5KO3 A;  1VQ1 A;  3SMP A;  3L26 A;  4DR6 M;  3FUT A;  4II7 A;  3NBI A;  4MH0 E;  2VQE M;  1QDR A;  3VKG A;  1IN5 A;  2DAE A;  4DUY M;  3SHG B;  1QAM A;  2CUZ A;  2DZL A;  1VG5 A;  3GRU A;  3HHW A;  3T6P A;  3KS4 A;  3QYE A;  4DR2 M;  4K0K M;  2N35 A;  4XGI A;  4AI6 A;  1YSY A;  1V34 A;  1R4G A;  2R46 A;  3HJQ A;  1KYI A;  1NHW C;  1ZV1 A;  3AJI B;  4PT5 A;  2EKK A;  2JZ0 A;  2KHH A;  1VEK A;  1JR3 A;  2Q2E B;  2LVA A;  5IZ7 D;  4DBG B;  3PNY A;  1WJ7 A;  2DHY A;  1Q3B A;  2CHG A;  4LCB A;  4B7H A;  1DGH B;  4LJ5 A;  2C9C A;  1PJJ A;  3TE6 A;  2KNA A;  3GLH B;  1IY1 A;  1IN8 A;  2OQ4 A;  1PJQ A;  3TPZ A;  4PDI A;  4RKU F;  1GKI A;  4IBJ A;  4JI6 M;  5ITR A;  1E9S A;  3RFW A;  1ZMW A;  3I01 M;  4G4N A;  2ZM6 M;  1OTR A;  3CF2 A;  3TQS A;  2UU9 M;  2L7H A;  1N78 A;  4AKG A;  1C7Y A;  1IM2 A;  3LW5 F;  4Z6Y A;  3T38 A;  3IHP A;  3KP0 E;  1TH3 A;  4GEW A;  1N32 M;  3QWL A;  1F4I A;  2AHM A;  4IBB A;  1R7R A;  3A46 A;  2FS1 A;  2QNJ A;  2LWX A;  1H6U A;  3FKE A;  2RRU A;  4GC9 A;  4LRS A;  2ZTC A;  1ZQ9 A;  4LJ8 A;  2C98 A;  4B3M M;  4QOS A;  7CAT A;  3B74 A;  2MH8 A;  3L25 A;  4BBA A;  1G71 A;  3C3E A;  1JR3 E;  3GLF B;  4AG5 A;  2O01 F;  2KXE A;  2QBY A;  1NNU C;  2RGH A;  4GC5 A;  2XSZ A;  3BOS A;  2Y0Q A;  2HL7 A;  1J5E M;  4D80 A;  1PGY A;  2NQ8 C;  1R2Y A;  2QSF X;  3I51 A;  4FW9 A;  4X64 M;  3KOY E;  4DR1 M;  3R8F A;  1OAO C;  1TDZ A;  2X49 A;  3GO8 A;  2KA6 B;  1XNR M;  1Z5B A;  3SYK A;  2O5R A;  4LFC M;  1NJG A;  1NHG C;  3KW6 A;  4S12 A;  2C5R A;  2K6B A;  2QPA A;  4EIW A;  1GVN A;  4JI7 M;  1N33 M;  2F4V M;  3I4Y A;  1R6B X;  4B3S M;  1DGB A;  3EIH A;  1EE8 A;  3QAU A;  2DZN B;  5L8R F;  3BXW A;  4M9S A;  3WHL A;  4AZF A;  3GPX A;  3KS8 A;  2UXB M;  2DXI A;  3L28 A;  2J7N A;  3FTE A;  4WP2 A;  3DZD A;  4MGK E;  2DWN A;  2D7E A;  1L2B A;  1VDL A;  2JXN A;  2KEB A;  2R45 A;  2EJS A;  4AKH A;  3GPP A;  4NSO B;  3CGW A;  1T6O A;  1ZAE A;  2DWM A;  3SAS A;  1AIP C;  1QUT A;  1XNQ M;  3FRI A;  2ERC A;  3B7Q A;  2UXD M;  3FUW A;  3B9P A;  5C18 A;  4JI3 M;  1VEJ A;  2I7P A;  2L6O A;  4AKI A;  3M0E A;  4FCV A;  1GJT A;  4JI5 M;  1SXJ B;  4M0W A;  3J7B A;  1MJG M;  1OAI A;  3FTF A;  2L7I A;  2JY7 A;  4L4U A;  1D2N A;  2EO2 A;  3GPU A;  5ITY A;  2E5L M;  4CHT B;  1C1K A;  3QYB A;  4DV6 M;  1NO1 A;  4LJA A;  4LJ6 A;  2DZO B;  4IBI A;  2EUC A;  2Z8Y M;  2KDL A;  3E46 A;  4QNM A;  1DGF A;  2KRK A;  1YUB A;  4M0D A;  3C58 A;  4F1I A;  3U6L A;  1WXQ A;  1VDD A;  1WR1 B;  4P16 A;  5EQT A;  5FTN A;  1UM8 A;  1I94 M;  2ZBK B;  3U60 A;  4X62 M;  4KHP M;  2Z7J A;  3J27 B;  2VQF M;  3U5Z A;  1NY5 A;  1L2D A;  2J7O A;  2G8L A;  3B7Z A;  3HGI A;  4FWG A;  3RE8 A;  2XGN A;  3FRH A;  3SAR A;  4OVZ A;  1J7K A;  3D8L A;  2VDB B;  3U6P A;  1E32 A;  1XMQ M;  1EIJ A;  1G41 A;  1TH2 A;  2FFJ A;  2XFS A;  3MJ5 A;  1QYR A;  3I4V A;  5EXS A;  3GRV A;  2Z4R A;  4NRW A;  5KPZ A;  3GRR A;  3DOA A;  3GQ3 A;  2C99 A;  2KZU A;  5E6J A;  1R5L A;  2WSF F;  3Q8G A;  2XSZ D;  2MR9 A;  4IBE A;  1IXZ A;  2GNO A;  4LJ4 A;  2JNH A;  4RF0 A;  4NOO B;  3UMM A;  4DR7 M;  4G4O A;  5EP2 A;  1HQY E;  3D8B A;  4G4R A;  3KDS E;  5LMN M;  3F92 A;  1ZMV A;  3GLG B;  2X4A A;  3B89 A;  3E9S A;  3U6O A;  3U60 B;  1IBK M;  3GLG E;  1HT1 E;  1XB2 B;  1OQY A;  3GQ5 A;  3W0F A;  4CGY B;  1L1Z A;  1HT2 E;  1DO0 A;  2XZU A;  4LG2 A;  2CV0 A;  2LVP C;  3KOZ E;  2OO9 A;  1R2Z A;  4JI4 M;  4GHA A;  4B08 A;  1JR3 D;  2QBY B;  3FYC A;  2C9O A;  3KSJ A;  1CUK A;  2R4E A;  4GKJ M;  1MU5 A;  4NRV A;  1I4W A;  1G59 A;  1J09 A;  2K9D A;  2L09 A;  1LV7 A;  3HJ8 A;  3T1Y M;  5IT9 S;  2APL A;  3SFZ A;  1LTM A;  5EJC A;  2DAG A;  2GQF A;  3TWM A;  4LJ7 A;  1SXJ C;  4RF1 A;  5KPT A;  4FWH A;  4LF6 M;  2LVN C;  3MMP A;  4AQY M;  1G8P A;  2Y20 A;  4FWD A;  1OIP A;  3SMS A;  1XXH A;  3J80 S;  4GIT A;  2LXE A;  1N34 M;  1QUS A;  2F5O A;  5FSW A;  1NNJ A;  3U6Q A;  3GLI B;  4JI2 M;  1QAN A;  4OW0 A;  3FE3 A;  2QP9 X;  2K0B X;  4OVZ B;  4AW4 A;  2CWB A;  4LZZ A;  4XBO A;  2Z3X A;  4KOD A;  1ORY B;  3U5Z B;  4LRT A;  2KRU A;  4Z8X A;  3GLF E;  1E94 E;  4NXM M;  3T1H M;  2R0I A;  3H4J A;  2K47 A;  2MRO B;  2CHV A;  2ZAO A;  3UK6 A;  5EP4 A;  1HNZ M;  1E9R A;  1V92 A;  3K92 A;  3R9X B;  2WSC F;  4JI8 M;  5JI2 E;  1OJL A;  1IFY A;  3W68 A;  3VLF B;  4FVM A;  2Y21 A;  3HJS A;  2D7G A;  3W67 A;  1Z59 A;  1TR8 A;  2O25 A;  4I5S A;  3U61 B;  2UUA M;  2CEA A;  1DGH A;  1K3X A;  2QCU A;  2I7N A;  4R3D A;  2HKJ A;  2DWL A;  5ITT A;  3H4M A;  3CTW B;  4FCW A;  2EKF A;  1IBL M;  4CIS A;  8CAT A;  2YNM D;  4HEO A;  2L4F A;  4JN6 A;  3VKH A;  1NVM A;  2R4J A;  2MJ5 B;  3ZH9 B;  4X66 M;  1RU3 A;  1L8Q A;  1Z5C A;  2UUB M;  4MGZ E;  2W82 A;  1IY2 A;  4DR3 M;  1NJF A;  3I04 M;  4BLC A;  1QAO A;  1QAQ A;  1OFH A;  2VII A;  4IBD A;  5JI3 E;  5ITX E;  5A2Q S;  2CV2 A;  2F5Q A;  4B3T M;  3GLI E;  1DV0 A;  3LVV A;  3THG A;  2KNV A;  2ZAN A;  2WSE F;  2JY5 A;  1TGU A;  5KQ8 A;  3VK7 A;  3LCU A;  1OKS A;  2QHO B;  2V1C A;  3HU1 A;  3J7A S;  3J81 S;  1PJS A;  2HWJ A;  1L2C A;  3JR4 A;  4I4L A;  1SXJ D;  4GH9 A;  1FJG M;  1IXS B;  1MN3 A;  2DAM A;  2DI0 A;  4R71 A;  2OPF A;  2JWS A;  3KSX A;  4LFB M;  3K9O A;  2HAK A;  1Z5A A;  4GKK M;  4F2L A;  2G5G X;  1KFV A;  4JYA M;  3GLG A;  3SAW A;  1NY6 A;  3L27 A;  5C1B A;  2R6F A;  1QQW A;  3UGJ A;  3GLH A;  4L8R C;  1D0K A;  4I81 A;  2CE7 A;  2JZ1 A;  3IG8 A;  3AOE C;  4G6Z A;  3DFZ A;  3K8Z A;  3UZU A;  4IIW A;  1OIZ A;  2LVO C;  3KP1 E;  4JI0 M;  4X65 M;  5F3W A;  2X8A A;  4IBC A;  1W5S A;  3FUV A;  3LMM A;  4YHH M;  1Z6T A;  2DAI A;  4DV7 M;  1V33 A;  2L4E A;  4DV1 M;  3ZC7 B;  2D7H A;  1UFZ A;  4LF7 M;  2F5N A;  1IN7 A;  4HLQ A;  3E4R A;  2OOB A;  3LQQ A;  1JB0 F;  3M6A A;  4FCT A;  4G3O A;  2JP7 A;  5GKN A;  3OTO M;  3CF6 E;  3SAU A;  4KLN A;  4LF4 M;  1EFU B;  2FH0 A;  4LF9 M;  2LHG A;  4QHT A;  4LF8 M;  1TH4 A;  3U6E A;  1IQP A;  2BWE A;  3AOG A;  1HR0 M;  1N75 A;  3SAT A;  1MX0 A;  3A45 A;  4L78 A;  4G4Q A;  2FE8 A;  2G3Q A;  3M7G A;  4W5W A;  4ZPX A;  1SG9 A;  4QNR A;  3AV0 A;  4PCZ A;  4LF5 M;  1XC8 A;  3UJN A;  2QQ8 A;  3CF0 A;  2CV1 A;  1XHB A;  2LH0 A;  4I8O A;  3U6C A;  1IN6 A;  3KOX E;  3AL0 C;  5FTJ A;  4TUW A;  2F5P A;  3SHF A;  1QDT A;  2DVW B;  3C9P A;  2CFO A;  2FNA A;  2M60 A;  4DV4 M;  3FTC A;  4NC6 A;  1TF0 B;  3U6S A;  4REZ A;  4Q7J A;  5ITU A;  5EXT A;  4ITQ A;  2R18 A;  1N36 M;  2DAK A;  2Z4S A;  5BR8 M;  1HJP A;  1NSF A;  5BPV A;  1K3W A;  3KXE C;  3FTD A;  2XLJ A;  1XMO M;  4DR4 M;  1QVR A;  2EA0 A;  2JA2 A;  3GLI A;  3L2A A;  4LJ9 A;  4HL4 A;  1IXS A;  2J5Y A;  1YLA A;  1FNN A;  1Q39 A;  3BBZ A;  3DA1 A;  2RKO A;  3LCV B;  3MK6 A;  2A5Y B;  1SXJ E;  2WZJ A;  2VF8 A;  1P3Q Q;  3FUX A;  4A3V B;  1WHC A;  4M9X A;  4KO8 A;  4WUR A;  2JY6 B;  1ZMU A;  1OFI A;  3HU3 A;  3MHV C;  4L6V 6;  1GJS A;  5EP1 A;  2VF7 A;  3GLF A;  2DWZ B;  2R65 A;  1XXH E;  3W0L B;  5E26 A;  3KFU G;  1GAB A;  2LBC A;  3HY5 A;  4MB7 A;  1Q3C A;  1S3S A;  2QEN A;  1TTE A;  2YFQ A;  3KOW E;  4Y28 F;  4AG6 A;  1TDH A;  5LMU M;  4JI1 M;  2OOA A;  3B7N A;  1T3T A;  3PNV A;  1WIV A;  2HHH M;  2CP8 A;  4PD2 A;  4XK8 F;  1G3I A;  2MGW A;  1PRB A;  2XEP A;  3GPY A;  1KSF X;  3RGS A;  3U6D A;  5FLX S;  4OU7 A;  3VFD A;  2ZAM A;  3U61 A;  3C3D A;  3HZJ A;  3IG5 A;  5FTK A;  5KQD A;  2ZTD A;  3ILK A;  4DV3 M;  1IN4 A;  4QHS A;  4L15 A;  4ANR A;  2LVQ D;  2RGO A;  5FTM A;  4GMQ A;  3ZQJ A;  3JR5 A;  2V6Z M;  3RGP A;  4JV5 M;  3L29 A;  3PXG A;  4DR5 M;  1JQJ C;  4B7G A;  2UXC M;  3GQ4 A;  3V76 A;  4CIZ A;  4DV5 M;  2CHQ A;  2P5T A;  4IJE A;  1DO2 A;  2FOI C;  2H1R A;  1W5T A;  4GRI A;  1G4A E;  4LGY A;  4MGH A;  5EXP A;  2JUJ A;  2LNH C;  4IBK A;  4QOZ C;  2KNZ A;  3IEC A;  1XXH B;  1AUA A;  2XFT A;  4LY6 A;  1HNX M;  5DFL A;  2UUC M;  3EIE A;  4IBF A;  5KPR A;  3HHZ A;  4R7G A;  4WW0 A;  4GHL A;  3NBX X;  4M9Z A;  1N77 A;  2KZS A;  4KT0 F;  1GO5 A;  2C96 A;  2JY8 A;  4P17 A;  3VDU A;  3HX3 A;  3NWL A;  4LGM A;  4MM3 B;  4D81 A;  5IRE B;  2M5Z A;  1T43 A;  4JXJ A;  2YR0 A;  4YY3 M;  4B7F A;  2HCB A;  3LQR A;  3AFH A;  1QZM A;  1GL7 A;  3VDP A;  1PJT A;  2F5S A;  3HWS A;  4MGY E;  3SBJ A;  4B3R M;  3SC3 A;  4LZJ A;  4BB9 A;  1NV9 A;  5DYI A;  2B3T A;  3HU2 A;  1D0L A;  4L16 A;  3Q8X A;  3PFI A;  3U6M A;  4DUZ M;  2BJV A;  1IXR C;  3FUU A;  4MGI E;  2DNA A;  3E21 A;  1QZE A;  3T15 A;  5FTL A;  1DGG A;  4NXN M;  2BWB A;  1PJI A;  3GLH E;  1WGN A;  2XZF A;  1SXJ A;  2KW0 A;  3FYD A;  1L1T A;  2XH9 A;  5EXX A;  3A98 B;  1XWI A;  3AOE A;  3KVW A;  3FD9 A;  4D82 A;  3SAV A;  2R44 A;  5H37 D;  2DEN A;  1VEG A;  3ZCB B;  1Q02 A;  1PM5 A;  3A42 A;  3TWK A;  3PVS A;  4UN2 B;  3K9P A;  3GP1 A;  4DV0 M;  2QZ4 A;  2YQZ A;  3SYL A;  4FD2 A;  4NL4 H;  2Y0T A;  5EP3 A;  5ITQ A;  3AKZ A;  2LTU A;  3HHX A;  3WHK A;  1IBM M;  2V1U A;  1X37 A;  2LHC A;  3TWL A;  5IWA M;  4PDG A;  4NSR A;  3TL4 X;  3K2L A;  4DV2 M;  4LFA M;  4IBG A;  1WGL A;  4OX9 M;  4GIP A;  1K82 A;  5DYG A;  3J2P B;  2L2D A;  3VK8 A;  2CRU A;  3GRY A;  4RNA A;  2BJW A;  1GL6 A;  1Y8G A;  3K1J A;  2DKL A;  3HKP A;  4IJF A;  5DNY A;  2BNK A;  5ITX A;  2H5X A;  1BVS A;  1IY0 A;  1HQC A;  1YE9 A;  1A5T A;  1GLN A;  4CJ6 A;  1HNW M;  2R62 A; 
#chains in the Genus database with same CATH homology
 2DHR A;  3HHY A;  3LVW A;  3JAM S;  2XF3 A;  5KO3 A;  3SMP A;  3L26 A;  4DR6 M;  3FUT A;  4II7 A;  3NBI A;  4MH0 E;  2VQE M;  3VKG A;  1IN5 A;  4DUY M;  3SHG B;  1QAM A;  2CUZ A;  3GRU A;  3HHW A;  3KS4 A;  4DR2 M;  4K0K M;  4XGI A;  4AI6 A;  1YSY A;  2R46 A;  3HJQ A;  1KYI A;  1NHW C;  3AJI B;  4PT5 A;  1JR3 A;  2Q2E B;  5IZ7 D;  3PNY A;  1Q3B A;  2CHG A;  4LCB A;  4B7H A;  1DGH B;  4LJ5 A;  2C9C A;  1PJJ A;  3TE6 A;  3GLH B;  1IY1 A;  1IN8 A;  2OQ4 A;  3TPZ A;  4PDI A;  1GKI A;  4IBJ A;  4JI6 M;  5ITR A;  1E9S A;  3RFW A;  4G4N A;  2ZM6 M;  3CF2 A;  3TQS A;  2UU9 M;  2L7H A;  1N78 A;  1IM2 A;  4Z6Y A;  3T38 A;  3KP0 E;  1TH3 A;  1N32 M;  3QWL A;  2AHM A;  4IBB A;  1R7R A;  3A46 A;  2LWX A;  1H6U A;  3FKE A;  4GC9 A;  4LRS A;  1ZQ9 A;  4LJ8 A;  2C98 A;  4B3M M;  4QOS A;  7CAT A;  3L25 A;  4BBA A;  3GLF B;  4AG5 A;  2QBY A;  2KXE A;  1NNU C;  2RGH A;  4GC5 A;  2XSZ A;  3BOS A;  2Y0Q A;  2HL7 A;  1J5E M;  4D80 A;  2NQ8 C;  1R2Y A;  3I51 A;  4FW9 A;  4X64 M;  3KOY E;  4DR1 M;  3R8F A;  1TDZ A;  2X49 A;  3GO8 A;  2KA6 B;  1XNR M;  1Z5B A;  3SYK A;  2O5R A;  4LFC M;  1NJG A;  1NHG C;  3KW6 A;  4S12 A;  2C5R A;  2QPA A;  4EIW A;  1GVN A;  4JI7 M;  1N33 M;  2F4V M;  3I4Y A;  1R6B X;  4B3S M;  1DGB A;  3EIH A;  1EE8 A;  3QAU A;  2DZN B;  3GPX A;  3WHL A;  4M9S A;  4AZF A;  3KS8 A;  2UXB M;  2DXI A;  3L28 A;  2J7N A;  3FTE A;  3DZD A;  4MGK E;  2DWN A;  2D7E A;  1L2B A;  2KEB A;  2R45 A;  4AKH A;  3GPP A;  4NSO B;  1ZAE A;  2DWM A;  3SAS A;  1XNQ M;  2ERC A;  2UXD M;  3FUW A;  3B9P A;  5C18 A;  4JI3 M;  2I7P A;  2L6O A;  4AKI A;  3M0E A;  4FCV A;  4JI5 M;  1SXJ B;  4M0W A;  3J7B A;  3FTF A;  2L7I A;  4L4U A;  1D2N A;  2EO2 A;  3GPU A;  5ITY A;  2E5L M;  4CHT B;  1C1K A;  4DV6 M;  4LJA A;  4LJ6 A;  2DZO B;  4IBI A;  2EUC A;  4QNM A;  1DGF A;  2KRK A;  1YUB A;  4M0D A;  3C58 A;  3U6L A;  1WXQ A;  1VDD A;  4P16 A;  5EQT A;  5FTN A;  1UM8 A;  1I94 M;  2ZBK B;  3U60 A;  4X62 M;  4KHP M;  2Z7J A;  3J27 B;  2VQF M;  3U5Z A;  1NY5 A;  1L2D A;  2J7O A;  2G8L A;  3HGI A;  4FWG A;  3RE8 A;  2XGN A;  3SAR A;  4OVZ A;  1J7K A;  3D8L A;  1XMQ M;  3U6P A;  1E32 A;  1G41 A;  1TH2 A;  2FFJ A;  2XFS A;  3MJ5 A;  1QYR A;  3I4V A;  5EXS A;  3GRV A;  2Z4R A;  4NRW A;  5KPZ A;  3GRR A;  3DOA A;  3GQ3 A;  2C99 A;  2KZU A;  5E6J A;  2XSZ D;  4IBE A;  1IXZ A;  4RF0 A;  4LJ4 A;  3UMM A;  4NOO B;  4DR7 M;  4G4O A;  5EP2 A;  1HQY E;  3D8B A;  4G4R A;  3KDS E;  5LMN M;  3GLG B;  2X4A A;  3U6O A;  3E9S A;  3U60 B;  1IBK M;  1HT1 E;  3GQ5 A;  3W0F A;  4CGY B;  1L1Z A;  1HT2 E;  1DO0 A;  2XZU A;  4LG2 A;  2CV0 A;  3KOZ E;  1R2Z A;  4JI4 M;  4GHA A;  4B08 A;  1JR3 D;  2QBY B;  3FYC A;  2C9O A;  3KSJ A;  4GKJ M;  2R4E A;  1MU5 A;  4NRV A;  1I4W A;  1G59 A;  1J09 A;  2L09 A;  3HJ8 A;  1LV7 A;  3T1Y M;  5IT9 S;  3SFZ A;  5EJC A;  3TWM A;  4LJ7 A;  1SXJ C;  4RF1 A;  5KPT A;  4FWH A;  4LF6 M;  4AQY M;  1G8P A;  2Y20 A;  4FWD A;  3SMS A;  1XXH A;  3J80 S;  4GIT A;  2LXE A;  1N34 M;  2F5O A;  5FSW A;  1NNJ A;  3U6Q A;  3GLI B;  4JI2 M;  1QAN A;  4OW0 A;  2QP9 X;  4OVZ B;  4AW4 A;  4LZZ A;  4XBO A;  2Z3X A;  4KOD A;  1ORY B;  3U5Z B;  4LRT A;  2KRU A;  4Z8X A;  1E94 E;  4NXM M;  3T1H M;  2K47 A;  2CHV A;  2ZAO A;  3UK6 A;  5EP4 A;  1HNZ M;  1E9R A;  3K92 A;  3R9X B;  4JI8 M;  5JI2 E;  1OJL A;  3VLF B;  4FVM A;  2Y21 A;  3HJS A;  2D7G A;  1Z59 A;  4I5S A;  3U61 B;  2UUA M;  2CEA A;  1DGH A;  1K3X A;  2QCU A;  2I7N A;  4R3D A;  2HKJ A;  2DWL A;  5ITT A;  3H4M A;  3CTW B;  4FCW A;  1IBL M;  4CIS A;  8CAT A;  2YNM D;  4JN6 A;  3VKH A;  1NVM A;  2R4J A;  3ZH9 B;  4X66 M;  1L8Q A;  1Z5C A;  2UUB M;  4MGZ E;  2W82 A;  1IY2 A;  4DR3 M;  1NJF A;  4BLC A;  1QAO A;  1QAQ A;  1OFH A;  2VII A;  4IBD A;  5JI3 E;  5ITX E;  5A2Q S;  2CV2 A;  2F5Q A;  4B3T M;  3LVV A;  3THG A;  2ZAN A;  1TGU A;  5KQ8 A;  3VK7 A;  2V1C A;  3HU1 A;  3J7A S;  3J81 S;  1L2C A;  3JR4 A;  4I4L A;  1SXJ D;  4GH9 A;  1FJG M;  1IXS B;  4LFB M;  2OPF A;  3KSX A;  4GKK M;  1Z5A A;  2G5G X;  1KFV A;  4JYA M;  3GLG A;  3SAW A;  1NY6 A;  3L27 A;  5C1B A;  1QQW A;  3UGJ A;  3GLH A;  4L8R C;  4I81 A;  2CE7 A;  4G6Z A;  3IG8 A;  3AOE C;  3DFZ A;  3K8Z A;  3UZU A;  4IIW A;  3KP1 E;  4JI0 M;  4X65 M;  5F3W A;  2X8A A;  4IBC A;  1W5S A;  3FUV A;  3LMM A;  4YHH M;  1Z6T A;  4DV7 M;  4DV1 M;  3ZC7 B;  2D7H A;  4LF7 M;  2F5N A;  1IN7 A;  4HLQ A;  3E4R A;  3M6A A;  3LQQ A;  4FCT A;  3OTO M;  3SAU A;  4LF4 M;  5GKN A;  4AKG A;  3CF6 E;  4LF8 M;  4KLN A;  4LF9 M;  4QHT A;  1TH4 A;  3U6E A;  1IQP A;  1HR0 M;  3AOG A;  1N75 A;  3SAT A;  1MX0 A;  3A45 A;  4L78 A;  4G4Q A;  2FE8 A;  3M7G A;  4W5W A;  4ZPX A;  4QNR A;  3AV0 A;  4PCZ A;  4LF5 M;  1XC8 A;  3UJN A;  3CF0 A;  2CV1 A;  1XHB A;  2LH0 A;  4I8O A;  3U6C A;  1IN6 A;  3KOX E;  3AL0 C;  5FTJ A;  2F5P A;  3SHF A;  2DVW B;  2CFO A;  2FNA A;  2M60 A;  4DV4 M;  3FTC A;  3U6S A;  4REZ A;  5ITU A;  5EXT A;  4ITQ A;  2R18 A;  1N36 M;  2Z4S A;  5BR8 M;  1NSF A;  5BPV A;  1K3W A;  3KXE C;  3FTD A;  2XLJ A;  1XMO M;  4DR4 M;  1QVR A;  2EA0 A;  2JA2 A;  3GLI A;  3L2A A;  4LJ9 A;  4HL4 A;  1FNN A;  1Q39 A;  3DA1 A;  2RKO A;  3MK6 A;  2A5Y B;  1SXJ E;  4A3V B;  3FUX A;  4M9X A;  4KO8 A;  4WUR A;  1OFI A;  3HU3 A;  3MHV C;  5EP1 A;  3GLF A;  2DWZ B;  2R65 A;  3W0L B;  5E26 A;  3KFU G;  4MB7 A;  1Q3C A;  1S3S A;  2QEN A;  2YFQ A;  3KOW E;  4AG6 A;  4JI1 M;  5LMU M;  1TDH A;  1T3T A;  3PNV A;  2HHH M;  4PD2 A;  1G3I A;  2XEP A;  3GPY A;  1KSF X;  3RGS A;  3U6D A;  5FLX S;  4OU7 A;  3VFD A;  2ZAM A;  3U61 A;  3IG5 A;  5FTK A;  5KQD A;  3ILK A;  4DV3 M;  1IN4 A;  4QHS A;  4L15 A;  5FTM A;  2RGO A;  4GMQ A;  3JR5 A;  2V6Z M;  3RGP A;  4JV5 M;  3L29 A;  3PXG A;  4DR5 M;  1JQJ C;  4B7G A;  2UXC M;  3GQ4 A;  4DV5 M;  2CHQ A;  2P5T A;  4IJE A;  1DO2 A;  2FOI C;  2H1R A;  1W5T A;  4GRI A;  1G4A E;  4LGY A;  4MGH A;  5EXP A;  4IBK A;  2LNH C;  4TUW A;  4QOZ C;  1XXH B;  2XFT A;  4LY6 A;  1HNX M;  2UUC M;  3EIE A;  4IBF A;  5KPR A;  3HHZ A;  4R7G A;  4WW0 A;  4GHL A;  4M9Z A;  1N77 A;  2KZS A;  2C96 A;  3VDU A;  3NWL A;  4LGM A;  4MM3 B;  4D81 A;  5IRE B;  2M5Z A;  4JXJ A;  2YR0 A;  4YY3 M;  4B7F A;  2HCB A;  3LQR A;  3AFH A;  1QZM A;  1GL7 A;  3VDP A;  2F5S A;  3HWS A;  4MGY E;  3SBJ A;  4B3R M;  3SC3 A;  4LZJ A;  4BB9 A;  5DYI A;  3HU2 A;  4L16 A;  3Q8X A;  3PFI A;  3U6M A;  4DUZ M;  2BJV A;  1IXR C;  3FUU A;  4MGI E;  5FTL A;  3T15 A;  1DGG A;  4NXN M;  1PJI A;  2XZF A;  1SXJ A;  2KW0 A;  3FYD A;  1L1T A;  2XH9 A;  5EXX A;  3A98 B;  1XWI A;  3AOE A;  3KVW A;  3FD9 A;  4D82 A;  3SAV A;  5H37 D;  3ZCB B;  1PM5 A;  3A42 A;  3TWK A;  3PVS A;  3GP1 A;  4DV0 M;  2QZ4 A;  2YQZ A;  3SYL A;  4FD2 A;  4NL4 H;  2Y0T A;  5EP3 A;  5ITQ A;  3AKZ A;  3HHX A;  3WHK A;  1IBM M;  2V1U A;  1X37 A;  3TWL A;  5IWA M;  4PDG A;  4NSR A;  3TL4 X;  3K2L A;  4DV2 M;  4LFA M;  4IBG A;  4OX9 M;  4GIP A;  1K82 A;  5DYG A;  3J2P B;  3VK8 A;  3GRY A;  4RNA A;  2BJW A;  1GL6 A;  4IJF A;  3K1J A;  3HKP A;  5DNY A;  2BNK A;  5ITX A;  1IY0 A;  1HQC A;  1YE9 A;  1GLN A;  1HNW M;  2R62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...