1NO1A

Structure of truncated variant of b.subtilis spp1 phage g39p helicase loader/inhibitor protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
MIEKDVVQILKAVSEFYPGRFQPDDLKGTVKAWHRVLAEYELEEIMNNLTDYAKVNKFPPTVSDLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of Bacillus subtilis SPP1 phage helicase loader protein G39P
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Replication
molecule keywords replisome organizer
total genus 16
structure length 67
sequence length 67
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.200 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Replisome organizer (g39p helicase loader/inhibitor protein) 1no1A00
1NO1A
chains in the Genus database with same CATH superfamily
4LGMA 3U5ZB 2FFJA 4Z8XA 3LCVB 5E26A 3VFDA 1K3WA 3L28A 1DGHB 1QUSA 3GO8A 1CUKA 4QOSA 3R9XB 4LG2A 3MHVC 4DR4M 1I94M 2KZUA 4GH9A 2HWJA 2ZBKB 3KW6A 4W5WA 3U5ZA 3ZC7B 3AFHA 1GVNA 2QZ4A 2Z4SA 4PDGA 3GLFB 1TH2A 2M5ZA 3U6EA 3H4JA 2CP8A 3HJSA 1QZEA 4JN6A 4ANRA 2UXDM 5EJCA 3WHKA 3Q8GA 4MGYE 3DA1A 4F1IA 4LJ5A 2DAMA 3K9PA 1G4AE 3I51A 3M7GA 4LZJA 2QPAA 2QBYB 1PJJA 1QZMA 3SMSA 5DYIA 2LH0A 3C3EA 4JI3M 1EIJA 1VDLA 1QYRA 4HL4A 3HKPA 1GABA 2Z8YM 3U60A 1K3XA 1E9SA 3K2LA 3UZUA 4GITA 1G3IA 3K9OA 2VF8A 1XMOM 4OVZB 4L15A 1QDRA 1Z5AA 2XEPA 4IBKA 3V76A 4KHPM 5C1BA 4GC5A 2Y0QA 2EKFA 3KDSE 4GHAA 4XGIA 2Z4RA 2D7EA 2DZNB 1XXHA 3CF2A 2JY8A 4M9ZA 2DAKA 4NSOB 1R7RA 3FTDA 4WW0A 4GRIA 4B3TM 2O01F 3AOEC 3HHXA 4JI0M 2VIIA 4OW0A 2F5OA 2UUBM 1OAOC 3CF0A 2L4EA 3SBJA 1DO0A 4QOZC 4XK8F 4LZZA 3PNYA 5JI2E 2CHVA 4KT0F 3W0FA 4AKIA 1PJTA 4R7GA 3U6PA 1J7KA 4OU7A 2G3QA 5FTKA 1IM2A 2XF3A 2YNMD 3TL4X 3UK6A 3SASA 3CGWA 3THGA 1TR8A 1DGBA 1N78A 3GLFE 2KNAA 4PCZA 4AKHA 1HQYE 4DV4M 1WIVA 3KP0E 4L8RC 5EXPA 2HL7A 2L7IA 1IN8A 3HU2A 3HHWA 2AHMA 1VEGA 2FOIC 2XFTA 3FYDA 3LMMA 3ZH9B 4B7FA 1D0MA 1DGFA 1HQCA 1IFYA 3PFIA 1TDHA 3EIHA 4LF6M 1NHGC 3QAUA 1IN7A 4IBEA 4JV5M 4CIZA 1PM5A 4NL4H 2ZAOA 3U61B 2HAKA 1HT2E 3DZDA 2CWBA 1Z59A 1IXZA 3B74A 4FWDA 5ITQA 2DWNA 4DR7M 1GO5A 4X62M 4REZA 3GLGB 4LJ6A 4IBCA 5ITYA 3I4YA 4L16A 4L6V6 4B3MM 3VLFB 1Q3BA 1TF0B 1V92A 4MGHA 2J5YA 2CFOA 4CJ6A 2UXCM 2ZANA 2FNAA 2KDLA 5KPTA 1XXHE 2QBYA 3U6DA 3L26A 2J7NA 3K92A 1W5SA 3GP1A 3U6MA 3B9PA 3ZCBB 5IT9S 3HX3A 2JP7A 1SG9A 1E32A 3DFZA 4PT5A 1T3TA 3HJQA 4GC9A 4NXMM 2GQFA 1R5LA 5KQDA 3L25A 2LVOC 2EUCA 4P17A 3H4MA 4DV7M 1QANA 4LF9M 1KYIA 1N33M 2JWSA 3E4RA 4HLQA 4IBFA 4IBGA 3VDUA 3SC3A 4DBGB 2VQFM 3GRRA 1Z5CA 1Y8GA 4FD2A 3GPUA 3VK8A 4LF8M 1G41A 2BJVA 1NV8A 4Q7JA 2KHHA 4ITQA 2Z7JA 2DENA 1MU5A 3J7AS 1OFHA 1E9RA 4FWHA 1UM8A 4X66M 3PXGA 2FE8A 2HKJA 3I01M 3WHLA 2CV2A 2OO9A 4RF0A 1IN4A 2LVAA 3NBIA 3AV0A 4JI2M 1DGHA 5IWAM 4LFAM 2ZM6M 2JA2A 3TWKA 5IZ7D 3VKHA 3VKGA 1Q39A 1YLAA 4GIPA 1IN6A 2VQEM 3GLHA 3M0EA 3KOYE 1Z5BA 2DWLA 1PGYA 3SAUA 4LRTA 1GLNA 4DV3M 8CATA 3UGJA 4JI7M 2L09A 3L29A 4PDIA 2M60A 2CHQA 3SMPA 4XBOA 5FTLA 3HU1A 2B3TA 2LTUA 2QHOB 2OQ4A 4CISA 1HR0M 4WURA 1UFZA 2E5LM 4K0KM 1G8PA 2KXEA 1NY6A 2JNHA 4G3OA 4IJEA 2K0BX 3FKEA 4D82A 3BOSA 3IG8A 1N75A 4JI6M 3U6CA 4AG5A 1R6BX 3MMPA 2ZAMA 3KS4A 2DHYA 2LVPC 3PVSA 1L2DA 4QNMA 2FH0A 4NXNM 1DV0A 4Z6YA 2RRUA 3J81S 1D0KA 1YE9A 2Q2EB 3UMMA 3FUXA 1R2YA 2KNVA 5KPRA 3Q8XA 3JR4A 1XC8A 3AOEA 1NY5A 2R44A 4LRSA 1WR1B 4NRVA 4YY3M 1E94E 2OPFA 1NHWC 1ZMWA 1EE8A 5EP4A 3GPPA 3W0LB 1IXSB 3GPXA 1KSFX 2ZTDA 2JZ1A 2K47A 1NO1A 4MGKE 4JI1M 2KRUA 3FRHA 3M6AA 2LVNC 4B08A 4LF7M 3RFWA 5FTJA 5ITUA 2KA6B 2R4EA 3KOXE 2CHGA 4IBJA 4G4OA 3C3DA 2LHGA 1TGUA 2KEBA 3B7ZA 4AQYM 5EXSA 1WXQA 2R6FA 3U60B 4R3DA 3GLGA 3KS8A 2DXIA 1XNRM 4LCBA 3KSJA 3HY5A 1C7YA 3VDPA 4X64M 5EXTA 4DUYM 5F3WA 1D0LA 1SXJE 1KFVA 1OIPA 4AG6A 5EQTA 4LJAA 2XH9A 3LW5F 2RGHA 3NWLA 4MGZE 3SHFA 3GQ5A 4OX9M 1EFUB 4AI6A 1IY2A 2QSFX 1NV9A 1VG5A 2APLA 3IHPA 3C58A 4OVZA 1L1TA 4DR5M 4LGYA 2WSCF 4DUZM 2NQ8C 3TWLA 2DAEA 1IXRC 2V1CA 4F2LA 2Y0TA 4B3RM 4LFBM 3ILKA 2C96A 4LF5M 1F4IA 3LQQA 2OOAA 2O5RA 2HHHM 2EA0A 1TTEA 1XXHB 4CHTB 3A46A 5EP2A 1QQWA 1OKSA 4LFCM 1OTRA 4BB9A 1TH4A 4MM3B 5DNYA 2CUZA 4X65M 2JXNA 3FTCA 2XSZA 3SAWA 3CTWB 3TWMA 1SXJB 3GRVA 2N35A 3VK7A 1ZQ9A 2LHCA 2R46A 2QP9X 3HZJA 2XZFA 2KNZA 2D7HA 3HJ8A 4KLNA 4DV5M 2G8LA 3FTEA 2UXBM 1ZAEA 2RGOA 2YQZA 1Q02A 1BVSA 4R71A 2DHRA 2JY6B 5EXXA 2QQ8A 3HWSA 3D8LA 5ITTA 3GPYA 1N32M 3T1YM 4NOOB 3AKZA 4A3VB 3W67A 4DV2M 3UJNA 1T43A 2DI0A 2V1UA 2R62A 1L8QA 4L78A 2BNKA 2WZJA 4G4QA 2L6OA 4II7A 2CV1A 1SXJA 3AJIB 3SHGB 1ZMVA 1LV7A 3JR5A 1N36M 3GLFA 2ZTCA 3K8ZA 1NSFA 1WGNA 3HGIA 5ITXE 4I81A 4DR2M 3E21A 1NNJA 5L8RF 1J09A 2C98A 3KXEC 5GKNA 5ITXA 3U6LA 1GKIA 2F5SA 2KZSA 2G5GX 2XSZD 1VEJA 4IJFA 3BXWA 3L27A 2XZUA 1C1KA 1FNNA 5KO3A 1IXSA 3E9SA 1ORYB 5BR8M 1W5TA 3R8FA 2H1RA 2DZLA 3HHZA 2CEAA 4DV6M 1IBLM 2GNOA 2C99A 2L4FA 4LJ8A 3GRUA 5A2QS 2VF7A 2YFQA 5DFLA 1L2CA 4JI8M 3FUTA 2QENA 1RU3A 4QHSA 7CATA 3J80S 1QAMA 4LY6A 4UN2B 1HNZM 3RGSA 5KPZA 1V33A 3KP1E 4ZPXA 2F5PA 4RKUF 4FW9A 4DV0M 2W82A 1QAQA 2DZOB 2I7PA 2WSFF 4KODA 4FWGA 4JI5M 2JY5A 2Y20A 2YR0A 2R0IA 4FVMA 1T6OA 3FTFA 3EIEA 4FCVA 4GEWA 4GHLA 3A42A 4B7GA 1QVRA 4KO8A 2KW0A 1NNUC 1S3SA 2CRUA 4IBDA 2XGNA 2C9CA 4LJ7A 1OJLA 3U6QA 4GKKM 4IIWA 4QHTA 5FTNA 1P3QQ 4JI4M 1H6UA 2MJ5B 4B7HA 3U6SA 1GL7A 1I4WA 2VDBB 4M0DA 2R65A 1JB0F 1NJFA 3FUUA 2QCUA 2XFSA 2RKOA 4G4NA 3T1HM 3QYEA 4BLCA 3FD9A 1QUTA 2X8AA 4GMQA 2HCBA 4LF4M 3IG5A 1D2NA 1OQYA 1TH3A 3FUVA 1MX0A 5C18A 3TE6A 1QAOA 2K9DA 4B3SM 2DNAA 4LJ4A 3LQRA 1VDDA 4I8OA 1IBMM 2UU9M 2LBCA 2MGWA 2UUAM 2FS1A 4M9SA 2DAIA 4EIWA 2XLJA 3LVWA 2J7OA 3SFZA 5LMNM 4PD2A 1J5EM 4L4UA 4WP2A 5KQ8A 1GJTA 4DR3M 3GQ3A 3FRIA 3QYBA 4HEOA 5JI3E 3GLIB 3QWLA 1IQPA 2JY7A 3GLHB 3HU3A 2A5YB 3GLGE 3U6OA 4FCWA 2I7NA 4RF1A 4JYAM 4IBBA 1IY1A 2V6ZM 4S12A 2LVQD 3T15A 1HNWM 1NJGA 1TDZA 3SATA 2KRKA 3J2PB 1HT1E 1JR3D 1OFIA 1X37A 1A5TA 3FUWA 4G6ZA 5DYGA 3TQSA 5FSWA 3GLIE 1WHCA 2DKLA 4FCTA 4IBIA 4TUWA 1HJPA 2MH8A 2P5TA 3T6PA 4NRWA 3L2AA 1SXJC 1IY0A 3RE8A 2OOBA 4LJ9A 4P16A 1G71A 2L7HA 3MK6A 2F5QA 2BWEA 4MH0E 1N77A 2F4VM 1JQJC 2DVWB 3TPZA 3A98B 1OIZA 1XB2B 2X49A 4AKGA 4AW4A 3DOAA 5FTMA 3D8BA 3KOZE 4MB7A 2CV0A 1XHBA 3B7NA 3LCUA 4M9XA 1XNQM 3B89A 1WGLA 1DO2A 3AL0C 1PJIA 1XWIA 1PJSA 1L1ZA 1FJGM 4D81A 1DGGA 3T38A 3MJ5A 2Y21A 3OTOM 1VQ1A 3NBXX 1GJSA 1G59A 2ERCA 2LXEA 3U61A 3I4VA 1SXJD 3W68A 1VEKA 5EP3A 2R18A 1QDTA 3I04M 3FYCA 1JR3A 5H37D 5EP1A 1IBKM 2F5NA 1NVMA 2C9OA 4Y28F 3SYLA 4QNRA 3JAMS 3GLIA 2EO2A 4NSRA 4RNAA 3RGPA 3FE3A 3B7QA 4CGYB 5LMUM 5IREB 2R4JA 1V34A 2JZ0A 4D80A 2DAGA 3C9PA 4DV1M 4G4RA 4M0WA 3GLHE 3J27B 1PJQA 2R45A 4NC6A 3PNVA 3GRYA 1WJ7A 2CE7A 2C5RA 1JR3E 2X4AA 5BPVA 2H5XA 2JUJA 2LWXA 3SYKA 3HHYA 1N34M 4AZFA 1OAIA 2LNHC 2BWBA 3GQ4A 1R4GA 3KFUG 1IN5A 4BBAA 1AIPC 1YUBA 3KVWA 1MN3A 1ZV1A 2DWZB 3F92A 4I5SA 5FLXS 1K82A 1YSYA 2L2DA 3A45A 1L2BA 3IECA 4YHHM 3ZQJA 4GKJM 2O25A 5E6JA 3AOGA 3LVVA 3J7BA 2D7GA 2QNJA 2WSEF 3KSXA 3SAVA 5ITRA 4MGIE 2EKKA 1GL6A 1PRBA 2Z3XA 1LTMA 3E46A 1Z6TA 2BJWA 4DR1M 1R2ZA 2UUCM 3KOWE 3CF6E 1HNXM 4DR6M 2MROB 1ZMUA 3SARA 2MR9A 1AUAA 2EJSA 3BBZA 2DWMA 1XMQM 4JXJA 1MJGM 1Q3CA 3K1JA 2K6BA 4I4LA
chains in the Genus database with same CATH topology
1NO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NO1 A; 
#chains in the Genus database with same CATH topology
 4LGM A;  3U5Z B;  2FFJ A;  4Z8X A;  3LCV B;  5E26 A;  3VFD A;  1K3W A;  3L28 A;  1DGH B;  1QUS A;  3GO8 A;  1CUK A;  4QOS A;  3R9X B;  4LG2 A;  3MHV C;  4DR4 M;  1I94 M;  2KZU A;  4GH9 A;  2HWJ A;  2ZBK B;  3KW6 A;  4W5W A;  3U5Z A;  3ZC7 B;  3AFH A;  1GVN A;  2QZ4 A;  2Z4S A;  4PDG A;  3GLF B;  1TH2 A;  2M5Z A;  3U6E A;  3H4J A;  2CP8 A;  3HJS A;  1QZE A;  4JN6 A;  4ANR A;  2UXD M;  5EJC A;  3WHK A;  3Q8G A;  4MGY E;  3DA1 A;  4F1I A;  4LJ5 A;  2DAM A;  3K9P A;  1G4A E;  3I51 A;  3M7G A;  4LZJ A;  2QPA A;  2QBY B;  1PJJ A;  1QZM A;  3SMS A;  5DYI A;  2LH0 A;  3C3E A;  4JI3 M;  1EIJ A;  1VDL A;  1QYR A;  4HL4 A;  3HKP A;  1GAB A;  2Z8Y M;  3U60 A;  1K3X A;  1E9S A;  3K2L A;  3UZU A;  4GIT A;  1G3I A;  3K9O A;  2VF8 A;  1XMO M;  4OVZ B;  4L15 A;  1QDR A;  1Z5A A;  2XEP A;  4IBK A;  3V76 A;  4KHP M;  5C1B A;  4GC5 A;  2Y0Q A;  2EKF A;  3KDS E;  4GHA A;  4XGI A;  2Z4R A;  2D7E A;  2DZN B;  1XXH A;  3CF2 A;  2JY8 A;  4M9Z A;  2DAK A;  4NSO B;  1R7R A;  3FTD A;  4WW0 A;  4GRI A;  4B3T M;  2O01 F;  3AOE C;  3HHX A;  4JI0 M;  2VII A;  4OW0 A;  2F5O A;  2UUB M;  1OAO C;  3CF0 A;  2L4E A;  3SBJ A;  1DO0 A;  4QOZ C;  4XK8 F;  4LZZ A;  3PNY A;  5JI2 E;  2CHV A;  4KT0 F;  3W0F A;  4AKI A;  1PJT A;  4R7G A;  3U6P A;  1J7K A;  4OU7 A;  2G3Q A;  5FTK A;  1IM2 A;  2XF3 A;  2YNM D;  3TL4 X;  3UK6 A;  3SAS A;  3CGW A;  3THG A;  1TR8 A;  1DGB A;  1N78 A;  3GLF E;  2KNA A;  4PCZ A;  4AKH A;  1HQY E;  4DV4 M;  1WIV A;  3KP0 E;  4L8R C;  5EXP A;  2HL7 A;  2L7I A;  1IN8 A;  3HU2 A;  3HHW A;  2AHM A;  1VEG A;  2FOI C;  2XFT A;  3FYD A;  3LMM A;  3ZH9 B;  4B7F A;  1D0M A;  1DGF A;  1HQC A;  1IFY A;  3PFI A;  1TDH A;  3EIH A;  4LF6 M;  1NHG C;  3QAU A;  1IN7 A;  4IBE A;  4JV5 M;  4CIZ A;  1PM5 A;  4NL4 H;  2ZAO A;  3U61 B;  2HAK A;  1HT2 E;  3DZD A;  2CWB A;  1Z59 A;  1IXZ A;  3B74 A;  4FWD A;  5ITQ A;  2DWN A;  4DR7 M;  1GO5 A;  4X62 M;  4REZ A;  3GLG B;  4LJ6 A;  4IBC A;  5ITY A;  3I4Y A;  4L16 A;  4L6V 6;  4B3M M;  3VLF B;  1Q3B A;  1TF0 B;  1V92 A;  4MGH A;  2J5Y A;  2CFO A;  4CJ6 A;  2UXC M;  2ZAN A;  2FNA A;  2KDL A;  5KPT A;  1XXH E;  2QBY A;  3U6D A;  3L26 A;  2J7N A;  3K92 A;  1W5S A;  3GP1 A;  3U6M A;  3B9P A;  3ZCB B;  5IT9 S;  3HX3 A;  2JP7 A;  1SG9 A;  1E32 A;  3DFZ A;  4PT5 A;  1T3T A;  3HJQ A;  4GC9 A;  4NXM M;  2GQF A;  1R5L A;  5KQD A;  3L25 A;  2LVO C;  2EUC A;  4P17 A;  3H4M A;  4DV7 M;  1QAN A;  4LF9 M;  1KYI A;  1N33 M;  2JWS A;  3E4R A;  4HLQ A;  4IBF A;  4IBG A;  3VDU A;  3SC3 A;  4DBG B;  2VQF M;  3GRR A;  1Z5C A;  1Y8G A;  4FD2 A;  3GPU A;  3VK8 A;  4LF8 M;  1G41 A;  2BJV A;  1NV8 A;  4Q7J A;  2KHH A;  4ITQ A;  2Z7J A;  2DEN A;  1MU5 A;  3J7A S;  1OFH A;  1E9R A;  4FWH A;  1UM8 A;  4X66 M;  3PXG A;  2FE8 A;  2HKJ A;  3I01 M;  3WHL A;  2CV2 A;  2OO9 A;  4RF0 A;  1IN4 A;  2LVA A;  3NBI A;  3AV0 A;  4JI2 M;  1DGH A;  5IWA M;  4LFA M;  2ZM6 M;  2JA2 A;  3TWK A;  5IZ7 D;  3VKH A;  3VKG A;  1Q39 A;  1YLA A;  4GIP A;  1IN6 A;  2VQE M;  3GLH A;  3M0E A;  3KOY E;  1Z5B A;  2DWL A;  1PGY A;  3SAU A;  4LRT A;  1GLN A;  4DV3 M;  8CAT A;  3UGJ A;  4JI7 M;  2L09 A;  3L29 A;  4PDI A;  2M60 A;  2CHQ A;  3SMP A;  4XBO A;  5FTL A;  3HU1 A;  2B3T A;  2LTU A;  2QHO B;  2OQ4 A;  4CIS A;  1HR0 M;  4WUR A;  1UFZ A;  2E5L M;  4K0K M;  1G8P A;  2KXE A;  1NY6 A;  2JNH A;  4G3O A;  4IJE A;  2K0B X;  3FKE A;  4D82 A;  3BOS A;  3IG8 A;  1N75 A;  4JI6 M;  3U6C A;  4AG5 A;  1R6B X;  3MMP A;  2ZAM A;  3KS4 A;  2DHY A;  2LVP C;  3PVS A;  1L2D A;  4QNM A;  2FH0 A;  4NXN M;  1DV0 A;  4Z6Y A;  2RRU A;  3J81 S;  1D0K A;  1YE9 A;  2Q2E B;  3UMM A;  3FUX A;  1R2Y A;  2KNV A;  5KPR A;  3Q8X A;  3JR4 A;  1XC8 A;  3AOE A;  1NY5 A;  2R44 A;  4LRS A;  1WR1 B;  4NRV A;  4YY3 M;  1E94 E;  2OPF A;  1NHW C;  1ZMW A;  1EE8 A;  5EP4 A;  3GPP A;  3W0L B;  1IXS B;  3GPX A;  1KSF X;  2ZTD A;  2JZ1 A;  2K47 A;  1NO1 A;  4MGK E;  4JI1 M;  2KRU A;  3FRH A;  3M6A A;  2LVN C;  4B08 A;  4LF7 M;  3RFW A;  5FTJ A;  5ITU A;  2KA6 B;  2R4E A;  3KOX E;  2CHG A;  4IBJ A;  4G4O A;  3C3D A;  2LHG A;  1TGU A;  2KEB A;  3B7Z A;  4AQY M;  5EXS A;  1WXQ A;  2R6F A;  3U60 B;  4R3D A;  3GLG A;  3KS8 A;  2DXI A;  1XNR M;  4LCB A;  3KSJ A;  3HY5 A;  1C7Y A;  3VDP A;  4X64 M;  5EXT A;  4DUY M;  5F3W A;  1D0L A;  1SXJ E;  1KFV A;  1OIP A;  4AG6 A;  5EQT A;  4LJA A;  2XH9 A;  3LW5 F;  2RGH A;  3NWL A;  4MGZ E;  3SHF A;  3GQ5 A;  4OX9 M;  1EFU B;  4AI6 A;  1IY2 A;  2QSF X;  1NV9 A;  1VG5 A;  2APL A;  3IHP A;  3C58 A;  4OVZ A;  1L1T A;  4DR5 M;  4LGY A;  2WSC F;  4DUZ M;  2NQ8 C;  3TWL A;  2DAE A;  1IXR C;  2V1C A;  4F2L A;  2Y0T A;  4B3R M;  4LFB M;  3ILK A;  2C96 A;  4LF5 M;  1F4I A;  3LQQ A;  2OOA A;  2O5R A;  2HHH M;  2EA0 A;  1TTE A;  1XXH B;  4CHT B;  3A46 A;  5EP2 A;  1QQW A;  1OKS A;  4LFC M;  1OTR A;  4BB9 A;  1TH4 A;  4MM3 B;  5DNY A;  2CUZ A;  4X65 M;  2JXN A;  3FTC A;  2XSZ A;  3SAW A;  3CTW B;  3TWM A;  1SXJ B;  3GRV A;  2N35 A;  3VK7 A;  1ZQ9 A;  2LHC A;  2R46 A;  2QP9 X;  3HZJ A;  2XZF A;  2KNZ A;  2D7H A;  3HJ8 A;  4KLN A;  4DV5 M;  2G8L A;  3FTE A;  2UXB M;  1ZAE A;  2RGO A;  2YQZ A;  1Q02 A;  1BVS A;  4R71 A;  2DHR A;  2JY6 B;  5EXX A;  2QQ8 A;  3HWS A;  3D8L A;  5ITT A;  3GPY A;  1N32 M;  3T1Y M;  4NOO B;  3AKZ A;  4A3V B;  3W67 A;  4DV2 M;  3UJN A;  1T43 A;  2DI0 A;  2V1U A;  2R62 A;  1L8Q A;  4L78 A;  2BNK A;  2WZJ A;  4G4Q A;  2L6O A;  4II7 A;  2CV1 A;  1SXJ A;  3AJI B;  3SHG B;  1ZMV A;  1LV7 A;  3JR5 A;  1N36 M;  3GLF A;  2ZTC A;  3K8Z A;  1NSF A;  1WGN A;  3HGI A;  5ITX E;  4I81 A;  4DR2 M;  3E21 A;  1NNJ A;  5L8R F;  1J09 A;  2C98 A;  3KXE C;  5GKN A;  5ITX A;  3U6L A;  1GKI A;  2F5S A;  2KZS A;  2G5G X;  2XSZ D;  1VEJ A;  4IJF A;  3BXW A;  3L27 A;  2XZU A;  1C1K A;  1FNN A;  5KO3 A;  1IXS A;  3E9S A;  1ORY B;  5BR8 M;  1W5T A;  3R8F A;  2H1R A;  2DZL A;  3HHZ A;  2CEA A;  4DV6 M;  1IBL M;  2GNO A;  2C99 A;  2L4F A;  4LJ8 A;  3GRU A;  5A2Q S;  2VF7 A;  2YFQ A;  5DFL A;  1L2C A;  4JI8 M;  3FUT A;  2QEN A;  1RU3 A;  4QHS A;  7CAT A;  3J80 S;  1QAM A;  4LY6 A;  4UN2 B;  1HNZ M;  3RGS A;  5KPZ A;  1V33 A;  3KP1 E;  4ZPX A;  2F5P A;  4RKU F;  4FW9 A;  4DV0 M;  2W82 A;  1QAQ A;  2DZO B;  2I7P A;  2WSF F;  4KOD A;  4FWG A;  4JI5 M;  2JY5 A;  2Y20 A;  2YR0 A;  2R0I A;  4FVM A;  1T6O A;  3FTF A;  3EIE A;  4FCV A;  4GEW A;  4GHL A;  3A42 A;  4B7G A;  1QVR A;  4KO8 A;  2KW0 A;  1NNU C;  1S3S A;  2CRU A;  4IBD A;  2XGN A;  2C9C A;  4LJ7 A;  1OJL A;  3U6Q A;  4GKK M;  4IIW A;  4QHT A;  5FTN A;  1P3Q Q;  4JI4 M;  1H6U A;  2MJ5 B;  4B7H A;  3U6S A;  1GL7 A;  1I4W A;  2VDB B;  4M0D A;  2R65 A;  1JB0 F;  1NJF A;  3FUU A;  2QCU A;  2XFS A;  2RKO A;  4G4N A;  3T1H M;  3QYE A;  4BLC A;  3FD9 A;  1QUT A;  2X8A A;  4GMQ A;  2HCB A;  4LF4 M;  3IG5 A;  1D2N A;  1OQY A;  1TH3 A;  3FUV A;  1MX0 A;  5C18 A;  3TE6 A;  1QAO A;  2K9D A;  4B3S M;  2DNA A;  4LJ4 A;  3LQR A;  1VDD A;  4I8O A;  1IBM M;  2UU9 M;  2LBC A;  2MGW A;  2UUA M;  2FS1 A;  4M9S A;  2DAI A;  4EIW A;  2XLJ A;  3LVW A;  2J7O A;  3SFZ A;  5LMN M;  4PD2 A;  1J5E M;  4L4U A;  4WP2 A;  5KQ8 A;  1GJT A;  4DR3 M;  3GQ3 A;  3FRI A;  3QYB A;  4HEO A;  5JI3 E;  3GLI B;  3QWL A;  1IQP A;  2JY7 A;  3GLH B;  3HU3 A;  2A5Y B;  3GLG E;  3U6O A;  4FCW A;  2I7N A;  4RF1 A;  4JYA M;  4IBB A;  1IY1 A;  2V6Z M;  4S12 A;  2LVQ D;  3T15 A;  1HNW M;  1NJG A;  1TDZ A;  3SAT A;  2KRK A;  3J2P B;  1HT1 E;  1JR3 D;  1OFI A;  1X37 A;  1A5T A;  3FUW A;  4G6Z A;  5DYG A;  3TQS A;  5FSW A;  3GLI E;  1WHC A;  2DKL A;  4FCT A;  4IBI A;  4TUW A;  1HJP A;  2MH8 A;  2P5T A;  3T6P A;  4NRW A;  3L2A A;  1SXJ C;  1IY0 A;  3RE8 A;  2OOB A;  4LJ9 A;  4P16 A;  1G71 A;  2L7H A;  3MK6 A;  2F5Q A;  2BWE A;  4MH0 E;  1N77 A;  2F4V M;  1JQJ C;  2DVW B;  3TPZ A;  3A98 B;  1OIZ A;  1XB2 B;  2X49 A;  4AKG A;  4AW4 A;  3DOA A;  5FTM A;  3D8B A;  3KOZ E;  4MB7 A;  2CV0 A;  1XHB A;  3B7N A;  3LCU A;  4M9X A;  1XNQ M;  3B89 A;  1WGL A;  1DO2 A;  3AL0 C;  1PJI A;  1XWI A;  1PJS A;  1L1Z A;  1FJG M;  4D81 A;  1DGG A;  3T38 A;  3MJ5 A;  2Y21 A;  3OTO M;  1VQ1 A;  3NBX X;  1GJS A;  1G59 A;  2ERC A;  2LXE A;  3U61 A;  3I4V A;  1SXJ D;  3W68 A;  1VEK A;  5EP3 A;  2R18 A;  1QDT A;  3I04 M;  3FYC A;  1JR3 A;  5H37 D;  5EP1 A;  1IBK M;  2F5N A;  1NVM A;  2C9O A;  4Y28 F;  3SYL A;  4QNR A;  3JAM S;  3GLI A;  2EO2 A;  4NSR A;  4RNA A;  3RGP A;  3FE3 A;  3B7Q A;  4CGY B;  5LMU M;  5IRE B;  2R4J A;  1V34 A;  2JZ0 A;  4D80 A;  2DAG A;  3C9P A;  4DV1 M;  4G4R A;  4M0W A;  3GLH E;  3J27 B;  1PJQ A;  2R45 A;  4NC6 A;  3PNV A;  3GRY A;  1WJ7 A;  2CE7 A;  2C5R A;  1JR3 E;  2X4A A;  5BPV A;  2H5X A;  2JUJ A;  2LWX A;  3SYK A;  3HHY A;  1N34 M;  4AZF A;  1OAI A;  2LNH C;  2BWB A;  3GQ4 A;  1R4G A;  3KFU G;  1IN5 A;  4BBA A;  1AIP C;  1YUB A;  3KVW A;  1MN3 A;  1ZV1 A;  2DWZ B;  3F92 A;  4I5S A;  5FLX S;  1K82 A;  1YSY A;  2L2D A;  3A45 A;  1L2B A;  3IEC A;  4YHH M;  3ZQJ A;  4GKJ M;  2O25 A;  5E6J A;  3AOG A;  3LVV A;  3J7B A;  2D7G A;  2QNJ A;  2WSE F;  3KSX A;  3SAV A;  5ITR A;  4MGI E;  2EKK A;  1GL6 A;  1PRB A;  2Z3X A;  1LTM A;  3E46 A;  1Z6T A;  2BJW A;  4DR1 M;  1R2Z A;  2UUC M;  3KOW E;  3CF6 E;  1HNX M;  4DR6 M;  2MRO B;  1ZMU A;  3SAR A;  2MR9 A;  1AUA A;  2EJS A;  3BBZ A;  2DWM A;  1XMQ M;  4JXJ A;  1MJG M;  1Q3C A;  3K1J A;  2K6B A;  4I4L A; 
#chains in the Genus database with same CATH homology
 1NO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...