1NO1A

Structure of truncated variant of b.subtilis spp1 phage g39p helicase loader/inhibitor protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
MIEKDVVQILKAVSEFYPGRFQPDDLKGTVKAWHRVLAEYELEEIMNNLTDYAKVNKFPPTVSDLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords replisome organizer
publication title Structural analysis of Bacillus subtilis SPP1 phage helicase loader protein G39P
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Replication
total genus 16
structure length 67
sequence length 67
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.200 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Replisome organizer (g39p helicase loader/inhibitor protein) 1no1A00
1NO1A
chains in the Genus database with same CATH superfamily
2L09A 1XXHA 3HHZA 1TR8A 3I01M 4D81A 3VK7A 5FTKA 2KDLA 1WGLA 2G5GX 3QYEA 4IBDA 4R71A 1PM5A 2JNHA 2DHYA 1I4WA 5FTJA 2WSEF 4IBEA 3W68A 1R4GA 4TUWA 3SC3A 4L6V6 2R45A 2J7NA 4LRSA 3SARA 3U6EA 1N32M 4FCTA 2LWXA 2V1UA 1XWIA 2OQ4A 3TPZA 1HT1E 1DGFA 1Z6TA 2DWZB 4HL4A 3L28A 1L1ZA 4LF8M 1FNNA 1NVMA 4B3MM 4M0WA 1Z5CA 1HQYE 3GLIA 2HHHM 4B3SM 1G4AE 2H1RA 2XGNA 2G3QA 1NHWC 3FTDA 4AZFA 2LVQD 1R7RA 4BLCA 4JI6M 3U6QA 2JWSA 1D2NA 2DZLA 3FUXA 3NWLA 3Q8GA 4MGYE 1A5TA 3FUWA 3FYCA 4EIWA 3NBXX 1HT2E 3CF6E 5C1BA 3KSXA 3E21A 4FW9A 2EJSA 4B3TM 3AKZA 1IN7A 4AG6A 4LF6M 3J7AS 4NL4H 4X65M 2XFSA 3B7QA 2R18A 1YSYA 1TDHA 1E94E 1PGYA 2LHCA 5IZ7D 4B7GA 5JI3E 2F5QA 1Q39A 3J7BA 1IXSA 1MN3A 2HL7A 3MHVC 1ZMUA 2C9OA 2KRKA 1PJJA 1TGUA 2L7HA 4LZJA 4GC5A 4DR3M 4R3DA 3VDPA 2Q2EB 5FLXS 5EXPA 2RRUA 4DR4M 2EKFA 4PD2A 5FTLA 1IXZA 2LNHC 4W5WA 1JR3E 2JP7A 1EIJA 2QHOB 1QZMA 3J81S 1D0LA 3GPYA 4AQYM 4JYAM 4YHHM 4IBCA 1TTEA 4LJ8A 1IXRC 3QWLA 4OW0A 1WXQA 2QSFX 3JR4A 1GO5A 3GRUA 3SATA 4LF7M 3JR5A 1IFYA 2JUJA 1AUAA 2XSZA 3F92A 2XZUA 1QVRA 1JR3A 4GRIA 4JXJA 2F5SA 1IBKM 3A45A 4I4LA 3MJ5A 4L4UA 1GVNA 3FKEA 3SMSA 3KOYE 4JI4M 5ITYA 1SXJB 4DR1M 1OIZA 4RF1A 3SBJA 2WSCF 1OFHA 3FYDA 4LG2A 1N33M 4MGHA 2ZM6M 2F4VM 3E9SA 4M9SA 4X64M 4NOOB 3U6LA 2QNJA 2MROB 2HKJA 2N35A 1JQJC 2YQZA 3WHLA 5LMUM 5E26A 1EFUB 3FUVA 1G71A 3K8ZA 2CHVA 3RE8A 1E9SA 2XH9A 4DV1M 4LF4M 3U61B 1UFZA 2B3TA 3I51A 3M7GA 3AOGA 4NSRA 3D8LA 1G3IA 5E6JA 1KYIA 4WW0A 3TWLA 4X62M 1XMOM 2KZSA 1ZMWA 2MR9A 1GKIA 2WZJA 4FWDA 4LGMA 4JI3M 3UMMA 3U60B 3LQRA 5ITTA 1ZV1A 3EIEA 1XHBA 2RGHA 2VDBB 3HU1A 2R0IA 1DGHA 1L2CA 1N78A 1T3TA 1V34A 3T6PA 2LBCA 2J7OA 2QCUA 1ZAEA 2LHGA 5EXXA 3V76A 1XMQM 1NHGC 3SASA 4LF9M 4QOZC 4KODA 1QAMA 1K3XA 1DGGA 1OQYA 4II7A 3TWKA 3KP0E 3T1YM 3FUTA 2CFOA 4IJEA 4L16A 3SAVA 1LV7A 1YLAA 4JV5M 3HZJA 1R2YA 1NY6A 1FJGM 1YUBA 2OO9A 4IBIA 1GL7A 1QANA 3GLGB 4DV0M 5KPRA 2CV1A 4LFAM 4F2LA 1VDLA 2YNMD 4D82A 3GLFB 3L26A 1IQPA 2ZAMA 2BJWA 1XXHE 4B7FA 1XB2B 8CATA 2C96A 3VLFB 5JI2E 4DV3M 3KOWE 3UGJA 3W0LB 2I7NA 1F4IA 1UM8A 2XZFA 3D8BA 4OU7A 2EUCA 4FWHA 3LVVA 3ZH9B 2JA2A 4LFBM 1XC8A 1NSFA 2LH0A 4LJAA 3KW6A 2DAEA 1GL6A 5GKNA 5KQDA 2BJVA 5DFLA 5C18A 4WP2A 1KFVA 2QENA 2DAMA 1DGBA 2R44A 1VEGA 2J5YA 1N77A 3DA1A 2V1CA 3R8FA 2E5LM 4BB9A 4FD2A 4AKGA 3CTWB 4G4NA 1NV9A 1D0MA 3GLIE 1GABA 4NC6A 1L1TA 3PNYA 3SAUA 4DR5M 3T38A 3KS8A 1QAOA 4DV4M 4IBJA 1L2BA 4RF0A 4GEWA 4LF5M 2UUAM 2QP9X 4I81A 3GRYA 4M9XA 3KDSE 3CF0A 2R4JA 3HKPA 2MGWA 2C5RA 3GQ5A 2QBYB 2A5YB 2FNAA 3SYLA 2OOBA 3FE3A 4FVMA 3LQQA 3KSJA 4B7HA 1EE8A 1Z5AA 4G6ZA 2UXDM 2VF7A 3KXEC 2DWNA 4IBGA 3RFWA 4QNRA 3SHFA 2XLJA 4QHSA 4S12A 4OX9M 1MU5A 1V33A 3U5ZA 2EKKA 3JAMS 5F3WA 1QDRA 5IWAM 1E32A 2V6ZM 5EXTA 3UK6A 4G4RA 1SXJD 2R4EA 1WHCA 1IY1A 4MH0E 4XK8F 2DNAA 4MB7A 2BNKA 4YY3M 3HJ8A 1OAOC 2JZ1A 2G8LA 2ZAOA 3E46A 2R6FA 1V92A 2C99A 4HLQA 2CUZA 4B08A 4JI2M 3RGSA 1N34M 3LVWA 2GNOA 4LJ9A 3IECA 2R46A 3FD9A 4P17A 1MJGM 2OOAA 3KOZE 4I5SA 1OAIA 3ZQJA 2O01F 1E9RA 3TL4X 5FTNA 2O5RA 4Z6YA 3PVSA 3H4MA 1G8PA 2APLA 2K0BX 4XBOA 1AIPC 2CHGA 5ITXA 3TE6A 3ZCBB 1NNUC 4K0KM 2XF3A 3VDUA 3KS4A 4KT0F 3WHKA 2DI0A 4NXNM 4KO8A 5H37D 1DO2A 3KP1E 5L8RF 3HWSA 2CE7A 4IJFA 3SHGB 2H5XA 1NO1A 1RU3A 2W82A 3C3EA 3OTOM 1S3SA 2UU9M 3GRVA 2FS1A 1Q02A 2LTUA 3SAWA 4DV7M 2HWJA 3GPPA 4DR2M 2UUBM 4MGKE 5DYGA 2UXBM 1VEKA 1X37A 3LW5F 3J80S 4AKIA 2GQFA 4LZZA 1XXHB 3VKGA 3GQ4A 5EP2A 4CHTB 4ANRA 3PFIA 3BOSA 3FTCA 3T15A 2ZBKB 1MX0A 1QYRA 2P5TA 4LCBA 1Q3CA 1PJQA 4L78A 1IBMM 1NY5A 4R7GA 1DO0A 1ORYB 1HNWM 5IT9S 4F1IA 4JI0M 1QUTA 5KQ8A 1PJSA 1OJLA 1IN8A 3A42A 4QHTA 2JY7A 4MGIE 4DR7M 2Y0QA 1BVSA 4KHPM 2C98A 5EP1A 3GLIB 1J5EM 4M9ZA 1QZEA 2L2DA 3LCVB 4OVZA 2Z4RA 2ZTCA 3W67A 2VQFM 1JB0F 1TDZA 1SG9A 2KNZA 3LCUA 2KW0A 3GRRA 3HGIA 2D7GA 3HU3A 4PDGA 1OIPA 4L8RC 3C58A 4IIWA 3IG8A 4NRWA 2LVPC 2BWEA 2KHHA 3K92A 3Q8XA 4IBKA 2CWBA 1JR3D 2KNAA 3DZDA 2DZNB 2K6BA 1N36M 4FCWA 3BBZA 3I4YA 4AW4A 4GKKM 1GJSA 3H4JA 4DBGB 1TF0B 1IN5A 1IXSB 4AKHA 2Z8YM 2KNVA 3EIHA 2Z4SA 2KRUA 4UN2B 2EA0A 1HQCA 3HHYA 3U6SA 1L2DA 4M0DA 2DZOB 3B9PA 4DR6M 3CGWA 3HJSA 2K9DA 2FOIC 2DVWB 2L7IA 3VFDA 3B7NA 1SXJA 2RKOA 1TH4A 3L2AA 4NRVA 4JI1M 4NXMM 1XNQM 2C9CA 4JN6A 4MM3B 3HU2A 2ZANA 1NJFA 2JY8A 2YR0A 4LY6A 2NQ8C 1T43A 2XEPA 3FUUA 4LFCM 1IBLM 4AG5A 3L25A 4ITQA 3J2PB 1WIVA 3U61A 2X4AA 2D7HA 1D0KA 4GC9A 4CGYB 3VK8A 1T6OA 5IREB 2VIIA 3GPUA 1R2ZA 2F5PA 2JY5A 5ITUA 2O25A 3E4RA 2CV2A 1J09A 5BR8M 3UZUA 3U60A 2DWLA 2CV0A 4JI8M 3KFUG 4GH9A 3ILKA 3UJNA 4JI7M 3B74A 5ITQA 2WSFF 4KLNA 2EO2A 1R5LA 2R65A 3IHPA 3K2LA 3U6DA 3VKHA 2QPAA 3GLGE 2KXEA 4LGYA 2XFTA 2OPFA 3M6AA 2DENA 3GLFE 4GKJM 4IBFA 3KVWA 1C7YA 1GLNA 3I04M 4DV5M 1HNZM 2ERCA 1IN6A 3HX3A 3ZC7B 1PRBA 3IG5A 4L15A 3T1HM 1WGNA 3CF2A 4GMQA 4LJ4A 2L4FA 3QYBA 2F5OA 4X66M 4IBBA 3GLGA 1QUSA 5FSWA 5ITXE 3FTFA 3GLFA 3C3DA 1N75A 3HY5A 1DGHB 5DYIA 3GLHE 4PT5A 2UXCM 3FRIA 2DAKA 3SMPA 4GHLA 1QQWA 2Z7JA 3FTEA 3GP1A 3KOXE 3K9PA 4MGZE 2CEAA 2F5NA 2L6OA 1J7KA 1VQ1A 4QNMA 3GQ3A 1VDDA 2DWMA 3PNVA 1IN4A 2Y20A 3L29A 1OTRA 4DV6M 4RNAA 2KA6B 3A98B 4OVZB 1TH2A 2JZ0A 3GLHA 4CISA 2LXEA 2M5ZA 1HR0M 1IM2A 1K82A 5BPVA 2HAKA 2RGOA 1C1KA 4Q7JA 3B89A 7CATA 2D7EA 3DFZA 3QAUA 3B7ZA 4PDIA 2DXIA 3THGA 1Y8GA 3AV0A 2R62A 3HJQA 4HEOA 1OKSA 4WURA 2JY6B 2YFQA 5EQTA 2KZUA 2JXNA 1P3QQ 1WR1B 2FE8A 4REZA 4ZPXA 3U6PA 1CUKA 3AJIB 1K3WA 5EJCA 1NV8A 1Z5BA 3HHWA 3NBIA 2LVOC 1YE9A 2LVAA 1NNJA 1PJIA 5KPTA 1DV0A 4GHAA 2MJ5B 5EP4A 3I4VA 2DHRA 2CRUA 2QBYA 2AHMA 4JI5M 1IY2A 2Y0TA 5A2QS 3K9OA 2DAGA 4I8OA 5LMNM 1HNXM 3A46A 4NSOB 2CHQA 1Z59A 5EP3A 5KO3A 1W5SA 4LJ5A 4QOSA 2UUCM 1R6BX 2VF8A 3K1JA 1VG5A 4LJ6A 3SFZA 2QZ4A 3TQSA 5DNYA 2L4EA 3LMMA 1I94M 3HHXA 2X49A 1OFIA 3TWMA 3R9XB 4PCZA 1QDTA 5KPZA 1ZMVA 2FH0A 1KSFX 1G41A 2I7PA 1W5TA 2QQ8A 2ZTDA 3MMPA 4GIPA 4CIZA 1H6UA 3C9PA 3RGPA 2X8AA 4FCVA 1L8QA 1PJTA 2XSZD 2KEBA 3GPXA 3U5ZB 4Z8XA 4GITA 4RKUF 4BBAA 2VQEM 2K47A 2BWBA 3MK6A 1HJPA 2Z3XA 1SXJE 3DOAA 2Y21A 4DUYM 4FWGA 3J27B 4P16A 4LRTA 3AL0C 3L27A 2FFJA 4DUZM 4DV2M 2M60A 1SXJC 1TH3A 4LJ7A 4Y28F 3AOEC 3SYKA 1Q3BA 2HCBA 3W0FA 5ITRA 1ZQ9A 4B3RM 3BXWA 5EXSA 1VEJA 4A3VB 3PXGA 4CJ6A 2DAIA 3AOEA 1G59A 1GJTA 4G4OA 3GO8A 4G4QA 1NJGA 2LVNC 1QAQA 1WJ7A 3AFHA 4G3OA 4XGIA 1LTMA 3U6OA 3U6CA 5FTMA 1XNRM 4D80A 4AI6A 2DKLA 1IY0A 2CP8A 3U6MA 2MH8A 3M0EA 3FRHA 3GLHB
chains in the Genus database with same CATH topology
1NO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NO1 A; 
#chains in the Genus database with same CATH topology
 2L09 A;  1XXH A;  3HHZ A;  1TR8 A;  3I01 M;  4D81 A;  3VK7 A;  5FTK A;  2KDL A;  1WGL A;  2G5G X;  3QYE A;  4IBD A;  4R71 A;  1PM5 A;  2JNH A;  2DHY A;  1I4W A;  5FTJ A;  2WSE F;  4IBE A;  3W68 A;  1R4G A;  4TUW A;  3SC3 A;  4L6V 6;  2R45 A;  2J7N A;  4LRS A;  3SAR A;  3U6E A;  1N32 M;  4FCT A;  2LWX A;  2V1U A;  1XWI A;  2OQ4 A;  3TPZ A;  1HT1 E;  1DGF A;  1Z6T A;  2DWZ B;  4HL4 A;  3L28 A;  1L1Z A;  4LF8 M;  1FNN A;  1NVM A;  4B3M M;  4M0W A;  1Z5C A;  1HQY E;  3GLI A;  2HHH M;  4B3S M;  1G4A E;  2H1R A;  2XGN A;  2G3Q A;  1NHW C;  3FTD A;  4AZF A;  2LVQ D;  1R7R A;  4BLC A;  4JI6 M;  3U6Q A;  2JWS A;  1D2N A;  2DZL A;  3FUX A;  3NWL A;  3Q8G A;  4MGY E;  1A5T A;  3FUW A;  3FYC A;  4EIW A;  3NBX X;  1HT2 E;  3CF6 E;  5C1B A;  3KSX A;  3E21 A;  4FW9 A;  2EJS A;  4B3T M;  3AKZ A;  1IN7 A;  4AG6 A;  4LF6 M;  3J7A S;  4NL4 H;  4X65 M;  2XFS A;  3B7Q A;  2R18 A;  1YSY A;  1TDH A;  1E94 E;  1PGY A;  2LHC A;  5IZ7 D;  4B7G A;  5JI3 E;  2F5Q A;  1Q39 A;  3J7B A;  1IXS A;  1MN3 A;  2HL7 A;  3MHV C;  1ZMU A;  2C9O A;  2KRK A;  1PJJ A;  1TGU A;  2L7H A;  4LZJ A;  4GC5 A;  4DR3 M;  4R3D A;  3VDP A;  2Q2E B;  5FLX S;  5EXP A;  2RRU A;  4DR4 M;  2EKF A;  4PD2 A;  5FTL A;  1IXZ A;  2LNH C;  4W5W A;  1JR3 E;  2JP7 A;  1EIJ A;  2QHO B;  1QZM A;  3J81 S;  1D0L A;  3GPY A;  4AQY M;  4JYA M;  4YHH M;  4IBC A;  1TTE A;  4LJ8 A;  1IXR C;  3QWL A;  4OW0 A;  1WXQ A;  2QSF X;  3JR4 A;  1GO5 A;  3GRU A;  3SAT A;  4LF7 M;  3JR5 A;  1IFY A;  2JUJ A;  1AUA A;  2XSZ A;  3F92 A;  2XZU A;  1QVR A;  1JR3 A;  4GRI A;  4JXJ A;  2F5S A;  1IBK M;  3A45 A;  4I4L A;  3MJ5 A;  4L4U A;  1GVN A;  3FKE A;  3SMS A;  3KOY E;  4JI4 M;  5ITY A;  1SXJ B;  4DR1 M;  1OIZ A;  4RF1 A;  3SBJ A;  2WSC F;  1OFH A;  3FYD A;  4LG2 A;  1N33 M;  4MGH A;  2ZM6 M;  2F4V M;  3E9S A;  4M9S A;  4X64 M;  4NOO B;  3U6L A;  2QNJ A;  2MRO B;  2HKJ A;  2N35 A;  1JQJ C;  2YQZ A;  3WHL A;  5LMU M;  5E26 A;  1EFU B;  3FUV A;  1G71 A;  3K8Z A;  2CHV A;  3RE8 A;  1E9S A;  2XH9 A;  4DV1 M;  4LF4 M;  3U61 B;  1UFZ A;  2B3T A;  3I51 A;  3M7G A;  3AOG A;  4NSR A;  3D8L A;  1G3I A;  5E6J A;  1KYI A;  4WW0 A;  3TWL A;  4X62 M;  1XMO M;  2KZS A;  1ZMW A;  2MR9 A;  1GKI A;  2WZJ A;  4FWD A;  4LGM A;  4JI3 M;  3UMM A;  3U60 B;  3LQR A;  5ITT A;  1ZV1 A;  3EIE A;  1XHB A;  2RGH A;  2VDB B;  3HU1 A;  2R0I A;  1DGH A;  1L2C A;  1N78 A;  1T3T A;  1V34 A;  3T6P A;  2LBC A;  2J7O A;  2QCU A;  1ZAE A;  2LHG A;  5EXX A;  3V76 A;  1XMQ M;  1NHG C;  3SAS A;  4LF9 M;  4QOZ C;  4KOD A;  1QAM A;  1K3X A;  1DGG A;  1OQY A;  4II7 A;  3TWK A;  3KP0 E;  3T1Y M;  3FUT A;  2CFO A;  4IJE A;  4L16 A;  3SAV A;  1LV7 A;  1YLA A;  4JV5 M;  3HZJ A;  1R2Y A;  1NY6 A;  1FJG M;  1YUB A;  2OO9 A;  4IBI A;  1GL7 A;  1QAN A;  3GLG B;  4DV0 M;  5KPR A;  2CV1 A;  4LFA M;  4F2L A;  1VDL A;  2YNM D;  4D82 A;  3GLF B;  3L26 A;  1IQP A;  2ZAM A;  2BJW A;  1XXH E;  4B7F A;  1XB2 B;  8CAT A;  2C96 A;  3VLF B;  5JI2 E;  4DV3 M;  3KOW E;  3UGJ A;  3W0L B;  2I7N A;  1F4I A;  1UM8 A;  2XZF A;  3D8B A;  4OU7 A;  2EUC A;  4FWH A;  3LVV A;  3ZH9 B;  2JA2 A;  4LFB M;  1XC8 A;  1NSF A;  2LH0 A;  4LJA A;  3KW6 A;  2DAE A;  1GL6 A;  5GKN A;  5KQD A;  2BJV A;  5DFL A;  5C18 A;  4WP2 A;  1KFV A;  2QEN A;  2DAM A;  1DGB A;  2R44 A;  1VEG A;  2J5Y A;  1N77 A;  3DA1 A;  2V1C A;  3R8F A;  2E5L M;  4BB9 A;  4FD2 A;  4AKG A;  3CTW B;  4G4N A;  1NV9 A;  1D0M A;  3GLI E;  1GAB A;  4NC6 A;  1L1T A;  3PNY A;  3SAU A;  4DR5 M;  3T38 A;  3KS8 A;  1QAO A;  4DV4 M;  4IBJ A;  1L2B A;  4RF0 A;  4GEW A;  4LF5 M;  2UUA M;  2QP9 X;  4I81 A;  3GRY A;  4M9X A;  3KDS E;  3CF0 A;  2R4J A;  3HKP A;  2MGW A;  2C5R A;  3GQ5 A;  2QBY B;  2A5Y B;  2FNA A;  3SYL A;  2OOB A;  3FE3 A;  4FVM A;  3LQQ A;  3KSJ A;  4B7H A;  1EE8 A;  1Z5A A;  4G6Z A;  2UXD M;  2VF7 A;  3KXE C;  2DWN A;  4IBG A;  3RFW A;  4QNR A;  3SHF A;  2XLJ A;  4QHS A;  4S12 A;  4OX9 M;  1MU5 A;  1V33 A;  3U5Z A;  2EKK A;  3JAM S;  5F3W A;  1QDR A;  5IWA M;  1E32 A;  2V6Z M;  5EXT A;  3UK6 A;  4G4R A;  1SXJ D;  2R4E A;  1WHC A;  1IY1 A;  4MH0 E;  4XK8 F;  2DNA A;  4MB7 A;  2BNK A;  4YY3 M;  3HJ8 A;  1OAO C;  2JZ1 A;  2G8L A;  2ZAO A;  3E46 A;  2R6F A;  1V92 A;  2C99 A;  4HLQ A;  2CUZ A;  4B08 A;  4JI2 M;  3RGS A;  1N34 M;  3LVW A;  2GNO A;  4LJ9 A;  3IEC A;  2R46 A;  3FD9 A;  4P17 A;  1MJG M;  2OOA A;  3KOZ E;  4I5S A;  1OAI A;  3ZQJ A;  2O01 F;  1E9R A;  3TL4 X;  5FTN A;  2O5R A;  4Z6Y A;  3PVS A;  3H4M A;  1G8P A;  2APL A;  2K0B X;  4XBO A;  1AIP C;  2CHG A;  5ITX A;  3TE6 A;  3ZCB B;  1NNU C;  4K0K M;  2XF3 A;  3VDU A;  3KS4 A;  4KT0 F;  3WHK A;  2DI0 A;  4NXN M;  4KO8 A;  5H37 D;  1DO2 A;  3KP1 E;  5L8R F;  3HWS A;  2CE7 A;  4IJF A;  3SHG B;  2H5X A;  1NO1 A;  1RU3 A;  2W82 A;  3C3E A;  3OTO M;  1S3S A;  2UU9 M;  3GRV A;  2FS1 A;  1Q02 A;  2LTU A;  3SAW A;  4DV7 M;  2HWJ A;  3GPP A;  4DR2 M;  2UUB M;  4MGK E;  5DYG A;  2UXB M;  1VEK A;  1X37 A;  3LW5 F;  3J80 S;  4AKI A;  2GQF A;  4LZZ A;  1XXH B;  3VKG A;  3GQ4 A;  5EP2 A;  4CHT B;  4ANR A;  3PFI A;  3BOS A;  3FTC A;  3T15 A;  2ZBK B;  1MX0 A;  1QYR A;  2P5T A;  4LCB A;  1Q3C A;  1PJQ A;  4L78 A;  1IBM M;  1NY5 A;  4R7G A;  1DO0 A;  1ORY B;  1HNW M;  5IT9 S;  4F1I A;  4JI0 M;  1QUT A;  5KQ8 A;  1PJS A;  1OJL A;  1IN8 A;  3A42 A;  4QHT A;  2JY7 A;  4MGI E;  4DR7 M;  2Y0Q A;  1BVS A;  4KHP M;  2C98 A;  5EP1 A;  3GLI B;  1J5E M;  4M9Z A;  1QZE A;  2L2D A;  3LCV B;  4OVZ A;  2Z4R A;  2ZTC A;  3W67 A;  2VQF M;  1JB0 F;  1TDZ A;  1SG9 A;  2KNZ A;  3LCU A;  2KW0 A;  3GRR A;  3HGI A;  2D7G A;  3HU3 A;  4PDG A;  1OIP A;  4L8R C;  3C58 A;  4IIW A;  3IG8 A;  4NRW A;  2LVP C;  2BWE A;  2KHH A;  3K92 A;  3Q8X A;  4IBK A;  2CWB A;  1JR3 D;  2KNA A;  3DZD A;  2DZN B;  2K6B A;  1N36 M;  4FCW A;  3BBZ A;  3I4Y A;  4AW4 A;  4GKK M;  1GJS A;  3H4J A;  4DBG B;  1TF0 B;  1IN5 A;  1IXS B;  4AKH A;  2Z8Y M;  2KNV A;  3EIH A;  2Z4S A;  2KRU A;  4UN2 B;  2EA0 A;  1HQC A;  3HHY A;  3U6S A;  1L2D A;  4M0D A;  2DZO B;  3B9P A;  4DR6 M;  3CGW A;  3HJS A;  2K9D A;  2FOI C;  2DVW B;  2L7I A;  3VFD A;  3B7N A;  1SXJ A;  2RKO A;  1TH4 A;  3L2A A;  4NRV A;  4JI1 M;  4NXM M;  1XNQ M;  2C9C A;  4JN6 A;  4MM3 B;  3HU2 A;  2ZAN A;  1NJF A;  2JY8 A;  2YR0 A;  4LY6 A;  2NQ8 C;  1T43 A;  2XEP A;  3FUU A;  4LFC M;  1IBL M;  4AG5 A;  3L25 A;  4ITQ A;  3J2P B;  1WIV A;  3U61 A;  2X4A A;  2D7H A;  1D0K A;  4GC9 A;  4CGY B;  3VK8 A;  1T6O A;  5IRE B;  2VII A;  3GPU A;  1R2Z A;  2F5P A;  2JY5 A;  5ITU A;  2O25 A;  3E4R A;  2CV2 A;  1J09 A;  5BR8 M;  3UZU A;  3U60 A;  2DWL A;  2CV0 A;  4JI8 M;  3KFU G;  4GH9 A;  3ILK A;  3UJN A;  4JI7 M;  3B74 A;  5ITQ A;  2WSF F;  4KLN A;  2EO2 A;  1R5L A;  2R65 A;  3IHP A;  3K2L A;  3U6D A;  3VKH A;  2QPA A;  3GLG E;  2KXE A;  4LGY A;  2XFT A;  2OPF A;  3M6A A;  2DEN A;  3GLF E;  4GKJ M;  4IBF A;  3KVW A;  1C7Y A;  1GLN A;  3I04 M;  4DV5 M;  1HNZ M;  2ERC A;  1IN6 A;  3HX3 A;  3ZC7 B;  1PRB A;  3IG5 A;  4L15 A;  3T1H M;  1WGN A;  3CF2 A;  4GMQ A;  4LJ4 A;  2L4F A;  3QYB A;  2F5O A;  4X66 M;  4IBB A;  3GLG A;  1QUS A;  5FSW A;  5ITX E;  3FTF A;  3GLF A;  3C3D A;  1N75 A;  3HY5 A;  1DGH B;  5DYI A;  3GLH E;  4PT5 A;  2UXC M;  3FRI A;  2DAK A;  3SMP A;  4GHL A;  1QQW A;  2Z7J A;  3FTE A;  3GP1 A;  3KOX E;  3K9P A;  4MGZ E;  2CEA A;  2F5N A;  2L6O A;  1J7K A;  1VQ1 A;  4QNM A;  3GQ3 A;  1VDD A;  2DWM A;  3PNV A;  1IN4 A;  2Y20 A;  3L29 A;  1OTR A;  4DV6 M;  4RNA A;  2KA6 B;  3A98 B;  4OVZ B;  1TH2 A;  2JZ0 A;  3GLH A;  4CIS A;  2LXE A;  2M5Z A;  1HR0 M;  1IM2 A;  1K82 A;  5BPV A;  2HAK A;  2RGO A;  1C1K A;  4Q7J A;  3B89 A;  7CAT A;  2D7E A;  3DFZ A;  3QAU A;  3B7Z A;  4PDI A;  2DXI A;  3THG A;  1Y8G A;  3AV0 A;  2R62 A;  3HJQ A;  4HEO A;  1OKS A;  4WUR A;  2JY6 B;  2YFQ A;  5EQT A;  2KZU A;  2JXN A;  1P3Q Q;  1WR1 B;  2FE8 A;  4REZ A;  4ZPX A;  3U6P A;  1CUK A;  3AJI B;  1K3W A;  5EJC A;  1NV8 A;  1Z5B A;  3HHW A;  3NBI A;  2LVO C;  1YE9 A;  2LVA A;  1NNJ A;  1PJI A;  5KPT A;  1DV0 A;  4GHA A;  2MJ5 B;  5EP4 A;  3I4V A;  2DHR A;  2CRU A;  2QBY A;  2AHM A;  4JI5 M;  1IY2 A;  2Y0T A;  5A2Q S;  3K9O A;  2DAG A;  4I8O A;  5LMN M;  1HNX M;  3A46 A;  4NSO B;  2CHQ A;  1Z59 A;  5EP3 A;  5KO3 A;  1W5S A;  4LJ5 A;  4QOS A;  2UUC M;  1R6B X;  2VF8 A;  3K1J A;  1VG5 A;  4LJ6 A;  3SFZ A;  2QZ4 A;  3TQS A;  5DNY A;  2L4E A;  3LMM A;  1I94 M;  3HHX A;  2X49 A;  1OFI A;  3TWM A;  3R9X B;  4PCZ A;  1QDT A;  5KPZ A;  1ZMV A;  2FH0 A;  1KSF X;  1G41 A;  2I7P A;  1W5T A;  2QQ8 A;  2ZTD A;  3MMP A;  4GIP A;  4CIZ A;  1H6U A;  3C9P A;  3RGP A;  2X8A A;  4FCV A;  1L8Q A;  1PJT A;  2XSZ D;  2KEB A;  3GPX A;  3U5Z B;  4Z8X A;  4GIT A;  4RKU F;  4BBA A;  2VQE M;  2K47 A;  2BWB A;  3MK6 A;  1HJP A;  2Z3X A;  1SXJ E;  3DOA A;  2Y21 A;  4DUY M;  4FWG A;  3J27 B;  4P16 A;  4LRT A;  3AL0 C;  3L27 A;  2FFJ A;  4DUZ M;  4DV2 M;  2M60 A;  1SXJ C;  1TH3 A;  4LJ7 A;  4Y28 F;  3AOE C;  3SYK A;  1Q3B A;  2HCB A;  3W0F A;  5ITR A;  1ZQ9 A;  4B3R M;  3BXW A;  5EXS A;  1VEJ A;  4A3V B;  3PXG A;  4CJ6 A;  2DAI A;  3AOE A;  1G59 A;  1GJT A;  4G4O A;  3GO8 A;  4G4Q A;  1NJG A;  2LVN C;  1QAQ A;  1WJ7 A;  3AFH A;  4G3O A;  4XGI A;  1LTM A;  3U6O A;  3U6C A;  5FTM A;  1XNR M;  4D80 A;  4AI6 A;  2DKL A;  1IY0 A;  2CP8 A;  3U6M A;  2MH8 A;  3M0E A;  3FRH A;  3GLH B; 
#chains in the Genus database with same CATH homology
 1NO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...