1NO1A

Structure of truncated variant of b.subtilis spp1 phage g39p helicase loader/inhibitor protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
MIEKDVVQILKAVSEFYPGRFQPDDLKGTVKAWHRVLAEYELEEIMNNLTDYAKVNKFPPTVSDLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of Bacillus subtilis SPP1 phage helicase loader protein G39P
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Replication
molecule keywords replisome organizer
total genus 16
structure length 67
sequence length 67
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.200 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Replisome organizer (g39p helicase loader/inhibitor protein) 1no1A00
1NO1A
chains in the Genus database with same CATH superfamily
3BBZA 1IBLM 2FOIC 1XXHA 4NSOB 3BOSA 3A45A 2EKKA 4R71A 2JUJA 4MGKE 4AZFA 1QAQA 3UZUA 2LVQD 3U6EA 4FCVA 4DR2M 1Z5AA 2G8LA 5IWAM 4JI2M 4CISA 5EXTA 4KLNA 4IJFA 3A42A 4RKUF 5ITUA 1VEKA 1Z6TA 1NVMA 1WHCA 4S12A 1OAIA 2L4FA 4AKIA 2QSFX 2X49A 3ZC7B 4GITA 2E5LM 2LVOC 4HL4A 2JY8A 4MGZE 1YLAA 4BB9A 1L2BA 1PGYA 4L78A 3PNYA 4AQYM 2Q2EB 4LFAM 1K3XA 3L2AA 2LHCA 2DVWB 1LTMA 2FFJA 3H4MA 3FRHA 5DYIA 1IFYA 1AIPC 2K0BX 3SAVA 1K3WA 3QYEA 2VF7A 1IBMM 1IY0A 2CUZA 2QENA 1HT2E 1YE9A 2CHGA 2Z7JA 3U5ZB 1DO2A 2Y0QA 3J7AS 4B3SM 5F3WA 4B7FA 2XSZA 3U6OA 5EP1A 2L4EA 1G4AE 2KXEA 2LXEA 2ZANA 1G8PA 3HHWA 4FCTA 1G3IA 1R7RA 3FKEA 1IBKM 3VFDA 2HWJA 4GHLA 3T6PA 4YHHM 2Z8YM 1SXJA 3FUVA 2DKLA 1KYIA 4RNAA 5C1BA 2LVAA 7CATA 3GLIA 1OJLA 1UM8A 4QNRA 5EP4A 5LMUM 3GRVA 1TDHA 1G59A 1E94E 4X66M 1EIJA 4FWHA 2K6BA 1IM2A 2KRUA 4JI7M 2HAKA 4X62M 1QDRA 3T1HM 1AUAA 2KNVA 2LVPC 3I04M 2OPFA 4B3RM 1DV0A 4LRTA 2DAGA 2CRUA 1D0KA 4LY6A 3SAUA 2F5PA 3VKGA 3J27B 4ANRA 2ZTCA 2UUAM 5KPRA 1DGBA 3E21A 2H5XA 2D7HA 3IG5A 1TR8A 3U6SA 4DR3M 2EUCA 1NNUC 2D7EA 2MGWA 4NSRA 1F4IA 2KW0A 3B7QA 3GLIE 3LMMA 4FCWA 1GL7A 3FE3A 2DZOB 3ZCBB 2J7OA 1XNRM 3HJQA 3GPXA 4L8RC 1R5LA 5C18A 5EQTA 2C96A 1GJTA 3AOEC 2FH0A 3TE6A 2DAKA 4DR7M 3TL4X 3HU1A 1GKIA 3DFZA 3GPYA 4RF1A 3GLHE 2A5YB 4B08A 1MN3A 4DV4M 2V1UA 2YR0A 4BBAA 2C98A 2R44A 1HJPA 1N77A 3KSXA 1V33A 1VDDA 5EP2A 3GQ3A 3GLFA 5FTMA 3E4RA 5FTNA 2XZFA 3FD9A 2JY7A 1JR3D 1HT1E 1TF0B 3FTDA 1LV7A 2R65A 3LW5F 5IZ7D 4D81A 1MX0A 2WSCF 4CJ6A 2C99A 1CUKA 2WSEF 4F1IA 4EIWA 4IIWA 4B7GA 1WJ7A 3E46A 1XMQM 3HZJA 1GABA 2BJWA 3MMPA 4R3DA 3FTEA 3D8BA 4GMQA 2FNAA 1XWIA 4FWGA 1TDZA 1V34A 2DHRA 2R6FA 3HJSA 3KOWE 3MK6A 5GKNA 4IBFA 3R8FA 1QUSA 4IBGA 1HQYE 1ZMUA 2QP9X 1G41A 1HNZM 3L25A 1GJSA 5DFLA 3DZDA 3FUUA 2Z4SA 3U6CA 2B3TA 4JN6A 4MGHA 3GLGA 2F4VM 3W0FA 3PXGA 1UFZA 4IBEA 3FYDA 1A5TA 3DA1A 3PNVA 4B7HA 2CHVA 2DAEA 3HHYA 3FUTA 1IN7A 1TH3A 3KW6A 3SAWA 4I4LA 2KRKA 3B9PA 4KODA 2DAIA 4PCZA 5IREB 2F5SA 2O25A 4L16A 4TUWA 4IBKA 4DV0M 2BNKA 4GC9A 2XZUA 3CF0A 4AI6A 1VQ1A 1XB2B 3Q8GA 3GPUA 1XC8A 2MH8A 4LGYA 3U6PA 4G4OA 4PDIA 4QOZC 3GLHB 3AFHA 4QHTA 1GO5A 4X64M 1NSFA 3J7BA 4UN2B 2JA2A 5KO3A 2YFQA 2HHHM 3A98B 1FNNA 4HLQA 3MHVC 3KS4A 3T38A 1Y8GA 1DGHB 2L7HA 2QNJA 4F2LA 4CHTB 5H37D 2J7NA 1Q02A 1Q39A 4WP2A 2M5ZA 3GRYA 4LJ8A 3QAUA 4NRWA 3U6LA 4LRSA 4LFCM 1Z5BA 2M60A 3PVSA 1R4GA 4Y28F 4LGMA 2XSZD 3B74A 1OFHA 1SXJC 1XHBA 1L2CA 4LG2A 5FTKA 3FUXA 3I51A 4IBBA 4A3VB 2XFTA 1OKSA 2JY6B 2MJ5B 5EXSA 1PJQA 4NXNM 4D82A 5DNYA 1R2ZA 2O5RA 4AW4A 3FTFA 3K1JA 3THGA 2DAMA 5L8RF 3CF2A 2ZBKB 3T1YM 2L09A 2MROB 2XGNA 2CEAA 2HL7A 3JAMS 1N32M 4PD2A 2JXNA 3KS8A 2AHMA 3U5ZA 1C7YA 2XFSA 3EIHA 3RGSA 1DGHA 2QBYB 3GPPA 1IXZA 4G4RA 2UU9M 2DWZB 4D80A 2VDBB 4GHAA 3RGPA 3MJ5A 1V92A 3J80S 3SFZA 5KQDA 2GNOA 2QQ8A 4JI6M 2JZ1A 4IBCA 4RF0A 4L4UA 3E9SA 2CE7A 4DR4M 4XBOA 4LJ4A 1WR1B 3CTWB 4LZZA 5ITXE 4GH9A 1MJGM 1SXJB 3HGIA 2F5QA 2L7IA 2ZAMA 4MGIE 2EA0A 3PFIA 1OQYA 4G4NA 3KFUG 3TWMA 2R45A 3K9PA 4LJ6A 1E9RA 3K8ZA 1ORYB 4I81A 3QWLA 1MU5A 2DZNB 2N35A 3A46A 3WHKA 5ITXA 3U6QA 3KOYE 1J5EM 4KHPM 4I8OA 2CFOA 4B3TM 3V76A 2QPAA 1N78A 1S3SA 8CATA 4G4QA 2QBYA 4DV1M 2C9CA 1XXHE 3AOGA 4JYAM 2FE8A 3C3DA 3J2PB 2MR9A 4M0DA 4GKJM 1TH4A 1SXJE 4JI5M 5ITRA 1DO0A 2R18A 2JY5A 2CHQA 3K2LA 4M0WA 3RFWA 5E26A 1PJJA 4FW9A 3VDUA 1J09A 4LJ7A 3U60B 2G5GX 2Z4RA 2HCBA 5FSWA 2VF8A 1ZAEA 1IXSB 2CP8A 4KT0F 2RKOA 4DR6M 1X37A 2R4EA 3IHPA 4LJ9A 1ZMWA 3AOEA 2UUCM 3SYLA 4Q7JA 3SC3A 1Z59A 4YY3M 2O01F 5ITTA 4REZA 2DWLA 2P5TA 5KPZA 3K9OA 4DV2M 4JI1M 3AV0A 3CGWA 3K92A 1KFVA 2QCUA 3I4VA 2C9OA 2V6ZM 1QANA 4JI3M 4JV5M 2JZ0A 2WZJA 3HY5A 4GIPA 4WURA 1Q3BA 4OVZA 5KQ8A 4HEOA 1T3TA 2JWSA 1NV9A 2LHGA 3CF6E 2Y0TA 5JI2E 2ZTDA 5IT9S 3FRIA 2VQFM 3UMMA 2I7NA 4LF8M 2QHOB 3L28A 1N33M 3LVVA 3NBXX 2LH0A 4GRIA 1IXSA 1L8QA 2Y20A 4DR1M 3ZQJA 3SYKA 1PJIA 4II7A 1PJSA 1IN5A 4KO8A 1RU3A 4P16A 2I7PA 2LVNC 1DGFA 1P3QQ 3AL0C 2D7GA 4LF7M 2DHYA 3U6MA 1WGLA 3JR4A 3L29A 2Z3XA 1W5TA 1E32A 2XH9A 4MGYE 3TWKA 3GQ5A 1NY6A 2CV0A 2APLA 3DOAA 3F92A 3M7GA 3SHGB 3HHZA 1OIZA 2HKJA 4L15A 1NJGA 2VQEM 3UGJA 1WXQA 2L2DA 1Q3CA 4XK8F 3VLFB 3VKHA 1NO1A 3KP1E 4LFBM 4OVZB 4GEWA 4LCBA 1I94M 2YQZA 5BR8M 4DV6M 5A2QS 3ILKA 4M9SA 4NC6A 4PDGA 1QUTA 3GRRA 4L6V6 4MM3B 4JI8M 4LF9M 3I4YA 3SATA 4WW0A 2WSFF 1T43A 2RRUA 2CV2A 3GO8A 2VIIA 4AG6A 3B7NA 5EXXA 2LWXA 3WHLA 3BXWA 2Y21A 4NXMM 1N34M 1G71A 3GLIB 1OFIA 3GLHA 1ZQ9A 3SHFA 1N75A 4JXJA 1BVSA 1WIVA 4FWDA 1OIPA 2G3QA 2RGOA 2BWEA 4DUZM 4Z8XA 3TPZA 4ITQA 3LCUA 3M0EA 1QAOA 3UJNA 3IECA 4M9ZA 3JR5A 1IY1A 4JI0M 2BJVA 1J7KA 1R6BX 1GL6A 3VK8A 2UXDM 2OO9A 3KXEC 1D0LA 1DGGA 2YNMD 1R2YA 4MB7A 4OU7A 1OTRA 1QZEA 1HNWM 2K47A 4ZPXA 1JQJC 3W0LB 2GQFA 3SARA 4LF4M 3HX3A 3IG8A 2JNHA 3LVWA 3C3EA 1NHGC 1KSFX 3SMPA 2F5NA 1IQPA 2EKFA 5EXPA 2R46A 3L27A 3QYBA 4DUYM 2XLJA 2C5RA 4AKHA 3HJ8A 3KOZE 2KNZA 3B7ZA 3H4JA 3ZH9B 2R62A 3EIEA 4I5SA 5BPVA 2ZM6M 3TWLA 3FTCA 3GQ4A 4DV5M 2CWBA 3C58A 5EJCA 1Z5CA 4DR5M 3M6AA 4LJAA 1N36M 4NL4H 1FJGM 3FUWA 2BWBA 4B3MM 3R9XB 1NHWC 5ITYA 4OX9M 4IBIA 2LBCA 3LQRA 2H1RA 1NY5A 2L6OA 2XEPA 2OOAA 3NWLA 4AKGA 1IN8A 4K0KM 2ERCA 1HR0M 1VEGA 1PJTA 3U6DA 1IY2A 2EO2A 4AG5A 5EP3A 4LF5M 2JP7A 5DYGA 1EE8A 1VEJA 3GLFB 2DI0A 2OOBA 5FTJA 3W68A 3GLFE 2UXBM 1QAMA 4GKKM 4BLCA 5KPTA 1E9SA 3NBIA 4NRVA 1QZMA 2KEBA 4PT5A 2LNHC 3T15A 1L1TA 3AKZA 4QHSA 1L2DA 1GLNA 1H6UA 1JR3A 1NNJA 3HWSA 3Q8XA 2ZAOA 1QYRA 3GLGE 1YUBA 3RE8A 1W5SA 4LF6M 1HNXM 1I4WA 2DXIA 2DZLA 3KVWA 1L1ZA 1WGNA 4Z6YA 4IJEA 1VG5A 3FYCA 1JB0F 3KP0E 3L26A 2UUBM 1QDTA 3HHXA 3U61B 4G6ZA 2EJSA 3AJIB 3J81S 3KOXE 2KDLA 1PRBA 3HU2A 3LCVB 4DBGB 1PM5A 2QZ4A 2UXCM 1D0MA 5FLXS 4CIZA 1NJFA 3SASA 4X65M 2K9DA 4M9XA 1D2NA 1QQWA 1XNQM 2X4AA 4P17A 3GLGB 2OQ4A 4OW0A 3HU3A 4CGYB 3VK7A 2R4JA 3I01M 3HKPA 1ZV1A 4DV7M 2W82A 4LZJA 4QNMA 1HQCA 2CV1A 2XF3A 1XMOM 1GVNA 1XXHB 3GP1A 3UK6A 3C9PA 3LQQA 2RGHA 2FS1A 4G3OA 3U60A 2KZSA 2F5OA 1QVRA 3SMSA 2V1CA 4GC5A 4IBDA 1IN4A 2R0IA 1C1KA 1K82A 1YSYA 5LMNM 3TQSA 2KHHA 2KNAA 2X8AA 3SBJA 2DWMA 4MH0E 3D8LA 4W5WA 3U61A 4LJ5A 1TGUA 2KA6B 4IBJA 2DENA 1TH2A 3VDPA 1VDLA 1IN6A 3B89A 1SXJD 1ZMVA 4NOOB 4DV3M 4JI4M 3W67A 5FTLA 2DWNA 4XGIA 2LTUA 1NV8A 1JR3E 1OAOC 1TTEA 1T6OA 4FVMA 3KSJA 4R7GA 5E6JA 5JI3E 2NQ8C 3OTOM 5ITQA 2J5YA 4QOSA 3KDSE 1IXRC 2KZUA 1EFUB 3GRUA 2DNAA 4FD2A 1SG9A
chains in the Genus database with same CATH topology
1NO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NO1 A; 
#chains in the Genus database with same CATH topology
 3BBZ A;  1IBL M;  2FOI C;  1XXH A;  4NSO B;  3BOS A;  3A45 A;  2EKK A;  4R71 A;  2JUJ A;  4MGK E;  4AZF A;  1QAQ A;  3UZU A;  2LVQ D;  3U6E A;  4FCV A;  4DR2 M;  1Z5A A;  2G8L A;  5IWA M;  4JI2 M;  4CIS A;  5EXT A;  4KLN A;  4IJF A;  3A42 A;  4RKU F;  5ITU A;  1VEK A;  1Z6T A;  1NVM A;  1WHC A;  4S12 A;  1OAI A;  2L4F A;  4AKI A;  2QSF X;  2X49 A;  3ZC7 B;  4GIT A;  2E5L M;  2LVO C;  4HL4 A;  2JY8 A;  4MGZ E;  1YLA A;  4BB9 A;  1L2B A;  1PGY A;  4L78 A;  3PNY A;  4AQY M;  2Q2E B;  4LFA M;  1K3X A;  3L2A A;  2LHC A;  2DVW B;  1LTM A;  2FFJ A;  3H4M A;  3FRH A;  5DYI A;  1IFY A;  1AIP C;  2K0B X;  3SAV A;  1K3W A;  3QYE A;  2VF7 A;  1IBM M;  1IY0 A;  2CUZ A;  2QEN A;  1HT2 E;  1YE9 A;  2CHG A;  2Z7J A;  3U5Z B;  1DO2 A;  2Y0Q A;  3J7A S;  4B3S M;  5F3W A;  4B7F A;  2XSZ A;  3U6O A;  5EP1 A;  2L4E A;  1G4A E;  2KXE A;  2LXE A;  2ZAN A;  1G8P A;  3HHW A;  4FCT A;  1G3I A;  1R7R A;  3FKE A;  1IBK M;  3VFD A;  2HWJ A;  4GHL A;  3T6P A;  4YHH M;  2Z8Y M;  1SXJ A;  3FUV A;  2DKL A;  1KYI A;  4RNA A;  5C1B A;  2LVA A;  7CAT A;  3GLI A;  1OJL A;  1UM8 A;  4QNR A;  5EP4 A;  5LMU M;  3GRV A;  1TDH A;  1G59 A;  1E94 E;  4X66 M;  1EIJ A;  4FWH A;  2K6B A;  1IM2 A;  2KRU A;  4JI7 M;  2HAK A;  4X62 M;  1QDR A;  3T1H M;  1AUA A;  2KNV A;  2LVP C;  3I04 M;  2OPF A;  4B3R M;  1DV0 A;  4LRT A;  2DAG A;  2CRU A;  1D0K A;  4LY6 A;  3SAU A;  2F5P A;  3VKG A;  3J27 B;  4ANR A;  2ZTC A;  2UUA M;  5KPR A;  1DGB A;  3E21 A;  2H5X A;  2D7H A;  3IG5 A;  1TR8 A;  3U6S A;  4DR3 M;  2EUC A;  1NNU C;  2D7E A;  2MGW A;  4NSR A;  1F4I A;  2KW0 A;  3B7Q A;  3GLI E;  3LMM A;  4FCW A;  1GL7 A;  3FE3 A;  2DZO B;  3ZCB B;  2J7O A;  1XNR M;  3HJQ A;  3GPX A;  4L8R C;  1R5L A;  5C18 A;  5EQT A;  2C96 A;  1GJT A;  3AOE C;  2FH0 A;  3TE6 A;  2DAK A;  4DR7 M;  3TL4 X;  3HU1 A;  1GKI A;  3DFZ A;  3GPY A;  4RF1 A;  3GLH E;  2A5Y B;  4B08 A;  1MN3 A;  4DV4 M;  2V1U A;  2YR0 A;  4BBA A;  2C98 A;  2R44 A;  1HJP A;  1N77 A;  3KSX A;  1V33 A;  1VDD A;  5EP2 A;  3GQ3 A;  3GLF A;  5FTM A;  3E4R A;  5FTN A;  2XZF A;  3FD9 A;  2JY7 A;  1JR3 D;  1HT1 E;  1TF0 B;  3FTD A;  1LV7 A;  2R65 A;  3LW5 F;  5IZ7 D;  4D81 A;  1MX0 A;  2WSC F;  4CJ6 A;  2C99 A;  1CUK A;  2WSE F;  4F1I A;  4EIW A;  4IIW A;  4B7G A;  1WJ7 A;  3E46 A;  1XMQ M;  3HZJ A;  1GAB A;  2BJW A;  3MMP A;  4R3D A;  3FTE A;  3D8B A;  4GMQ A;  2FNA A;  1XWI A;  4FWG A;  1TDZ A;  1V34 A;  2DHR A;  2R6F A;  3HJS A;  3KOW E;  3MK6 A;  5GKN A;  4IBF A;  3R8F A;  1QUS A;  4IBG A;  1HQY E;  1ZMU A;  2QP9 X;  1G41 A;  1HNZ M;  3L25 A;  1GJS A;  5DFL A;  3DZD A;  3FUU A;  2Z4S A;  3U6C A;  2B3T A;  4JN6 A;  4MGH A;  3GLG A;  2F4V M;  3W0F A;  3PXG A;  1UFZ A;  4IBE A;  3FYD A;  1A5T A;  3DA1 A;  3PNV A;  4B7H A;  2CHV A;  2DAE A;  3HHY A;  3FUT A;  1IN7 A;  1TH3 A;  3KW6 A;  3SAW A;  4I4L A;  2KRK A;  3B9P A;  4KOD A;  2DAI A;  4PCZ A;  5IRE B;  2F5S A;  2O25 A;  4L16 A;  4TUW A;  4IBK A;  4DV0 M;  2BNK A;  4GC9 A;  2XZU A;  3CF0 A;  4AI6 A;  1VQ1 A;  1XB2 B;  3Q8G A;  3GPU A;  1XC8 A;  2MH8 A;  4LGY A;  3U6P A;  4G4O A;  4PDI A;  4QOZ C;  3GLH B;  3AFH A;  4QHT A;  1GO5 A;  4X64 M;  1NSF A;  3J7B A;  4UN2 B;  2JA2 A;  5KO3 A;  2YFQ A;  2HHH M;  3A98 B;  1FNN A;  4HLQ A;  3MHV C;  3KS4 A;  3T38 A;  1Y8G A;  1DGH B;  2L7H A;  2QNJ A;  4F2L A;  4CHT B;  5H37 D;  2J7N A;  1Q02 A;  1Q39 A;  4WP2 A;  2M5Z A;  3GRY A;  4LJ8 A;  3QAU A;  4NRW A;  3U6L A;  4LRS A;  4LFC M;  1Z5B A;  2M60 A;  3PVS A;  1R4G A;  4Y28 F;  4LGM A;  2XSZ D;  3B74 A;  1OFH A;  1SXJ C;  1XHB A;  1L2C A;  4LG2 A;  5FTK A;  3FUX A;  3I51 A;  4IBB A;  4A3V B;  2XFT A;  1OKS A;  2JY6 B;  2MJ5 B;  5EXS A;  1PJQ A;  4NXN M;  4D82 A;  5DNY A;  1R2Z A;  2O5R A;  4AW4 A;  3FTF A;  3K1J A;  3THG A;  2DAM A;  5L8R F;  3CF2 A;  2ZBK B;  3T1Y M;  2L09 A;  2MRO B;  2XGN A;  2CEA A;  2HL7 A;  3JAM S;  1N32 M;  4PD2 A;  2JXN A;  3KS8 A;  2AHM A;  3U5Z A;  1C7Y A;  2XFS A;  3EIH A;  3RGS A;  1DGH A;  2QBY B;  3GPP A;  1IXZ A;  4G4R A;  2UU9 M;  2DWZ B;  4D80 A;  2VDB B;  4GHA A;  3RGP A;  3MJ5 A;  1V92 A;  3J80 S;  3SFZ A;  5KQD A;  2GNO A;  2QQ8 A;  4JI6 M;  2JZ1 A;  4IBC A;  4RF0 A;  4L4U A;  3E9S A;  2CE7 A;  4DR4 M;  4XBO A;  4LJ4 A;  1WR1 B;  3CTW B;  4LZZ A;  5ITX E;  4GH9 A;  1MJG M;  1SXJ B;  3HGI A;  2F5Q A;  2L7I A;  2ZAM A;  4MGI E;  2EA0 A;  3PFI A;  1OQY A;  4G4N A;  3KFU G;  3TWM A;  2R45 A;  3K9P A;  4LJ6 A;  1E9R A;  3K8Z A;  1ORY B;  4I81 A;  3QWL A;  1MU5 A;  2DZN B;  2N35 A;  3A46 A;  3WHK A;  5ITX A;  3U6Q A;  3KOY E;  1J5E M;  4KHP M;  4I8O A;  2CFO A;  4B3T M;  3V76 A;  2QPA A;  1N78 A;  1S3S A;  8CAT A;  4G4Q A;  2QBY A;  4DV1 M;  2C9C A;  1XXH E;  3AOG A;  4JYA M;  2FE8 A;  3C3D A;  3J2P B;  2MR9 A;  4M0D A;  4GKJ M;  1TH4 A;  1SXJ E;  4JI5 M;  5ITR A;  1DO0 A;  2R18 A;  2JY5 A;  2CHQ A;  3K2L A;  4M0W A;  3RFW A;  5E26 A;  1PJJ A;  4FW9 A;  3VDU A;  1J09 A;  4LJ7 A;  3U60 B;  2G5G X;  2Z4R A;  2HCB A;  5FSW A;  2VF8 A;  1ZAE A;  1IXS B;  2CP8 A;  4KT0 F;  2RKO A;  4DR6 M;  1X37 A;  2R4E A;  3IHP A;  4LJ9 A;  1ZMW A;  3AOE A;  2UUC M;  3SYL A;  4Q7J A;  3SC3 A;  1Z59 A;  4YY3 M;  2O01 F;  5ITT A;  4REZ A;  2DWL A;  2P5T A;  5KPZ A;  3K9O A;  4DV2 M;  4JI1 M;  3AV0 A;  3CGW A;  3K92 A;  1KFV A;  2QCU A;  3I4V A;  2C9O A;  2V6Z M;  1QAN A;  4JI3 M;  4JV5 M;  2JZ0 A;  2WZJ A;  3HY5 A;  4GIP A;  4WUR A;  1Q3B A;  4OVZ A;  5KQ8 A;  4HEO A;  1T3T A;  2JWS A;  1NV9 A;  2LHG A;  3CF6 E;  2Y0T A;  5JI2 E;  2ZTD A;  5IT9 S;  3FRI A;  2VQF M;  3UMM A;  2I7N A;  4LF8 M;  2QHO B;  3L28 A;  1N33 M;  3LVV A;  3NBX X;  2LH0 A;  4GRI A;  1IXS A;  1L8Q A;  2Y20 A;  4DR1 M;  3ZQJ A;  3SYK A;  1PJI A;  4II7 A;  1PJS A;  1IN5 A;  4KO8 A;  1RU3 A;  4P16 A;  2I7P A;  2LVN C;  1DGF A;  1P3Q Q;  3AL0 C;  2D7G A;  4LF7 M;  2DHY A;  3U6M A;  1WGL A;  3JR4 A;  3L29 A;  2Z3X A;  1W5T A;  1E32 A;  2XH9 A;  4MGY E;  3TWK A;  3GQ5 A;  1NY6 A;  2CV0 A;  2APL A;  3DOA A;  3F92 A;  3M7G A;  3SHG B;  3HHZ A;  1OIZ A;  2HKJ A;  4L15 A;  1NJG A;  2VQE M;  3UGJ A;  1WXQ A;  2L2D A;  1Q3C A;  4XK8 F;  3VLF B;  3VKH A;  1NO1 A;  3KP1 E;  4LFB M;  4OVZ B;  4GEW A;  4LCB A;  1I94 M;  2YQZ A;  5BR8 M;  4DV6 M;  5A2Q S;  3ILK A;  4M9S A;  4NC6 A;  4PDG A;  1QUT A;  3GRR A;  4L6V 6;  4MM3 B;  4JI8 M;  4LF9 M;  3I4Y A;  3SAT A;  4WW0 A;  2WSF F;  1T43 A;  2RRU A;  2CV2 A;  3GO8 A;  2VII A;  4AG6 A;  3B7N A;  5EXX A;  2LWX A;  3WHL A;  3BXW A;  2Y21 A;  4NXM M;  1N34 M;  1G71 A;  3GLI B;  1OFI A;  3GLH A;  1ZQ9 A;  3SHF A;  1N75 A;  4JXJ A;  1BVS A;  1WIV A;  4FWD A;  1OIP A;  2G3Q A;  2RGO A;  2BWE A;  4DUZ M;  4Z8X A;  3TPZ A;  4ITQ A;  3LCU A;  3M0E A;  1QAO A;  3UJN A;  3IEC A;  4M9Z A;  3JR5 A;  1IY1 A;  4JI0 M;  2BJV A;  1J7K A;  1R6B X;  1GL6 A;  3VK8 A;  2UXD M;  2OO9 A;  3KXE C;  1D0L A;  1DGG A;  2YNM D;  1R2Y A;  4MB7 A;  4OU7 A;  1OTR A;  1QZE A;  1HNW M;  2K47 A;  4ZPX A;  1JQJ C;  3W0L B;  2GQF A;  3SAR A;  4LF4 M;  3HX3 A;  3IG8 A;  2JNH A;  3LVW A;  3C3E A;  1NHG C;  1KSF X;  3SMP A;  2F5N A;  1IQP A;  2EKF A;  5EXP A;  2R46 A;  3L27 A;  3QYB A;  4DUY M;  2XLJ A;  2C5R A;  4AKH A;  3HJ8 A;  3KOZ E;  2KNZ A;  3B7Z A;  3H4J A;  3ZH9 B;  2R62 A;  3EIE A;  4I5S A;  5BPV A;  2ZM6 M;  3TWL A;  3FTC A;  3GQ4 A;  4DV5 M;  2CWB A;  3C58 A;  5EJC A;  1Z5C A;  4DR5 M;  3M6A A;  4LJA A;  1N36 M;  4NL4 H;  1FJG M;  3FUW A;  2BWB A;  4B3M M;  3R9X B;  1NHW C;  5ITY A;  4OX9 M;  4IBI A;  2LBC A;  3LQR A;  2H1R A;  1NY5 A;  2L6O A;  2XEP A;  2OOA A;  3NWL A;  4AKG A;  1IN8 A;  4K0K M;  2ERC A;  1HR0 M;  1VEG A;  1PJT A;  3U6D A;  1IY2 A;  2EO2 A;  4AG5 A;  5EP3 A;  4LF5 M;  2JP7 A;  5DYG A;  1EE8 A;  1VEJ A;  3GLF B;  2DI0 A;  2OOB A;  5FTJ A;  3W68 A;  3GLF E;  2UXB M;  1QAM A;  4GKK M;  4BLC A;  5KPT A;  1E9S A;  3NBI A;  4NRV A;  1QZM A;  2KEB A;  4PT5 A;  2LNH C;  3T15 A;  1L1T A;  3AKZ A;  4QHS A;  1L2D A;  1GLN A;  1H6U A;  1JR3 A;  1NNJ A;  3HWS A;  3Q8X A;  2ZAO A;  1QYR A;  3GLG E;  1YUB A;  3RE8 A;  1W5S A;  4LF6 M;  1HNX M;  1I4W A;  2DXI A;  2DZL A;  3KVW A;  1L1Z A;  1WGN A;  4Z6Y A;  4IJE A;  1VG5 A;  3FYC A;  1JB0 F;  3KP0 E;  3L26 A;  2UUB M;  1QDT A;  3HHX A;  3U61 B;  4G6Z A;  2EJS A;  3AJI B;  3J81 S;  3KOX E;  2KDL A;  1PRB A;  3HU2 A;  3LCV B;  4DBG B;  1PM5 A;  2QZ4 A;  2UXC M;  1D0M A;  5FLX S;  4CIZ A;  1NJF A;  3SAS A;  4X65 M;  2K9D A;  4M9X A;  1D2N A;  1QQW A;  1XNQ M;  2X4A A;  4P17 A;  3GLG B;  2OQ4 A;  4OW0 A;  3HU3 A;  4CGY B;  3VK7 A;  2R4J A;  3I01 M;  3HKP A;  1ZV1 A;  4DV7 M;  2W82 A;  4LZJ A;  4QNM A;  1HQC A;  2CV1 A;  2XF3 A;  1XMO M;  1GVN A;  1XXH B;  3GP1 A;  3UK6 A;  3C9P A;  3LQQ A;  2RGH A;  2FS1 A;  4G3O A;  3U60 A;  2KZS A;  2F5O A;  1QVR A;  3SMS A;  2V1C A;  4GC5 A;  4IBD A;  1IN4 A;  2R0I A;  1C1K A;  1K82 A;  1YSY A;  5LMN M;  3TQS A;  2KHH A;  2KNA A;  2X8A A;  3SBJ A;  2DWM A;  4MH0 E;  3D8L A;  4W5W A;  3U61 A;  4LJ5 A;  1TGU A;  2KA6 B;  4IBJ A;  2DEN A;  1TH2 A;  3VDP A;  1VDL A;  1IN6 A;  3B89 A;  1SXJ D;  1ZMV A;  4NOO B;  4DV3 M;  4JI4 M;  3W67 A;  5FTL A;  2DWN A;  4XGI A;  2LTU A;  1NV8 A;  1JR3 E;  1OAO C;  1TTE A;  1T6O A;  4FVM A;  3KSJ A;  4R7G A;  5E6J A;  5JI3 E;  2NQ8 C;  3OTO M;  5ITQ A;  2J5Y A;  4QOS A;  3KDS E;  1IXR C;  2KZU A;  1EFU B;  3GRU A;  2DNA A;  4FD2 A;  1SG9 A; 
#chains in the Genus database with same CATH homology
 1NO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...