1NO1A

Structure of truncated variant of b.subtilis spp1 phage g39p helicase loader/inhibitor protein
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
67
structure length
67
Chain Sequence
b'MIEKDVVQILKAVSEFYPGRFQPDDLKGTVKAWHRVLAEYELEEIMNNLTDYAKVNKFPPTVSDLLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords replisome organizer
publication title Structural analysis of Bacillus subtilis SPP1 phage helicase loader protein G39P
pubmed doi rcsb
source organism Bacillus phage spp1
molecule tags Replication
total genus 16
structure length 67
sequence length 67
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.200 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Replisome organizer (g39p helicase loader/inhibitor protein) 1no1A00
1NO1A
chains in the Genus database with same CATH superfamily
3UGJA 3CF6E 3I04M 2YQZA 4L6V6 1VEGA 1GLNA 1OFHA 2QCUA 2ZBKB 3B9PA 3H4MA 3HHWA 5L8RF 1R2YA 4AG6A 5FTNA 4B3MM 4B3TM 2H5XA 1ZMUA 3FD9A 1D0KA 1Q3CA 3FKEA 3SC3A 2KRKA 1PGYA 4I4LA 3VDUA 1R6BX 4QNRA 2I7PA 3GLIA 3AL0C 2EO2A 2R4JA 2MJ5B 4DV0M 3KOWE 2F4VM 3GRUA 1Q39A 2JY6B 1MX0A 4AZFA 2R18A 3K2LA 1R5LA 4JI1M 4W5WA 4ZPXA 4WURA 2F5OA 1HJPA 2I7NA 3SATA 4JYAM 3DA1A 5EXSA 2KNVA 2OPFA 4LRTA 2KA6B 5EP2A 2KDLA 1AIPC 2KW0A 4GHAA 2ERCA 1GABA 1EIJA 3VLFB 1NV8A 3R8FA 1XNQM 7CATA 3SASA 4LF8M 2D7EA 4MH0E 2LBCA 1NV9A 3U61A 3PNVA 5EXXA 3GRVA 4A3VB 2R6FA 2DWLA 1EFUB 2FS1A 2BJVA 1IXSB 2BJWA 2CHGA 4HL4A 1WGNA 4M9XA 1TDHA 1T43A 4S12A 2Z3XA 4LY6A 2V1CA 2NQ8C 1T6OA 1UFZA 1OQYA 2CUZA 3GPPA 4B08A 2UXBM 4NRVA 2K6BA 1Q02A 2H1RA 3B7ZA 2ZANA 1VEKA 4UN2B 4LF4M 1PJJA 2WSEF 3J2PB 2XSZA 2ZTCA 3SHGB 4L8RC 2GNOA 4B3RM 1N75A 1IBMM 5KQ8A 3U6OA 1ZV1A 2X49A 3M0EA 5H37D 5LMUM 3GRYA 1IN5A 4LF5M 3CF2A 4GKKM 3JR5A 2Y0QA 4DV3M 3J7BA 1Z5CA 2KZSA 2C9CA 1JR3E 3C3DA 1KYIA 2Z4SA 2JY5A 4NC6A 1IN6A 5FTMA 2D7GA 1E9RA 2WSFF 3HU1A 3FUVA 1MN3A 3IG8A 2XFTA 4QHSA 4XGIA 4K0KM 2Y21A 3GPYA 4G4RA 2C5RA 5ITXA 4DV5M 2DWNA 2Z4RA 4LFAM 3MK6A 1HNWM 2DHYA 1G59A 2LHCA 2M60A 1SG9A 3LW5F 5KO3A 1GVNA 5KPZA 4PDIA 1FNNA 2FE8A 1PJIA 1WR1B 2D7HA 2N35A 3HJQA 3B89A 3J27B 3E46A 2J5YA 2VF7A 2G5GX 3KOXE 1BVSA 5EQTA 3ZQJA 4JI5M 4DR3M 3MMPA 2RRUA 4X65M 2E5LM 2HAKA 1L1TA 2EA0A 3KS4A 3L27A 4LGMA 3LMMA 1LV7A 4DUYM 2R46A 1YUBA 1IY1A 2KRUA 3WHKA 2KXEA 1TDZA 3HU2A 3QWLA 3LQRA 3KP1E 4PCZA 1IBKM 1TH4A 3KP0E 4FW9A 1IN8A 3E4RA 4M0DA 1I4WA 2FOIC 2KNAA 4RNAA 1OIZA 4IBDA 3VFDA 4Z6YA 2Z7JA 3W67A 3GLGA 4FVMA 3FTCA 3VK7A 3VK8A 4FCVA 4LJ7A 1J5EM 2DWZB 3UK6A 4D80A 4IBCA 4DV6M 3U6EA 3R9XB 3KOYE 4IJEA 3DOAA 4MB7A 5FLXS 1QYRA 3GO8A 2DI0A 4OU7A 2C98A 4AKGA 4JI7M 4DV7M 3HWSA 4GC5A 4QNMA 2CHVA 2JP7A 4XK8F 3GPUA 4LF7M 4CHTB 3TWKA 2UXDM 1N78A 2R0IA 3Q8XA 1G8PA 3U5ZA 4AW4A 1V34A 1R7RA 2QHOB 2DAMA 1WXQA 2HCBA 3FUWA 4AKIA 4FCWA 1SXJD 5ITUA 5IWAM 3C58A 1Z59A 3T38A 1JR3D 2WSCF 5FTLA 4L15A 3E21A 4IJFA 4CIZA 1ZAEA 1VDLA 5A2QS 2OOBA 3SHFA 1IM2A 4JV5M 2VIIA 4YY3M 1OTRA 3RGSA 4TUWA 3U61B 2UUAM 5JI2E 1T3TA 3B7QA 4KT0F 2LVNC 4DR2M 3L28A 4DR1M 1OAIA 1HT1E 2CWBA 4LJ5A 5KPTA 2BNKA 2L4FA 2CE7A 2R65A 8CATA 3GQ3A 1MU5A 1PJQA 3TE6A 4IBBA 2DXIA 1R2ZA 1VDDA 4D82A 1HR0M 2HL7A 1XXHA 3KSXA 4F2LA 3HHYA 3HHXA 3GQ5A 3HHZA 2VF8A 1A5TA 3A42A 1PM5A 4ANRA 3GLHA 4IBGA 4JI0M 2QBYA 2ZAOA 1QUSA 1JQJC 3IECA 4DUZM 3U6MA 4OVZA 2LWXA 5ITXE 1D0LA 2JY7A 2QZ4A 4JI8M 3KSJA 4KHPM 4FWHA 3BBZA 5IT9S 3V76A 1TF0B 4QHTA 2YFQA 1DGHA 2KZUA 3IHPA 3EIEA 3MJ5A 2DAIA 1IFYA 1GJSA 1AUAA 1EE8A 4GHLA 2DHRA 2CEAA 3ZH9B 1P3QQ 2LVPC 2XF3A 1ZMWA 4KO8A 4LZJA 5KPRA 4XBOA 3TWLA 2CP8A 4HLQA 3W0LB 4R71A 3PVSA 2UU9M 4LFBM 2C9OA 3SARA 2MROB 2LNHC 2LVQD 4Q7JA 3T1YM 2JXNA 2O5RA 3LVVA 3CGWA 1QUTA 5IREB 4B3SM 3FRIA 2W82A 3L29A 4GKJM 4GIPA 1Y8GA 3KS8A 2VQFM 2A5YB 1K3XA 1OKSA 3U6LA 1QDTA 2X4AA 2CV1A 4CGYB 2WZJA 3AKZA 1D2NA 1VG5A 3FRHA 3D8LA 4RF0A 3RE8A 1XNRM 1G71A 1NNUC 4NOOB 1TGUA 4DV2M 2MR9A 2R44A 1QVRA 3CF0A 4X64M 4HEOA 4MGZE 2LVAA 3J7AS 2R62A 2XH9A 1NNJA 2AHMA 4LJ8A 5DFLA 4QOZC 2YNMD 1OJLA 1K82A 1L8QA 1WHCA 4II7A 4X62M 2XLJA 4RKUF 4G4OA 3TWMA 1Z6TA 4DR7M 2M5ZA 4RF1A 3L26A 4ITQA 2VDBB 1WIVA 2G8LA 1QZMA 2ZAMA 3BXWA 5EXPA 2DWMA 4JI4M 4AI6A 2F5PA 4BB9A 2L7IA 4LJ6A 2V1UA 4I8OA 1IN7A 4WP2A 2CHQA 1IXZA 3VDPA 1QAOA 1JB0F 3U6PA 1UM8A 3AOGA 2R45A 1DO2A 1GL6A 5JI3E 1IXRC 2JY8A 5BPVA 1J09A 3A46A 1SXJC 4DV1M 4QOSA 3U5ZB 3ZC7B 2EKKA 4IBKA 1NHWC 5BR8M 2XGNA 5FTJA 3AOEC 3FYCA 3THGA 5ITRA 2BWBA 4GH9A 3RFWA 4MGHA 3K9OA 5DYGA 1TR8A 4GITA 3GLIE 3F92A 2VQEM 3HZJA 3J81S 4FD2A 4G6ZA 3FUXA 1KSFX 3D8BA 3NBIA 3TL4X 1Q3BA 5DYIA 2DZOB 3C3EA 1XXHE 4LF9M 1E9SA 3AV0A 4FWGA 3GLIB 2QENA 2MGWA 4LF6M 5IZ7D 1OFIA 1IY0A 4DV4M 1SXJA 1QQWA 1J7KA 3GLHE 1L2DA 3HJSA 2UUBM 3HJ8A 1K3WA 3HX3A 3LCUA 2DAKA 3FYDA 4FWDA 1XXHB 3LCVB 3SFZA 2Q2EB 3AOEA 3IG5A 1QANA 1QAQA 2FFJA 2FNAA 1HNZM 3B74A 3GLHB 2X8AA 4LJ4A 1L2BA 1G41A 4OVZB 3I4VA 3GLFA 3SAVA 2DENA 2DAEA 5FSWA 2RGOA 4WW0A 5EP4A 1N77A 4GEWA 1XC8A 3QAUA 3VKHA 3A45A 3I51A 5F3WA 3MHVC 4JN6A 2JUJA 3U6DA 2QNJA 3E9SA 4LGYA 2FH0A 1PJTA 3AFHA 2UXCM 2QQ8A 2EKFA 4G3OA 1YLAA 4KLNA 2P5TA 3I4YA 2DNAA 1N34M 1DO0A 2Y0TA 2GQFA 3QYEA 5E26A 2XEPA 5FTKA 1YE9A 1WGLA 5KQDA 3KXEC 4L4UA 3SBJA 3K9PA 2DZLA 1OAOC 4OW0A 1N32M 2L09A 2OOAA 3K8ZA 4OX9M 3GRRA 3TQSA 2CRUA 4DR4M 4NXNM 3PXGA 3Q8GA 3UJNA 4FCTA 4G4QA 2CV2A 3K1JA 3HKPA 3GP1A 2RKOA 1XB2B 1PRBA 5EP1A 1NY6A 1FJGM 3DZDA 3L25A 1E94E 3U60A 1N33M 3J80S 2ZM6M 1PJSA 1Z5BA 2QSFX 2L2DA 2O01F 3GPXA 4EIWA 3KW6A 3KDSE 1NJFA 4REZA 1VEJA 3JR4A 2LTUA 3JAMS 4CJ6A 1G3IA 1TTEA 2C99A 3BOSA 3SAUA 2F5SA 1R4GA 2EJSA 2R4EA 3M6AA 2OQ4A 1NY5A 1CUKA 4IBJA 3H4JA 4DBGB 2XFSA 3K92A 2B3TA 2C96A 4MGIE 2YR0A 2LH0A 1QZEA 2DVWB 3UZUA 1XMOM 3WHLA 4BBAA 2O25A 4CISA 2HWJA 3HGIA 1E32A 4LJ9A 4L78A 4B7FA 3GLGE 1L1ZA 4PT5A 3FTEA 3FUUA 3M7GA 2J7OA 1XMQM 2HHHM 4LG2A 4I5SA 1MJGM 3SMPA 4NXMM 2CV0A 1QDRA 2QP9X 1ZQ9A 2BWEA 2LXEA 3NWLA 4LRSA 1F4IA 3U6QA 1ZMVA 4LZZA 1H6UA 2ZTDA 2F5QA 3W0FA 4NL4H 5ITYA 3SYLA 3GLGB 1HT2E 3ILKA 2XSZD 2UUCM 1SXJE 1DV0A 3AJIB 3OTOM 4G4NA 1V92A 4IIWA 1QAMA 1IXSA 2L7HA 1TH2A 5ITTA 2XZUA 1NO1A 3L2AA 4PDGA 3UMMA 1VQ1A 5GKNA 1SXJB 2J7NA 2JZ0A 3LVWA 1IBLM 2DKLA 3KFUG 4IBFA 2K9DA 4MGYE 1YSYA 5EXTA 4AG5A 4F1IA 3PNYA 5DNYA 1L2CA 4GMQA 1IN4A 4Y28F 3GLFE 4LJAA 1OIPA 1Z5AA 3GQ4A 1X37A 4DR6M 4GRIA 5ITQA 1IY2A 4PD2A 2KHHA 4NSOB 1RU3A 4MM3B 4IBEA 4B7HA 5LMNM 4M0WA 1NHGC 2APLA 1NSFA 1XHBA 2JNHA 4L16A 1G4AE 2L4EA 2L6OA 2DZNB 1D0MA 2KNZA 2QPAA 2Y20A 5EP3A 4M9ZA 3TPZA 1HQCA 3GLFB 1GL7A 3LQQA 1GO5A 3SMSA 1LTMA 2JZ1A 4DR5M 4AQYM 3A98B 4I81A 4NRWA 2K47A 3C9PA 4LCBA 3T1HM 1HNXM 4X66M 1W5SA 2MH8A 1N36M 3FUTA 1GJTA 2RGHA 4BLCA 5C18A 2CFOA 4IBIA 1NJGA 2DAGA 4JI3M 1KFVA 2G3QA 3NBXX 5EJCA 4M9SA 3SAWA 4YHHM 1JR3A 4KODA 5E6JA 1DGGA 3T6PA 4D81A 3FTFA 3ZCBB 4AKHA 3PFIA 1DGFA 2EUCA 1TH3A 1ORYB 4MGKE 1C7YA 4B7GA 3U6SA 1HQYE 3U6CA 3FE3A 2F5NA 1XWIA 2LVOC 3HY5A 1GKIA 3KOZE 1C1KA 3SYKA 1V33A 1IQPA 3EIHA 2QBYB 4Z8XA 4P17A 4R7GA 4LFCM 2LHGA 1I94M 3VKGA 3QYBA 1DGBA 4P16A 2K0BX 3HU3A 2JA2A 3KVWA 1DGHB 1WJ7A 4JXJA 3RGPA 5C1BA 2JWSA 1S3SA 2Z8YM 3B7NA 3CTWB 3I01M 4NSRA 3FTDA 4R3DA 1W5TA 1NVMA 3T15A 3U60B 2KEBA 4JI2M 4JI6M 2V6ZM 2HKJA 2OO9A 3DFZA 4GC9A 3W68A 2XZFA
chains in the Genus database with same CATH topology
1NO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NO1 A; 
#chains in the Genus database with same CATH topology
 3UGJ A;  3CF6 E;  3I04 M;  2YQZ A;  4L6V 6;  1VEG A;  1GLN A;  1OFH A;  2QCU A;  2ZBK B;  3B9P A;  3H4M A;  3HHW A;  5L8R F;  1R2Y A;  4AG6 A;  5FTN A;  4B3M M;  4B3T M;  2H5X A;  1ZMU A;  3FD9 A;  1D0K A;  1Q3C A;  3FKE A;  3SC3 A;  2KRK A;  1PGY A;  4I4L A;  3VDU A;  1R6B X;  4QNR A;  2I7P A;  3GLI A;  3AL0 C;  2EO2 A;  2R4J A;  2MJ5 B;  4DV0 M;  3KOW E;  2F4V M;  3GRU A;  1Q39 A;  2JY6 B;  1MX0 A;  4AZF A;  2R18 A;  3K2L A;  1R5L A;  4JI1 M;  4W5W A;  4ZPX A;  4WUR A;  2F5O A;  1HJP A;  2I7N A;  3SAT A;  4JYA M;  3DA1 A;  5EXS A;  2KNV A;  2OPF A;  4LRT A;  2KA6 B;  5EP2 A;  2KDL A;  1AIP C;  2KW0 A;  4GHA A;  2ERC A;  1GAB A;  1EIJ A;  3VLF B;  1NV8 A;  3R8F A;  1XNQ M;  7CAT A;  3SAS A;  4LF8 M;  2D7E A;  4MH0 E;  2LBC A;  1NV9 A;  3U61 A;  3PNV A;  5EXX A;  3GRV A;  4A3V B;  2R6F A;  2DWL A;  1EFU B;  2FS1 A;  2BJV A;  1IXS B;  2BJW A;  2CHG A;  4HL4 A;  1WGN A;  4M9X A;  1TDH A;  1T43 A;  4S12 A;  2Z3X A;  4LY6 A;  2V1C A;  2NQ8 C;  1T6O A;  1UFZ A;  1OQY A;  2CUZ A;  3GPP A;  4B08 A;  2UXB M;  4NRV A;  2K6B A;  1Q02 A;  2H1R A;  3B7Z A;  2ZAN A;  1VEK A;  4UN2 B;  4LF4 M;  1PJJ A;  2WSE F;  3J2P B;  2XSZ A;  2ZTC A;  3SHG B;  4L8R C;  2GNO A;  4B3R M;  1N75 A;  1IBM M;  5KQ8 A;  3U6O A;  1ZV1 A;  2X49 A;  3M0E A;  5H37 D;  5LMU M;  3GRY A;  1IN5 A;  4LF5 M;  3CF2 A;  4GKK M;  3JR5 A;  2Y0Q A;  4DV3 M;  3J7B A;  1Z5C A;  2KZS A;  2C9C A;  1JR3 E;  3C3D A;  1KYI A;  2Z4S A;  2JY5 A;  4NC6 A;  1IN6 A;  5FTM A;  2D7G A;  1E9R A;  2WSF F;  3HU1 A;  3FUV A;  1MN3 A;  3IG8 A;  2XFT A;  4QHS A;  4XGI A;  4K0K M;  2Y21 A;  3GPY A;  4G4R A;  2C5R A;  5ITX A;  4DV5 M;  2DWN A;  2Z4R A;  4LFA M;  3MK6 A;  1HNW M;  2DHY A;  1G59 A;  2LHC A;  2M60 A;  1SG9 A;  3LW5 F;  5KO3 A;  1GVN A;  5KPZ A;  4PDI A;  1FNN A;  2FE8 A;  1PJI A;  1WR1 B;  2D7H A;  2N35 A;  3HJQ A;  3B89 A;  3J27 B;  3E46 A;  2J5Y A;  2VF7 A;  2G5G X;  3KOX E;  1BVS A;  5EQT A;  3ZQJ A;  4JI5 M;  4DR3 M;  3MMP A;  2RRU A;  4X65 M;  2E5L M;  2HAK A;  1L1T A;  2EA0 A;  3KS4 A;  3L27 A;  4LGM A;  3LMM A;  1LV7 A;  4DUY M;  2R46 A;  1YUB A;  1IY1 A;  2KRU A;  3WHK A;  2KXE A;  1TDZ A;  3HU2 A;  3QWL A;  3LQR A;  3KP1 E;  4PCZ A;  1IBK M;  1TH4 A;  3KP0 E;  4FW9 A;  1IN8 A;  3E4R A;  4M0D A;  1I4W A;  2FOI C;  2KNA A;  4RNA A;  1OIZ A;  4IBD A;  3VFD A;  4Z6Y A;  2Z7J A;  3W67 A;  3GLG A;  4FVM A;  3FTC A;  3VK7 A;  3VK8 A;  4FCV A;  4LJ7 A;  1J5E M;  2DWZ B;  3UK6 A;  4D80 A;  4IBC A;  4DV6 M;  3U6E A;  3R9X B;  3KOY E;  4IJE A;  3DOA A;  4MB7 A;  5FLX S;  1QYR A;  3GO8 A;  2DI0 A;  4OU7 A;  2C98 A;  4AKG A;  4JI7 M;  4DV7 M;  3HWS A;  4GC5 A;  4QNM A;  2CHV A;  2JP7 A;  4XK8 F;  3GPU A;  4LF7 M;  4CHT B;  3TWK A;  2UXD M;  1N78 A;  2R0I A;  3Q8X A;  1G8P A;  3U5Z A;  4AW4 A;  1V34 A;  1R7R A;  2QHO B;  2DAM A;  1WXQ A;  2HCB A;  3FUW A;  4AKI A;  4FCW A;  1SXJ D;  5ITU A;  5IWA M;  3C58 A;  1Z59 A;  3T38 A;  1JR3 D;  2WSC F;  5FTL A;  4L15 A;  3E21 A;  4IJF A;  4CIZ A;  1ZAE A;  1VDL A;  5A2Q S;  2OOB A;  3SHF A;  1IM2 A;  4JV5 M;  2VII A;  4YY3 M;  1OTR A;  3RGS A;  4TUW A;  3U61 B;  2UUA M;  5JI2 E;  1T3T A;  3B7Q A;  4KT0 F;  2LVN C;  4DR2 M;  3L28 A;  4DR1 M;  1OAI A;  1HT1 E;  2CWB A;  4LJ5 A;  5KPT A;  2BNK A;  2L4F A;  2CE7 A;  2R65 A;  8CAT A;  3GQ3 A;  1MU5 A;  1PJQ A;  3TE6 A;  4IBB A;  2DXI A;  1R2Z A;  1VDD A;  4D82 A;  1HR0 M;  2HL7 A;  1XXH A;  3KSX A;  4F2L A;  3HHY A;  3HHX A;  3GQ5 A;  3HHZ A;  2VF8 A;  1A5T A;  3A42 A;  1PM5 A;  4ANR A;  3GLH A;  4IBG A;  4JI0 M;  2QBY A;  2ZAO A;  1QUS A;  1JQJ C;  3IEC A;  4DUZ M;  3U6M A;  4OVZ A;  2LWX A;  5ITX E;  1D0L A;  2JY7 A;  2QZ4 A;  4JI8 M;  3KSJ A;  4KHP M;  4FWH A;  3BBZ A;  5IT9 S;  3V76 A;  1TF0 B;  4QHT A;  2YFQ A;  1DGH A;  2KZU A;  3IHP A;  3EIE A;  3MJ5 A;  2DAI A;  1IFY A;  1GJS A;  1AUA A;  1EE8 A;  4GHL A;  2DHR A;  2CEA A;  3ZH9 B;  1P3Q Q;  2LVP C;  2XF3 A;  1ZMW A;  4KO8 A;  4LZJ A;  5KPR A;  4XBO A;  3TWL A;  2CP8 A;  4HLQ A;  3W0L B;  4R71 A;  3PVS A;  2UU9 M;  4LFB M;  2C9O A;  3SAR A;  2MRO B;  2LNH C;  2LVQ D;  4Q7J A;  3T1Y M;  2JXN A;  2O5R A;  3LVV A;  3CGW A;  1QUT A;  5IRE B;  4B3S M;  3FRI A;  2W82 A;  3L29 A;  4GKJ M;  4GIP A;  1Y8G A;  3KS8 A;  2VQF M;  2A5Y B;  1K3X A;  1OKS A;  3U6L A;  1QDT A;  2X4A A;  2CV1 A;  4CGY B;  2WZJ A;  3AKZ A;  1D2N A;  1VG5 A;  3FRH A;  3D8L A;  4RF0 A;  3RE8 A;  1XNR M;  1G71 A;  1NNU C;  4NOO B;  1TGU A;  4DV2 M;  2MR9 A;  2R44 A;  1QVR A;  3CF0 A;  4X64 M;  4HEO A;  4MGZ E;  2LVA A;  3J7A S;  2R62 A;  2XH9 A;  1NNJ A;  2AHM A;  4LJ8 A;  5DFL A;  4QOZ C;  2YNM D;  1OJL A;  1K82 A;  1L8Q A;  1WHC A;  4II7 A;  4X62 M;  2XLJ A;  4RKU F;  4G4O A;  3TWM A;  1Z6T A;  4DR7 M;  2M5Z A;  4RF1 A;  3L26 A;  4ITQ A;  2VDB B;  1WIV A;  2G8L A;  1QZM A;  2ZAM A;  3BXW A;  5EXP A;  2DWM A;  4JI4 M;  4AI6 A;  2F5P A;  4BB9 A;  2L7I A;  4LJ6 A;  2V1U A;  4I8O A;  1IN7 A;  4WP2 A;  2CHQ A;  1IXZ A;  3VDP A;  1QAO A;  1JB0 F;  3U6P A;  1UM8 A;  3AOG A;  2R45 A;  1DO2 A;  1GL6 A;  5JI3 E;  1IXR C;  2JY8 A;  5BPV A;  1J09 A;  3A46 A;  1SXJ C;  4DV1 M;  4QOS A;  3U5Z B;  3ZC7 B;  2EKK A;  4IBK A;  1NHW C;  5BR8 M;  2XGN A;  5FTJ A;  3AOE C;  3FYC A;  3THG A;  5ITR A;  2BWB A;  4GH9 A;  3RFW A;  4MGH A;  3K9O A;  5DYG A;  1TR8 A;  4GIT A;  3GLI E;  3F92 A;  2VQE M;  3HZJ A;  3J81 S;  4FD2 A;  4G6Z A;  3FUX A;  1KSF X;  3D8B A;  3NBI A;  3TL4 X;  1Q3B A;  5DYI A;  2DZO B;  3C3E A;  1XXH E;  4LF9 M;  1E9S A;  3AV0 A;  4FWG A;  3GLI B;  2QEN A;  2MGW A;  4LF6 M;  5IZ7 D;  1OFI A;  1IY0 A;  4DV4 M;  1SXJ A;  1QQW A;  1J7K A;  3GLH E;  1L2D A;  3HJS A;  2UUB M;  3HJ8 A;  1K3W A;  3HX3 A;  3LCU A;  2DAK A;  3FYD A;  4FWD A;  1XXH B;  3LCV B;  3SFZ A;  2Q2E B;  3AOE A;  3IG5 A;  1QAN A;  1QAQ A;  2FFJ A;  2FNA A;  1HNZ M;  3B74 A;  3GLH B;  2X8A A;  4LJ4 A;  1L2B A;  1G41 A;  4OVZ B;  3I4V A;  3GLF A;  3SAV A;  2DEN A;  2DAE A;  5FSW A;  2RGO A;  4WW0 A;  5EP4 A;  1N77 A;  4GEW A;  1XC8 A;  3QAU A;  3VKH A;  3A45 A;  3I51 A;  5F3W A;  3MHV C;  4JN6 A;  2JUJ A;  3U6D A;  2QNJ A;  3E9S A;  4LGY A;  2FH0 A;  1PJT A;  3AFH A;  2UXC M;  2QQ8 A;  2EKF A;  4G3O A;  1YLA A;  4KLN A;  2P5T A;  3I4Y A;  2DNA A;  1N34 M;  1DO0 A;  2Y0T A;  2GQF A;  3QYE A;  5E26 A;  2XEP A;  5FTK A;  1YE9 A;  1WGL A;  5KQD A;  3KXE C;  4L4U A;  3SBJ A;  3K9P A;  2DZL A;  1OAO C;  4OW0 A;  1N32 M;  2L09 A;  2OOA A;  3K8Z A;  4OX9 M;  3GRR A;  3TQS A;  2CRU A;  4DR4 M;  4NXN M;  3PXG A;  3Q8G A;  3UJN A;  4FCT A;  4G4Q A;  2CV2 A;  3K1J A;  3HKP A;  3GP1 A;  2RKO A;  1XB2 B;  1PRB A;  5EP1 A;  1NY6 A;  1FJG M;  3DZD A;  3L25 A;  1E94 E;  3U60 A;  1N33 M;  3J80 S;  2ZM6 M;  1PJS A;  1Z5B A;  2QSF X;  2L2D A;  2O01 F;  3GPX A;  4EIW A;  3KW6 A;  3KDS E;  1NJF A;  4REZ A;  1VEJ A;  3JR4 A;  2LTU A;  3JAM S;  4CJ6 A;  1G3I A;  1TTE A;  2C99 A;  3BOS A;  3SAU A;  2F5S A;  1R4G A;  2EJS A;  2R4E A;  3M6A A;  2OQ4 A;  1NY5 A;  1CUK A;  4IBJ A;  3H4J A;  4DBG B;  2XFS A;  3K92 A;  2B3T A;  2C96 A;  4MGI E;  2YR0 A;  2LH0 A;  1QZE A;  2DVW B;  3UZU A;  1XMO M;  3WHL A;  4BBA A;  2O25 A;  4CIS A;  2HWJ A;  3HGI A;  1E32 A;  4LJ9 A;  4L78 A;  4B7F A;  3GLG E;  1L1Z A;  4PT5 A;  3FTE A;  3FUU A;  3M7G A;  2J7O A;  1XMQ M;  2HHH M;  4LG2 A;  4I5S A;  1MJG M;  3SMP A;  4NXM M;  2CV0 A;  1QDR A;  2QP9 X;  1ZQ9 A;  2BWE A;  2LXE A;  3NWL A;  4LRS A;  1F4I A;  3U6Q A;  1ZMV A;  4LZZ A;  1H6U A;  2ZTD A;  2F5Q A;  3W0F A;  4NL4 H;  5ITY A;  3SYL A;  3GLG B;  1HT2 E;  3ILK A;  2XSZ D;  2UUC M;  1SXJ E;  1DV0 A;  3AJI B;  3OTO M;  4G4N A;  1V92 A;  4IIW A;  1QAM A;  1IXS A;  2L7H A;  1TH2 A;  5ITT A;  2XZU A;  1NO1 A;  3L2A A;  4PDG A;  3UMM A;  1VQ1 A;  5GKN A;  1SXJ B;  2J7N A;  2JZ0 A;  3LVW A;  1IBL M;  2DKL A;  3KFU G;  4IBF A;  2K9D A;  4MGY E;  1YSY A;  5EXT A;  4AG5 A;  4F1I A;  3PNY A;  5DNY A;  1L2C A;  4GMQ A;  1IN4 A;  4Y28 F;  3GLF E;  4LJA A;  1OIP A;  1Z5A A;  3GQ4 A;  1X37 A;  4DR6 M;  4GRI A;  5ITQ A;  1IY2 A;  4PD2 A;  2KHH A;  4NSO B;  1RU3 A;  4MM3 B;  4IBE A;  4B7H A;  5LMN M;  4M0W A;  1NHG C;  2APL A;  1NSF A;  1XHB A;  2JNH A;  4L16 A;  1G4A E;  2L4E A;  2L6O A;  2DZN B;  1D0M A;  2KNZ A;  2QPA A;  2Y20 A;  5EP3 A;  4M9Z A;  3TPZ A;  1HQC A;  3GLF B;  1GL7 A;  3LQQ A;  1GO5 A;  3SMS A;  1LTM A;  2JZ1 A;  4DR5 M;  4AQY M;  3A98 B;  4I81 A;  4NRW A;  2K47 A;  3C9P A;  4LCB A;  3T1H M;  1HNX M;  4X66 M;  1W5S A;  2MH8 A;  1N36 M;  3FUT A;  1GJT A;  2RGH A;  4BLC A;  5C18 A;  2CFO A;  4IBI A;  1NJG A;  2DAG A;  4JI3 M;  1KFV A;  2G3Q A;  3NBX X;  5EJC A;  4M9S A;  3SAW A;  4YHH M;  1JR3 A;  4KOD A;  5E6J A;  1DGG A;  3T6P A;  4D81 A;  3FTF A;  3ZCB B;  4AKH A;  3PFI A;  1DGF A;  2EUC A;  1TH3 A;  1ORY B;  4MGK E;  1C7Y A;  4B7G A;  3U6S A;  1HQY E;  3U6C A;  3FE3 A;  2F5N A;  1XWI A;  2LVO C;  3HY5 A;  1GKI A;  3KOZ E;  1C1K A;  3SYK A;  1V33 A;  1IQP A;  3EIH A;  2QBY B;  4Z8X A;  4P17 A;  4R7G A;  4LFC M;  2LHG A;  1I94 M;  3VKG A;  3QYB A;  1DGB A;  4P16 A;  2K0B X;  3HU3 A;  2JA2 A;  3KVW A;  1DGH B;  1WJ7 A;  4JXJ A;  3RGP A;  5C1B A;  2JWS A;  1S3S A;  2Z8Y M;  3B7N A;  3CTW B;  3I01 M;  4NSR A;  3FTD A;  4R3D A;  1W5T A;  1NVM A;  3T15 A;  3U60 B;  2KEB A;  4JI2 M;  4JI6 M;  2V6Z M;  2HKJ A;  2OO9 A;  3DFZ A;  4GC9 A;  3W68 A;  2XZF A; 
#chains in the Genus database with same CATH homology
 1NO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...