1NONA

Pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
179
structure length
161
Chain Sequence
b'MQKAVVMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGASVPVGELDITLYRVPFPVTERNVILVDDVLFTGRTVRAAMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELSEVDGIDQVSIHEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PyrR bifunctional protein
publication title Structure of the Nucleotide Complex of PyrR, the pyr Attenuation Protein from Bacillus caldolyticus, Suggests Dual Regulation by Pyrimidine and Purine Nucleotides
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription, transferase
total genus 52
structure length 161
sequence length 179
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2003-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nonA00
1ECCA 1G2PA 2JBHA 2JKYA 1LH0A 1O57A 2H07A 1TC1A 1G9TA 1UFRA 1UPUA 2XBUA 1R3UA 1GPH1 1QB8A 2HCRA 5BQOA 4RANA 2IGBA 4RHYA 1P19A 4PAWA 1XTVA 1AO0A 1Y0BA 1D6NA 1QCCA 2FXVA 3H83A 1TC2A 4P80A 3HVUA 5BQPA 1Z7GA 1A98A 1ECGA 1BD3A 4MB6A 1I5EA 4IJQA 1JLSA 3ACCA 1G2QA 4RABA 4WN3A 4RQAA 3MJDA 5K51A 1ECJA 1VSTA 4RAOA 4RHXA 5KAMA 1I14A 3LRTA 4KN6A 4ZFNA 1ZN7A 1DQNA 4RV4A 3GGCA 1ZN9A 2JI4A 4P82A 5ESWA 4LZAA 1IBSA 1CJBA 1QK3A 1U9YA 3EFHA 1XZNA 4M0KA 5ESXA 1ZN8A 4LYYA 3DMPA 2GEBA 4RADA 2PRYA 3N2LA 4M0UA 5E38A 1I0IA 1NULA 1L1RA 1VCHA 4X44A 1I13A 1STOA 4QYIB 5JSQA 2WNSA 4QYIA 1OREA 3OZFA 2C4KA 2JKZA 1DKRA 1GRVA 4P83A 1VDMA 2H06A 3LPNA 5IPFA 1XTUA 1A97A 1V9SA 3M3HA 4QRIA 3ACDA 1UPFA 1ECFA 1MZVA 5HIAA 3GGJA 3OZGA 3KB8A 3GEPA 5IAOA 4OHCA 1XZ8A 5BSKA 2E55A 1JLRA 1OPRA 1WD5A 2PRZA 4P86A 1A3CA 4M0PA 1DQPA 4TWBA 4LYGA 3DEZA 4Z1OA 4LZNA 3DAHA 1QK5A 4JITA 1DBRA 1YFZA 1A95A 3QW4B 1FSGA 1P17A 1QK4A 2PS1A 4P84A 4FYMA 5HKLA 5KAPA 1A96A 1O5OA 3NAGA 3O7MA 1XTTA 1ECBA 3MBIA 4S2UA 1P18A 4RQBA 1U9ZA 1G9SA 1NONA 4RHUA 1I0LA 4LZOA 1DKUA 5JV5A 1OROA 1QCDA 5BRNA 1L1QA 1PZMA 2EHJA 4X45A 2YZKA 4PFQA 5EUCA 3OHPA 4JLSA 4RAQA 1QB7A 3S5JA 1A4XA 1P4AA 2P1ZA 1HMPA 3ACBA 4WMLA 1BZYA 2AEEA 2DY0A 4P3KA 2H08A 4P81A 4RACA 4RHTA 1W30A 2VFAA 4F8EA 1J7JA 1BD4A 3G6WA 1HGXA
chains in the Genus database with same CATH superfamily
2CNKA 2AZTA 4N5DA 4O0MA 4X85A 5K0SA 1ZSYA 4HGOA 2P6NA 2IF0A 1G6Q1 1T24A 1UPUA 2QUAA 4LKRA 4LWPA 2JFHA 1U1IA 4MUFA 3AFGA 2QRUA 3T3MB 1T13A 2WSLA 3QPUA 1ODFA 2TRSB 4P32A 1BWQA 1DRWA 3TRIA 4O25A 1XDWA 3FY4A 2B25A 3LF2A 4Q9HA 1TCUA 1YMUA 3GDFA 4MS3A 5IF9A 1QWOA 3LDHA 1FFAA 3TKYA 4DLKA 3EY9A 3QUQA 3BN3A 4KR3A 1Y5IA 3PGLA 1MR3F 3UMFA 5JNVA 1GZUA 4BWYA 4V0LA 4AJPA 3JATA 4PG5A 3SSAA 1NVXQ 3UHPA 1J1IA 1S02A 1ZGAA 3IJ5A 4IX1A 4QPPA 4V0MA 4AICA 5KQGA 1GUYA 2JZOA 3BQ9A 2FLKA 4WD3A 3LOPA 4I1PA 4NCJA 3GLQA 1XT6A 4I4NA 1ONSA 3Q3HA 4Q47A 3SZUA 3U4AA 5I4KA 3I52A 1ZN7A 2HDNB 1NPTO 2PX6A 4UBJA 4KWTA 4MRRA 1XMSA 2OECA 3MWLA 1E0DA 3HSKA 5EFZA 4AS3A 4LFBB 4R1UA 2AFIB 2YWJA 3DOEA 3N2GB 2IIVA 3DONA 3OJLA 3P71T 2VP6A 3MGBA 4H7HA 4BTVA 2VCYA 4CFYA 1AQJA 2XGGA 2ROQA 3EEYA 1GD1O 3HKBA 2RC6A 3LOUA 3UPDA 3R3SA 4DADA 5CA1F 3IKMB 1RAFA 4L16A 3CVYA 4RTMA 2ENUA 2ODEA 4E70A 4YJGB 1MP0A 5AVOA 1Z06A 2E4WA 1G8YA 3L4EA 4YRLA 3NHKA 4EG5A 1YU9A 1Z4MA 2PY6A 2AVDA 2G8NA 2YL2A 1NMXA 4MSUA 4RNDB 3WMEA 6AT1A 2FN3A 3QE0A 2FQWA 1NTRA 1KI1A 2JK1A 4HN9A 1SQ5A 4DV3B 3H4MA 5B7PA 4ON9A 1LDBA 2PL9A 1PR4A 4QX6A 1BVUA 1JAIA 4XGKA 1S0UA 3WAGA 5KWSA 4IDGA 3SIRA 1ILWA 1D2GA 5BPFA 2JFOA 1A97A 3LZDA 4OATA 3QKUA 1DQYA 2B8EA 2QQ5A 2AHOA 3O83A 4DQVA 2UVPB 3H0EA 1FQKA 4WESA 1MABB 3PDJA 1FXSA 3T7RA 1MZPA 3NOOA 4GI1A 4IDBA 1QIMA 5EFOA 5JRJA 1IAVA 1DQSA 1P7WA 3WB2A 5LZ7A 5EINA 5AUNB 1JA0A 3MLEA 4AF8A 4Z53A 1X8XA 4L07A 4REOA 2CNDA 4ZALA 4J3NA 4DTIA 1AO3A 5JNWA 3VTKA 4DR1B 3N70A 3V55A 5DTRA 3DHEA 3KYDA 2F1JA 4HWOA 4YR9A 5KTSA 1AKQA 3EGCA 2SKDA 3CN7A 3JQ9C 4NAVA 4OK6A 1U7TA 1ZM3A 3N2EA 1TCBA 1BS1A 3QJYA 3GG9A 3M4JA 4TT3D 3K8ZA 5CVVA 5KTKA 2HSJA 2JFFA 4UPEA 1UUFA 1VL6A 2N0SA 5A6SA 3LQKA 4FSXA 3H16A 3V8PA 4NTZA 2HSWA 3X3HA 4CN9A 3RHZA 5G3ZA 1A9ZA 3VX3A 1HMYA 3I53A 3Q5DA 3HM2A 3MGKA 1XXLA 4Z1MD 2IOYA 4DWOA 4C08A 2XYVA 5TMEA 5J4LA 3OWXA 5FR1A 1MNAA 4CDNA 4XCQA 1G3RA 1BD4A 5KYNA 1SXPA 3IXMA 3BCHA 4Q21A 3MOIA 5LNK6 2XE6A 1VKOA 1NHWA 4MULA 3HL0A 3E84A 3OICA 2JCGA 3SXUA 3QFFA 3UOAB 1W5AA 3TZCA 3WGUA 1IJKA 4N0QA 3CXUA 4IHKA 4I50B 4AK9A 2VQSA 5F35A 1K2WA 5IT9A 4JJFA 2A9QA 1UC5B 1V48A 1WD7A 4LIPD 1A4UA 4AO8A 4EJSA 4ZOQI 4AX8A 1K8QA 1NFFA 1NMSA 2B6NA 2CE7A 4HSGA 3RUEA 1OFTA 3VH1A 4YAWA 4F7DA 1U8ZA 4E33A 2VHEA 4Q1EA 4AD8A 2UYHA 4MH0R 4BC1A 1EPUA 4M1YA 1ZH6A 2CBZA 5DJ5A 1VKNA 3K5WA 4O4JA 3TXXA 1LNQA 1VZ2A 1X8LA 3C3CA 4RCYA 4XWAA 5K0CA 4R2WA 3GQBB 3LXUX 2BR3A 2I7CA 3PFNA 4WZAA 1U5BA 5SICE 4GKBA 1KZYC 2Q5HA 1FFHA 4KN6A 2LV8A 2V7QA 1PNQA 2R6GA 2C2OA 4HZIA 4NU0A 4EG4A 1XBTA 3ETEA 2ISQA 5EIBD 2EVWX 3CNLA 3K32A 3DXZA 1JYEA 4QNNA 3U62A 4D2IA 4EJ6A 3HO1A 1PGJA 3ORYA 4WBXC 5EG5A 4ZA2A 1TQ2A 1U1FA 4PYMA 4ENWA 3OLVA 5FIUA 4CQLB 1W88B 5IVHA 4NECA 1DT3A 2QAIA 1DZ3A 3O4JA 1TCCA 2O2XA 2O06A 1J90A 1EWYA 2EKZA 2GCPA 3NHUA 5FPTA 3VPFA 3PE4A 1NVTA 1W1WA 3M6LA 3ZCXA 2AX3A 4DCSA 5F7OA 1QYWA 2QA5A 2GN2A 3O8OA 2Y1KA 5BR8B 4C5AA 2EJUA 3QFSA 1X87A 2AXQA 1A88A 1EDDA 4JGBA 4QGGA 1ODTC 1KVTA 3KHUA 1M1NA 3MT0A 4HDSB 4QATA 4XDYA 4EWLA 3TRKA 2P2GA 1VDMA 1CZUA 2VQ6A 1PRYA 3KQWA 1GNQA 2BKLA 3H4TA 3BULA 3HEBA 3L0SA 1XEXA 3L8DA 4QLBA 4OYYA 3WIEA 1UDXA 3QWBA 3LJKA 4JYAB 2QMQA 4MP6A 3N75A 5B57C 2IV2X 3HXQA 2QDXA 4HGQA 1ORHA 2JHPA 5DIFA 3I3OA 3FF4A 3AFNA 1R5NA 3RI3A 1GSHA 1TECE 4RD6A 5BVGB 1PQUA 3OQBA 2Q7DA 1VMEA 2GRJA 1XMXA 1DKPA 3LBHA 5KWEA 2FEXA 3WJ1A 2CYCA 2E2WA 2HPHA 2HSEA 2RE8A 4WZZA 1Z13A 3W5HA 4P53A 4A26A 5BNZA 4DG5A 2WOJA 3A3YA 3PIIA 1FW6A 3RQSA 3TSYA 3X1DA 2EFYA 4R98A 5F76A 2Y1DA 3ZV7A 5CRIA 3GJYA 2J31A 5AI0A 4PAOA 2YN0A 4NZYA 1C9DB 1QIEA 5TQVA 1PT5A 3ND6A 2P11A 5FR2A 4P0PB 1E3EA 1CQJB 3A2LA 4G8JA 3ESAA 3TFOA 3K1JA 1NT2A 3IV9A 4LGCA 5EUQB 3RS4A 3A3PA 4UUMA 5G1OA 2AT1A 1ZM9A 4Q9JA 4XFKA 3R9XA 1JTEA 2C1XA 1NQUA 1SXJE 3ORHA 1OQAA 2QRVB 2PFSA 4RL6A 4MR9A 5CCXA 1LX6A 2Z3WA 4J49A 1EU1A 3LTEA 1BJTA 2BTEA 1L0BA 2VJMA 5A0FA 3ZHUA 5B1YA 3GJZA 4E0BA 3VA7A 4AXXA 1GGJA 1XZIA 4ID3A 2JLRA 1EKXA 2YOHA 2GXAA 4IZHA 1CHDA 1GLVA 3C6KA 5G1PA 3X1WA 1CQIB 4GGOA 3WLLA 2OC9A 2NXNA 3P20A 4TV8A 4FT4A 3LT1A 1R8XA 3UWPA 4C4YA 3P19A 4K9KA 4OGGA 4EATA 1LCIA 1WMFA 3DZDA 3A9SA 3ET5A 2OOSA 4JXJA 1EFKA 2ZIVB 4ZVUA 1WPXA 1Q74A 2FZ4A 5G53C 3ZIAA 1TEVA 3OPYB 4RF5A 1BE1A 4NULA 2QM0A 3ASYA 4JMPA 5TMDA 2GM9A 3EXG1 4GPD1 4YASA 3D43A 3VVMA 5AVQA 3F97A 3F3KA 1IZYA 3PUVA 1W6UA 3ILHA 4GM4A 3JARB 4WAUA 1XA4A 2IYXA 4XDZA 1U0JA 4YDQA 5HRCA 3MWKA 2Q5LA 1ZKMA 1YDHA 3CSSA 1KZ1A 5IAKA 4LYAA 1J6UA 2P75A 3AG6A 4D44A 1IZ0A 4DGQA 4ZIRB 3L7BA 3QXCA 1FYWA 2XUIA 4R41A 1W49A 3N58A 1VCMA 1I5OA 2XRMA 4YQEA 1ZUD1 1GPJA 4UU0A 1E6EA 3VKHA 1GL7A 3PFKA 3ZNOA 1C2YA 4U2EA 4I36A 2OD9A 2VHVA 2XUFA 2WY2D 3HB0A 1DOHA 3OT5A 2DP4E 5REQB 2P2LA 3V1TC 1EZ4A 2BH2A 2GJ4A 3WK8A 3NYQA 4L1KA 4I5FA 4M7WA 4DN6A 3ZJYA 5F98A 2OD7A 2A1UA 1L8OA 4A0GA 3B7WA 1U2DA 1PFQA 1AUXA 2ZE5A 3ZPXA 4BAUA 4AKHA 1N1DA 4LC0A 3BMOB 4X92A 1LDEA 3E61A 4GBED 3CWZA 3WMFA 4EF4A 1MJGA 1SM4A 3HB4X 5G41A 1JSLA 1KS2A 2ONCA 3FNRA 4QAJA 4HX2A 1II8A 2P35A 4CV1A 1FFDA 4FW9A 4KWIA 2BGKA 2XF8A 1ZYUA 1SZJG 1WW3A 2LCFA 2PYIA 1CY8A 4HPXB 3CA8A 1U0SY 3LT5A 1EZZA 5J1SB 5B2EA 1ZJ4A 1ST3A 3MAGA 4PBRA 1T6XA 3ORRA 1COZA 1M1YE 2CYBA 3OTGA 1JR3A 1P73A 5T41A 3QUAA 2VNHA 2JBWA 4WLUA 3EF1A 1UMCA 4LXXA 5AK5A 3TL2A 1H3EA 3DEZA 1DMSA 1N9ZA 4EW3A 2Q3DA 1RYZA 3GW8A 5EJFA 1U9CA 5CHYA 3AB8A 2JJ8A 4LFCB 3WHPA 4FYPA 5D3ZA 3UHJA 5TEWA 3ER6A 3VGPA 1BWRA 1FSGA 1JE0A 2XOKA 3GZTB 1JDPA 2B82A 3FPAA 3UTDA 1YS2X 2IX3A 2RD2A 2C78A 1Z47A 1Z45A 2I76A 3UKOA 1SKUA 3PSAA 3MOGA 4DSNA 2JDID 4EX7A 3M4YA 2F64A 4RVHA 1AKNA 3RVRA 2GEJA 2CLMB 4LRSB 2GK4A 3AUTA 4CM8B 2NXEA 1Z5UA 4PR0A 2FRDA 1EM8B 1MU0A 1WOYA 1WZEA 5AVUA 1W5SA 4LOHA 4MR8B 4XVUA 3BMCB 1PFWA 1VFNA 3Q3VA 4JFRA 1JJBA 4J8PA 4NYMQ 2YICA 1K7EB 2HMYB 3DD1A 3RPEA 1I4TD 2Q29A 2QTVA 2WHEA 3DQQA 3HKDA 2RIPA 4MA4A 4QGBA 5A7HA 1EP2B 3G1TA 2COKA 2GAAA 3WNCA 1PBTA 2O6LA 1W0JA 3KOMA 4JQZA 3CN9A 2SCUA 4YP5A 3ML1A 3KYJB 4L7QA 1W2GA 4I5GA 4NDNE 3N39C 4S1WA 2BW0A 4CQJA 2Q50A 3K9HA 1I3LA 2ZROA 4U9IS 4UBMA 3DFMA 4RC9A 2RGYA 4AUMA 1CETA 2P9YA 3DZBA 3AX6A 3ZVRA 4TWJA 3ZHVA 3PUXA 1WZUA 4I3GA 5AJHA 2X9NA 5F1YA 2AK3A 1WDMA 1Y48E 2NZYA 5DT9A 2PWBA 1E7YA 4U6SA 2F8MA 2QTGA 4KUHA 3ZS9A 1W5FA 2UYQA 1L5RA 4KO1S 4ASUA 2Q8PA 1ZONA 4WBNB 3FCAA 4N40A 1HO3A 3WFIA 1XC7A 3AKEA 4RO0A 2Q3HA 4V0KA 4ZCPA 3HLKA 4WTOA 5JAPA 4QWMA 4GP7A 3D0KA 4XPIB 1DBPA 3W2FA 2PZBA 3A06A 1DIAA 1RYFA 3KPVA 2UYCA 1DGQA 3D7NA 3DT6A 2YIVX 3GMTA 4PR3A 1YZLA 2M9MA 4HGYA 1IL0A 4YJKA 2WINI 5KREA 1VIYA 4ZV9A 1RMYA 3WKBA 3FTDA 2GZMA 2MT9A 4XEUA 1FNDA 4ZYWA 1U0BB 2G06A 5BSUA 2VPTA 1BCRB 1T9GS 3FCXA 4FBGA 3RS2A 3UJ9A 4E30A 5ISMA 3RFTA 5JC1A 5KKAA 3FOFC 5AHWA 5B6IA 5T8KA 1KOLA 1G8GA 2WYIA 7MDHA 4YJ2F 3ZLJA 1F51E 2Q0HA 4QXAA 3ZK8A 2QLMA 1Y5NA 1DTWA 5DULA 2QSYA 3OTIA 4JH0A 4QGSA 3IL2A 2FP4A 3E9ZA 4AZTA 1RRCA 4TL8A 4MRPA 4CU5A 4J75A 1QTQA 3K2QA 1HT1E 8AT1A 4NBSA 4FHCA 1R0XA 1Z34A 4J76A 5LB2A 3JTMA 1UC8A 2FB9A 1SBNE 2IZ0A 3T3GA 4UJ5A 3G5TA 1I9GA 1KI8A 1XZMA 3E1GA 1F4PA 1SRRA 1IWPB 4DMLA 3OD5A 4OKSA 5BW8A 2QTAA 2A9VA 4UNNA 3LX4A 1UMDB 1DSSG 1OT3A 2J0VA 2VCHA 3E9RA 4FHFA 4HS9A 4M87A 4IFIA 4RF3A 3SYKA 1H8HD 5I47A 3JVUA 4IVPA 4QOIA 1Q6ZA 3D2CA 1XZPA 1DEOA 3AY7A 5BV0A 1AGYA 5CVCA 5AJZA 2R1VA 2D4AA 4OXRA 4XR4A 5F5NA 1CRZA 4D43A 1QC5A 3KT8A 4MGKR 2XB2A 3JQ9A 1T8UA 3INYA 4HADA 2C2WA 4KAJA 1IBKB 4KMRA 3NT2A 1QUFA 1YKGA 4KW7A 1DPFA 1K9SA 3GBSA 3LYHA 4U0JA 4YEDA 2G36A 3UG7A 2XQFA 4OI2A 4MIKA 1L5SA 1E89A 1YQXA 3EG5A 1MH9A 3GEDA 1G291 5GGXA 5A02A 5IWCA 1EK6A 1XEAA 2WAAA 1Z38A 1QFXA 3NTUA 2F1OA 5ER9A 3DBIA 4DMFA 4CQNA 2B2NA 3ANYB 4CMIB 1TU0A 1RJEA 3AUJB 2MYPA 3I37X 3N8NA 4CF3A 1UC9A 3A11A 4DMHA 5TSDA 2QEQA 3RV3A 3T52A 2FOLA 4MQBA 2PZFA 2Q1YA 5AOBA 5GINE 5J59A 4X7BA 1QB7A 1JAZA 3IQGX 1ONPA 3LZ6A 1GUDA 2ZULA 4WINA 3P52A 5D7BA 1BVYF 1PEDA 3PF8A 1QQBA 4XA8A 4NH4A 4NONA 4RK5A 3U7JA 1D2NA 4HX5A 3WLOA 5I7HA 9ABPA 1DADA 2I7XA 4O5AA 1JR2A 4LTDA 2VZ9A 4B09A 4EYEA 2J45A 3WDKA 3WQRA 1I4LD 1R0LA 4CMEC 1PZHA 1J2TA 4J4HA 3DZ8A 4TLDA 3RLFA 2PL1A 3SGLA 5KOHA 2DETA 5LPNA 1DVRA 1MFPA 2NO1A 2WV9A 3G0GA 3AESA 2NPFA 9LDBA 5FNVA 1XDGA 4FWTA 3SZ3A 2ODPA 2P65A 3V00A 3NT4A 1IOZA 3GPBA 4MWSA 5EWMA 4RZQA 2OKGA 1AO0A 1NYTA 4IDEA 2VUHB 3UB4A 5KOYA 1H2HA 2ACWA 2E1PA 4PVCA 1Z5PA 2WHXA 3V48A 1FMTA 2E6KA 1NSTA 3JALB 3Q41A 1OILA 2P2DA 1UEIA 3JSAA 5A6VA 3R24A 4KXVA 4EQ6B 2YDXA 3LBIA 4FEAA 3RFXA 1DLIA 1N5JA 1X0VA 2PGIA 3EQ9A 3FNIA 4NMLA 1GFIA 3WWOA 3ZD8A 1B8OA 2BCJQ 1R0CA 2CHVA 3C3BA 1L7PA 1P4RA 3MJSA 5DW3A 4ZEOA 3WHIA 3GH3A 4BE9A 1DQNA 3BMNB 5JZ9A 3VDQA 1D4OA 3RS0A 1J23A 5D8DA 2FKNA 2WQZA 1E1MA 2C8VA 3PFIA 5CURA 2D1SA 2ZEJA 3HFGA 3I9NA 3UXMA 5JAIA 3ZJ4A 1JP7A 3MQ2A 4N3GA 1TLTA 3JX9A 3NYIA 4JBYA 2NO9A 4GDFA 4AI6A 3FMVA 1CUCA 1VPVA 1VLMA 5LDGA 1UZAA 1BX1A 3G5MA 4WHMA 2JAXA 3IOEA 4NPCA 2YXLA 2FMFA 4HDNA 3ZCUA 3E23A 1DX6A 3X1ZA 2PKWA 2HF7A 2RG7A 2R85A 2GM3A 4IQ8A 4AJIA 2WNSA 3ABOB 3LIPA 3PGMA 3M4ZA 3QW2A 2BV3A 4EPRA 4UNSA 2E5FA 1OWOA 2NUPB 4GPTA 1BKSB 3PFWO 2HMUA 2NW6A 2VSQA 2C5EA 4LV5B 1J07A 1U0TA 3CRNA 5IBPA 2F8SA 4N0DA 5KVVA 3KK0A 1YR2A 4PYKA 5M04A 4K6OA 4FFSA 3LCUA 5BRNA 4BQOA 4TVKA 2QB5A 4UUBA 2IQIA 4CTJA 5JVDF 3KFVA 1X9IA 4UD6A 1YONA 4HEA6 1O89A 2B4RO 4MR7A 2H9IA 5JXIA 4EK9A 1XRJA 2WI8A 4Y2JA 4EVIA 5K3FB 1EJ6A 5EI5A 2A9JA 2NUAA 4UVGA 3E7WA 3W2EA 2G5PA 3AB3A 2OA0A 421PA 3GFOA 3HG7A 3KJNA 2H92A 2A0WA 4NVRA 4PF1A 3GFQA 1VI6A 3CR3C 3ZEIA 4CHTA 5JXHA 4DT1A 1OFHA 1W0KD 1R5OA 4X54A 5DGHA 2J67A 3PNQA 1ZX1A 3VZBA 1KVRA 3E27A 5H3HA 1B6TA 5FLEX 2QN2A 1W9MA 4JKIA 4ZMBA 3IUJA 5D3QA 3CLSC 2ODNA 3MS7A 4M1SA 1D0IA 1XYGA 2H5EA 2JGDB 4FZJA 4ZEWA 1KDTA 2ALJA 3AM5A 4O5OA 4QUDA 4D9NA 1SUEA 4EB3A 1OH7A 4TT3A 4OXNA 2ZB4A 4I1VA 4TLCA 5C0OE 3O2QB 1PEYA 2GPYA 3M70A 2AXEA 3QXXA 4IJVA 4RTJA 3PEWA 3V4RA 3ULKA 3C5EA 1XTBA 2FSUA 1S8NA 3I3SR 1EK1A 2W0SA 4WCVA 2IEGA 2QQEA 3A04A 3LX5A 3AHHA 3VNSA 1LK0A 1UDCA 1ECCA 2YASA 2XOXA 4KGZA 5CTAA 4Z1MA 1OF1A 1L3CA 5HCIA 2I6XA 1O57A 3F6PA 4QXPA 3QOWA 2AG5A 3AJRA 5D5PA 3D7LA 1Y1SA 1Z4OA 4KX5A 1KBQA 2LZ0A 4FXOA 5CJPA 5GV8A 4ZVSA 4BGUA 3R3UA 2G9UA 1P0QA 4M38A 3ETCA 1QR2A 5E6RB 2M6LA 4YLYA 4YT8A 3MAAC 2RHLA 2OZKA 1U0FA 1XPJA 2XKAA 4MW6A 4PG4A 3V4VB 4C0HA 1I94B 5BN5B 4YJDA 4MVWA 3KJHA 2PFGA 3GLRA 1OA1A 1N7IA 2QMEA 1MEJA 3QBDA 5FADA 1MDBA 2OCBA 3EMBA 4IJQA 4NS4A 2IWHA 2LD4A 5KWVA 2J3LA 2Z2KA 2FI1A 3GOHA 1JU3A 3MJDA 4G85A 2VPWA 1N5KA 3WK7A 3OE1A 3JYOA 3OBBA 2YVAA 4AC9A 4TTAA 1NLZA 4Y2VA 5D1NA 3L0ZA 5ELMA 2UDPA 2XOEA 2C2HA 4C6TA 4EVSA 2NU9A 3LY8A 2JFVA 5K01A 1QK3A 4HXGA 5H3CA 1IM8A 2IWRA 3E7FA 4XM0A 4PLTA 3A1EA 1YRWA 2XGOA 5CG2A 3ANMA 1BDJA 2PIDA 2WILA 3EOBI 3LUGA 4RADA 2ECQA 1Y63A 2R00A 5LZ5A 3TN7A 1TKRA 4TT8A 4YRMA 1TKBA 5AVRA 5IEJA 3T3NA 4GT1A 1R0WA 1RU3A 1LBIA 3V32A 3DHWC 4Z99A 1AHHA 2MYNA 1K3UB 1GL6A 2JGMA 3SSMA 3CX8A 3TSCA 1JHYA 4XOIA 2MIIA 2Z5GA 4P83A 2DPLA 4YCMA 3NVAA 3AI7A 3QBEA 2QLLA 4G2NA 3AEXA 3RJ9A 3ICOA 3LX8A 4PSUA 4O2AB 3JQAB 4DABA 1AXEA 2O52A 4HNSA 2IYPA 3N0TA 4WWHA 1SXJB 4X6UA 4JB3A 1N3IA 5CLLA 1OOEA 2NVUB 1GUBA 4U6NA 3SXJA 1SOVA 4H35A 5BSTA 2ZT5A 5ES4B 1ZHOA 4CKWB 3UCXA 1SQFA 1ZUNB 2QIPA 2WD8A 3EPPA 4JYPA 1CR1A 1N6HA 2ZE7A 1VHLA 1PR5A 2AA3A 2AMYA 3IJEB 4R7TA 2HPVA 2HW8A 4KZPA 5UKDA 3BXHA 4LJ6A 2C97A 3RUIA 1R8JA 2PR2A 1SXHA 3O1JC 4F38A 1ABEA 1NKVA 1XYYA 2BKAA 1Q7RA 2QTRA 4V24A 1MFZA 4RK0A 1NP7A 3PLNA 4M8LA 3HXLA 1GV0A 1GEGA 1VBMA 1LF0A 2VF7A 3CT4A 3O7MA 4WFIA 4ARZA 4KN8A 5K99A 1ZJWA 1LNSA 1YJ8A 3QWIA 4TXHA 2B2XA 4G26A 3HCOA 4AZVA 3D8RA 4EZIA 1KI6B 2Q5FA 1FUKA 3NORA 4FFOA 2BEUA 4AY5A 2JD1A 3GJ5A 5FBVB 3AXTA 5EKTA 3PHCA 1CZOA 3VC3A 2R96A 3VJLA 1HQCA 1EVIA 1Z62A 2JI9A 3OFVA 4KQWA 3OZVA 4DXHA 5JLJA 1HR0B 4R68A 1V1MB 2P0YA 3H6KA 1Z29A 4K9OA 1OLSB 2FE4A 1N32B 3OEYA 1MUUA 5AKIA 3BDIA 1Y4AE 5JCOC 4ND8B 2QVZX 3OPQA 4LN1A 3VVCA 5PGMA 4GVXA 3VH3A 1CEQA 1NJSA 4TYMA 2J59A 2ZI7A 4RTQA 3U60B 1GNRA 3BSSA 5CDTA 3K0AB 4A9AA 2XAUA 5BYKA 3TTUA 2YNMD 4BKRA 2ZYRA 1EEXB 2P4SA 5C8ZA 3LNCA 1CQPA 4UUNA 4NYMR 4RLHA 5FRDA 3V8RA 1O95D 5E9QA 3OY7A 2J0UA 2GAFA 1RLTA 3GROA 3NDRA 2RGWA 2CBXA 4X41A 4RTNA 3VTZA 3WLQA 5J1TB 2RGAA 3B1JA 4LS3A 3EZLA 4ARIA 1TFUA 1P4JA 4UUPA 2APJA 3PUWA 1KVSA 1ZI8A 2A5JA 4PRZA 4Q9AA 3EDRA 3CPEA 4RENA 1GKUB 1TEXA 1JU4A 3ISTA 4JLWA 4OMFG 4UDYX 3RT1A 4BJ1A 2YW9A 3ZVLA 4YRGA 1XEWX 2J85A 4YJFA 4EG1A 4RMNA 3BWXA 3K30A 1M6YA 4UBLA 5GTDA 1IEVA 1RYDA 2GBGA 2JJ1D 3G59A 4YRTA 1I7DA 1YR6A 4HEHA 1HE5A 2KI5A 4KRFA 1UIRA 2WHQA 4INOA 5BR7A 1X92A 4FHGA 2O0JA 1M1YB 2PK3A 1KY2A 2PRKA 1TQ8A 3HB5X 3UGQA 5CDHA 1ADFA 3GAFA 2OFFA 3GYBA 4DZZA 1N8TA 3TTWA 5IJ9A 1NY5A 3COZA 4DIEA 4BZQA 4F9TA 1ISRA 4FD3A 2Q5IA 4HLQB 4P33A 5JE8A 2ZJ5A 1ZEJA 3C43A 4QRDA 4AJ1A 3ZN2A 1MA3A 1ZD9A 5CEEA 3KXPA 5LZ4A 2E4XA 2R6DA 4F2PA 4YP0A 1FU8A 1LLCA 3MTIA 2RCNA 4YS6A 4ABTA 5EOVA 1TFRA 2VJBA 1UKBA 3ITDA 2I6SA 2IV7A 3WX0A 1T8TA 4TMFA 2D1RA 3IPXA 3AF1A 3HU1A 3PC8C 1BXRA 4DJ5X 3AR8A 1Q1QA 5JU6A 5CW2A 4P31A 4XUDA 4ENPA 4HH4A 4JS0A 1YZFA 2IXEA 2V03A 2Q4DA 2JA2A 4K6MA 3IUSA 5JH7F 3G3EA 1FDTA 2IHJA 3D3WB 3HY3A 1W47A 4OBEA 3GT7A 1QNLA 3ZWQA 4X8HA 2TS1A 4E4TA 1FF9A 2ETVA 1Z6GA 1WVIA 3WBKA 4LYGA 4AURA 4E21A 3F7OA 3CVJA 3UUWA 4HLUC 5E1BA 1GG2A 1M0TA 2D0PB 4S35A 4JKYA 4B7AA 3VU3A 3W9BA 5C34B 3W5AA 2GZ2A 4WA7A 1SURA 2BFEA 2QAGC 5GP1A 3EHDA 3E6AA 2TMYA 4IIBA 4KJZA 4YAOA 1UBJS 2EOAA 4HVAA 2YZMA 4YCAA 5DHTA 3Q0EA 4M9XA 3SC2B 2Q5CA 4RQTA 3UK6A 2PGLA 1CY1A 3FVRA 3R5XA 1EAMA 1KH1A 2QV7A 3FETA 3JR7A 3KTAB 2W2NA 4OQDA 4RHUA 4B4VA 4DEVA 2H4ZA 1I2ZA 3AJAA 1XD2A 4AJOA 4N3AA 3VPHA 3BGWA 4DCVA 4LCBA 2JDIA 1ARZA 2F17A 4C0QC 1W36C 1B4DA 1KS9A 2D7CA 1AZLA 3KL2A 3PI6A 5F1OA 4P3KA 2D8MA 3G2PA 3TTYA 2BFMA 3SF8A 2VSNA 3ZIUA 4FS3A 2RJNA 4M0DA 1O0SA 3RFVA 1Y37A 2OB2A 3W77A 2I1VB 2XWSA 2IE8A 3Q2IA 1R74A 5I8PA 2GCEA 1ZM7A 2C2YA 2J3EA 4JVOA 2JKYA 4TLEA 2BKXA 4GP6A 2B3DA 2ZZKA 4RD0A 1M54A 4KXMA 4PLWA 1S7CA 2BKUA 3N0RA 3WRVA 2W2TA 2BJWA 1G6HA 2DJ5A 3GCXA 4D9KA 4Y2RA 4ZEVA 4AAYA 3BJEA 1RMQA 4IH4A 1EP9A 5AW4A 5HF9A 4FT2A 5AJWA 2IXFA 3TUJC 3MPUA 3H87A 3HJRA 1HTWA 1E3WA 2ZU6A 3OM8A 4XWOA 3FKQA 4GOOD 2J7KA 2YV5A 5AW3A 2YZGA 5SZKB 3TZBA 3ZXUB 4QD3A 3OQNA 3V7YA 5K8IA 4H2DA 2PKEA 4C7XA 1C1XB 3RWMB 2Q6LA 5IXYA 1BXGB 1XQXA 2WUDA 2ZWPA 3PNOA 3CEPB 5KAMA 1IG0A 1LNZA 3PA6A 5BXYA 4U3JB 3A3OA 3VM6A 1O95C 4HB2A 4E1BA 2PCLA 3IKTA 1COWD 3AEKB 4NZ9A 2D6FA 4KXQA 4XSGA 1JAYA 2GMWA 2B99A 1KXJA 3LC1O 4QOHA 1C7IA 2CFSA 4W1PA 2PDAA 3P5BA 4RV5A 2NNWB 1XHEA 5DM1A 2QRMA 1AB5A 2FPGB 3CG4A 4PYOA 4GFDA 3LWZA 4L78A 2V1XA 2H57A 5E8JA 2RHJA 5JSFA 2P3LA 1QMGA 4QQKA 2OILA 1UMBB 4BX8A 5EJ9A 1GPYA 3LU1A 3OIYA 3T54A 1CF2O 3CLUC 1DDOA 1PNOA 4TWZA 5T4HA 3FFBA 4XW2A 2PKRA 2RGRA 1FOEB 2AKAB 1NVBA 1BE6A 1YJXA 5AKJA 2CJXA 4V0ME 2YTZA 5F78A 1A9SA 2QD3A 1UWVA 1EFUA 1ZOLA 1XZBA 1C9YA 3BT7A 3DDCA 3ASZA 1ISGA 4QT4A 2Z6AA 4UQPA 5CD9A 4RY2A 4AN0A 1UAGA 3A32A 4LVNA 4X1KB 1T9HA 2VLBA 3K5HA 4BNNA 1GAWA 2I2FA 2CVHA 1CY6A 3R7DA 4ATNA 1DC3A 3LK6A 2CT8A 1A9XB 2WA1A 5AJXA 2P6UA 2OO7A 3UWKA 1P8AA 3V9PA 4TWBA 4QOJA 3UAVA 3MJEA 1SIBE 3LKVA 1KEKA 4EPYA 3NRBA 2R6JA 1Z5ZA 1H8HA 2AC7A 1T0IA 1WU8A 4OUDB 4Y9RA 4WVLA 5G2OA 4YIKA 3A2MA 4FYVA 4KQFA 3EVCA 1MOQA 4GNKA 1T3ZA 4YK7A 1FTGA 5ELXA 4YNBA 2EEPA 4R71A 1BIFA 4H1VA 4U7WA 3WQSB 2H2HA 2QZ9A 1E3MA 1YI8A 2PZEA 1IQPA 1EUDB 1SK9A 1ZAYA 1T26A 2ZRQA 5DHSA 5AQEA 5B7QA 2YIJA 5H7XA 1LWOA 1NVKA 4Q93A 1N57A 1L1QA 1NY6A 1P1CA 3OCUA 4U2BA 3UMSA 5HHTA 4DPMA 1XXHA 5L3SA 1GA1A 1XFDA 3EB9A 1E2KA 4FDUA 1HMPA 3B1ZA 2F1RA 2R7KA 4Y8VA 5EP3A 4X66B 2OUIA 3L7NA 3EGDB 1L7MA 4ZU3A 3QVLA 4KPUB 2VPQA 3PNSA 3M0EA 3E9MA 1BEZA 5E6UA 4TZ0A 4O2BA 3RANA 3PHIA 2JLYA 4HSEA 2R4QA 3AP2A 3AF0A 4KQ2A 4MPJA 4WKBA 3R75A 4MUAA 1NLYA 1VLJA 4MV1A 2EX1A 2I03A 3U3KA 2WTAA 4TOIA 3ZI4A 3KCNA 1EBUA 2ID8A 1EHYA 3OQHA 1Z5VA 1LVGA 2X77A 3A4TA 5GAJA 1QVAA 5JATA 3L9WA 1YAJA 3G2KA 2XMPA 1RPTA 3JPWA 4X71A 1X38A 3DFKA 3AUUA 3JY6A 2B6HA 3ONDA 1CVRA 1IN5A 1Z7GA 5HCNA 5B3JA 3AUKA 4DJFC 3QX9A 1EJBA 2NTYC 2YV4A 5TE9A 3TLGB 2R2GA 3PD0A 721PA 1CY2A 2B2CA 2BGUA 2EFCB 2WJ6A 4PLPA 1ZZEA 1O0BA 2CLDX 2VP4A 3GGPA 4OHVA 3IE0A 4XJXA 3ER9A 1KQFA 1M7GA 4RBNA 5JSYA 5EHGA 4KGVA 4BLUA 2OE2A 3MUEA 2XI4A 3ODGA 1PHRA 1N2OA 2QTHA 1BGXT 1N75A 2OYRA 2F00A 4I1UA 4N8EA 2JLAA 3WIDA 5CBPA 4Q16A 2XKKA 5ADVA 3QU5A 2QZSA 3ZKWB 1G7CA 3FBGA 2BE9A 1ISHA 1YRBA 2JKVA 3FLMA 2WM9B 4IDNA 1DIBA 1N6RA 1FFEA 3GZNB 1NLMA 1WLYA 2FPOA 4M8SA 2W4IA 5EAIA 5EP4A 3TMYA 3W7BA 4ZJYA 3AUFA 3I04M 4O4HB 1APBA 2WJJA 2VT7A 2O50A 4HRYA 1QYVA 1RE0A 3HDYA 4AZ3A 3DOIA 2PUDA 1G8HA 3BFJA 3WL5A 5CDFA 3QVOA 2B5OA 1I7LA 1ZK4A 1F2VA 1NI3A 3AY3A 3DC2A 4PYNA 2R44A 3H42B 3ICVA 4GWGA 5C1IA 4LW8A 3SWWA 3TNLA 3WFJA 1KJZA 4BFSA 1TK9A 3KOOA 4KQGA 4MWGA 4DPLA 2Q4OA 3IIIA 3E3NA 1JNYA 4WZAE 4PCAA 1V43A 1DJNA 5FI5A 1WHTB 4M54A 3VR5D 2I6TA 1FU7A 3VZDA 4EUEA 1X2EA 2KLBA 2QF7A 2AG6A 4KK4A 5ADHA 4HEJA 1MAHA 2E21A 2HJSA 2RBEA 2LUOA 5CH5A 4HNVA 4DUYB 4ZHQF 1E8DA 2YC2C 3SOZA 1UK8A 4YV1A 2XNCA 4TUYF 4EFDA 2Y1EA 4ZCQA 2VQDA 1Z6XA 3NHSA 4B6PA 5B1EA 1CS4C 3HZRA 3P2KA 3ZV5A 1GDTA 5J5VA 1OJ7A 2RGNA 2X9QA 3JD4A 4DL9A 3PT9A 4GRDA 3A1UA 1H66A 1O58A 4ZYVA 2Y4NA 3N8KA 1ODCA 3U40A 3W2IA 1OBCA 5E3HA 1KA9H 4D79A 3H19A 3OY2A 3WGNA 1CIVA 1LLFA 2D2XA 4KQ1A 1VA4A 2QTWB 4H7EA 2B4KA 2C2XA 2CVQA 2EQ5A 1VP9A 4QTXA 5CM8B 2QT1A 5FTWA 1NIPA 5HG0A 4FHDA 1XO1A 3HKEA 1W0KA 3R5KA 4KNYA 2L82A 4PAMA 2JGRA 3H7IA 3UANA 3A6PC 4H18A 2OK8A 1CSEE 1JQKA 2AOWA 2VNKA 3NJRA 2MOKA 1GN9A 2QJRA 2XVZA 4FFPA 2WJGA 2V5VA 2YY6A 1KEEB 2AEEA 1X7XB 2DY0A 4O2RA 1B1CA 4NCAA 1ACLA 4QSHA 3ZV6A 1JB1A 1OUMA 1I3MA 3P0HA 3U4HA 2PRSA 4BO2A 1WXGA 1HOTA 2WKQA 1KFBB 4JR0A 3SBOA 1BXZA 2FW9A 2V4UA 3ENWA 5IZCA 4CPDA 2Y71A 3T1TA 1Y7IA 1JHZA 1I4EB 3B1KA 3B3AA 3TE6A 5ADUS 1MN6A 1TT5B 3AQIA 1KZ6A 1CS0B 1YQTA 2K2QB 3AR3A 1T91A 1GY8A 4UEJA 5JO9A 4J3JA 1E4EB 4YUVA 3NKVA 4YRDA 1BROA 1WCIB 3SYTA 4DLZA 3ORSA 1ICIA 1Z6TA 1A98A 1T8YA 1VQ1A 3SHWA 3U4MA 1YE5A 4DCMA 3WLNA 4MP3A 4Y0VA 3STYA 4BMSA 2XPCA 1XN4A 5DI9A 2A9FA 2PV0A 2DPYA 2X1MA 2IJGX 4FYKA 4DLNA 4OLBA 2XNKA 1E2LA 4CETA 1JZTA 4OHBA 5F2KA 2QBYA 4TM8A 3DC7A 2VPPA 5BOSB 2TMKA 3VYWA 1UKYA 2BFFA 3C3YA 3JWHA 1H5NA 1M74A 4IGKA 2OZLA 4L8YA 3SZLA 2DHCA 2I66A 1A50B 3TCKA 1YMQA 3KQNA 1NLUA 1VSQA 1F2UA 1I6LA 3CE6A 3UJBA 4RVDA 5I7AA 2GEVA 4UMFA 2HHHB 1J8VA 4A6DA 2ZVQX 1Z82A 2ZREA 5FUBA 5JBNA 2J5QA 3U7GA 3FPJA 4OOFA 2R4TA 4I4TB 2PX3A 1I0IA 1P9LA 3EGVA 4NY1A 3ZDYB 4BCCA 2VJPA 3U4IA 2ZWAA 1KY3A 3TIIA 3PJEA 2PRJA 5IAEA 4A4DA 1A8PA 1CUBA 1UFOA 2D7JA 4QYIB 3UO8B 3V5NA 3U61B 1RNLA 1F38A 4XOUA 3WV4A 1QE3A 3IB6A 3TLKA 2GJ9A 2QW0X 3KHTA 3KT6A 3AIMA 1O08A 1MHPA 1QDLB 1ZBQA 2X22A 4AG5A 4G0NA 3HWRA 1KH2A 3I01A 1SCUA 2XW6A 4BX3A 5F2OA 1FNNA 2QVYX 3Q7RA 4P2GA 2Q6TA 2X5OA 4OGKA 1PW7A 2A8YA 3RRBA 2GNAA 5T4BA 5KWIA 1SXIA 2RHDA 4L9SA 5EJIA 2VXCA 1UIMA 2GFIA 3HA3A 4OMDA 5TS2A 3C14C 2Z6VA 4B79A 3CKMA 3WLRA 1NBAA 3FF1A 5D3KA 3U3MA 4L51A 3ROKA 1MAUA 2AG0A 5IFKA 3K70D 4LXUA 4MUBA 2XRYA 1PS8A 2VR1A 5EZYA 4N82A 3BKXA 1OYOA 1P81A 1JECA 4A0HA 5C5CA 1WXFA 3ICWA 2CCJA 4MVJF 3HCPA 3I2JA 1SC9A 5IMBA 4HL6A 5U9CA 4U2CA 5CYGA 1MC5A 2VPZA 3FWNA 3PT5A 1RYHA 2XGJA 3LAWA 2H11A 4S05A 3OSUA 3KFXA 3OZRA 2GN9A 4LCEA 1OZFA 3L6UA 3PC2A 1A76A 1EE1A 1QKIA 5AW5A 4HT3B 3K0BA 3L04A 3QU7A 3TBFA 3SR3A 3PX7A 4KV7A 1RPZA 5HMMA 4MCIA 1JR3E 3NYRA 3AP1A 2I7DA 2P2NA 1AF4A 1JQEA 1XTKA 1KK1A 3E5MA 1W8IA 1QTNA 3KQQA 4PHGA 5DP2A 4P6VF 3ZDBA 1XHFA 2K6GA 5G40A 2EFDB 3UBMA 1M67A 4HUTA 3SHOA 2R7NA 1XRPA 1JSZA 2UUOA 3UMVA 5J4YA 1DPGA 1JAHA 1Q0SA 2PBRA 3EVFA 1KRWA 3AGPA 4BTEA 1ZKDA 1V1RB 4UPDA 5HBRA 4JB8A 4Q3EA 2GK6A 5KTRA 4G1FA 3UHAA 4IGEA 4BQSA 1X13A 3BS4A 1MH1A 4AY6A 2NG1A 3H9UA 4QLAA 1KDZA 3T0GA 2V7VA 7REQA 2BGIA 1GUFA 1MTZA 1Y89A 2ZYTX 3SVZA 2JGEA 1RYYA 3AZOA 2YNMA 3BBPA 2GZAA 2IZ1A 4FOTA 1K66A 5DTJA 5TQ0A 2AXPA 5CP8A 3WQHA 1WQ1R 1VG0B 3WL8A 4PN7A 1UMKA 1O95A 2W6NA 1FSZA 3TZQA 1L5GB 5KNDH 3LUCA 2E4VA 1QXSA 4FMDF 4TVOA 1TQHA 1PZXA 3E2PA 5HZMA 2DR2A 1XF1A 4C5CA 4D56A 3D64A 1ZM2A 3F5SA 5BOVA 5JSHA 4BNWA 3A4NA 3DKVA 4ESEA 1HNWB 1NBIA 2Q07A 4Q48A 4KLZA 3ENNA 2VH5R 3Q3IA 5DK6A 5FO0A 1BXKA 4LY0A 1YS7A 5HJ2A 1DKNA 1IPFA 4MW2A 2AL7A 4JZYA 5FFNA 3U3DA 3UW3A 5C5IA 2JJ1A 1A5ZA 4S0XA 3SM9A 3G49A 1KRXA 3IDSA 2ZJ8A 1QYXA 1PGOA 3P2IA 2I67A 3EDMA 1M2VA 1NR5A 1TJ5A 4QU5A 2O8EB 4WEQA 1XKLA 1Z5GA 1VKJA 4JC8A 1KJJA 4PPGA 5DYIA 2UZAA 2FEAA 5KKNB 4OX9B 1FL9A 1LU9A 5KNBH 1U3WA 4F93B 4IIGA 2CXRA 4ZANA 1PI3A 4TSFD 4JHLA 2BFWA 4MJXA 5EE1A 3VKVA 4YGYA 4UOQA 4G25A 3Q87B 4C4ZA 1U7ZA 2CXOA 3U3JA 5GMOA 1ODLA 2CVOA 3IDOA 2ECFA 2FG5A 5CLQA 5DSXA 5C8YA 5EHZA 4V1CB 1K6XA 3OOEA 4DLRA 1HFKA 2AW5A 1AQLA 1FZQA 2ZUTA 3EPJA 7MHTA 4QNMA 2C5SA 4P5EA 4L02A 4XQCA 2G40A 1G5IA 4GBGA 3KLBA 4EEXA 5IM4F 4DUZB 4RJKA 1WXQA 2X5NA 4Y1EA 3A6DA 2ZJ3A 1J39A 4MDEA 3T9FA 1YOVB 3IAAA 4GWKA 4ADSG 1L7QA 4GECA 4GOKA 5I7OA 3I9LA 4URZR 1EK2A 4U5XA 3C6XA 3L84A 3NM5A 3K1ZA 1IC6A 3E3MA 4EEZA 1XZFA 5HSGA 3OZAA 3EDCA 5KTOA 3K7EA 2VHZA 1EUYA 3IHKA 3C3AA 5ABPA 1WWKA 3OP1A 2HMTA 4DLAA 2LPMA 4MKFA 4DSUA 1XROA 2A88A 1G19A 3V46A 3VO2A 3KOWA 3ZE0B 1TZKA 3P0IA 2GWRA 3LQYA 4FOSA 2ZM6B 4J0IA 2WJIA 3A05A 3RASA 3V1UA 5PNTA 1N2ZA 1SCJA 2NADA 5AFSA 2LIPA 3PTZA 2QU8A 1Y8RA 3CRRA 3HE3A 1ZIOA 4X3CA 1SVUA 1RWNA 4U8GA 1F9EA 1P77A 1X1RA 2J3IA 2JW5A 3LLUA 1TDJA 5JI3E 2HJGA 1YIDA 5EY5B 1BU8A 1N5RA 2HWKA 2FEWB 1PN3A 3B9QA 3MTGA 1FLVA 4M86A 4JQYA 5ERXA 3QNWA 1TVCA 4Z6KA 5EUBA 2ZTSA 3VMFA 4L5JA 3ZHTA 1ORVA 1Z0SA 3LKDA 4ALIA 3SX4A 1EK0A 4MLPA 5AW1A 3L41A 5P21A 1JUDA 2G5CA 2VDPB 4W9MC 1Z6YA 4RGQA 3GRAA 3HU3A 2OAGA 2H5IA 3CZMA 2N9UA 5KNDD 5JC8A 4R2MA 4MS3B 2G0AA 2O2GA 3IKLA 3QLEA 3N8DA 5F1KA 4ZT2A 5F4BA 1S1MA 2HFKA 4FNAA 3ZHZA 1GQ2A 3PFBA 4AT1A 3JATB 1V8PA 1AKWA 5ADWA 3RLIA 3VV3A 1PFUA 2XMCA 5C80A 4DIDA 4G5SA 3GAMA 4OI0A 4Q01A 4EY3A 1E61A 4L7VA 1W5EA 4OHOA 5JXGA 4KDFA 1P6QA 1I2AA 2H0QA 4YWHA 4C0BA 3HCFA 2AOVA 4DILA 2J08A 4E2FA 1EDOA 3ZU5A 3OTWA 2FFRA 1LPNA 10MHA 1IHYA 2HRDA 4MPDA 2H2AA 3N59A 1F6DA 2WUEA 5AKGA 5DNEA 2HJ9A 3HKBB 3QVWA 4Q00A 5TGTA 3M5WA 3VO9A 2ID4A 3GEIA 4F3KA 3QKIA 4TQ9A 5TQJA 5HQTA 1K5DA 4NATA 2Q0QA 1COWA 1E4VA 1JKMA 4YAEA 4CL2A 4C4XA 2B98A 1HV8A 4P8RA 3DXYA 2WG0A 3KV1A 2DLNA 4YAUA 4LHSA 2Z8YA 2QLNA 2HY7A 5BPHA 1M72A 5K0LA 1D3AA 5AXCA 5KCZA 3E5RA 1NQOA 2N46A 2W2QA 3ESZA 5JEEA 4X1OA 5DXAA 1TZMA 2EX4A 1DKRA 2VH1A 5KIAA 1EGHA 1XK7A 1TAUA 3NAZA 6YASA 2VZ0A 1YSCA 2J30A 2P41A 1UDWA 2QL7A 4G07A 3VDMA 2RKBA 3B3JA 3L2OB 5DBOA 3U2QA 5ALVA 2AC2A 4FUQA 3ROTA 2A58A 1GPDG 3DEFA 3T3EA 4AWAA 1S6YA 3ECSA 1DBIA 5GZ3A 4MZDA 4INPA 3K09A 4ZO9A 4NNPA 4II3A 4WESB 4ZO4A 4EUFA 1NPDA 3RIEA 4CKBA 4O4IF 4MV3A 5K0JA 2V98A 5H1YA 3V2GA 1YVEI 1CFJA 3D3NA 4DM3A 5C51B 4IX9A 4MUYA 3KKPA 5GONF 2UVQA 5DYYA 3FTNA 1Q12A 2XQGA 1JL3A 1M2KA 4BNJA 3MBOA 1BYIA 1PJ3A 1P5JA 1KO4A 1Q3HA 2NTNA 3D3KA 3AKYA 3DQZA 3HQ4O 1O4VA 3KYDB 5CNIA 3CTPA 4Q7LA 3UMMA 1RWVA 1T5SA 4DR4B 3FXAA 3HJNA 3N53A 3H05A 4HN2A 4P08A 2WMYA 2MSKA 5HOQA 4W5RA 1HDIA 5HF8A 1X1QA 1QS0A 1W8DA 2E49A 3RS7A 6ABPA 1J56A 2OY0A 3ISJA 1GPKA 5A6SB 2W4QA 4G5GA 2AD1A 4JV5B 1CP2A 3NAMA 4Q1FA 4UXIA 4F45A 4XASA 1RC8A 4N54A 4XQEA 5K8VA 2BFOA 4FOLA 1JMKC 4E15A 5IFLA 1R27A 1NW4A 5DPMA 3L8HA 1XX6A 2FMXA 3PC7A 3W4KA 4BAZA 4YAKA 4COKA 1KL7A 1P0MA 5IULC 2P4EA 1Z56C 2EBHX 2V0NA 3V42A 2OPBA 1Q0ZA 3R40A 2AR9A 1FTSA 3W9UA 3ND8A 1G55A 2RDMA 4LOKA 4HXFB 5J43A 3LP6A 1G2PA 3M2PA 3NVDA 1E9EA 2ECKA 3PDCA 5DCLA 3SXUB 2NACA 1V35A 1RWPA 4EFMA 3PHJA 5KPDA 2ZJBA 5KYXA 1T9BA 1JQ3A 1WPQA 4C06A 1SO8A 3WNDA 1QFYA 2PX0A 2ADMA 5K8TA 1E6UA 1Y3AA 4W1QA 4EGAA 1VSVA 1YZVA 3NBXX 2I29A 2W48A 4RVNA 4C4AA 3NTXA 5IT0A 3W5IA 4JSRA 3LWDA 4NFSA 2ZRIA 5AHXA 4BBJA 3IUYA 5CLGA 1LXCA 2F62A 3LT4A 1ZIPA 2IHUA 4O4JB 4MQEA 1E5LA 4P7GA 1NUHA 2XIJA 2PXAA 3PQCA 3MK31 1T2UA 4WZAB 4RDHA 4IVNA 3BL5A 1U5BB 5M34A 4UUAA 4CUJA 2O1WA 3G89A 3HJGA 4QODA 4ENTA 4D3FA 5J2TA 4DCCA 5JBIA 1R8QA 2XCUA 3OM0A 1ORWA 4AULA 1VJ0A 3U39A 3CB2A 4KUGA 3IESA 4UM8B 1WV0A 4R81A 3K3PA 4DVGA 3B38A 4TS3A 1NQTA 5JEDA 3K0SA 1B43A 1UPAA 1D6SA 1NZDA 2BF4A 3MC1A 3IUBA 3RWBA 1HLDA 4FILA 3SDZA 4Q4CA 4MV6A 3EXIA 1ESDA 1VE5A 2DBRA 1OTXA 2XHZA 3FJOA 3O8OB 4KL8S 1OAOC 5AI4A 5A62A 1EWVA 1Y1PA 4EI7A 2HR1A 1CDEA 3F71A 5CFRA 3PUIA 3JQGA 1JLLA 2RC5A 1DC8A 2CXUA 5AKYA 3MB8A 4KPYA 2W6ID 1M5TA 1M1NB 3GLUA 5F77A 4TMXA 2Z09A 5MN5A 2YYYA 2ZYVX 2VHCA 4QTTB 5EXSA 4N3NA 1QKJA 1XEXB 3HA7A 1HT3A 1AK9A 5DHAA 1SQ6A 3ZGLA 3OQIA 4TPKA 2ZRCA 3VDNB 1QHFA 3EWSA 4IHJA 1CIPA 4Z4FA 4XWGA 1NXXA 1XFAA 3OX1A 3E7DA 2HMWA 3J7TA 2OMKA 1Q11A 4PBTA 3VR5A 3TSOA 3WLTA 4U00A 5HFJA 2ZR8A 1NI4A 4Z54A 1GTVA 4Q34A 2ZQYA 1QK5A 1XCLA 2YN4A 3PX2A 2W22A 4BJ3A 2IPLA 1T1IA 1Q1EA 2WYHA 2A84A 3VYRB 1DJQA 1H8ED 1KARA 3QHPA 4OYLA 3R5TA 4BL5A 2ZGVA 2H6EA 1KY5A 1SUWA 2TYSB 3KSUA 1EWKA 4JT4A 5TLSA 2FW6A 3W9YA 4IF4A 1H2XA 1IHXA 1IWOA 1SGWA 2H31A 1G9SA 2IOQA 2YHUA 2I99A 4EAAA 2DKOA 5FBZA 5J2UA 2NX2A 4NJMA 3F6CA 2K5UA 1IG3A 1ORIA 4PIPA 4X3OA 3UJ7A 3KSZO 4MW4A 3BVPA 5B55A 3ZV3A 3R9XB 4OH7A 3K73O 1YCHA 3EWNA 2C5BA 3GFTA 4BP1A 3DVAA 1V95A 2EARA 5I7SA 2IUSA 2XUOA 2Q3EA 4MR9B 4UVHA 4A1FA 1ULHA 5LQMA 6GPBA 2PNFA 1TIBA 4DDWA 1BRMA 5BMVF 3U7HB 4MQMA 3TOZA 1JBEA 2VJMB 2FA9A 3CGWA 1V5IA 3V1KA 4V0RA 5EIWA 3NWOA 2A14A 3S27A 4CLXA 4R1PA 2IVZA 4HLCA 5CIWA 3SHVA 1L5WA 4B33A 2B3TA 1UJMA 1RP7A 3L82B 1UXGA 4TV8B 1KZHA 5KYTA 4R1QA 3GRPA 2JLVA 3TB6A 1UJNA 2A9PA 2JFPA 2G6BA 2MSCB 3EQ6A 3U26A 2GZRA 1T1GA 3EZGA 3GD5A 3P0EA 2B1QA 4OGLA 3TEJA 4FGKA 1YCDA 4LF4B 1YJ5A 2I7TA 4HATA 1QIJA 1NKSA 3AO0B 1X74A 5MN6A 1EFVA 3BC1A 5CK5A 4YWJA 4XYLA 3F3YA 4US0R 4CE6A 3IQWA 2YMLA 4DM4A 4B2IA 3H6GA 4PC6A 2JH9A 5CHEA 4EYGA 5FWYA 1HNXB 1Q0QA 2UZ3A 4MGZR 4HQFA 3PFFA 4IIHA 5H8WA 4IBOA 2XUAA 1N33B 2LBPA 4Z4EA 2D13A 5KX5F 1RJDA 4NEGA 2WIAA 3N6VA 5T3YA 4NK4A 5ECWA 2HWWA 1U3UA 1Q0HA 4LNAA 5LM3A 1LF5A 3HKCA 4D3YA 1MEOA 1Z6ZA 1JJFA 2DTDA 5EHQA 3QVMA 1W4CA 2YWXA 3MCAA 1PS0A 4V02A 3RFUA 2A1UB 3CLKA 3IDAA 3P32A 4FOPA 5EKUA 4ARVA 1VCIA 2V5UA 3K0CC 1GT6A 1ZGGA 1F8YA 4HOYA 4DUPA 4EHKA 4BDSA 1E3QA 4HNAA 1LBQA 2XJ9A 3ZWNA 3FIUA 3B70A 4UTRA 1CEYA 4AJJA 2Y67A 8ADHA 1OFGA 5CM9C 2HBYA 5JS6A 1AGPA 1FFBA 1II8B 2YOFA 1IUNA 1LV8A 1TLLA 4K05A 1QLJA 4JKOA 5K0NA 4PWZA 2LWIA 1P5RA 3P94A 1W25A 1GQYA 2JRLA 1Y82A 4HXYA 3NHLA 5E3JA 1B8UA 2QN8A 3EUFA 4G5QA 4HLNA 5KJEA 1PL0A 5T6MA 3UT5A 2XECA 5L7TA 1QUEA 3NBAA 1GOTA 2NAPA 3CUSA 1P2UA 3K0EA 4R8SA 4YP1A 5JNSA 1UMCB 4WOJA 4I99A 4X60A 5JNUA 1P60A 2OCXA 1MTOA 2Q1XA 4ZOAA 2AYZA 3KNZA 4ZICA 1P1RA 2VXBA 3F73A 4MW7A 2B20A 1CEXA 1A95A 1ELOA 2EFJA 2PYDA 3LHDA 4TM7A 1WUJS 4B3FX 1IXRC 2FPIA 2NZWA 2I3ZA 3DG9A 2XMSA 1CUJA 1RXUA 1L5ZA 1Z5WA 4Z7OB 4Y7DA 2C9MA 1CW2B 3KEFA 3KUUA 3OTHA 3UOGA 3ZU6A 4LX8A 2ZSKA 5JQGF 4QO7A 1F8XA 4LF5B 4KKXB 4YAFA 3WRYA 5LYJF 2ZSUA 2PBFA 4CMBA 1MNQA 1DAHA 3BZUA 4EJFA 1HQKA 1AUOA 1J7KA 1U28A 1J0BA 1V6CA 2YVKA 3GMDA 4LDNA 2Q6VA 2XR1A 3RGGA 3I6MA 2QTVB 1MT3A 3SVLA 3HKDB 2A3RA 3P0FA 2CUKA 4ER7A 4NQRA 1H4TA 3A26A 3W1EA 3OQMA 2VK1A 1DRUA 2SCUB 4UAUA 5D6OA 3GVHA 2ETXA 1PT7A 5DM0A 4UFOA 4AP9A 1XMQB 2H1SA 5IJWA 3IT2A 3LGXA 5LUBA 5ARCA 4DMCA 1CUUA 2QRQA 3G7UA 4F4FA 4HQNA 1ZUIA 2HNAA 3N86A 1I6WA 4KVAA 1RAGA 1R9MA 1SBYA 2EYQA 2R8YA 2YZ2A 2I3BA 1HZZA 2OZEA 4M0CA 1KSHA 4OHUA 3PVSA 1KI3A 1GPMA 1HZJA 1K6MA 1PG5A 2JCSA 3GZJA 2CEAA 3PD7A 1NBMD 4PS0A 3KXLA 3PGJA 4XFJA 1UQTA 2X42A 3KZNA 4ZCTA 1A9QA 2PANA 2XNDD 4X62B 4U7PB 1X9GA 2O2JA 3DLHA 1FS6A 3ZW9A 1FCJA 4R54A 2X9VA 4CKCA 5FJIA 3WR5A 1Y4UA 4DLUA 4HUQA 2I2AA 3B1XA 1WW8A 3NHYA 3IR7A 4LOJA 4MHOA 4YA6A 4Y30A 2MU1A 4G63A 4KRGA 4XDGA 1C7QA 2VDLB 1JJIA 3CZQA 4M1TA 4XM1A 4BU0A 5JTTA 1WUKS 3G9UA 1FQOA 3EX7C 3OKFA 1B3BA 3KPWA 3MGCA 3C4QA 4FJ2A 5CR9A 3J81A 1BKYA 1V3UA 3D8BA 1FX1A 1MQSA 2AOXA 2P90A 4PPNA 5JS7A 3GLIA 4AFNA 1GAQA 1DTWB 1MOZA 1NP6A 2YV2A 3A0RB 5BSVA 1VCHA 3T9AA 4XYMA 5LC1A 1SWWA 2FP4B 2VWPA 2ZCJA 4Z8XA 1HDCA 4GZLA 1A8IA 3RBZA 3X0DA 5DN6D 4L8WB 1RXVA 3P0JA 1TGVA 2C4KA 2IZOA 2Y1WA 4DV6B 1RQNA 3ORFA 5AP9A 1N2IA 2GVNA 4NOJA 5KQPA 4CL8A 1RYEA 3KVVA 3NH6A 4U2GA 5CUQA 5JFOA 4I8XA 4GW3A 5FBRB 3T6KA 1XPRA 2DBYA 1HKHA 1O94D 3KM0A 4V03A 3ETNA 1L7DA 1J06A 5CTJA 5I51A 5JPDA 3E48A 3QLTA 3QPVA 5B2ZA 4ARAA 3ZXXA 3OOJA 2OCIA 3IIEA 2F8TA 2GWHA 4TSFA 2QW8A 5HDQA 2O8CA 2R65A 4BUJA 1GN8A 4ZREA 1U6KA 3C7AA 3W3AH 3MFQA 3QBTA 1NVFA 4KDRA 1QVWA 2QLBA 3E3AA 1JS1X 2R1VB 3HY4A 3UAWA 5GPBA 1KYQA 3UENA 2V6IA 4BYMA 3FVTA 1QC5B 2A5FA 4ZDKA 4RJ2A 3TR0A 1JLMA 3P9ZA 4FFDA 1FBNA 1LVUA 3TBHA 3SYMA 3QLUC 1CHNA 1JDZA 4QVIA 3AVPA 1T43A 2E48A 4OJKA 4ZOBA 2DUJA 2ZJOA 4IFEA 4D8VA 2Q2NA 3O75A 3ZCSA 3DDOA 1GGFA 5AESA 5CB4A 4D80A 4RKFA 2O07A 1NGSA 2FSHA 3BJZA 3IP9A 3V8QA 1FFWA 3FYUC 4YCJA 3NHAA 2VP5A 3MLAA 2IYQA 2C7PA 3FB1A 3GH1A 3T7TA 4HZGA 3WWDA 1RW4A 3D6NB 2GHRA 1T3GA 4JBXA 3AV3A 2ZWVA 5EYPA 5IBQA 4F7WA 2HMSA 1NJ8A 4Q7KA 2X0IA 4OPMA 1UBTS 5AXBA 3NX4A 1ABBA 3PL1A 3C6MA 4BZPA 1B00A 3T1HB 6CHYA 3BMQA 5JWHA 2DYKA 1GP2A 1K3TA 4B83A 5KOHB 3E8MA 1AG9A 4FHZA 1M0SA 2ZVDA 1KYXA 1U8AA 2CNNA 2ORVA 3AESB 4JFAA 2VYQA 5FNVB 4DSTA 4DJJA 4FJ0A 1IY9A 1H9AA 2OBBA 3W8EA 5EWMB 2GBCA 4BO5A 2EZ4A 2IXTA 4QGAA 4FPXA 2IL1A 3EBLA 2ZI6A 5BP7A 3NO4A 3TRDA 1XLUA 2IEDA 3FBTA 1DXQA 1QDUA 5D1HA 4FFLA 1G1MA 2BELA 3BJIC 3KWJA 5ECYA 3OPXA 1TX4B 2CSUA 3D1VA 2O20A 3AETA 4OL9A 5K6AC 1UCFA 1XXHE 5KNDA 1C5KA 2B1GA 2VUSA 2GD1O 1QHXA 3MMNA 1DBSA 5ANRB 5C53B 2R8PA 4QVGA 4DHWA 4QULA 4Z51A 2EC5A 2ILTA 4YJHA 4DVJA 4U7HA 4PYRA 2X41A 1GKIA 2C3YA 3FRHA 4P0TA 4X8MA 5DH9A 3EQ2A 4N8DA 1L5NA 3M82A 3D4PA 4EHJA 3U16A 5EJAA 3EFBA 5CEJA 2HCJB 3HA2A 4BEBA 4B4UA 1XD9A 1XUOA 5L53A 2GF2A 4MB0A 1OAOA 1T1EA 3NHPA 3Q98A 1FDVA 1L7RA 2OOKA 3IAEA 3X44A 4RE6A 2W2KA 4FFBA 4BECA 2HQSA 1GDDA 1GPUA 1HQYE 5H5JA 4HDNB 3DKRA 2JNWA 2P77A 2UZ1A 1RSZA 1RHKA 3CLVA 3KCQA 5EHXA 4NESA 1WXXA 2V3WA 3Q85A 4P34A 1CUDA 1KPIA 2WKPA 5LOVA 5C32A 2DTXA 5CDYA 4QL3A 1LY1A 2QVGA 1BGVA 4ZO6A 3QMWA 3ZNNA 1TO2E 2ONZA 4K86A 4CQMD 2WJVA 5K8JB 2EGHA 1NW3A 4IICA 4QICA 1NZFA 1UZLA 3ESBA 3IVMA 3PXAA 4M98A 3VPXA 2WFAA 1ZNQO 3FDXA 4M21A 3S2UA 4MQ4A 4OLJA 1MD9A 4MR7B 3RUCA 3FN4A 1FXWF 2H7YA 3ZLTA 4FINA 2V8OA 5LBTA 2HT6A 1T2NA 2AW3A 4B5KA 2H3EA 2NUAB 3GJ4A 4N7BA 5K8UA 1VP3A 1P3Y1 2P69A 1O94C 3JD1A 1RKVA 1WXWA 2VSFA 3RSFA 3AOGA 2LDXA 1QPGA 4DT1B 2G17A 2KBFA 5IDQA 1QIDA 4HFRA 2GJAA 2JS7A 5CDFE 3R09A 5AICA 3VYTB 1UT6A 5A05A 1T6BY 5HKAA 3KQPA 1YBVA 2K7FA 1EB9A 1OBHA 2QUZA 4B31A 5JASA 1PVOA 4OQXA 3UUGA 4DDVA 3GJ8A 4EYQA 4EJ2A 1BKDR 2PX2A 4LE1A 4Q4DA 2FSPA 5CAEA 4DA6A 2CF5A 3WDMA 2OBLA 3QPDA 1ND6A 3ZU4A 3VPAA 4DV1B 3OHPA 4BJ5A 1EVZA 5MDHA 3SMVA 1A4XA 1YQUA 1TQDA 4MCJA 4DA8A 2QRKA 2NXCA 1S8OA 1IULA 4UUQA 2E89A 2HQOA 4A6EA 821PA 3MCUA 4TL9A 4K2HA 4N41A 1PJSA 2ZRLA 3LRXA 1R4MA 4N49A 5HILA 1G5HA 1YC5A 4JJ6A 4YUYA 2BMFA 2OCAA 4EA6A 2DH5A 1KZGB 1NOJA 4KIFA 4EYOA 3E5NA 3K0HA 4EKGA 3QG1A 4TZKA 4CL0A 1N9KA 1QRDA 5EE9A 4L4XA 2XKJE 1E5QA 1IDOA 1XKTA 2UZ4A 2AJ8A 4RFSA 4RL4A 3O47A 1W93A 5L7WA 4UEOA 4A0FA 5ELLA 4UULA 1EGVB 3R1IA 4B43A 4BNDA 2NUBA 5L3RA 4P7FA 1T5OA 3INNA 1WL8A 1KEZA 4K0KB 3WKCA 1WG8A 1Z5NA 2BTQA 4UHKA 1KERA 4IDFA 3EWAA 4PXAA 4DBZA 1PFVA 3HO6A 4DM7A 5C18A 2GN0A 5AVKA 3D7SA 2QXUA 4QHSA 4RORA 1WB5A 3WHLA 5F2NA 2VIIA 5JWRA 1QIKA 2GBLA 5HVNA 2ZT7A 5HIKA 1SKAA 4C6TB 4E7OA 4KFUA 2QPOA 2NU9B 3EE6A 1PJRA 1U8UA 4CM6A 3HEAA 5CIQA 2AUTA 1U3VA 4N9QA 1HSOA 2EG5A 1BMDA 2HA5A 4OJQA 1ORDA 3CUYA 1ES9A 1NMEA 1VMDA 2DWQA 1IDN1 4QKQA 1WVGA 2R1ZA 1E2GA 5C1DA 4FGZA 5ALUA 1OE0A 5TMBA 1W34A 4IUCS 1P5ZB 3ESXA 3WRWA 2X8LA 4ZZ1A 5LKRA 4IEFB 5EMJA 4EPTA 4EY8A 3GJTA 1OKKD 5EVCA 2R84A 4B6FA 5LL6P 3QM1A 1UBCA 4F04A 2KPOA 4RZXA 5E4TA 4UTVA 3H1BA 4LOAA 4HDAA 2ZJFA 1U6IA 4QA9A 3C3DA 3IMEA 1XTUA 2BDEA 1R4NA 3PNKA 4L4RA 1S7GA 5FOSA 4JU8A 2IW1A 1TF7A 2W6IA 4O1HA 3Q3GE 2QORA 3A3KA 3HDVA 2YKGA 3VOBA 4B46A 1OB2A 3PXBA 1GR1A 4N5MA 2BD0A 1VBKA 3JVEA 3ZVMA 3PKJA 4UBOA 2XNSA 2VVTA 2ZIZA 3O1HB 1EVLA 1W29A 2QRJA 2PO5A 2V6GA 3OFKA 1U3CA 4G1UC 5TVGA 3TX6A 5ENVA 1FW8A 1S2DA 5CEFA 1QVRA 2O7VA 4G56A 3LOQA 1J33A 4ARZB 4KE6A 4AX4A 1KHTA 2CLIB 4JJ7A 3K72B 4Q7JB 2ANCA 4RFLA 3N2NA 4PFKA 2IBMA 3AEZA 1H8EA 1C9NA 1I0LA 1Y3DE 2BEUB 1P7YA 1ZLXA 2HRBA 3GO4A 2BI4A 3GCWA 4H7IA 2ZANA 4YDSA 3HJCA 2V7XA 5MGBA 2JFWA 2IKSA 2ZCVA 3LUPA 3M3PA 3S44A 3EGEA 1XVTA 5A03A 3FRIA 5EUCA 2R0QC 3IEIA 4RMHA 3SJAA 1JFFA 1MF7A 4EHNA 1OZ0A 1ZQ9A 2VK8A 2XE8A 3D6TB 3LPCA 4B9EA 2RHWA 1R9NA 1CFZA 2AIRA 4QBGB 5IM5A 5IYZA 3IBSA 1FBTA 2GEUA 3T8YA 3WO1A 5HX7A 2OXFA 1WMSA 2WWHA 4PX9A 5KS2A 1LH0A 3QXHA 1YA8A 4OYRA 4IXMA 2HI0A 3X1KA 1CDOA 2ZZMA 2QJWA 4UVIA 3QV2A 3F3SA 2PH1A 1NNLA 4U1RA 1TUBA 2BFDA 2IHBA 2P7IA 2WM2A 1D6NA 3IIKA 4PINA 3TOCA 2WJYA 2QENA 3FOCA 4X90A 4KXYA 5AI5A 5ALMA 4JR1A 5L7YA 2J0UB 4JASB 1E0JA 1U0RA 3L7AA 1KYZA 1NRWA 3UMBA 3VU9A 2QHXA 3D6UA 4JOBA 4GOND 1UZNA 4HBZA 4JLJA 1E6MA 1I5EA 4QWWA 4UUOA 4XR9A 2DR3A 4Y6OA 2DEUA 4F11A 5DZSA 3N28A 3PUHA 2VDNB 2QGFA 2FJ0A 5A4KA 2PKQO 2ZSDA 1OIXA 1TYEB 2NV2B 2PTHA 4YJFB 4EMTA 3EEFA 2J5XA 2O2EA 2ID9A 2O8EA 3QU9A 1QANA 1L7VC 5AHRA 1AY0A 1L6RA 1PJCA 2C9YA 4H1HA 2QVXX 3VR1A 2GPSA 3BF7A 4EY7A 1AOXA 2I6UA 1R2QA 3DZKA 3MXOA 4M9ZA 4ETIA 1HM5A 3DL7A 2V4MA 2VQEB 2P9HA 4H15A 4EI9A 4MW9A 2JK0A 2IUFA 3OLZA 3JQFA 3CZ9A 5IJ9B 5ICCA 1AM4D 3OPNA 3UNXA 3GVXA 4FEYA 4KQIA 1H69A 1FVFA 1W4LA 4EG0A 1L6IA 3UXHA 1FYVA 3H5WA 4R69A 3Q8LA 2B5WA 1STOA 4OQFA 4NG4A 1WDKA 5K0ZA 3OZFA 5JOQA 3W2HA 5T67A 1YU6A 4OI1A 1Q0RA 3WRXC 1BXRB 3CHYA 3UJDA 1EMDA 2NU6A 4KVGA 4PZ0A 1R4ZA 4PRKA 4FZ5A 4BIMA 3S99A 1AGNA 3HCBA 5F73A 4CF5A 5KSWB 2ASVA 3Q72A 1RABA 2EF0A 3W6OA 1L4FA 2IY8A 1Z4IA 1S1CA 2HNBA 3IDZA 4F06A 1JLRA 5CLFA 1I80A 1L4NA 2BMAA 4FMDB 3KVRA 2CLFB 3NDIA 2Z1MA 4KLAA 4RIFA 3A58B 3OIVA 4UEKA 2P3QA 3IAM1 4F9GA 4G5OA 2VG8A 4JEMA 3FH0A 1GDHA 4HDQB 1XWFA 2NO6A 1NJ1A 4LOLA 4DDUA 1SXQA 1C30A 2BFEB 4WLEA 4HNTA 3U7FB 1N6PA 4LOIA 2JFNA 4FEEA 2JEYA 3KLOA 4F71A 4MA0A 3WHKA 3DEIA 2ASEA 1GU0A 3C24A 5HCUA 3D5EA 3FYUA 2QDKA 4MITA 3A7DA 3L6RA 2X1HA 5A9SA 1OWMA 1VZ3A 4HQRA 5JRZA 1XD2B 3K1YA 3DE6X 4EW1A 3QNMA 5J4KA 2O48X 2VDUE 3O8CA 2ODBA 3DOJA 3F47A 2PLNA 1J1ZA 2FFBA 5H9WA 3IKVA 4N3CA 4O02B 4PSVA 1X7HA 1HEYA 4B7ZA 2FPPA 3SBEA 3SF8B 1Y9JA 2D74A 4PO8A 3HPRA 4M0EA 3CW8X 4MMYB 2OK7A 4Q1CA 4CIVA 4AJ9A 3JQCA 1SPBS 2OSVA 3SR4A 1ZI6A 1ZD1A 3BWYA 1GRNA 3MTDA 5COQA 5C4IA 5F23A 3Q7SA 3FZYA 4KIJA 1QAOA 4N3BA 2FMTA 3GFFA 3QLJA 4ZCLA 1T35A 1FUUA 3CEHA 2WJHA 3T5CA 1EFTA 1E3WB 2X9GA 3FLBA 2H00A 4TRNA 2JVJA 2W98A 3X1MA 2H18A 3FHTA 2FPLA 1DUSA 4KCGA 1QZTA 2IHTA 5KSPA 1G2QA 3BK7A 3FB4A 3E0XA 4ITRC 2B7LA 4QEZA 5F7ZA 2UVDA 3UJ3X 4FX2A 5JTUA 4YV2A 3G2QA 4CZ2A 1ZD5A 4LECA 1NXPA 1P72A 1NBMA 1Z16A 2ZIXA 3B3FA 1T34A 2Q9BA 1T4DA 2GX6A 2YUIA 5AH0A 3DUFA 3OQPA 5IRCD 5FBLB 3TB4A 5C1PA 2IOFK 2XNDA 3B6JA 3HP4A 4QM7A 2X2FA 1IBSA 1XWIA 5KQLA 3SN6A 3WL7A 5IUJC 3KPUA 3EFHA 2G9VA 4YPFA 4N6GA 1RRFA 3I2HA 3OQ6A 4WNIA 3DE1X 1A5BB 1JI0A 1O1YA 1OZGA 2OV4A 3FZEA 1K8ZB 1THGA 1USKA 2Y77A 3MS4A 4HWRA 4QECA 3KQTA 2WT8A 4N0EA 2WZCA 1SXJC 4QIHA 1X1BA 3EEIA 3G9TA 4AU1A 1LC0A 3OJOA 4AMGA 5E7JA 3RK0A 4QQRA 3KB6A 3LY7A 5I6DA 2HK8A 1FK8A 1DMRA 4QFMA 3MJTA 1LEHA 3CH4B 3IP8A 4GZ6A 4OGWA 3WMRA 1BH2A 3ZHBA 4EI8A 2AXNA 4X0EA 3C3WA 2DPMA 1GYRA 1JWBB 2VTKA 3O31A 4YBZA 2G7MC 5FUVA 3RRMA 4DLWA 3ROXA 5FTLA 3IR6A 2PZJA 3KQUA 1M0EA 3DBLA 5MFPA 1DC4A 3JWGA 5CJJA 1TK3A 1GKYA 2PLRA 4GP9A 3AR7A 5DN6A 1DXHA 4B2YA 3RK4A 2WQ6A 4B34A 1F20A 3SFTA 5IX8A 5BSEA 1P9OA 2AEMA 3U7QA 4GXRA 4I6EA 4ZEXA 1O94A 3HPQA 1H0HA 2BMWA 2O3SA 1CIJA 4FSDA 3ZQJA 4OQZA 1P6XA 3IEUA 3W6PA 2Y1OA 5FPYA 3RSQA 2XEXA 4M6WA 1PR6A 4Q4AA 3RM3A 4Q3BA 1HLGA 1P17A 1A9OA 4C43A 1O5IA 5FO1A 1G64A 4RJIA 3PNLA 1G8JA 3MWGA 2R97A 2PE5A 2LKCA 2UYYA 2I4RA 3KWFA 4A92A 4BN0A 3HFJA 1NF8A 4S24A 3E9QA 3OU6A 4HYTA 4C05A 2ZTHA 4Q3DA 3QWAA 2I0FA 5HQJA 4JIGA 4D3DA 1XXHB 5L3SB 2PUBA 2OCYC 1ZDMA 3CG0A 3KLPX 2AKYA 4N7MA 1CUZA 3S5JA 2YUTA 5AVTA 1UBSB 1HH4A 1T5IA 4E5KA 1YFLA 3AHJA 1FB5A 1GGVA 4LZZA 4OQQA 1PAUA 4ZVQA 3NATA 5BUSA 1MHTA 3NV7A 1ISFA 3REOA 4CHGA 4Q9DA 2GTIA 2VYND 2PS3A 3VX4A 2BDUA 4RA9A 1HYHA 2J6HA 1R18A 5E6UB 3TINA 2DFLA 3WGVA 4UNQA 3AF2A 3M6VA 1MC4A 4O2BB 4G1MB 4G81A 4GSKA 1CZRA 3NBKA 2D1YA 2CLHB 3NTOA 2ZRKA 4FDAA 4ISBA 4ODIA 4UU7A 4W9NC 2W42A 1G21A 2D1TA 1NKTA 2WP0A 1FYEA 1FRFS 3JTEA 1F0PA 1A4RA 2O7RA 4GR5A 3FFTA 3OX4A 3KJZA 3MT7A 3ESQA 3I9MA 3OF2A 3FUTA 2DE0X 2ZJ7A 1UBOS 1SPXA 1W2WB 4IQFA 3RIXA 5T57A 1IN7A 3MIIA 3OIDA 4ZEMA 3L02A 4IVQA 1I3OA 1KAMA 1M66A 4WLVA 1VL5A 3L6BA 1QRUA 3QRWA 4OJTA 4EL0A 2XT6A 2DBZA 3BD6A 1H1TA 3M5CA 3HYNA 3T5PA 1FXUA 1M2EA 2C7OA 1H2YA 3VR0A 1VPEA 2BJHA 5U4XA 3KQHA 4JVSB 1RDFA 4UOZA 2C9CA 2PUVA 4G1EB 1YDFA 1LJLA 2IS2A 3MB5A 5LA6A 2VYCA 3JQ7A 1ZXLA 3DEHA 3SLRA 1E3IA 4GI7A 1F3OA 2ADOA 1G42A 1PV2A 2OQVA 3T7SA 4K9SA 1C8KA 3ZHQA 1UAAA 3U7EB 2B83A 2WF6A 4RTLA 4BQNA 3EAFA 4PTYA 4JJ8A 3R7SA 3QOFA 3S8MA 2DXIA 1ZESA 3RV4A 2X0JA 2YY7A 1DOZA 2CUZA 4EHAA 1DAPA 4AZ3B 2V6BA 5F51A 2BL4A 3IRVA 3LBYA 2NSJA 2EG9A 3RVSA 5IZCC 1IEQA 4RTOA 4EHHA 1U1GA 4D0LB 3NNNA 2HYIC 4HKTA 1YVPA 1KI4A 3STHA 2Y6VA 1C3LA 4L4SA 4LXGA 3TRJA 4E14A 3CJTA 2PVCA 4PRLA 3ZZNA 5FBKA 4QFDA 2J5RA 4PNEA 2QQGA 3E22A 4YY3B 4KSYA 3L49A 4LYJA 2E82A 3UH1A 5TMPA 4JP8A 4RIIA 3I2FA 3OZDA 1IFXA 2WWIA 4R9SA 3TL3A 1Z12A 3QEMA 1Q1GA 4L75A 4RY9A 2HBZA 4D46A 5CDSA 3SKXA 1T2DA 2WWFA 1XQ6A 5ALHA 3VR2D 1A82A 1INLA 2WE7A 2XZDA 3I4LA 4CQMA 3J7AC 2JGAA 1CR0A 1CVIA 2HHLA 5KWJA 2HREA 3NMUF 3DFFA 4XX1A 1FYFA 4BB0A 4CR6A 4Q3KA 5JW6A 4LG1A 3O94A 4QFCA 1PZNA 4PQFA 4DC0A 3AOEA 1H0SA 3RVLA 2WF8A 1VE6A 3KX2A 3CF4G 2IXBA 3ZWAA 3ZDDA 2YFQA 1AJEA 2PVPA 2P27A 4Q15A 2O8NA 3GN2A 1A69A 1NXWA 3GJ7A 2I3DA 1T10A 3F7NA 1PJ2A 3GBPA 5HKLA 4BU1A 3IT3A 2VRNA 5KC9A 1FS5A 8ABPA 2W7TA 3C1OA 1I30A 3GHYA 4W8OA 3TZLA 1TTHA 2PGOA 2C03A 1NUTA 2INGX 3HKEB 4MYRA 1BU5A 1PYGA 2J41A 3G2HA 2IPNA 4K6HA 4B76A 5TPZD 6Q21A 1IZZA 4GPZA 4KOEC 2WVHA 1J09A 4FIZA 2VC2B 1SB9A 5EEHA 5FPKA 2JI7A 3QEKA 3WTBA 4KQMA 2Q8NA 4AXBA 1VPDA 4BLSA 3AVUA 5LLTA 1XK6A 1HUQA 4DIMA 2BEJA 2H5JA 2SKEA 1DQRA 1R8YA 3IA2A 4DNPA 4GX0A 2ISSD 4J1TA 3WG9A 4W4TA 4CI9A 4JXXA 4DLBA 4ZQGA 3NBYC 4EL5A 4E4RA 4DSOA 4ZI2A 4I5EA 1BFKA 1D9ZA 1U7HA 2HU5A 4GQIA 3ENQA 3KS9A 1SUAA 2A4KA 1XDSA 2DZDA 4POAA 1TJPB 1YZNA 4UCFA 3R7LA 3GN1A 1M0WA 1NXTA 1OIWA 3IVGA 4G9GA 4K8OA 1FYDA 2IV3A 1O0CA 4XWTA 4WXPA 3L8YA 1AT1A 2J8ZA 4MKIA 1U8EA 3GA7A 5IKPA 2QJOA 3TIFA 3EGXA 1ZA2A 5AT1A 5J4VA 3B6ZA 5E7QA 2RH5A 4IW3B 3JVVA 3OESA 4IPTA 2R6R1 3R3HA 1GG5A 4QOSA 4R01A 2H9YA 3HLYA 3NDPA 1G8KA 4MUMA 2W70A 5A7FA 5CA0F 4GX2A 3ZCQA 1A9RA 4BMCA 1TXGA 1VJTA 2YCLA 3D59A 3CNNA 3D8SA 2IDMA 3MWDA 4D9CA 1GT91 2QBYB 3DE4X 1OI4A 2BFFB 3WLJA 5CGZA 2OZLB 3LRTA 4LJ4A 2Q0XA 1H6AA 2AD5A 1IK4A 3ME5A 4M9UA 2H7XA 1WKBA 2PA3A 2PJZA 3OG9A 4HHEA 4TS4A 5THQA 5HPYB 3ZX5A 4C78A 1N2CA 2CKMA 2FG7C 1C7EA 5AVWA 3T5MA 1TCVA 2GRUA 4URHA 2F6RA 4XB6B 5BQXA 1M6VA 1QGUA 3LCVB 1I01A 4MZXA 5LZ9A 4OHRA 1UAYA 1VXOA 2CFCA 2Z9BA 3LXMA 3V4SA 1E8NA 1SB8A 5JJ5A 5CVEA 1MAAA 1WCWA 3B20A 3L6DA 3RRXA 1QSGA 4Z4QA 3NJ4A 1GZVA 4NX2A 1L7XA 1IU9A 1AD2A 5JYBA 1VE9A 1K3FA 2XITA 1J5EB 4RD3A 1KSGA 1Z37A 5BR1A 3DMFA 3LP5A 4PZLA 1S8FA 4M1EA