1NONA

Pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
179
structure length
161
Chain Sequence
MQKAVVMDEQAIRRALTRIAHEIIERNKGIDGCVLVGIKTRGIYLARRLAERIEQIEGASVPVGELDITLYRVPFPVTERNVILVDDVLFTGRTVRAAMDAVMDLGRPARIQLAVLVDRGHRELPIRADFVGKNVPTSRSELIVVELSEVDGIDQVSIHEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PyrR bifunctional protein
publication title Structure of the Nucleotide Complex of PyrR, the pyr Attenuation Protein from Bacillus caldolyticus, Suggests Dual Regulation by Pyrimidine and Purine Nucleotides
pubmed doi rcsb
source organism Bacillus caldolyticus
molecule tags Transcription, transferase
total genus 52
structure length 161
sequence length 179
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.9: Uracil phosphoribosyltransferase.
pdb deposition date 2003-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1nonA00
3MJDA 4X45A 1CJBA 2AEEA 2EHJA 2P1ZA 3DEZA 4RQAA 1OREA 4RHYA 3DMPA 1A98A 1A95A 1HGXA 1QB8A 4RAQA 5IAOA 1JLRA 1ECGA 5BQPA 1ZN7A 1D6NA 3GGJA 3M3HA 2H06A 1I0LA 4RACA 2JI4A 1HMPA 3GEPA 5HIAA 2JKYA 2JKZA 4PFQA 5ESWA 5BSKA 3OHPA 4WN3A 1TC2A 1XZ8A 4LYYA 1NULA 5HKLA 2PRYA 1ECJA 1O5OA 1BD4A 3N2LA 4PAWA 2E55A 1P4AA 1R3UA 2XBUA 4RHXA 4RHTA 1YFZA 1XTUA 1A4XA 5BRNA 1I0IA 4RABA 2GEBA 4LZNA 4P86A 1BZYA 2HCRA 3ACBA 1UPUA 1XTTA 1I13A 1Y0BA 1Z7GA 4IJQA 3ACDA 3OZFA 2JBHA 1DKRA 1G9TA 1O57A 2DY0A 2PRZA 3LPNA 1QCDA 1DQNA 1QCCA 1STOA 1TC1A 3NAGA 1G9SA 4P83A 5K51A 1G2QA 2YZKA 5EUCA 1AO0A 2VFAA 4M0KA 1ECCA 4JLSA 5IPFA 4M0UA 1P17A 1UFRA 3HVUA 3QW4B 1XZNA 3ACCA 5KAPA 5KAMA 4S2UA 3O7MA 1DKUA 1JLSA 1BD3A 3MBIA 1ECBA 1GRVA 1U9YA 4M0PA 2WNSA 1W30A 1J7JA 4RAOA 1V9SA 1ECFA 4TWBA 4X44A 4QYIA 4WMLA 4ZFNA 1I5EA 4RHUA 5BQOA 2H07A 3G6WA 5E38A 2FXVA 1MZVA 4LYGA 4P80A 1A96A 4QYIB 4RANA 3KB8A 3S5JA 1PZMA 3LRTA 1L1RA 1ZN8A 4RADA 4OHCA 1XTVA 4F8EA 1A97A 3H83A 4FYMA 5JSQA 1QK3A 1OPRA 1WD5A 2C4KA 1QK4A 1I14A 1G2PA 1UPFA 3GGCA 1DBRA 1VCHA 1LH0A 3OZGA 4RV4A 1VDMA 1QK5A 2H08A 1NONA 4LZOA 1FSGA 4P82A 4RQBA 4LZAA 1ZN9A 1OROA 4P84A 1U9ZA 4P81A 2PS1A 4KN6A 1P19A 1DQPA 4QRIA 5JV5A 1VSTA 4P3KA 1A3CA 2IGBA 1QB7A 4MB6A 1GPH1 1P18A 4Z1OA 5ESXA 1L1QA 4JITA 1IBSA 3DAHA 3EFHA
chains in the Genus database with same CATH superfamily
1ZR4A 2WNHA 4B35A 3SQXA 1CUUA 1K63A 1RYHA 3DTNA 2XUIA 4UVGA 3THXA 4LBVA 2ZT5A 3WL7A 2IXAA 3SYKA 1GHTA 4JQZA 3LCMA 1SBIA 1J23A 2VDJA 3P9CA 5CA0B 4WY8A 5JFTA 2O2HA 5BN4A 2Z6QA 4BN0A 1ZN7A 3LUJA 3RVQA 4M8IA 1BXGA 3DWFA 4KX5A 2XGOA 1KMNA 2QVZX 3P9KA 4W6QA 2E4ZA 4KE8A 3PF8A 1JVNA 1MNAA 3O8QA 3THOA 2M1XA 4LBYA 8ABPA 2H7XA 3U37A 4JXKA 2ABWA 4PPQA 4KPUA 3FAZA 4QATA 3UOWA 1AS2A 2NO5A 1JFRA 3GRZA 4FC7A 1AKUA 4ZO7A 3BVPA 3ZV5A 2IS2A 5C7OO 5IBQA 1BWPA 2JIPA 3CWQA 2PV7A 3MAJA 4K6GA 3NGLA 1T4CA 5DIFA 2TMDA 3ESQA 3TJZA 1EJ6A 3X3HA 3W9UA 4P34A 4KQIA 2O19A 4BV3A 1FTQA 5DTEA 3LKZA 5A0VA 1RBYA 3BDAA 4BNKA 2R6GA 2JF0A 1C8KA 1XLWA 2B8EA 3GVIA 2VEOA 4RK5A 1OSNA 3OQVA 3A1FA 1DEOA 1F4LA 4A92A 4RLHA 4PYJA 3RC8A 2NTEA 4P4SA 1Q6ZA 3JTMA 3R0XA 1T3SA 3WRVA 2PUWA 2JVIA 1X80A 2Y4NA 3CF2A 4GWLA 3T1VA 1G1MA 2OLJA 2QX6A 3SC2A 4BNHA 4Q5IA 1IBLB 2IIBA 1FW6A 2YW2A 2IHUA 3WNZA 3INGA 4EO7A 2LE0A 1A9TA 1CX9B 2B69A 3HVUA 4HUJA 1JLKA 2LRHA 1US8B 4YJFA 5AM5A 4Z54A 1OLSB 3C15C 1XU7A 2AF3C 4UHKA 5T4HA 5BUZA 5CH5A 3B7WA 5DISB 3VU1A 4BMCA 3S2ZA 1O1YA 2IYOA 5CW1A 2ORED 4TWZA 1TRHA 3RIMA 3A0RB 4LZLA 1NY6A 4FHFA 1J90A 4C0WA 1V9SA 2PSFA 4NYJR 4B0PA 3QUTA 1QZUA 3DLTA 1NYTA 4H0CA 4OU5A 5JCXA 3UK1A 1EI9A 1ZCBA 3BCUA 5BQOA 2X9VA 3OCCA 1ODKA 5CBPA 2BAGA 4L5YA 1BJKA 4ZO9A 3W5VA 4WNAA 3MS4A 2FLWA 1SGWA 4B4WA 4AI6A 1OLUA 4AWXA 5BYAA 1G16A 1IBRA 2ZYDA 3HJCA 3QEAZ 4ALJA 4Z4FA 3BKXA 1W1UA 4NYJQ 3MMXA 4B8WA 5BNWA 1KMHA 2A5GA 3RT9A 1EX7A 1DAFA 1ZMTA 3GDWA 1T2VA 2W4MA 2WHEA 1G2OA 4K2HA 4E33A 1FP4B 3ESRA 4I5EA 3AFOA 1P73A 5HMMA 1W36D 4P4LA 4DM3A 4DMHA 1A9SA 5AK4A 1ZM7A 3R9WA 4MS3A 2C1XA 2Q4RA 1RLMA 2ZJAA 3QBVA 3ZOZA 3NYQA 4E07A 1SY7A 4AT1A 1T1GA 2QLTA 1SOUA 3IKVA 4KSYA 4RZIA 4ZU1X 1Y7LA 5ECWA 3H5WA 1KI2A 4KO1S 3R9KA 4AY6A 3VV2A 1DU4A 1GG5A 1U0TA 1WP9A 4KR3A 1XRSB 2DC1A 2WTNA 3NHLA 2WWVD 4NCNA 1F7UA 2BTEA 3RVLA 3VKFA 2ZBUA 2WB2A 4LJ9A 3PHJA 1ZW6A 2YX1A 4FE4A 3VMFA 4Y0NA 3VNRA 3OBBA 5EXTA 1JDBC 2CXPA 1OGJA 4ZJPA 5LWHA 3BIOA 2NO4A 3O0DA 1DJLA 2L82A 5DM4A 4AMUA 5KWJA 1PS8A 2VRCD 4HDOB 2CBZA 3KJNA 3GDGA 4HL6A 4I1SA 4WXMA 5FLEX 4ZC8A 4CDRA 2I3ZA 4ND4A 4PIVA 1TIPA 3I73A 3PGJA 3TI9A 5D3MA 3EGEA 1LF0A 3O74A 4LXTA 3VHLB 4R2MA 3NTRA 1X7GA 2IEDA 2QMHA 4HC4A 1ZNQO 9MHTA 1GPMA 2QJFA 2VN8A 1F2UA 5BRJA 3ILVA 1PG5A 5IHPA 5L3QA 4D8XA 2QUBA 3F6PA 2B9EA 2OCDA 2V55B 2IC5A 1A4XA 4MUGA 3R0VA 3RABA 5B2FA 3B3FA 3K1AA 3IE0A 2M6SA 2NACA 3EGXB 3ZK7A 2QX4A 2XCOA 3R7LA 3COYA 4NJEB 4DSOA 1NTRA 3TD6A 4D6XA 4EO4A 1PJCA 2ZJ8A 3B78A 2PLNA 1VI5A 5HJEA 2WZCA 1TKRA 2F43A 1QJCA 2A9JA 2I1WA 1KAHA 4HEHA 2OHXA 4AULA 1QIHA 5HBRA 2V0CA 1TUEA 3K9WA 3OJWA 4KLCA 3IP5A 4MARA 3SJZA 3TLYA 1Q1EA 5CPBA 4CRWB 4AF6A 3AQIA 4JNKA 3UJDA 2WZDA 2FE1A 3T3GA 1TTPB 1VBFA 2Z09A 3EGCA 1N33B 3V4PB 4K9KA 4UE3S 4CLDA 3HADA 4E22A 4L8LA 3R5XA 2ZM6B 4CMBA 1M2OA 4M9ZA 2WKQA 5KOJA 4H18A 4P92A 5J1TB 3I9V1 4YRMA 3GA0A 4C4RA 2EWMA 3FCCA 2ONYA 2HRZA 2NV6A 5AVUA 1XEXB 1NIJA 1TO2E 4FCTA 5JAPA 3ONVA 5SY4A 2W2TA 2I2BA 2QM8A 3GIDA 2HOQA 3NOXA 4A8JB 3L6OO 3GF4A 2I33A 4AQDA 2JGJA 3B6ZA 3EPKA 2C7PA 3NDBB 4GZ6A 2H07A 3AIMA 3PKIA 1OH8A 2O8DB 3AY3A 5C8YB 3W8FA 4OYYA 4UQPA 5SZKB 3VR2A 2P35A 1XZEA 2RC5A 5KO2A 3EBPA 4QU9A 3OUZA 3RAGA 3U4GA 5BXQC 4XEUA 4NAUA 2PKRA 4C01A 1JA1A 2EYUA 4NCHA 3G6KA 3SS7X 4ARZA 3ZCUA 3KWLA 1RJ9B 5KVVA 1RQNA 3KR9A 2VHCA 4YLGA 1Z6YA 5MN6A 4C4OA 4I9GA 2AC7A 3DJYA 1U0SY 1E62A 1G4HA 3R0ZA 3EFOB 4Q9HA 1T5BA 2REBA 4M7RA 3PT9A 2IIQA 2HMUA 2J5BA 1VJ1A 2L18A 4FMCF 1OROA 4H6XA 4Y7DA 5FOXA 4ZEOA 1CUIA 4TKUA 4XYMA 3TO5A 4O2AB 3S0JA 1CYEA 1E7QA 5B3JC 3BE4A 3PQ6A 2I55A 3KWJA 4JJFA 1QYIA 2CEKA 4Q9IA 3UHFA 1R0CA 3R5TA 2GBPA 3TGWA 4E1AA 2JDID 4UTPA 1W5AA 3S1AA 2GNPA 1ZAKA 2AG6A 2EZ4A 3RF6A 4C88A 1W35A 2AA3A 3AR9A 3BWXA 5DO9A 3WJ2A 2ZRMA 2J5RA 4MYDA 4ZMRA 2WFLB 3QMVA 1PZXA 5E3JA 3HMKA 2PL1A 4Z8YA 1C3OB 1OE0A 4LBZA 4QNMA 3GNTA 5BSVA 5DX1A 4RFSA 3P26A 5AJVB 4RHYA 3A4LA 1NQUA 1EFVA 1OWOA 2X9GA 1N2HA 2P2ZA 2VPPA 2Z5FA 4H15A 4XM2A 1JLRA 3GW8A 3ZDQA 3L7IA 3LUAA 3EBOA 1BSVA 3L06A 4D9HA 1EMDA 3LTNC 4AY3A 4I5IA 3V1LA 4DKXA 5IAAA 2CDNA 1DJQA 3BL6A 1HLFA 4LQDA 1XAJA 5FOUA 1O6GA 4Q3CA 5F3DA 1NA5A 1TC2A 4JWKA 2G80A 1JPNA 1LLFA 3VHXA 5HUJA 1Y4DE 4X92A 5EFZA 4RTNA 3HCDA 4WOJA 2E55A 1VM6A 2Z2YA 3P4XA 3HG7A 3JAKA 1XTUA 5FO1A 1Z7YA 3DAOA 5HF6A 4MRPA 4DR2B 4G0UA 6REQB 1T8WA 5E0KB 1GQSA 3LIPA 5JXIA 2VSQA 3PUYA 2B2CA 2VF8A 4MLCA 4ZCPA 5ITZA 3O1IC 2Y71A 1MW9X 1N32B 4LDZA 5LCXA 3ZDYB 1E3TA 1J07A 3LDUA 4AQ7A 1LZKA 1E99A 1IJFA 1YDGA 2V3CC 2QPLA 1VE3A 3SP1A 2CCJA 4P3XA 1AN9A 4CLRB 4E15A 4HXYA 1O6BA 3HKDB 3NHJA 4WN9A 4DLUA 3E3NA 5ICCA 1GRQA 4MQFB 4FSHA 2WY2D 5IM4F 4GPAA 4U00A 2WJGA 2GR9A 2DEUA 2XVYA 4HLUA 1O6ZA 2OV8A 3MUOA 1LBQA 1UOOA 1WOYA 1W36B 3Q10A 1YCFA 2DFTA 3I23A 4JCOA 2HI0A 1H2AS 4UPVA 5EJIA 4BMPB 4PSAA 1X7HA 1R5JA 1PP4A 3MWFA 2I6GA 3JWIA 3AMVA 3QLVA 4YJ2B 2DT5A 2OZLB 4Q05A 4RH1A 1TEZA 1GSAA 2Z95A 2CXSA 3Q2OA 4AY2A 3KLPX 4C1BA 4DDTA 4KPYA 4AYWA 1ZMXA 1OGIA 1M75A 4YCJA 2OT3B 4BVGA 4B79A 4I4LA 3ULKA 3GJ7A 4DV4B 3VJMA 4RIGA 3PQ2A 4KR7A 2LKCA 1U6JA 3JYPA 3STYA 5EA2A 3TG2A 3MWDB 1RBMA 5JROA 3WGQA 4BNMA 2NMVA 5D1HA 2I6FA 2BKLA 3O31A 4UXIA 3ESXA 2ZBQA 3WVNA 3OZRA 1FXWA 5F7JA 2AZMA 3UB3A 2PZFA 1X94A 4O8ZA 3LVFO 2C5AA 3TQSA 4RTKA 3IAS1 3TQFA 4ILEA 4PBTA 1KU6A 3RUHA 2ID9A 4BNLA 1OZGA 1E3EA 2HA5A 5FI5A 3THYB 1QDUA 3FYUC 5ALFA 5EL0A 4R9SA 2DBVO 1IN8A 4KRFA 5BN1A 3KOYA 4LFCB 4GM1A 1GCUA 3GEHA 5CGZA 1DIAA 3NWBA 3NANA 4F7WA 2PX8A 3ZPXA 1SD2A 1AKNA 5G3ZA 4H59A 4MUIA 3T54A 5KVAA 1I0ZA 3RRNA 4FBLA 3UGKA 2A9PA 1D7AA 2XTNA 4UHHA 1U9IA 3ZDBA 2PIDA 5BNFA 3GLKA 3B1XA 1TE2A 5K3FA 2BCJQ 1C2YA 1CF4A 2NTNA 2AMLA 3GMSA 3ML1A 4RM3A 5BORA 2JHFA 1KIAA 2GKSA 2Q5JA 4GZMA 4BU0A 3K8QA 4R84A 2HMSA 5BWCA 1VJ5A 2P8JA 3UUFA 4Y6LA 3KOUA 4MR8A 3W2TA 1RJWA 1U4OA 4TL7A 3K6RA 5E95A 4B2IA 4IR7A 5JZBA 1QHNA 4ZCMA 3SC4A 4R0VA 4PAGA 1EVJA 1N57A 3M5CA 1PO7A 4PSKA 3IMGA 4Q1DA 5H59A 3RBAA 2HPZA 9LDTA 2GMWA 1ZIOA 1CNEA 2OXFA 2IBTA 4K7JA 3AEQB 1W29A 1QYVA 2ZR0A 4GNRA 4OAOA 3AESB 3EEQA 3UY4A 2PZ8A 2A86A 1ZJYA 4KEAA 1S2GA 2YHSA 3BL5A 3TNJA 4ER0A 4AG5A 4I55A 2RAVA 3EASA 4ERXA 1G21E 3A1WA 4G1UC 3OLXA 1AKVA 5LXTB 2JAHA 4CKWB 3C3AA 1KKUA 1U0LA 1A8SA 2QI9C 1IHDA 5CFLA 5K99A 4E1VA 3H05A 1MX3A 5EUQB 3PNOA 2B7LA 4XLTA 4AECA 3HDTA 2QRNA 4G24A 4JEHA 4C2AA 3KPUA 2ESRA 3Q6NA 1XR3A 4BQFA 3RKUA 2CCGA 2J87A 1NL3A 2OWDA 3IXLA 2PY6A 4M37A 2NZUG 3PNQA 5TQ2B 4BO7A 4Q1CA 4B76A 3ACDA 3IQIX 4GOJA 3W77A 1GTRA 2H3EA 1BDMA 2WF5A 5FBQB 2H5IA 2O8EA 1SZJG 4Q24A 3VZRA 4A10A 4QEDA 2F3TA 3F5SA 4JOSA 5DI9A 2XTZA 3DMTC 4BQRA 1I5RA 4EY3A 4X5OA 1IJKA 4Y67A 4DARA 2OP0A 4JL6A 4BB6A 4B8YA 4PX2A 1TZBA 4OK6A 4UCWA 3T5BA 4RU1A 4R8MA 4REMA 4AVYA 4XYBA 2PQMA 3VZBA 3W5IA 3DOIA 1UFRA 2PANA 2XECA 2FPLA 3ICOA 3MGBA 3UNXA 2YMQA 1H3EA 1QFSA 1TA4A 1ODFA 1U8XX 1OXMA 3A1UA 3JQFC 4NCAA 3R3YA 4XI9A 1AQJA 3K4HA 5K20A 3TAHA 3D8UA 3SNKA 3LUBA 3RLFA 1DIRA 1PL0A 4YRIA 4TS1A 4MUYA 1I3OA 3ZD7A 1U8CB 2OD7A 4P2BA 1IBMB 3FKQA 1H2ZA 1Q11A 3KLNA 1XNRB 1TI7A 5BN3B 3PUZA 5BSEA 1NRIA 1GCOA 5C37A 2IDJA 2JLRA 4PC7A 4ENPA 5CLGA 3TZQA 1S6YA 1G5PA 1K8RA 3BF7A 3CW8X 1KVRA 5EIAA 3WHIA 3EJ6A 2ATXA 4K1XA 4TV9F 1RLUA 3LG2A 2HDHA 3LE8A 3QVJA 4LWZA 3FPAA 5CVTA 1PX0A 4K8RB 4X20B 1H2HA 4Y9TA 5JVDA 3WXBA 3NVDA 1IMJA 2OSVA 1VHTA 2UYCA 4HGPA 3PCRB 2J0QA 3GJQA 3MB5A 2BFCA 1LVGA 3E1KA 3DT9A 1TQ4A 3LUGA 4Y2RA 5SYAA 4QWMA 4DQDA 2AB0A 3U3MA 1DG1G 1XAGA 2KM1A 1ZR2A 2JLVA 2FGJA 4PZLA 3RV4A 1C30B 4LVUA 3JV7A 1XHEA 3NIGB 2TRSB 4KR9A 3AETA 5HK8A 1DAPA 3K9LA 3NBZC 1E7SA 4MMXB 3TAXA 3W5DA 4X6LA 4LEIA 1L4YA 1V71A 3URKA 4C6HA 4IFEA 3QLUC 4NCJA 3PL5A 3PQ5A 3ZN2A 5DNCA 4JT8A 4ZCSA 1RI5A 1RPAA 2ZE5A 3L07A 4MW5A 4O4JA 1NBHA 3F4KA 1LK5A 4PGFA 2BBOA 3FMGA 4RIEA 5DTRA 3KQNA 1GJRA 3ZWOA 2O1EA 4R40A 4A2PA 5HQTA 2ZKIA 4GOKA 5JCJA 3DLPX 2Q21A 4LI3X 2QM7A 2OAP1 1XMVA 3MPOA 1GL6A 1KZYC 2RI1A 3KQSA 3MBKA 4GMFA 4YRPA 1XV5A 4I66A 1Z56C 3K8ZA 2JJ8A 1U3GA 2RDMA 5IYZA 3DMGA 3LRPA 3UHJA 4EW1A 2QUKA 5LUBA 3PJRA 2Y1OA 2BPOA 2H6EA 3FHOA 3BH6A 1Y6ZA 4YRTA 1TGYA 4FONA 2QN1A 4NYMQ 4JIGA 3H4MA 3FMVA 4MS4B 4F1WA 1A2BA 1IHUA 1NBIA 1R4NB 2B1QA 4UHJA 1U7HA 1Z4IA 4NOKA 4F1JA 5G53C 5C34B 5BNTA 6CHYA 4NG4A 3CCCA 2F1IA 3PQDA 3KB2A 1MAHA 4RGYA 5L3RA 3RYIB 3FTNA 4YMTA 2IYAA 2CYCA 2ZJ4A 4C5CA 1UCFA 4GLOA 3WP0A 3ZKWB 3MWGA 2JGKA 2WM9B 1NC1A 4FEAA 1AGNA 1ZXLA 4DMLA 2YN0A 4YN3A 2HADA 1DEAA 3QFSA 1X38A 3MGKA 4LMAA 2GPTA 4RDCA 3D7MA 4CF3A 3KXLA 2A57A 1FFXA 2PKWA 2V5AA 1ZC4A 1K8ZB 3L1VA 3VX4A 4M60A 4B46A 4DCPA 2PX4A 1Y8CA 2ORIA 1R5BA 3PQ8A 4MUJA 2VTBB 3TUZC 4PO8A 3WYDA 4DA4A 2NO7A 1HNNA 3I9MA 5EZSA 5MDHA 1ORWA 4QOFA 1L6IA 1BGWA 1B0AA 3NI2A 4BLRA 1GPNA 4V0RA 4AC9A 5AK3A 1P8JA 1HL3A 1ZKDA 1XCLA 2B1GA 2OMEA 3NC4A 5CA1F 3JU3A 4LNUA 5DP1A 3ACCA 2Q0HA 4FNMA 1KH2A 4JB0A 3WNCA 2Q6VA 3S81A 3EF1A 1ULBA 4M89A 4LHVA 4ZAZA 2P41A 2G70A 3L8EA 2CNLA 4MQBA 4KIGA 5DBOA 2FN4A 3D8BA 5EIEA 2FW0A 2NG1A 3JATB 3HMQA 1DTSA 4PQFA 1WBBA 1KKMA 1EFKA 1GQ2A 3B1WA 4DSAA 1GNTA 4YCMA 3LT4A 2AW3A 1BA2A 1KFJB 1LFDB 4RPKA 4WLOA 5FF9A 2PZMA 1DRUA 1ZP6A 1XP8A 4MRAA 4TROA 3K0HA 1JHXA 2P4EA 3N74A 2WQ7A 4JJAA 1VB3A 3RANA 1LDBA 2DPHA 3IEXA 1NC3A 1OBVA 2HBQA 2YWBA 2BKAA 3DE5X 1PU2A 2A9RA 2HR1A 4EL5A 4IGFA 4I1UA 4IDDA 4R5MA 1GPYA 4WZBB 3V4VB 2P6OA 1KARA 2BJVA 1L7OA 2ONCA 3AFHA 2SKDA 4IW3B 4LF7B 3IYLW 3ZK8A 1P7CA 3ZIAA 4CI0B 1OIVA 1R0RE 2BIFA 1A9XA 2PG3A 4UMDA 2Q1SA 4E6EA 2GEKA 4WKBA 4RKRA 3WYEA 1QRUA 2OO7A 4BL5A 1SM4A 1ZD2P 2YV5A 3F6SA 2O2EA 4WIAA 5H80A 3KYCA 3ADDA 3GQVA 4X8MA 2ZPAA 3RYHB 2WMDA 3T61A 4DUGA 3NC0C 5DBHX 4BKMA 5B6IA 3LUDA 2JGAA 2IL1A 1MPXA 4X45A 1YZHA 1Y8RB 2C7VA 2J5XA 2JJ1A 2R6R1 3KV1A 3KZ1E 3MELA 3G02A 5GONF 3S4YA 1E1RD 4H4EA 3DWGA 2VHEA 3T6KA 3P8ZA 2ZJ2A 3RT1A 3RLIA 5JNVA 5KJ6A 1OAOC 3ROZA 2VTEA 2G17A 2H06A 4CTKA 2QMYA 3UGTA 4EELA 5I4BA 3CO5A 5MGNA 3HZRA 2VIIA 1Z06A 2XSZD 4QM6A 4LC1A 2WINI 3PX3A 4PNZA 3EGDA 4BQPA 4I4TB 1Z88A 1XD8A 3KKEA 4URXR 3BWEA 2JAUA 2PUDA 3V8MA 2DBQA 3ZIUA 1BD4A 3IKJA 4B6SA 2I4OA 5DCYA 3OA2A 3HWRA 1N4AA 1IK6A 2WVAA 3WBJA 2C77A 1QFXA 3QM1A 5I9BA 1TW3A 3EDCA 1K97A 5JPIA 1TFUA 3CTPA 3KOMA 1MX1A 3OT1B 2XKKA 4GXTA 2VP3A 1FQKA 5G4LA 4YMVA 3DBLA 4QASA 1A9YA 4R1QA 4TTRA 1G9TA 2IEYA 2VHZA 1W8DA 2JLBA 4I6JA 1NVWQ 2VC2B 2ZIFA 5I48A 5JPCA 1BCSB 1OHHD 1SH7A 2WKWA 3QTBA 3TW6A 4DOMA 4RE5A 3U7FB 4EG4A 5FULA 1MLDA 1ABFA 3M4YA 1WZEA 1A2OA 1ADBA 2P30A 2WOOA 2OBNA 2Y2UA 3NASA 4IRUB 2MSCB 1Z6XA 2BP7A 2QXTA 1DV1A 3Q5GA 3QRWA 4N3NA 1EK2A 1PE0A 1XDZA 4OK3A 5A9SB 1YU6A 4I4CA 1SKUA 3GZJA 2VATA 3DB1A 4EJ2A 4LMRA 4G8CA 3SWWA 4IUYA 4WK6A 3ZC3A 5H9VA 3IPLA 3G8BA 3ZDXB 3HEBA 1CIPA 1N2JA 2BYTA 2H4WA 4M1EA 1E2GA 1Z4QA 3LT1A 4LJYA 3VNQA 2ZSBA 4E5PA 2HUNA 4LISA 3WWOA 5GZ3A 2H1LA 3PEFA 5G3YA 4QC2A 1P60A 5AYVA 5JY6A 2ZIAA 4QYIB 3H2SA 3FMOB 3QEMA 1OILA 2XEXA 1G21B 4EJFA 2NQ8A 4F9FA 1XMSA 2I65A 5H7XA 2FPSA 1GSHA 3EGOA 4YFVA 3U5ZB 3BS4A 2ZS8A 1EUZA 1PSZA 3L8GA 2QUIA 2J5QA 2NZVG 1CJSA 2UYYA 4NV3A 4EDHA 3DQZA 1DBRA 1AB6A 5EJFA 2BFPA 4RVUA 1UFVA 2E48A 5CGQB 4G6ZA 4RDHA 4DY4A 2YV3A 3M0EA 3J81A 1X1CA 3EULA 4CKCA 4ZI7A 4ER6A 2O7RA 1ONPA 2FY8A 5HGXA 1WX1A 3GROA 4BWFB 1W8IA 3GELA 2VUHB 1EGVB 4UFPA 1W93A 1JV2B 3BMNA 2VCHA 2WTMA 3I45A 3S3TA 3WK7A 4NIMA 1UJNA 4LJAA 4CIYA 2HHHB 4LF6B 3X1JA 1RXIA 1IDN1 5AFSA 4HBZA 2WKSA 3RFCA 4BO3A 4JLOA 2XQKA 4G9EA 5FWYB 3R20A 4K3UA 4LSGA 5IAGA 4XPIA 2HY7A 1N92A 1L8XA 1J8VA 3K0CA 5GMOA 1XTBA 2GB4A 3NJRA 2OCYC 4RQTA 3D0QA 4JENA 2GFIA 4I2NA 4DBLC 3NKVA 1WMAA 3JYNA 2X9QA 3EHDA 4ND7A 4F85A 4UU1A 2YZGA 3AI2A 3HYSA 5HCIA 3CLTD 5ISMA 2WFZA 4ZT3A 5K8VA 5LYJF 2P3LA 2OAGA 2GUWA 4V0QA 3PB3A 5CEEA 1VLQA 2R62A 1KBZA 2G07A 2VT2A 3G9UA 3Q8XB 3BJIC 2ZYVX 1M2GA 3JWEA 4J1QA 1UBKS 1RVDA 3D54D 1VLJA 5K9ZA 5A4IS 3VKGA 3L8ZA 3RYTC 3DONA 1L8QA 2BZ0A 1QPBA 4UNIA 5F3RA 5DNEA 4RTLA 3UMRA 4R81A 3V9AA 2F3RA 3IEPA 1IJBA 4U2EA 1YD7A 5SYMA 4PVCA 3NV9A 1Q2UA 1P80A 1SCUA 1O96B 3B70A 4GBED 2IYEA 1E4EB 1T6YA 2QUHA 1MFPA 1A69A 1OXBB 4LTMA 4N54A 3JQBC 1Z5WA 1M3SA 2QRVB 4UUNA 5KS2A 1KI8A 1UDCA 2H9AA 2I7XA 2VDMB 2Z8YA 3GDHA 4IIFA 4X71A 3SIWA 4Z7QB 2YJGA 2JGFA 3UT0A 3CM0A 3GRYA 2C20A 2H2FA 3DOHA 2HLPA 4RA6B 1DQNA 4CEIB 3EIWA 4PR0A 2VT3A 3OE7D 4Y6OA 4E21A 4JKIA 4KI7A 4EGFA 5IUJC 3F73A 3MGGA 9ATCA 1EXWA 4RK0A 3UH0A 3ZS9A 2G71A 1DXOA 3DBHA 3I83A 3W3AH 4P58A 2HMYB 5MF6A 1MO5A 1RBQA 2Q1TA 2W6PA 4GVLA 4QYTA 2WAMA 1QKJA 4XIJA 3WMRA 5FV4A 1DKUA 1YL7A 5DTJA 3GLGE 4HEJA 1J5EB 4BGUA 2EKLA 1EYZA 3H16A 5KC9A 5K2OA 3ZVKA 4U6NA 2BMWA 3ZGYA 4GM0A 5BMVB 3LHDA 4QYSA 4N8DA 2QP3A 3PHCA 4WZAE 1I51A 4J4BA 4KHZA 4Q4JB 4CETA 1WHTA 4LF4B 2G0NA 4BCBA 5FPPA 2R3SA 5B36A 5AVVA 2N46A 5MN5A 2TECE 1VZ2A 2C99A 5ESDA 3LGAA 1LA2A 3MJRA 4OHMA 1ZNZA 3KYDA 5AVSA 1YZYA 2ISCA 4MQUA 3K6SB 1JSLA 1QTNA 4C0AC 4UTRA 2Q2WA 5CJ2A 3OFJA 3QVOA 3UHAA 1A2QA 2Q3EA 2VJMB 3CU5A 4K87A 2NWQA 4TTPA 4HQRA 4EA7A 3WOHA 1RXYA 1UZUA 3T95A 3FDXA 4P82A 5KCZA 1Z38A 3WV5A 5M04A 1I3CA 1AS0A 5JSUA 1SVNA 1X8LA 1PEYA 4XOUA 1FYEA 1OGYA 1Y3IA 4CCYA 1KOJA 1O2DA 2ZI4A 3UAZA 2XJ9A 2FUEA 3TKYA 4EYOA 2A33A 2AR0A 4O4IA 1XQ9A 1XTIA 2OR3A 1VGVA 1OCEA 1YB6A 2BTQB 3LT2A 1NURA 1V3QE 2GK3A 2AR7A 4XGIA 4N7JA 3Q12A 5AKEA 4HUTA 1O94A 5C8VA 4JVNA 3PIRA 3C3YA 5FP0A 3TEMA 1TQ6A 2YYSA 5DMHA 4LW8A 1QONA 2WWYA 3BZUA 4L78A 3DDHA 1PEAA 5AXAA 3V34A 1K0UA 5H82A 5IC4A 3FJYA 1RKVA 4QUDA 5FR1A 1CUHA 2O3QA 3EVZA 1DWQA 3VSAA 3AKCA 1QTRA 3FSGA 1XK7A 2PBZA 2XVMA 1JEYA 4XIYA 2PQ0A 5T6BA 5BV2P 1QQ7A 3BE6A 4II3A 3UPUA 5LIRA 2JD2A 2AMFA 1UPAA 2OB1A 4U39A 3I5XA 3I76A 1J39A 4MYRA 4XVCA 2JFVA 4BKOA 1T9CA 4M1MA 4EGCB 2HF7A 4YUAA 1QR6A 1C9NA 5A05A 4DG9A 1CF2O 3ZCPA 1RC8A 2AF4C 4TRRA 1U7TA 3DCYA 2A0XA 1N2XA 3CR8A 4BLQA 3JZIA 3FYUA 4Q1EA 1X15A 4AZTA 4Q3BA 1WSBA 3GRFA 5F35A 2ZRCA 3NEJA 2ZYAA 3GNLA 4DY6A 1QRSA 2ADFA 1XMXA 1R6BX 4LOIA 2HCRA 4Q4CA 2QTFA 5EZ5A 1OH7A 1NFRA 2A3RA 1O97C 1LWNA 4RH0A 1G6OA 2H2DA 3PUHA 3KSUA 1M5TA 5EIWA 3WK8A 5A3JA 2LPMA 4N0QA 2ASEA 1HE1C 2EIXA 3KZKA 1PYOA 3ORHA 1U94A 2C0CA 2EX4A 1HM5A 2PCLA 2ZZNA 1ULZA 4Q6BA 1SN7A 3NAGA 2QZ9A 4IFBA 3VTAA 1K7FB 4D2IA 4LHYA 1KA9H 4EB3A 5CXQA 3FBGA 2P0AA 4IJMA 4PHTA 2RB4A 2P79A 4R54A 2REOA 3JYOA 4EGQA 4XASA 2PH3A 1YIAA 1HDOA 2FG5A 3P9PA 4NESA 1K5HA 4D9EA 4OQNA 4RPCA 1YSCA 4CM5A 3A6LA 3KSRA 3IHTA 4NARA 5F2EA 1SXJD 2GFHA 5CDUA 1P7ZA 3GCZA 3E53A 4RD1A 5A5GA 4D26A 2CLLB 3W9SA 4S04A 1SR8A 4W63A 1JR3A 3BSYA 3QUAA 4DIUA 1DCMA 1GV1A 5HKKD 3DA8A 2BONA 2Q9AA 3MRVA 4WMLA 1AX9A 5LDDC 2IHYA 3AILA 1DOHA 4R83A 4YJHA 4RMGA 3L79A 5DNDA 3QQPA 4TKVB 1RCUA 2PRKA 4X6YA 1DC5A 1JA9A 1S2LA 2ZJ0A 2ZRQA 5YASA 3V55A 5CXUA 4F3YA 2IYTA 2D5LA 3FNGA 2OMKA 4ZVMA 3T3DA 4QXOA 1YMQA 2YXBA 5ALHA 3A3YA 2BH9A 2G76A 1P7PA 3VOTA 4AYTA 4KIJA 4KPEC 5I7AA 5U4QA 2ZYHA 4PAQA 3H2KA 2AKYA 4TSFD 4BUJA 2CD9A 1OX4A 3OD1A 4YIKA 3V4LA 2FP4A 3W5BA 3K7EA 3OFKA 1Y42X 2VF5X 1A2KC 4X24A 2Q2VA 4EQ6A 4CEHA 2IH5A 2BEWB 3HEMA 4NK5A 4Y1GA 3F47A 3FIJA 4YUWA 3P9ZA 4HBGA 3AHHA 4P81A 1OAKA 4UVIA 4HDCA 2ZUTA 1HZJA 3IIEA 1QHHB 3X1XA 1YVPA 3OT5A 2UXCB 3F8SA 4MROA 5IKEA 5JV5A 3HA7A 2LDXA 3H1FA 2RJNA 2W2LA 2WWRA 4PXAA 4LIPD 5DSXA 2MSDB 1N1MA 3A2MA 1R18A 2JGMA 5BVGA 2IWHA 4E2XA 3MJFA 3Q7QA 4EB6A 1RYYA 3PXAA 3UJPA 2FCRA 2BMJA 3F6RA 4HLQB 4UNSA 1B6RA 1MJFA 4C2TA 3DMHA 4OMCA 3MOIA 1TXGA 2EHJA 3EGIA 5TT0A 2BEUB 3RFUA 4DABA 1T8TA 2QBYB 1J2RA 2AWNA 1YTLA 3K15A 4FMPA 4P3YA 4DLVA 2NO0A 2IQIA 3ZGNA 1Q0ZA 2R68A 1J25A 3CNBA 1AQUA 3C7TA 3E9MA 4RAQA 3VPCA 1ZVQA 3IUMA 3DS8A 3W9BA 2P9GA 2RGBA 1U7UA 3DLIA 3QOXA 4A6PA 3GEDA 1NXVA 1SK9A 5C8YF 3RSZA 3M9LA 4B48A 1SHKA 4WLVA 4N9WA 5H83A 4HOYA 3QH4A 3G0DA 4U9UA 3WJ7A 4LSWA 2G9NA 1XX6A 1R12A 4HGNA 4WESA 2IE8A 1UP7A 2PKCA 2A88A 4M98A 3ETNA 2F64A 4MV0A 3KVOA 2W70A 2ZE8A 4PIPA 1UDRA 1TVMA 5AKZA 4MR9A 1RQRA 3URMA 2PZLA 7REQA 4LZNA 2GKOA 2P3OA 3MWEB 3MD0A 2YQZA 3LPDA 1HFEL 3B89A 3OZCA 3QE2A 2JBAA 4O2AF 3ELBA 4LBWA 2YN4A 4B73A 5A4AA 5KSWB 2JASA 1VHQA 3D6FA 5CRIA 3C6MA 1ENOA 3NX4A 4J0EA 4HR7A 3UV7A 1SBZA 1ZQ1A 2E5WA 1B15A 3HV2A 3Q8KA 4EY7A 3PFHA 3TQTA 5ARCA 1A04A 2ZG6A 2Y92A 4F3RA 2ZOSA 4ZDIA 1SVOA 4ZK2A 1AO0A 4FD2A 1GLGA 2R1TB 3Q7TA 4H0NA 2BMFA 1IRXA 1SURA 2WD7B 4OXRA 3PC2A 4ND3A 1K5PA 5K5EA 4S12A 2I6QA 2PH5A 1AURA 2GM4A 1Z0ZA 3CH5A 3QELA 1T2EA 4OM7A 1M8FA 3NM5A 4NAHA 2N1MA 1DDIA 1KK3A 3COVA 4DIBA 2V6JA 2OKCA 4MYTA 3SJUA 3IBYA 6ABPA 2Y0PA 4FHEA 4JJ6A 3F97A 2OK8A 3ZWKA 3AFNA 2HC9A 2NO1A 3ND8A 4EPXA 5JADA 1PTKA 1ISRA 3FKSA 4YRCA 2WWTA 3KQMA 4EF6A 4CGZA 3R7NA 4JLBA 1WVMA 3D8SA 5TGZA 2XQVA 3N8DA 1NZDA 4V1CB 2NUPB 3I1FA 5BNZA 4JL8A 3AYXB 4ANFA 3Q8MA 4FDMA 5LLSA 4X3CA 2C2HA 3NBKA 4JA0A 2GZHA 1Q20A 1B0PA 4RD3A 5KVQA 3ROMA 5FUQA 2V74B 1E8NA 2JAOA 4KVAA 1YBVA 5AQEA 2O48X 4LV8B 1ENZA 3H83A 1Z22A 3IAUA 1H65A 3HA5A 3TLGB 4BPBA 1SB9A 1RP7A 2NZWA 4KQ1A 5JFGA 2YMPA 4W5NA 1VJTA 3D8NA 4BNIA 4HX2A 1TUBB 2FAXA 3GJTA 4K9MA 4XPZA 2OBYA 3HWWA 3RRBA 1ISHA 2FMTA 4ZV4A 3WWYA 3CVXA 5BRAA 4QGSA 2Q07A 4BNZA 4R68A 2QL5A 2ZJOA 3L9WA 5FR2A 1ORRA 2E85A 1YAHA 2ZR9A 4AN4A 3UFXB 4L95C 3ME5A 4QT4A 3ENQA 2QT0A 3HA2A 1YVEI 4MPPA 5TJHA 5JY1A 3WG9A 3IVAA 5TVKA 5F64A 1LBTA 1MB9A 1CS0B 1JG1A 2CUKA 1SBQA 2QG9A 6NULA 3CBGA 3UUWA 1PFKA 5H81A 4CGYA 3MD9A 4YACA 5BSWA 5J2TA 1DXYA 3DOEA 3ZV3A 2RBGA 2ZRDA 4FYJA 3IHWA 2J9ZB 1W0JD 2VJQA 3O0TA 2EBUA 3WGHA 3GLGB 4PPFA 3D6UA 1A4UA 5IMBA 5JLJA 2JVJA 2IY8A 4B6RA 1YA4A 3GAAA 1DTWB 3CUKA 3PFBA 2OCIA 4WZAB 3EQ8A 1JRLA 3N9IA 3D2CA 3WGLA 1XD2B 4I46A 1KQPA 2FH5B 4N3CA 3EGVA 3ZHRA 4C4ZA 1Y1LA 3HYRA 2B35A 4PZZA 2RCYA 4Z9BA 2Q28A 1HT0A 4JC0A 5T64A 5AJWA 4LYYA 2P6MA 5IF9A 1GEGA 5B1YA 4EARA 1FW8A 3LX6A 3H8JA 2BMVA 4EB0A 1Z47A 1LC3A 3GT3A 2A0YA 5HP4A 1KE2A 1JKJA 3RTDA 1EDBA 1NLYA 3A31A 1T0HB 1IAQA 1MTOA 2ZYWX 2J30A 3B6EA 4L74A 4MI3A 3OO1A 2G88A 4JD5A 4Q9DA 4RMIA 4QREA 1JILA 4RO0A 3O83A 5G4KA 3S44A 3FCEA 3OZUA 1MIHA 4CDMA 1MB4A 4DBVO 1UAAA 1AN0A 3F90A 1FA9A 4WX2B 5LZ8A 3W5SA 2B8WA 4DCTA 3C8UA 4JY7A 4CQMB 4JEIA 3ADPA 3SYMA 2EVWX 1QCDA 3E1GA 3H2GA 3FUUA 4FSDA 4ROSA 3O2JA 3R74A 4JV5B 3FWPA 2HUPA 3DH0A 3MJTA 2XCRB 4N39A 1L7BA 1PFUA 1WZUA 1F38A 4YJ3B 3COWA 1S7GA 3LL7A 1F2TA 3HCCA 4TLBA 1N4DA 4BLWA 4ZYUA 3EXHB 3CUUA 1G6Q1 4QNNA 3JQQA 5A9RA 1PI3A 1WLSA 3D0KA 4CN8A 1U2TA 3KQQA 1PR2A 3PI6A 1P6QA 4OK5A 1X7WA 2GS9A 1D9ZA 3DFIA 3L93A 3RTGA 4LWOA 3WB1A 1BD3A 5DYIA 3JVIA 3JQDA 3HB4X 2XJ4A 4FT4A 1T13A 2ZI6A 4QDUA 4EB8A 2DE0X 3SZMA 1LBSA 3TPZA 2WSIA 4NZNA 1LGYA 3G3EA 4HRAA 3IS3A 5TNXA 2GN9A 2C03A 4O8CA 5BXYA 3C6BA 4RSMA 1QYCA 4RLFA 2WJHA 2PGLA 1LBHA 1LLCA 2RGGA 2NUAB 2OYCA 4XDYA 5LXTF 1IQRA 3HB9A 2OLKA 1MOPA 4NK4A 4B71A 3JQ8A 2NXCA 2HIAA 5TARA 4FUQA 2D00A 1EXNA 2J85A 3KO8A 4YP1A 3W5HA 1G64A 2IP2A 2ZYGA 3HUTA 3IEIA 1BFUA 1QK4A 4JUFA 5KYXB 2L69A 4LYDA 3LBNA 2XRFA 2YWJA 1DFGA 5DN9A 3STTA 2ATCA 2XWJI 4ARSA 4DLZA 1OASA 4TVSA 4JB2A 4OHUA 1R0SA 2QRZA 4WCFC 4H77A 1VPEA 5A1TA 3A11A 4G0XA 1G8GA 3GZTB 2DY1A 4JT4A 4F12A 3JRXA 3IBGA 4YRLA 5C46F 5KYTA 1RLIA 2COUA 4IDQA 4DC1A 1PHRA 3WA7A 3KRTA 4QG7A 3PUWA 3UO8B 4RF2A 4MW0A 2Z1DA 2O0JA 2ERCA 2FN8A 3LQ4A 4HV4A 2FWIA 1N3LA 3SSOA 3V8EA 1QB7A 3E9EA 2R7LA 3EDRA 2FSHA 2G5GX 1GZSA 2WC1A 2O0HA 1Z0IA 2C1EA 3AHEA 3QYFA 1KK1A 3MQFA 2YC2C 3VQTA 5KYKA 5DLQC 2I34A 5I9TA 2PHZA 3HNRA 4BEVA 4ZV7A 1XKLA 4U7JA 3I6MA 2GTIA 3FFXA 3QVSA 5DOZA 1EBUA 1EE2A 1XEWY 1E2NA 1I4OA 2D2VA 2CVPA 2FXIA 2IYXA 2MDTA 3P4YA 4GOLD 4QPPA 1UXIA 3ITEA 5CCXA 3U4MA 1QCZA 5EXDA 1RYFA 3CNEA 3S40A 1JYFA 3THXB 1ZD4A 2BCEA 3B13B 5BQPA 2DETA 3OTGA 3QOWA 3QVXA 3L8DA 4NFHA 1YR1A 2GAOA 3GVXA 2E4WA 5ALNA 3G79A 2VXCA 3AFMA 2DULA 3NVAA 4HH4A 5BYBA 2D06A 3R0IA 4G5FA 1CD5A 2JKZA 5BN4B 3NM4A 2W6IA 3FR7A 4IIYA 2O4CA 3K0FA 4Q3OA 1BXGB 5ALYA 5HCNA 4AIIA 3GLUA 3LBIA 1H2WA 4UDXX 4MV4A 2O2CA 3VR0A 3DXXA 2CHUA 3TDKA 3O8QB 3VC2A 5GIPE 1T9BA 2FG7C 2FRXA 2X5KO 4XRGA 3D6HA 4MVJM 3PDJA 5CDTA 4FINA 1YJBA 1V26A 1ZHFA 3CXUA 1ORVA 3OM0A 3DLCA 4KPUB 3CQ9A 2HZ7A 2OAQ1 4RK4A 5EFOA 3TZCA 3WKAA 2C5HA 4JI4B 5K0ZA 1T4CB 4OXNA 2RG7A 3PE6A 4ZAVA 4FN4A 1Z6QA 5E7QA 3K6JA 4FYPA 3EXEA 3ISTA 4JQOA 2ICAA 2X0DA 4DL9A 3BCRA 2AXEA 3NATA 2I54A 3CKKA 2WAXA 3P2EA 2IDMA 4HVLA 5C2JB 3QENA 2PWYA 2QZ4A 1JDTA 1VDZA 3JQ6A 4C4TA 1IY9A 4CLXA 3NO4A 3TS1A 2VAXA 4MKHA 1WXHA 1X80B 1V8ZA 2CJYA 3SC2B 3QXGA 4GDFA 3L49A 3WWCA 2JZCA 3EG5A 1XZDA 5EWMB 3VDNB 1FS5A 2PM8A 2XT9A 1XA0A 1XTRA 4YJFB 3AOEC 4WH0A 4ZQBA 4ALNA 5JDIC 1DLJA 3ZGLA 2PUCA 1HFKA 3UMMA 3E9QA 3RUEA 2FUCA 1J6UA 1N8NA 2WF9A 1I3NA 3F7MA 1RC1A 3ZZ0A 3TIVA 2CSXA 4NDAA 4A2QA 1SMKA 2HBYA 1HA3A 1FNMA 4TRJA 1Z4MA 3QHPA 4YQZA 4FFVA 3RPEA 1HE5A 1KJJA 3LXUX 3CCBA 3DPIA 2JAXA 4IHJF 5CBPB 1KI7A 1Z12A 2F3QA 5JECA 4WNAB 3ZWYA 4UTXA 1FP2A 3SHOA 2JG3A 1C3XA 1Y80A 1OLUB 4M7PA 2QK4A 3KEOA 1NVVR 4QUIA 4H7DA 1TO6A 4R4JA 7AT1A 3CTMA 3O8BA 5LQRA 1AV6A 3LQFA 2I4MA 4FFWA 2PL5A 1KMHB 1GPLA 1QV7A 3VAZA 4P84A 3V8PA 1VG0B 4BO9A 1AY0A 2AI2A 4RYDA 3VSBA 3HJTA 4C3VA 1TCBA 5EMHA 4KR2A 1C3VA 1XLTC 2AXPA 4MS1A 5AI5A 4JP5A 1T5TA 1R6DA 2FZKA 3TTWA 4LXQA 1HYQA 3M6VA 3I6ZA 2CXRA 1SULA 3JWGA 4MKRA 4MS3B 2J0SA 2AOUB 1NVVQ 3Q88A 1UR5A 4RK7A 1HZZC 3ZXSA 1JG4A 5FWXA 2VS1A 3NALA 3SM9A 1KFCB 4DREA 5JJBA 5E8JA 3D5EA 3VR6H 5FEMA 4QULA 2GBLC 2JARA 1KQGA 5JMWA 5F98A 1QBKC 3AWIA 3CPJB 2BW0A 2VF7A 3LP6A 4QAJA 4RQUA 2YVAA 3UAXA 1Q57A 3WL3A 4OFZA 2FUNB 2PGDA 1CXZA 4HFNA 4MA5A 2BGTA 2EJUA 3RFFA 2QRJA 1GFWA 3FWNA 4PWZA 1MVLA 4PHGA 4ZA2A 3U7HB 4X41A 1SCIA 2R47A 4JHXA 3C4VA 2PNFA 4OXXA 1GN9A 1HEYA 4UHCA 3OZIA 3GUHA 5D3MB 2FR8A 1G20A 4JU8A 5THKA 1G8YA 3UG7A 3W6NA 4PRLA 1F17A 1RM3A 2ANCA 1FDOA 3ZZ1A 4MLPA 3AVTA 3K1ZA 5JC1A 3Q7SA 4FOOA 3OSUA 5L3QB 4I1IA 1ZVJA 3FWKA 3LVRE 1U8FO 1JAZA 1HYEA 3NR2A 5D87A 4D9JA 2VG8A 2YIJA 2GAIA 2HT1A 4BTLA 4YI5A 4G8JA 5ALJA 5FTWA 2WPNA 2NZ8A 4UUBA 3K1AB 2VP0A 3HABA 3OZFA 4F93B 1PFGA 2J7KA 3CF4G 3OTWA 3OETA 3MQ4A 1LBIA 4G56A 4MXDA 5EMJA 3FTFA 2AW5A 4TX1A 2F43B 1K3TA 3QX8A 1EFPA 3ZWVA 3WB9A 2VJDA 3Q2KA 4YALA 1VCIA 3GLQA 4F9TA 1MX9A 2GM9A 1NT2A 5DXAA 5IFLA 3OA0A 5B4VA 1NMEA 3PGLA 5ABPA 2YJ6A 3DMDA 1U9JA 1IZZA 2WU8A 4NMMA 2Y4OA 5CFOA 2ZRNA 2WNIA 5FL7A 1P0FA 3OCZA 3AI7A 3U4IA 2J6CA 2KW5A 3DBIA 3DMNA 3DD1A 4MGEA 2PH1A 1G38A 1R66A 1M2OB 1OYYA 1YVRA 4S1WA 3ZHVA 2OYRA 4JGIA 2I2WA 1E2HA 4TSKA 1YQWA 5TQ0A 5KB3A 4RHEA 4ZFNA 2HBRA 3I72A 1UBLS 4PPGA 3KS9A 3K0SA 3OIVA 1C0KA 3SQDA 1QAQA 4I4TF 1MZVA 3DE7X 3W5CA 3WKCA 4KACA 4I3HA 2IUSA 4E5KA 3Q4GA 1UWLA 1SVLA 4WKGA 4HJXA 3DFKA 4R8VA 4EPVA 1FFHA 1JEDA 1TCUA 4JI0B 4E5UA 1IVYA 4N1AA 1RM4A 2Y1XA 2J3HA 3L84A 4D96A 1WTCA 2XE7A 2DPXA 4RV5A 1ZA2A 1VHJA 3WDSA 3ER8A 5DK6A 1PLLA 1HRDA 1UPFA 2GZ1A 4ZEWA 2CVZA 2O2IA 3GJ5A 4I1RA 4ARZB 3ID6C 4HXGA 3T1OA 2GD6A 4ZMSA 2A5FA 1Q6YA 2QW8A 5F21A 2LV8A 3EVAA 5GWXA 1EUQA 2HF8A 2OHVA 4C22A 2P3SA 3TIXB 4WEOA 3M5DA 3NBFA 4ALLA 1ORHA 3GJ6A 5FD8A 3UT6A 3SHVA 2DQ4A 4HF7A 1NXXA 4YX9A 3GT4A 4TKUB 2NXWA 2LR0A 4GLBA 4POAA 1MC5A 2ZJFA 2D4HA 2IEGA 4B75A 3DC7A 2VZ8A 3OPMA 2GA8A 1CR1A 4ETWA 3N6XA 5FI0B 3F3KA 1JHVA 2CNBA 1ZH6A 2Q62A 1MEJA 2AG1A 4TWJA 2J0VA 2B61A 3FYTA 3S1AB 1GGJA 5LA6F 4BEJA 2XD4A 1RJFA 1LFAA 1VLMA 3AUUA 3IQXA 1RI2A 1OFGA 2G6BA 2ZJ5A 4GPIB 1KWGA 1G5QA 3ZZMA 3V1KA 3JYLA 1A98A 2AMYA 5HS4A 4YRSA 4ZEVA 1KEWA 1C14A 4HGZA 1CF9A 3ZXIA 2ZB2A 2WP8J 1DUSA 3LHKA 3K9FC 1JWLA 3C3WA 1YS7A 3DE3X 3QOYA 2JFPA 1PZFA 4RFSB 3U1TA 4DMRA 3BMOA 4S1TA 4EVSA 1LPBB 2Q3MA 1EFVB 2FZWA 4RVCA 4CM6A 3IH5A 3VR3A 2LWIA 1F20A 3OE5A 4XX0A 4Y2UA 5F1PA 1KZ6A 4YPOA 1D9XA 2GBCA 1P1KA 5IJZA 4KPGA 4CPDA 2Z5LA 4ZI3A 3NM6B 1OFVA 4OBXA 4DMKA 3B1YA 3DNMA 2H29A 2GSDA 3X43A 3CT4A 2GK4A 3VHXB 4WBNA 2HF2A 1V8FA 2IY7A 4ESVA 2NZXA 2E4UA 3JAKB 1ZSYA 3G0BA 3VI3B 4HGYA 1GZ5A 2R7MA 3WLKX 4C03A 5JZMA 3RUIA 1RWPA 1A7JA 3SOPA 4PRYA 2WDPA 1PTJC 4Q7QA 3PUIA 5IG2A 5K7SA 1J8QA 4KQ6A 1Z63A 3FFWA 5ITZB 3PRJA 1IZ7A 2GN1A 2P5UA 4RETA 5EWMA 5F2NA 3P0RA 1QP0A 3FY4A 1YU9A 4OG2A 3QMWA 3UG6A 3ZY6A 1ISSA 4HDQB 1N6PA 3FETA 1OTHA 1RYMA 2P2YA 1D2CA 1TU4A 4AX8A 4WN9B 1S8AA 1HOXA 3UWMA 2GJ9A 5JCJD 5AH0A 5NLLA 2C5LA 3KXKA 3C24A 3BDVA 5DF1A 2J3KA 5HBGA 5IUNC 2Z2ZA 2HA7A 2ZJ3A 3OFNA 4OJKA 3PNPA 4R5HA 4XARA 5J3JA 2Q6OA 4YRFA 1CLUA 2HQOA 3G13A 4AJKA 4LGCA 3AEYA 4CTMA 4IQ8A 4MRMA 2X5OA 3VR4A 5J1SB 2PJRA 1GL9B 10MHA 3BXFA 5IBPA 1UZLA 1H2RS 1FDUA 1HQCA 1KGSA 1T9DA 1VIYA 1RYDA 3HVJA 4ZQCB 5FTJA 3RUDA 4DSNA 5HZMA 5JYDA 4HATA 4J0DA 1K2WA 4LYGA 4OHZA 1E3JA 2M6KA 4KVGA 1K9VF 1P5RA 4DQLA 3L05A 1FFBA 2QTCA 5E3IA 2E2WA 1RPJA 2ET6A 2WDZA 3HP1A 1ORDA 4BNDA 1FUEA 3T5GA 1HOTA 2WT4A 4N0EA 3JPYA 3N8NA 4W1SA 2OM6A 4AM8A 4HQOA 2YZ2A 5IT5A 1ZIPA 2FEWB 4A6EA 3LKBA 4DILA 2QN8A 1QGOA 5CLFA 2X15A 3A6JA 1NYRA 4LZAA 3MWYW 4ZQGA 3OLCX 1L5WA 4IMPA 2J3MA 5KTOA 4LXIA 2G9ZA 5CLJA 3I52A 1IK4A 1RWBA 2VK1A 3T7IA 2OPHA 5HOEA 2ATVA 3A4IA 3U7QA 5D6OA 1RC0A 1P3Y1 4FFBA 4IX1A 1THZA 2OV3A 1I8TA 4HGQA 1HRKA 4LKRA 3BQ9A 1HKHA 2IT1A 3HO6A 6PFKA 3G9TA 1W5TA 2ZEJA 3QXXA 1P4RA 1S2IA 2XZPA 2NTVA 2Z4RA 3GEBA 4DV6B 1BWSA 3F49S 5K3FB 4TQ9A 3BRQA 4Y0VA 4DJTA 4OHBA 3ZQ4A 2NVBA 4UREA 2E49A 1L4LA 2PUFA 4NU6A 4W1RA 1MDBA 4FB5A 1U8UA 3BE5A 4D56A 5BMVF 4DM7A 1B1AA 2QQ0A 1TLFA 1SHZA 3A9CA 1JECA 2K7ZA 4QYXA 3ANLA 4QLOA 5C1IA 3ROTA 3T5CA 3D1VA 3ZNQA 5A1JA 1XJ5A 1WUIS 4LRWA 5FPHA 1UPXA 1W5SA 5AK5A 2RMKA 4N8EA 2P90A 5KNLA 2ODNA 1G19A 1PW7A 4UUAA 3WL8A 4W7SA 4COKA 1XRMA 1UMDA 1TZMA 1V48A 1E5VA 1ONSA 3QWAA 3N2LA 3JPWA 3ZUPA 1MJGM 3SGLA 1R3UA 4JI1B 2HA3A 1E6CA 4J91A 4DLAA 4F5WA 4ARBA 4E2FA 1M1NA 4I55B 1Y8QB 3QYJA 3QJYA 3LQ1A 3R3VA 4ZDWA 2O7VA 1WCWA 4RCYA 1LDYA 2FF7A 1R64A 4NJMA 3WKEA 3H17A 3ZIAD 1XQWA 2KX7A 4M99A 3QUBA 3H1GA 4O2RA 2ZE6A 3PSAA 4FE3A 1Q50A 1OOEA 3PD0A 2JI6A 3RS5A 1UUFA 1V45E 1HTTA 3A3NA 4L3WA 3ZW9A 2BD0A 4I50F 2JIMA 2B99A 3G68A 3U39A 1U2QA 1T2NA 4IDEA 1KP3A 4L9SA 2XD9A 4CV2A 3PR1A 4X6UA 4DUGD 3SQNA 1GG9A 5K6RA 5HTOA 2O8EB 3EF3A 1JFVA 2WBLC 3VTZA 5T7BA 4B3RB 1H9AA 5CHYA 3GYBA 4WI1A 1A8IA 2PS0A 3UCXA 2H65A 1FFCA 3DGFC 1YI0A 3IP8A 2C2XA 2ZUCA 1UKYA 3GZNA 3HWX1 4C0HA 1D5CA 5BV1A 5K6TA 5FPQA 1E2BA 1KNQA 5K3CA 3JSXA 2PYZA 5T5QA 2WSMA 3LHSA 1BHSA 2FJPA 4MUEA 3I61A 2ZB8A 3R3WA 1NIPA 2BRUA 3C97A 5DKFA 1NU6A 3W7BA 1CB0A 2H4JA 2QYTA 3M6UA 4A1FA 3HYTA 3CLVA 4B0OA 3EIUA 1K68A 1NBEA 2BL4A 5CVVA 1L5YA 2J3IA 3DJFA 3M6MD 4KSBA 3S7ZA 3BJEA 5TMDA 4BP3A 2Q4OA 2ZRPA 4UOZA 2Z5GA 4MLDA 4DB2A 4KR6A 1ZGJA 4R1UA 4W6ZA 2W58A 4UASA 3IDFA 3RNOA 2OORC 3AGQA 3DZIA 2X86A 3GGPA 4HNUA 5KX5F 5LMUB 4C7MA 3NHWA 4KBYA 1ECLA 2RHWA 4K86A 1DBPA 2IZ1A 4N49A 5HEKA 5JVDB 4AJJA 2ZREA 4U8GA 4TSRA 3JZMA 3TNFA 3USCS 4IEIA 3V33A 3RH0A 5KWEA 4M9XA 3R6LA 1GOTA 2BFCB 4FFOA 2VR1A 2D1QA 3GBPA 3OQJA 4WDQA 5IABA 3T99A 5CIWA 3GGOA 4ARIA 1NI4A 2G36A 4TV9A 4UOQA 2C7OA 4A0HA 4YT8A 1USKA 3IOMA 4F4HA 1IMOA 2QMQA 3AETB 2Q5IA 3L0YA 4G23A 1F0KA 1VIVA 1Z26A 2FW6A 4X84A 2KLHA 1NKVA 2X1HA 4JFAA 5EZQA 4AUMA 2NW6A 5A0TA 2XYVA 2CXOA 4BZQA 3GRCA 2EIHA 4KTVE 4DPKA 1L4NA 1WRBA 3EIXA 3ELYA 4E46A 1GKLA 3E7FA 4O4JB 1W581 4ZTBA 4DNQA 3UJAA 5CITA 1RTTA 4JJ8A 4OGGA 1W87A 1NF8A 1X7DA 3M81A 4YXWA 3A4NA 1CPYA 5DLPA 4YAUA 1DO0A 2C29D 3L1UA 4JP3A 1CY0A 2QR3A 3KKLA 1Z8NA 2FFBA 2QVCA 3WFIA 2O59A 2SNIE 1I2CA 3MRTA 3BD8A 4U2GA 1CUZA 2R6ZA 1BW9A 3QXCA 5IYZB 5BSFA 4MYHA 2C3PA 3ZWCA 1KPHA 3G59A 4YIHA 1V4VA 4QDZA 4YB8A 5LLDA 1TK9A 2ZQ5A 2OOSA 4G1BA 1YZVA 5KHAA 2OV4A 4L73A 3WZ2A 2VJLA 2SHKA 3EAGA 1MOQA 3U0BA 1QZ3A 1I94B 4D99A 4GZ3A 4NONA 5CNKA 5ALVA 1KAOA 5HFAA 5JZSA 4V3BA 1GFSA 3T0IA 3ODPA 2V45A 1UMCA 5DULA 1L5OA 3WY9A 4FB4A 3OZTA 1XDSA 4GW3A 3A1TA 1GV0A 5EJ9A 3QU4A 3R2JA 4ZT6A 1UOQA 4M87A 4A8HA 5IVKA 2AUMA 1CP3A 4JT9A 2RK3A 2YDYA 1E2FA 2XMGA 1TECE 2YZKA 1FFXB 3I1YA 4LY9A 4OHKA 3KK0A 4D6YA 4E11A 1SUFA 2RK6A 1N5LA 2DAPA 4L9AA 3RUFA 4BFXA 2XCQA 3KEFA 4PX9A 5LD2B 4Q37A 4CM9A 3QZUA 1KO8A 2ID4A 1FMLA 1PNOA 3HVIA 2VF4X 2BFMA 1TA9A 1Z37A 3B48A 5ALMA 3ZX5A 3G1UA 2LIPA 4RLSA 1L7EA 1N78A 1K4MA 4HVAA 1PJSA 1UQUA 1SJ9A 9LDBA 1F3OA 2Y0CA 4QIHA 2ERXA 1UF9A 4LNUB 1KFEB 4IMRA 2PFKA 4DR4B 4D3DA 1ZCFA 2G40A 4H7EA 4LYFA 1CHDA 2NTJA 1Z6AA 4EHLA 4HFMA 4FILA 4HDNA 3F0TA 3G6WA 2W71A 4OQFA 4YR7A 4TTAA 1ZNWA 3JTEA 1Z2DA 2JATA 2GEJA 2PVSA 3OLZA 1UK7A 5JSYA 4D92A 3OD5A 2H8KA 2R11A 1O95C 5AI8A 5K0LA 5CA1A 3IURA 4J9UE 2IHNA 1N2IA 2Z5VA 4G01B 5AHKA 4DDMA 1M34A 3CNQS 1QLHA 4N6GA 1GLNA 3K8YA 1SEVA 2NX2A 5DOVA 3H75A 3FROA 2DUUA 2W0SA 4LN1A 3K0EA 1MAUA 4TV8F 4XQ0A 4XWWA 5I51A 4M0DA 1D0SA 4L5BA 2H00A 4OD0A 1W6RA 5FRDA 4CM4B 1I14A 4IVRA 2XUQA 3C48A 1PJ4A 3DDSA 3GYGA 5IFKA 5CCEA 2CLMB 1N3IA 3DNFA 3OJLA 2V96A 4EG8A 5C51B 2C7GA 1P74A 1SG6A 5JTTA 1ISPA 2RIPA 2WD9A 2YCLA 2QRUA 1QAOA 3E27A 2ADMA 2QJWA 1IVNA 1PZGA 3R5HA 4D41A 5JBQA 4L5JA 2YUTA 3GCXA 4O0MA 2IX3A 3AZPA 1WVIA 3ORRA 1A9XB 3GGGA 2Z9BA 2ZQYA 3ZHZA 3E9CA 2OCXA 4C6TB 2JRCA 1S3SA 2G67A 2P9EA 3HUDA 3NHUA 3PUKA 4IXMA 2GAAA 3AB8A 4J7UA 4KDCA 3VU3A 5I01A 4M4SA 4JXXA 4D80A 4N48A 3KYCB 3EXG2 3PRYA 4FGLA 2X77A 1J2TA 5JDIA 4G5OA 5DGDA 4TLEA 1XBTA 2X0JA 1TL7C 5B64A 1OLXA 2R2AA 2NXEA 3NVMB 2JFFA 2ZPTX 3AVUA 2RH8A 3PU6A 3OG9A 2QAGA 4PTZA 4WNCA 3D81A 3UW3A 5C4GB 1I0LA 3G2HA 3HH8A 4QVGA 1KK2A 4TXLA 4BIMA 1YOBA 2EQ5A 3CGWA 4TTTS 1D1SA 1JR3E 4MUFA 1T29A 3ENWA 5ETJA 1SO8A 3RWMB 1PJTA 1DJOA 1ZM9A 3TR0A 5L4LA 1BCRA 3T1HB 2OXIA 5KAPA 4DC0A 5J23A 1NVGA 1ZITA 5GONA 4MKZA 3K9NA 5BT9A 3EGDB 3HN2A 3LZDA 3HSYA 4MRSA 3AHCA 5EPEA 3FB1A 1RLTA 2GZDA 3GHHA 1BZYA 5KNCD 1OH5A 1X92A 2OM2A 2H18A 2I22A 1SC4A 1XLTA 3HA3A 4JR0A 3TL3A 2O8CA 3SZRA 5IKPA 1IRIA 3ORSA 1JJVA 3ETEA 4JSRA 4OEHA 4P5EA 1RZVA 1Y1TA 3KCNA 5LZ4A 1HDXA 1XLUA 1O94D 1HZZA 3EMBA 5LB2A 3DBLB 4NEGA 4GAEA 2IV7A 3IVXA 3AM1A 1EFCA 2C3YA 1FVHA 5IVHA 2FX2A 2H8GA 3I3OA 2MSEB 1WM1A 5AMXA 5EIHA 1A8HA 1JI0A 1ULHA 4QOEA 1ECCA 2KYRA 2HNKA 3IODA 1MQSA 1UBHS 1U8YA 1DXHA 2B3TA 2HJVA 2PVCA 2WSSA 2YYAA 3A1SA 3F5QA 3FSGD 5IH3A 3A6EA 1PNVA 5JD6A 5JFOA 2FEPA 2OAEA 1BE0A 1JDBB 4MWBA 1GQRA 2BP7B 2G3YA 2HEIA 1IUOA 1Y9EA 3DCNA 4RTQA 3OZDA 1G55A 1NBMA 4BECA 4DQVA 4HLDA 1BWQA 1VIAA 1KPIA 3IOEA 1EFLA 3MVEA 3DOFA 1I6MA 2W37A 5E6RA 2MIIA 2XUKA 3SSNA 4E2ZA 3GUYA 1C80A 3DTYA 5I7WA 1NVAA 3ND7A 2VQEB 1HTBA 3MTAA 2QW0X 5C3MA 2HJSA 5ALDA 5KTYA 4J2TA 1KPGA 4QEKA 2J4FA 3CZRA 4Q9AA 4UHBA 2CXTA 3DFFA 3K70C 1ZOOA 4KMMA 4TMVA 3RIYA 2GBFA 3QEMB 2VNKA 4US2R 4K46A 4XA8A 3M1YA 3QF7A 3TQRA 2QMOA 4FZVA 2GA9A 4F9EA 5EJ7A 1KAMA 1SELA 1TAHA 3BQNB 2K87A 3QKSA 1QUEA 3ELDA 1ACJA 4D5EA 2YS7A 4QLBA 4AU1A 1MD9A 2YC4C 4OM8A 2C2BA 3O73A 2ZITA 4MVJF 3NPMA 5EMKA 2JEYA 3QV2A 3FR8A 2I3GA 2VBGA 4QYWA 1EUYA 1NVMB 3ITNA 3O93A 5FBVB 3ADCA 1GPDG 3GJ3A 2RSLA 5L4NA 2PE5A 1ZRSA 4LECA 1YMVA 4CKCB 3OMLA 4ZI7B 1KL7A 1LPOA 3ZU5A 1M0TA 4MB6A 5FUWA 4KV9A 4YJ3F 5D6NA 5L7WA 1P9RA 1AGRA 1T0UA 1P1HA 2QMEA 3IIMA 5CM9C 3RCBA 3BMNB 2IZ5A 3DBOB 3PGA1 2QQEA 3U49A 4YCDA 5JS7A 3OOWA 1V16A 1EB8A 5AHOA 3RTAA 4U7WA 4PNHA 3NG1A 4V38A 4G9BA 1T91A 4JJ7A 4RCZA 1XN1A 1M8JA 1OD6A 3IULA 2O5CA 1DARA 1JI3A 4XPIB 5CU7A 2LP4Y 3CX8A 3CUVA 3JQ7A 1UP6A 1CK4A 1KZ1A 4AB1A 3S8MA 1FIUA 5CEFA 1S2MA 1CZKA 3OQMA 3DM9B 5AVRA 2Y2VA 1YQ9A 4U7PB 4X7RA 2A92A 1MGOA 2GD0A 4WPGA 3I62A 1J9ZA 1R0ZA 4DJDC 2DQSA 3SC3A 1ZL2A 1QYDA 4Q93A 1V1JA 5GJBA 4QJ4A 1OQAA 5HKLA 3LO8A 2EFYA 2J08A 2FQWA 4YDHB 1OZAA 3V1YA 4IINA 3FSEA 4NMHA 4QFDA 4YAOA 3I5MA 4Z7NB 4AAYA 1Q0TA 1TM1E 1XU9A 1SCJA 4V0NA 4J4TA 4PWYA 2QMZA 1G3QA 2ZVJA 2R7NA 3UXEA 3IP3A 4DJAA 1PS0A 4R71A 1PG0A 1N8SA 4F5EA 2FF5A 2ZBFA 5LYJA 1JE0A 721PA 1PDWA 4FUTA 4OJTA 3E8XA 5TB5A 4F9GA 2G82A 4F4UA 3S5UA 1Y5MA 3N5KA 1Q2XA 5BSUA 4CIDA 4Z5XA 3G5MA 4PONA 1OBOA 5EXXA 2JLXA 1SCUB 2QYOA 4A8TA 3QE3A 4IZHA 1DB3A 4AZ0A 2DY0A 2G5CA 3OKPA 4MGIR 4Q00A 3V9PA 3TX2A 1LXCA 5J9FA 1WUYA 3IXMA 4HTFA 1V7PC 3FM9A 4HAWA 2WVGA 4AO8A 1IB6A 2WIJA 4JELA 4CG2A 4OJYA 3PTLA 1YDEA 4ZVVA 1GARA 3KR0A 5CB4F 3R6GA 5H3CA 3PQEA 5REQA 3B9QA 3Q7PA 1JG2A 3TQCA 2PMFA 3ZKAA 1XPRA 3NCHA 3QPVA 1KOFA 4S1VA 1UWKA 2ARKA 5HF5A 4B3MB 1VKRA 1XRQA 1Q7EA 2YMLA 4XCXA 5FOWA 1J06A 3E5HA 3UM9A 8ADHA 3DBHB 1R37A 1E6KA 3O75A 3VMMA 3P94A 5JS6A 1A5SB 3GAZA 2WAAA 3HJNA 1Y82A 1QV6A 3ESDA 2ZDGA 4B6FA 3C43A 3E9NA 1K08A 4XTCS 5JARA 4BRSA 3BRCA 1C7RA 3NH9A 4OTZA 2ANBA 2PL9A 2O0KA 4NE9A 2B2XA 3BH0A 2OBXA 1WWKA 3FI0A 5FHQA 1WHTB 3GA5A 3KZOA 2XQFA 2VJNA 2YHUA 1JTEA 1RMTA 1D2GA 2BF7A 2O7SA 1T3ZA 4RZ3A 3WLIA 2JGEA 3ZNPA 3DAYA 1DKOA 3KYDB 3WAKA 5KSPA 3NOOA 4RC9A 1V6SA 1PTJA 4Y6RA 4Z0NA 3SZGA 4A6XA 3NAQA 2NADA 2XUJA 1NF3A 3T52A 2HU8A 2RHJA 1AC5A 1N5KA 3VNBA 4YO7A 1NG1A 3QITA 4IV8A 1YT5A 4D44A 1BYUA 4YR9A 4WJKB 1O08A 3MGCA 4PZCA 3THSA 1XZBA 4UTVA 1XZAA 1R8JA 3O47A 4UBLA 3O2SB 2HU5A 2JHPA 1P0CA 5SV2A 1YIOA 4RX1A 3RARA 4CCYB 3NAMA 4XJSA 1NOKA 1IVSA 1XVUA 1Y1KE 2JAPA 4NHEA 5AT1A 5JT1A 4O4IB 5IK2A 2C2OA 3SY8A 1AZLA 1E18A 1XEFA 4DUYB 2QX8A 3FKSD 1MO3A 3KD2A 4FYKA 3VPXA 3TL2A 1T2AA 1Y33E 2A2ZA 1SC6A 1BTOA 2OV6A 4H2DA 5E4FA 1QBGA 1QUFA 2JI7A 4GKJB 3QPCA 1E4VA 2PPLA 1UBNA 3D7NA 1RHKA 3PENA 4HNSA 5HKBA 2VRWA 3PXXA 1G7SA 4HNQA 3HGQA 3K71B 5EJ2A 1ZUWA 2X7XA 3ANTA 2QP9X 3EY9A 1CBUA 3HBFA 1JEYB 3W5UA 1JN0A 3P97A 4ZQFA 1IN7A 5F9FA 5JANA 3WB2A 3HBNA 2HNAA 1K6XA 1PS9A 2R86A 3VX3A 1EUCA 2A1UB 3N05A 1BOFA 5K09A 3WAGA 2P3QA 7MDHA 3AL2A 1YVUA 4LVOA 1TRKA 4LDJA 3TTTA 1TAUA 3VDMA 3A25A 5FOQA 3CY6A 5IEBA 2CK3D 4D8YA 1FQWA 3QNWA 4FHDA 2FW1A 4G0PA 4D9KA 1T1JA 5EHIA 1OJ7A 3D2LA 4ZQEA 2ZPUA 1WNTA 3FYUB 4XYGA 1UC4B 3EK2A 4K6FA 1SD1A 1Z07A 1V9CA 5LC1A 2CC2A 1A8QA 1JMKC 1UEXC 1YB7A 4DE5A 1MC1A 2PMWB 4XDHA 1E0DA 1X1TA 2ODTX 3LPCA 3WLSA 1KAGA 2WM8A 5G0SA 5KKAA 4NCBA 2H59A 4UDOA 3ICQB 3U4QA 2H1FA 4AJ4A 1OUMA 2CXUA 1XVLA 2QXYA 3TBFA 1BN7A 2IW3A 1G4UR 1KDYA 5DJ5A 3AXTA 3OOHA 5EJMA 1UQTA 2ZXEA 3PNBA 1TVCA 4GMDA 2PO5A 4DIEA 3OKFA 5FFNA 4CTJA 1O4VA 3EFBA 3WMWA 1ILWA 1JBKA 2FU5C 3S7TA 2JBWA 2MSLA 1E61A 4RK1A 1WV1A 4HH3C 3IEKA 2VT6A 4GX5A 4PS0A 5A3QA 2YOFA 4B09A 2GVZC 3RBVA 4P2GA 1F4VA 1I30A 2OD2A 4CVNA 2ZM5A 3ZNNA 2CZGA 3DHNA 4DIFA 2IEIA 4QPCA 1UDBA 3ZWDA 1FU7A 2A4KA 1R8QA 2M1ZA 4E5YA 1NQVA 1PR9A 4YJHB 4BN4A 1RWNA 3HHPA 1N5JA 2XAUA 3GP5A 5EJ6A 5JJIA 4RHFA 1K8XB 2AVDA 5BN5B 4B80A 4OSOA 3C70A 3FCUB 1PJLA 5BQ3A 3ZZUA 1NJ8A 1U04A 3B3GA 4GBMA 2KJQA 2XYPA 3Q0IA 1SU8A 1MB2A 4U2BA 3LA8A 4UM8B 3U80A 5CDYA 2J3JA 1OB5A 3FNRA 4LXHA 1FXUA 4Q0MA 1OX4B 1WD7A 1ZI9A 2DVMA 4CEHB 3ZGZA 4WNIA 3ZS8A 5TPWA 3PFCA 4EQ6B 4HWTA 5EP3A 3ELUA 1E4OA 4CLOB 1MW8X 4IDBA 2KE5A 1EDEA 2E1RA 3C85A 3OEWA 1EVLA 4EO9A 3WZMA 4N0PA 1E20A 4KXXA 4GIBA 4IGKA 5DMXA 3EQZA 2XNDA 3K05A 1YMUA 1KI4A 5JJCA 3TUIC 4G2NA 3ZU4A 2I66A 3A1CA 3O4HA 4M1QA 1SPXA 3PFGA 4D97A 1F7VA 1VRCA 1EQ2A 2G8NA 4HYQA 1EFUA 1PJ3A 1PYDA 1R16A 2UVQA 3H5IA 4HNGA 2KWIA 4ZANA 3T7TA 3VR1A 4GZLA 5BVGB 4J0KA 2PUTA 4IAOA 3GL9A 4EB6B 3KQPA 2OE2A 3PA8A 2QDXA 4W8OA 1FFDA 1P4HA 2X8BA 4N5HX 3KUDA 3LD9A 5JSKA 3TLZA 2CFRA 4XEHA 2QYHA 4UBOA 1ORIA 2IYVA 5GTDA 4QQFA 2B4RO 4B47A 4BYMA 4U63A 1ZHHA 5BPHA 1RCFA 3OC6A 4Z4IA 3LC1O 5LIPA 1KJYA 4IJWA 4P7JA 3D4PA 1U2RA 2GCOA 1E3MA 3COSA 2O1WA 4W5HA 4CYMA 3OPNA 1DUIA 4KN8A 3TWOA 1IHXA 1Y98A 1FYDA 1YL5A 2WP0A 2D1YA 1NVKA 2HFJA 3P0FA 1RE1A 4D81A 3Q9NA 3HJHA 3F6CA 1S5PA 3QVGA 4Q21A 3PRKE 1EQUA 1ZJZA 2CB0A 1JZTA 1M1XB 1XQ6A 2YWFA 2Z6VA 3NTOA 3RIXA 2RFLA 3VPFA 5KJCA 2XHEA 1C0LA 4WTOA 1XWIA 2F48A 3QV1A 4MR9B 4DXDA 1VKHA 2KBFA 2VNAA 4F96A 7REQB 1X7YA 4XIIA 3RSGA 3QBTA 3F8WA 5EXEA 1T6XA 4BP1A 4LKOA 2BE7A 2JBAB 3H0KA 1V11A 4PBSA 2IHVA 3PQ7A 3OLYA 4OJNA 3K30A 4DWJA 5IVPA 1O6FA 2QAIA 3FZNA 4PSCA 4OKIA 1UK8A 4HSEA 5JSHA 2GZSA 4H1WA 4RTJA 2C83A 4BNUA 4BHTA 5HOQA 1JLHA 2DJIA 3W8EA 4DRYA 1NNI1 4QOIA 1DI0A 1KEEB 2R65A 3X1MA 4QO7A 4CMIA 3A26A 2WWFA 4K81B 3L7KA 3QELB 4FFDA 3AC0A 4ZAFA 2BM9A 2V1UA 5AM4A 1FNNA 1KERA 1C3LA 2QOEA 3CC8A 2W6ID 3KTOA 2ZIXA 3QXJA 1UWVA 5AHXA 3R8CA 2ZBVA 3EFEA 2JI8A 1CZHA 4YCAA 3SZOA 1ADJA 2EFGA 2DUNA 3UANA 1MEOA 1XCPA 5D84A 3AUAA 2BGLA 1WNFA 3OURA 1K3FA 4OGFA 4ZP1A 1JEJA 3N2NA 3GC6A 3P32A 2J9GA 1KJQA 2C78A 3AW9A 4IIEA 1XA3A 3L18A 3TSAA 3I0MA 1C7FA 5DDIP 4Z4QA 3WTCA 4CZ2A 1XNJA 4LZJA 4JL5A 2OGWA 2J9FA 3DZFA 1G20E 3WZLA 1BS9A 5B7GA 2B4YA 1E69A 2C97A 4YHHB 5K1ZA 1LPSA 1MOSA 1PZHA 2NVOA 3FRJA 4G37A 3MWJA 3ZQ6A 5EQFA 5KQLA 4JI7B 3O7WA 2DG2A 5ITVA 3PG5A 4Y6QA 1UQRA 4QPDA 4DZZA 4NBLA 1B42A 3D3JA 2RH5A 4KPFC 2C9DA 4YT2A 3COJA 5DM2A 3BH7A 2BMDA 1MEEA 5HRAA 1SVKA 2NPFA 1UZAA 4NENA 1E3WA 3JQGA 3RR2A 2YJ4A 2UXBB 1GNSA 4D4IA 1T5SA 3AGPA 3MJCA 1ZCZA 1W94A 3NDRA 4II7A 4MZDA 1RPZA 3PXUA 4IDHA 3CKMA 1NZJA 1QO7A 1CJBA 4MWOA 2Z2IA 5EXSA 3OP1A 4XE5A 3WRXC 3G8AA 1VE6A 3KAKA 4I14A 5E1OA 4RA9A 1GPJA 5DEIA 4L6CA 5HK9A 3IRVA 1A95A 3RK1A 3WAJA 3D6AA 3CG0A 3MTBA 4PM4A 1HQDA 3J7AC 5KWVA 1PV4A 2LW7A 1O95A 4H3KB 1G7CA 1FUUA 4DQXA 3UZUA 3HKBB 5EC8A 2F3UA 4JFRA 3MTDA 2PUGA 4DTIA 1BHO1 4Y6PA 2R8RA 2B0JA 4DLSA 1SZPA 1VTKA 2R48A 4RELA 1HG1A 1T3GA 2XQIA 4LFBB 4BXOA 2BEVA 1F5SA 3IAXA 1TT5A 2IYYA 1L7MA 1FXWF 1RRCA 4J03A 1C8BA 3S1LA 1SZDA 2X3UA 2A30A 2J45A 2FJUA 1AGYA 1Z45A 3AEUA 3AVQA 3RJ5A 2CJXA 3ACBA 3MWDA 3OKAA 2VTKA 3LU1A 1J33A 4LHWA 1C7EA 2DLDA 1UJ4A 3ND9A 1AHHA 1N6OA 1Z7GA 2PN1A 1V43A 3WGGA 4EKEA 5KQMA 2B8JA 4OI4A 1R6XA 4YAIA 3A6HA 5C31A 3OOJA 1AV7A 2IEZA 1GUYA 3NORA 1Y1SA 4J4HA 1KJ8A 2FW9A 4C6RA 1X9IA 3L1JA 4CIBA 2RKOA 2C4TA 3W2HA 4E30A 3B1JA 5L6LB 3QYPA 3LUFA 4FLFA 8OHMA 5AKIA 5T3YA 2ZUDA 2A84A 5HJ7A 5JALA 4RMHA 3BBLA 3U3OA 3CN9A 1C1XA 1XDGA 3USES 1K6JA 3VR5A 3ASUA 2GSWA 5T8KA 1N77A 3LCCA 4RL6A 1E9EA 1JQJC 1EKXA 3MTJA 5LBUA 5A71A 1YS4A 2Z43A 3H3XA 1JTFA 4BFWA 1F2TB 2P9QA 4UJ3A 4OOFA 2VBCA 2AG8A 3VU8A 4G0NA 2JLCA 3SXUA 5C53B 3TCNA 4EVQA 4BPRA 5DLYA 3WGZA 1VXOA 3ENNA 1X7WB 1PT5A 4GKKB 2AOWA 5LBTA 3T94A 1J0EA 1XALA 3BFPA 4IIBA 5J5AA 3U3KA 1OA0A 1Q12A 4XUDA 1VL6A 3D59A 4P80A 1FQJA 1Z4OA 2X2OA 1LSOA 3WLPA 3FUWA 1DBWA 1L1RA 5IJXA 2WYVA 3CX6A 2UUPA 4UUPA 2JLYA 4TS4A 3TEFA 4F6LA 4GU5A 1YHZA 2FEKA 4Y0AA 4BC0A 2IUYA 3L7BA 4G0WA 5AVKA 1W7AA 5BYKA 1YIDA 3GQBA 1QVAA 3JQ8B 5DGTA 5JMOA 5A5FA 3U56A 5BOSA 3I2YX 1XO1A 3UAOA 1ZK1A 4BGEA 1N6NA 2C57A 2X8WA 2FP3A 3QU2A 4G5QA 4OCZA 4S0XA 4QU5A 3L8YA 2QT9A 4NBNA 4HDMA 5HS6A 2IE0A 2OILA 1OFIA 2P65A 4RJTA 1OWLA 3EARA 1KDPA 5LXTA 1YAJA 4TS9A 4ZAXA 1O8CA 3UMYA 3VSCA 1NVEA 3NBUA 4NMLA 1E32A 2ONJA 4ZD6A 3UENA 1PJQA 1H66A 3N2EA 5AESA 2WLTA 2WYWA 4GR9A 5JZ9A 4A15A 4ZTZB 1YRWA 5B12A 2BEKA 2VJPA 2GNAA 4QJBA 3ETCA 1Z34A 3ISVA 3M1IA 4JA2A 1JKFA 3SIRA 1BRTA 1NMQA 1EE9A 1TVEA 3S2IA 5K3OA 4O5AA 2BOVA 3PLRA 5GJVC 1R8YA 2CJWA 2ETVA 2C8LA 2YNMA 2ZYRA 1Q44A 3QQ5A 4EJ0A 1QB8A 4DLYA 3MTQA 3O90A 4ZCIA 1DIGA 5C18A 4RTMA 3Q3HA 5LDHA 1JG3A 1Q15A 3ROPA 4PQRA 5A6SA 4WWHA 2IXBA 5TT1A 5CB6A 1TF7A 1LSUA 5EPUA 4ZGWA 2HRCA 2Z56A 1GL3A 2PSSA 1YE5A 3A3PA 4EGSA 3KZMA 3CVWA 2XITA 4I8XA 4KX3A 4AIRA 1LK7A 3DE1X 3H9CA 1VPLA 4FTWA 1A9ZA 2OHJA 4JROA 2GLUA 4LXUA 1NJFA 4XJXA 5CW2A 4ER5A 2XE8A 3QE4A 5BRNA 3TAUA 2IF2A 1Q19A 3K0FB 2GEBA 5T3UA 3PNSA 2QN7A 3C3MA 1GUFA 1NBOA 2EKBA 2MHCA 2Q4TA 4Y30A 3MJSA 1IPFA 3NP9A 3SQLA 1JEOA 3ZD6A 3HC7A 4UEQA 4ZOBA 4X65B 1JE1A 1FPQA 4CFSA 2Q2NA 2OHHA 2JBHA 1YJCA 3H0CA 2V7VA 1JR6A 2XQJA 1AUOA 5C1PA 1P3JA 1J2JA 4WUTA 5JRJA 3QFCA 4X20A 5FHRA 1IFXA 1MRZA 4IX9A 1UKAA 1KO7A 1M74A 3FN4A 1T35A 4MKXA 4PSUA 5EUCA 3ZWBA 1UEJA 4OLJA 3UMBA 1UADA 2IYRA 3KV3O 2XDAA 3AHDA 4PC1A 2P27A 3CUEF 3EXEB 3UH1A 4D9MA 1P1JA 5ARBA 1P0QA 3LVQE 3LXXA 3FOWA 3UWPA 3OPQA 2FE4A 1ZK0A