1NORA

Two-dimensional 1h-nmr study of the spatial structure of neurotoxin ii from naja oxiana
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
61
structure length
61
Chain Sequence
b'LECHNQQSSQPPTTKTCSGETNCYKKWWSDHRGTIIERGCGCPKVKPGVNLNCCRTDRCNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROTOXIN II
publication title Two-dimensional 1H-NMR study of the spatial structure of neurotoxin II from Naja naja oxiana.
pubmed doi rcsb
source organism Naja oxiana
molecule tags Neurotoxin
total genus 7
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1993-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1norA00
4HQPF 1CB9A 2OFSA 1CDSA 1NORA 2VLWA 1HOYA 3NH7A 1F94A 5DZ5A 1FRAA 5EBXA 1IDHA 2CCXA 2JQPA 2BTXA 1FF4A 3PLCA 1W6BA 3FEVA 1IDGA 3LAQU 1H0JA 1IJCA 1CXNA 1RGJA 3EBXA 4BDTB 2CRSA 1QKDA 2CRTA 1LSIA 3NEQA 1ZADA 4P7UA 2J8BA 1KFHA 3BT2U 1MR6A 1KU6B 1TXBA 1VB0A 2PJYC 1IKCA 2MJ0A 1BXPA 2CTXA 1RL5A 1L4WA 1NYUA 2MJYA 2UX2A 4ZQYA 1FASA 4QTIU 2BHIA 4OM4A 1G6MA 1QKEA 4UY2C 1TGXA 1KBTA 1LXHA 2I9BE 4RUDA 2PJYB 1JBDA 3QB4B 1B41B 1KS6A 1CRFA 1NEAA 2H62D 2QC1A 5DU1A 1KTZB 3EVSC 5IMTD 2H5FA 1S4YA 1KBAA 3KFDI 1JGKA 1NXBA 2NBTA 2X8BB 1LJZA 1KC4A 1YWHA 1KXIA 1COEA 2HLQA 2JVEA 1V6PA 1CXOA 4EY8B 1KBSA 1IK8A 2L03A 2QJAC 2H7ZA 4DO8A 3U73U 1CDRA 2H64B 4OM5A 1CCQA 1HC9A 2LA1A 2MUOA 1CHVS 2MUPA 1DRSA 2MHYA 1ABTA 2ABXA 1NYSA 2QJBC 1CTXA 5DO6A 1HAJA 1CDTA 1FSCA 1LX5B 1NTNA 1ONJA 1ES7B 2GOOB 3KFDE 1CODA 5IMYC 4AEAA 1LXGA 2FD6U 1IDIA 1CVOA 1JE9A 1BTEA 4LFTA 1TFSA 2H64C 1TXAA 1IQ9A 1KL8A 4XJJA 1REWC 2H7ZB 4IYEA 2CDXA 1ERAA 1NTXA 2MFAA 2H62C 3BT1U 1I02A 1HC9B 2UWRA 1ERGA 2GOOC 1QM7A 3VTSA 3HH7A 1F8UB 1CREA 1MAHF 1UG4A 2HLRA 3NDSA 2MJ4A 2N99A 1M9ZA 6EBXA 1IDLA 3ERAA 1FSSB 4FAOE 1CDQA 2QJ9C 3U74U 4BIKB 1FFJA 1PLOA 2K3GA 2H8UA 1XT3A 2ERAA 1HAAA 2L5SA 2LCRA 4FAOC
chains in the Genus database with same CATH superfamily
4HQPF 1CB9A 2OFSA 1CDSA 1NORA 2VLWA 1HOYA 3NH7A 1F94A 5DZ5A 1FRAA 5EBXA 1IDHA 2CCXA 2JQPA 2BTXA 1FF4A 3PLCA 1W6BA 3FEVA 1IDGA 3LAQU 1H0JA 1IJCA 1CXNA 1RGJA 3EBXA 4BDTB 2CRSA 1QKDA 2CRTA 1LSIA 3NEQA 1ZADA 4P7UA 2J8BA 1KFHA 3BT2U 1MR6A 1KU6B 1TXBA 1VB0A 2PJYC 1IKCA 2MJ0A 1BXPA 2CTXA 1RL5A 1L4WA 1NYUA 2MJYA 2UX2A 4ZQYA 1FASA 4QTIU 2BHIA 4OM4A 1G6MA 1QKEA 4UY2C 1TGXA 1KBTA 1LXHA 2I9BE 4RUDA 2PJYB 1JBDA 3QB4B 1B41B 1KS6A 1CRFA 1NEAA 2H62D 2QC1A 5DU1A 1KTZB 3EVSC 5IMTD 2H5FA 1S4YA 1KBAA 3KFDI 1JGKA 1NXBA 2NBTA 2X8BB 1LJZA 1KC4A 1YWHA 1KXIA 1COEA 2HLQA 2JVEA 1V6PA 1CXOA 4EY8B 1KBSA 1IK8A 2L03A 2QJAC 2H7ZA 4DO8A 3U73U 1CDRA 2H64B 4OM5A 1CCQA 1HC9A 2LA1A 2MUOA 1CHVS 2MUPA 1DRSA 2MHYA 1ABTA 2ABXA 1NYSA 2QJBC 1CTXA 5DO6A 1HAJA 1CDTA 1FSCA 1LX5B 1NTNA 1ONJA 1ES7B 2GOOB 3KFDE 1CODA 5IMYC 4AEAA 1LXGA 2FD6U 1IDIA 1CVOA 1JE9A 1BTEA 4LFTA 4KSNA 1TFSA 2H64C 1TXAA 1IQ9A 1KL8A 4XJJA 1REWC 2H7ZB 4IYEA 2CDXA 1ERAA 1NTXA 2MFAA 2H62C 3BT1U 1I02A 1HC9B 2UWRA 1ERGA 2GOOC 1QM7A 3VTSA 3HH7A 1F8UB 1CREA 1MAHF 1UG4A 2HLRA 3NDSA 2MJ4A 2N99A 1M9ZA 6EBXA 1IDLA 3ERAA 1FSSB 4FAOE 1CDQA 2QJ9C 3U74U 4BIKB 1FFJA 1PLOA 2K3GA 2H8UA 1XT3A 2ERAA 1HAAA 2L5SA 2LCRA 4FAOC
chains in the Genus database with same CATH topology
4HQPF 1CB9A 2OFSA 1CDSA 1NORA 2VLWA 1HOYA 3NH7A 1F94A 5DZ5A 1FRAA 5EBXA 1IDHA 2CCXA 2JQPA 2BTXA 1FF4A 3PLCA 1W6BA 3FEVA 1IDGA 3LAQU 1H0JA 1IJCA 1CXNA 1RGJA 3EBXA 4BDTB 2CRSA 1QKDA 2CRTA 1LSIA 3NEQA 1ZADA 4P7UA 2J8BA 1KFHA 3BT2U 1MR6A 1KU6B 1TXBA 1VB0A 2PJYC 1IKCA 2MJ0A 1BXPA 2CTXA 1RL5A 1L4WA 1NYUA 2MJYA 2UX2A 4ZQYA 1FASA 4QTIU 2BHIA 4OM4A 1G6MA 1QKEA 4UY2C 1TGXA 1KBTA 1LXHA 2I9BE 4RUDA 2PJYB 1JBDA 3QB4B 1B41B 1KS6A 1CRFA 1NEAA 2H62D 2QC1A 5DU1A 1KTZB 3EVSC 5IMTD 2H5FA 1S4YA 1KBAA 3KFDI 1JGKA 1NXBA 2NBTA 2X8BB 1LJZA 1KC4A 1YWHA 1KXIA 1COEA 2HLQA 2JVEA 1V6PA 1CXOA 4EY8B 1KBSA 1IK8A 2L03A 2QJAC 2H7ZA 4DO8A 3U73U 1CDRA 2H64B 4OM5A 1CCQA 1HC9A 2LA1A 2MUOA 1CHVS 2MUPA 1DRSA 2MHYA 1ABTA 2ABXA 1NYSA 2QJBC 1CTXA 5DO6A 1HAJA 1CDTA 1FSCA 1LX5B 1NTNA 1ONJA 1ES7B 2GOOB 3KFDE 1CODA 5IMYC 4AEAA 1LXGA 2FD6U 1IDIA 1CVOA 1JE9A 1BTEA 4LFTA 4KSNA 1TFSA 2H64C 1TXAA 1IQ9A 1KL8A 4XJJA 1REWC 2H7ZB 4IYEA 2CDXA 1ERAA 1NTXA 2MFAA 2H62C 3BT1U 1I02A 1HC9B 2UWRA 1ERGA 2GOOC 1QM7A 3VTSA 3HH7A 1F8UB 1CREA 1MAHF 1UG4A 2HLRA 3NDSA 2MJ4A 2N99A 1M9ZA 6EBXA 1IDLA 3ERAA 1FSSB 4FAOE 1CDQA 2QJ9C 3U74U 4BIKB 1FFJA 1PLOA 2K3GA 2H8UA 1XT3A 2ERAA 1HAAA 2L5SA 2LCRA 4FAOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HQP F;  1CB9 A;  2OFS A;  1CDS A;  1NOR A;  2VLW A;  1HOY A;  3NH7 A;  1F94 A;  5DZ5 A;  1FRA A;  5EBX A;  1IDH A;  2CCX A;  2JQP A;  2BTX A;  1FF4 A;  3PLC A;  1W6B A;  3FEV A;  1IDG A;  3LAQ U;  1H0J A;  1IJC A;  1CXN A;  1RGJ A;  3EBX A;  4BDT B;  2CRS A;  1QKD A;  2CRT A;  1LSI A;  3NEQ A;  1ZAD A;  4P7U A;  2J8B A;  1KFH A;  3BT2 U;  1MR6 A;  1KU6 B;  1TXB A;  1VB0 A;  2PJY C;  1IKC A;  2MJ0 A;  1BXP A;  2CTX A;  1RL5 A;  1L4W A;  1NYU A;  2MJY A;  2UX2 A;  4ZQY A;  1FAS A;  4QTI U;  2BHI A;  4OM4 A;  1G6M A;  1QKE A;  4UY2 C;  1TGX A;  1KBT A;  1LXH A;  2I9B E;  4RUD A;  2PJY B;  1JBD A;  3QB4 B;  1B41 B;  1KS6 A;  1CRF A;  1NEA A;  2H62 D;  2QC1 A;  5DU1 A;  1KTZ B;  3EVS C;  5IMT D;  2H5F A;  1S4Y A;  1KBA A;  3KFD I;  1JGK A;  1NXB A;  2NBT A;  2X8B B;  1LJZ A;  1KC4 A;  1YWH A;  1KXI A;  1COE A;  2HLQ A;  2JVE A;  1V6P A;  1CXO A;  4EY8 B;  1KBS A;  1IK8 A;  2L03 A;  2QJA C;  2H7Z A;  4DO8 A;  3U73 U;  1CDR A;  2H64 B;  4OM5 A;  1CCQ A;  1HC9 A;  2LA1 A;  2MUO A;  1CHV S;  2MUP A;  1DRS A;  2MHY A;  1ABT A;  2ABX A;  1NYS A;  2QJB C;  1CTX A;  5DO6 A;  1HAJ A;  1CDT A;  1FSC A;  1LX5 B;  1NTN A;  1ONJ A;  1ES7 B;  2GOO B;  3KFD E;  1COD A;  5IMY C;  4AEA A;  1LXG A;  2FD6 U;  1IDI A;  1CVO A;  1JE9 A;  1BTE A;  4LFT A;  1TFS A;  2H64 C;  1TXA A;  1IQ9 A;  1KL8 A;  4XJJ A;  1REW C;  2H7Z B;  4IYE A;  2CDX A;  1ERA A;  1NTX A;  2MFA A;  2H62 C;  3BT1 U;  1I02 A;  1HC9 B;  2UWR A;  1ERG A;  2GOO C;  1QM7 A;  3VTS A;  3HH7 A;  1F8U B;  1CRE A;  1MAH F;  1UG4 A;  2HLR A;  3NDS A;  2MJ4 A;  2N99 A;  1M9Z A;  6EBX A;  1IDL A;  3ERA A;  1FSS B;  4FAO E;  1CDQ A;  2QJ9 C;  3U74 U;  4BIK B;  1FFJ A;  1PLO A;  2K3G A;  2H8U A;  1XT3 A;  2ERA A;  1HAA A;  2L5S A;  2LCR A;  4FAO C; 
#chains in the Genus database with same CATH topology
 4HQP F;  1CB9 A;  2OFS A;  1CDS A;  1NOR A;  2VLW A;  1HOY A;  3NH7 A;  1F94 A;  5DZ5 A;  1FRA A;  5EBX A;  1IDH A;  2CCX A;  2JQP A;  2BTX A;  1FF4 A;  3PLC A;  1W6B A;  3FEV A;  1IDG A;  3LAQ U;  1H0J A;  1IJC A;  1CXN A;  1RGJ A;  3EBX A;  4BDT B;  2CRS A;  1QKD A;  2CRT A;  1LSI A;  3NEQ A;  1ZAD A;  4P7U A;  2J8B A;  1KFH A;  3BT2 U;  1MR6 A;  1KU6 B;  1TXB A;  1VB0 A;  2PJY C;  1IKC A;  2MJ0 A;  1BXP A;  2CTX A;  1RL5 A;  1L4W A;  1NYU A;  2MJY A;  2UX2 A;  4ZQY A;  1FAS A;  4QTI U;  2BHI A;  4OM4 A;  1G6M A;  1QKE A;  4UY2 C;  1TGX A;  1KBT A;  1LXH A;  2I9B E;  4RUD A;  2PJY B;  1JBD A;  3QB4 B;  1B41 B;  1KS6 A;  1CRF A;  1NEA A;  2H62 D;  2QC1 A;  5DU1 A;  1KTZ B;  3EVS C;  5IMT D;  2H5F A;  1S4Y A;  1KBA A;  3KFD I;  1JGK A;  1NXB A;  2NBT A;  2X8B B;  1LJZ A;  1KC4 A;  1YWH A;  1KXI A;  1COE A;  2HLQ A;  2JVE A;  1V6P A;  1CXO A;  4EY8 B;  1KBS A;  1IK8 A;  2L03 A;  2QJA C;  2H7Z A;  4DO8 A;  3U73 U;  1CDR A;  2H64 B;  4OM5 A;  1CCQ A;  1HC9 A;  2LA1 A;  2MUO A;  1CHV S;  2MUP A;  1DRS A;  2MHY A;  1ABT A;  2ABX A;  1NYS A;  2QJB C;  1CTX A;  5DO6 A;  1HAJ A;  1CDT A;  1FSC A;  1LX5 B;  1NTN A;  1ONJ A;  1ES7 B;  2GOO B;  3KFD E;  1COD A;  5IMY C;  4AEA A;  1LXG A;  2FD6 U;  1IDI A;  1CVO A;  1JE9 A;  1BTE A;  4LFT A;  4KSN A;  1TFS A;  2H64 C;  1TXA A;  1IQ9 A;  1KL8 A;  4XJJ A;  1REW C;  2H7Z B;  4IYE A;  2CDX A;  1ERA A;  1NTX A;  2MFA A;  2H62 C;  3BT1 U;  1I02 A;  1HC9 B;  2UWR A;  1ERG A;  2GOO C;  1QM7 A;  3VTS A;  3HH7 A;  1F8U B;  1CRE A;  1MAH F;  1UG4 A;  2HLR A;  3NDS A;  2MJ4 A;  2N99 A;  1M9Z A;  6EBX A;  1IDL A;  3ERA A;  1FSS B;  4FAO E;  1CDQ A;  2QJ9 C;  3U74 U;  4BIK B;  1FFJ A;  1PLO A;  2K3G A;  2H8U A;  1XT3 A;  2ERA A;  1HAA A;  2L5S A;  2LCR A;  4FAO C; 
#chains in the Genus database with same CATH homology
 4HQP F;  1CB9 A;  2OFS A;  1CDS A;  1NOR A;  2VLW A;  1HOY A;  3NH7 A;  1F94 A;  5DZ5 A;  1FRA A;  5EBX A;  1IDH A;  2CCX A;  2JQP A;  2BTX A;  1FF4 A;  3PLC A;  1W6B A;  3FEV A;  1IDG A;  3LAQ U;  1H0J A;  1IJC A;  1CXN A;  1RGJ A;  3EBX A;  4BDT B;  2CRS A;  1QKD A;  2CRT A;  1LSI A;  3NEQ A;  1ZAD A;  4P7U A;  2J8B A;  1KFH A;  3BT2 U;  1MR6 A;  1KU6 B;  1TXB A;  1VB0 A;  2PJY C;  1IKC A;  2MJ0 A;  1BXP A;  2CTX A;  1RL5 A;  1L4W A;  1NYU A;  2MJY A;  2UX2 A;  4ZQY A;  1FAS A;  4QTI U;  2BHI A;  4OM4 A;  1G6M A;  1QKE A;  4UY2 C;  1TGX A;  1KBT A;  1LXH A;  2I9B E;  4RUD A;  2PJY B;  1JBD A;  3QB4 B;  1B41 B;  1KS6 A;  1CRF A;  1NEA A;  2H62 D;  2QC1 A;  5DU1 A;  1KTZ B;  3EVS C;  5IMT D;  2H5F A;  1S4Y A;  1KBA A;  3KFD I;  1JGK A;  1NXB A;  2NBT A;  2X8B B;  1LJZ A;  1KC4 A;  1YWH A;  1KXI A;  1COE A;  2HLQ A;  2JVE A;  1V6P A;  1CXO A;  4EY8 B;  1KBS A;  1IK8 A;  2L03 A;  2QJA C;  2H7Z A;  4DO8 A;  3U73 U;  1CDR A;  2H64 B;  4OM5 A;  1CCQ A;  1HC9 A;  2LA1 A;  2MUO A;  1CHV S;  2MUP A;  1DRS A;  2MHY A;  1ABT A;  2ABX A;  1NYS A;  2QJB C;  1CTX A;  5DO6 A;  1HAJ A;  1CDT A;  1FSC A;  1LX5 B;  1NTN A;  1ONJ A;  1ES7 B;  2GOO B;  3KFD E;  1COD A;  5IMY C;  4AEA A;  1LXG A;  2FD6 U;  1IDI A;  1CVO A;  1JE9 A;  1BTE A;  4LFT A;  4KSN A;  1TFS A;  2H64 C;  1TXA A;  1IQ9 A;  1KL8 A;  4XJJ A;  1REW C;  2H7Z B;  4IYE A;  2CDX A;  1ERA A;  1NTX A;  2MFA A;  2H62 C;  3BT1 U;  1I02 A;  1HC9 B;  2UWR A;  1ERG A;  2GOO C;  1QM7 A;  3VTS A;  3HH7 A;  1F8U B;  1CRE A;  1MAH F;  1UG4 A;  2HLR A;  3NDS A;  2MJ4 A;  2N99 A;  1M9Z A;  6EBX A;  1IDL A;  3ERA A;  1FSS B;  4FAO E;  1CDQ A;  2QJ9 C;  3U74 U;  4BIK B;  1FFJ A;  1PLO A;  2K3G A;  2H8U A;  1XT3 A;  2ERA A;  1HAA A;  2L5S A;  2LCR A;  4FAO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...