1NORA

Two-dimensional 1h-nmr study of the spatial structure of neurotoxin ii from naja oxiana
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
61
structure length
61
Chain Sequence
LECHNQQSSQPPTTKTCSGETNCYKKWWSDHRGTIIERGCGCPKVKPGVNLNCCRTDRCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two-dimensional 1H-NMR study of the spatial structure of neurotoxin II from Naja naja oxiana.
pubmed doi rcsb
source organism Naja oxiana
molecule tags Neurotoxin
molecule keywords NEUROTOXIN II
total genus 7
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1993-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1norA00
2H64C 3ERAA 3KFDI 1CTXA 2HLQA 1NTNA 1TXAA 3PLCA 2JQPA 1IDGA 3HH7A 3FEVA 1HAJA 2ABXA 1CCQA 1NYSA 2MUPA 1DRSA 1NORA 3BT2U 1YWHA 4QTIU 1ES7B 1NXBA 1TFSA 2H5FA 1LXHA 2MJ4A 1CXNA 2FD6U 2CDXA 5IMTD 2CRTA 1ZADA 1I02A 1NTXA 1IDHA 1JE9A 1FFJA 2L5SA 1MR6A 5IMYC 1CHVS 4RUDA 1COEA 1CVOA 1FASA 1HOYA 1IKCA 2H7ZB 1LX5B 1ONJA 2GOOB 1CDRA 1RL5A 2LCRA 1FRAA 1MAHF 4DO8A 3KFDE 1W6BA 1IDLA 2H62D 2MHYA 4XJJA 1TGXA 1QKEA 2PJYC 1NYUA 2NBTA 1LJZA 4OM5A 3LAQU 5DU1A 4OM4A 1KBSA 1BTEA 2QJ9C 4FAOC 1CXOA 1B41B 2H7ZA 3EVSC 2LA1A 1TXBA 2H62C 1ERGA 2H64B 2OFSA 1KBTA 1NEAA 4IYEA 1IK8A 1CDTA 4UY2C 1ERAA 1FSCA 2UX2A 2X8BB 1F8UB 1CRFA 3NH7A 1HAAA 5DO6A 1KC4A 2VLWA 1LSIA 3U74U 1ABTA 1HC9A 2JVEA 1F94A 1PLOA 2MJ0A 2K3GA 4FAOE 1FSSB 2BTXA 2MJYA 2QJBC 1CDSA 2MUOA 1KBAA 2PJYB 1KFHA 1FF4A 1M9ZA 1H0JA 1QKDA 3NEQA 2QJAC 3U73U 1S4YA 3NDSA 2CCXA 1XT3A 2GOOC 3QB4B 1CDQA 1JBDA 3BT1U 1V6PA 4BIKB 2QC1A 1HC9B 1L4WA 2UWRA 5EBXA 3VTSA 1IDIA 1KL8A 2L03A 1KU6B 4ZQYA 1IJCA 2ERAA 4EY8B 1LXGA 4LFTA 1REWC 1CB9A 4BDTB 1JGKA 1CREA 3EBXA 1KS6A 4AEAA 1BXPA 1UG4A 1VB0A 2BHIA 1G6MA 1IQ9A 1KTZB 1RGJA 1CODA 1QM7A 2HLRA 2J8BA 5DZ5A 1KXIA 6EBXA 2I9BE 2CTXA 2MFAA 4P7UA 2N99A 4HQPF 2H8UA 2CRSA
chains in the Genus database with same CATH superfamily
2H64C 3ERAA 3KFDI 1CTXA 2HLQA 1NTNA 1TXAA 3PLCA 2JQPA 1IDGA 3HH7A 3FEVA 1HAJA 2ABXA 1CCQA 1NYSA 2MUPA 1DRSA 1NORA 3BT2U 1YWHA 4QTIU 1ES7B 1NXBA 1TFSA 2H5FA 1LXHA 2MJ4A 1CXNA 2FD6U 2CDXA 5IMTD 2CRTA 1ZADA 1I02A 1NTXA 1IDHA 1JE9A 1FFJA 2L5SA 1MR6A 5IMYC 1CHVS 4RUDA 1COEA 1CVOA 1FASA 1HOYA 1IKCA 2H7ZB 1LX5B 1ONJA 2GOOB 1CDRA 1RL5A 2LCRA 1FRAA 1MAHF 4DO8A 3KFDE 1W6BA 1IDLA 2H62D 2MHYA 4XJJA 1TGXA 1QKEA 2PJYC 1NYUA 2NBTA 1LJZA 4OM5A 3LAQU 5DU1A 4OM4A 1KBSA 1BTEA 2QJ9C 4FAOC 1CXOA 1B41B 2H7ZA 3EVSC 2LA1A 1TXBA 2H62C 1ERGA 2H64B 2OFSA 1KBTA 1NEAA 4IYEA 1IK8A 1CDTA 4UY2C 1ERAA 1FSCA 2UX2A 4KSNA 2X8BB 1F8UB 1CRFA 3NH7A 1HAAA 5DO6A 1KC4A 2VLWA 1LSIA 3U74U 1ABTA 1HC9A 2JVEA 1F94A 1PLOA 2MJ0A 2K3GA 4FAOE 1FSSB 2BTXA 2MJYA 2QJBC 1CDSA 2MUOA 1KBAA 2PJYB 1KFHA 1FF4A 1M9ZA 1H0JA 1QKDA 3NEQA 2QJAC 3U73U 1S4YA 3NDSA 2CCXA 1XT3A 2GOOC 3QB4B 1CDQA 1JBDA 3BT1U 1V6PA 4BIKB 2QC1A 1HC9B 1L4WA 2UWRA 5EBXA 3VTSA 1IDIA 1KL8A 2L03A 1KU6B 4ZQYA 1IJCA 2ERAA 4EY8B 1LXGA 4LFTA 1REWC 1CB9A 4BDTB 1JGKA 1CREA 3EBXA 1KS6A 4AEAA 1BXPA 1UG4A 1VB0A 2BHIA 1G6MA 1IQ9A 1KTZB 1RGJA 1CODA 1QM7A 2HLRA 2J8BA 5DZ5A 1KXIA 6EBXA 2I9BE 2CTXA 2MFAA 4P7UA 2N99A 4HQPF 2H8UA 2CRSA
chains in the Genus database with same CATH topology
2H64C 3ERAA 3KFDI 1CTXA 2HLQA 1NTNA 1TXAA 3PLCA 2JQPA 1IDGA 3HH7A 3FEVA 1HAJA 2ABXA 1CCQA 1NYSA 2MUPA 1DRSA 1NORA 3BT2U 1YWHA 4QTIU 1ES7B 1NXBA 1TFSA 2H5FA 1LXHA 2MJ4A 1CXNA 2FD6U 2CDXA 5IMTD 2CRTA 1ZADA 1I02A 1NTXA 1IDHA 1JE9A 1FFJA 2L5SA 1MR6A 5IMYC 1CHVS 4RUDA 1COEA 1CVOA 1FASA 1HOYA 1IKCA 2H7ZB 1LX5B 1ONJA 2GOOB 1CDRA 1RL5A 2LCRA 1FRAA 1MAHF 4DO8A 3KFDE 1W6BA 1IDLA 2H62D 2MHYA 4XJJA 1TGXA 1QKEA 2PJYC 1NYUA 2NBTA 1LJZA 4OM5A 3LAQU 5DU1A 4OM4A 1KBSA 1BTEA 2QJ9C 4FAOC 1CXOA 1B41B 2H7ZA 3EVSC 2LA1A 1TXBA 2H62C 1ERGA 2H64B 2OFSA 1KBTA 1NEAA 4IYEA 1IK8A 1CDTA 4UY2C 1ERAA 1FSCA 2UX2A 4KSNA 2X8BB 1F8UB 1CRFA 3NH7A 1HAAA 5DO6A 1KC4A 2VLWA 1LSIA 3U74U 1ABTA 1HC9A 2JVEA 1F94A 1PLOA 2MJ0A 2K3GA 4FAOE 1FSSB 2BTXA 2MJYA 2QJBC 1CDSA 2MUOA 1KBAA 2PJYB 1KFHA 1FF4A 1M9ZA 1H0JA 1QKDA 3NEQA 2QJAC 3U73U 1S4YA 3NDSA 2CCXA 1XT3A 2GOOC 3QB4B 1CDQA 1JBDA 3BT1U 1V6PA 4BIKB 2QC1A 1HC9B 1L4WA 2UWRA 5EBXA 3VTSA 1IDIA 1KL8A 2L03A 1KU6B 4ZQYA 1IJCA 2ERAA 4EY8B 1LXGA 4LFTA 1REWC 1CB9A 4BDTB 1JGKA 1CREA 3EBXA 1KS6A 4AEAA 1BXPA 1UG4A 1VB0A 2BHIA 1G6MA 1IQ9A 1KTZB 1RGJA 1CODA 1QM7A 2HLRA 2J8BA 5DZ5A 1KXIA 6EBXA 2I9BE 2CTXA 2MFAA 4P7UA 2N99A 4HQPF 2H8UA 2CRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H64 C;  3ERA A;  3KFD I;  1CTX A;  2HLQ A;  1NTN A;  1TXA A;  3PLC A;  2JQP A;  1IDG A;  3HH7 A;  3FEV A;  1HAJ A;  2ABX A;  1CCQ A;  1NYS A;  2MUP A;  1DRS A;  1NOR A;  3BT2 U;  1YWH A;  4QTI U;  1ES7 B;  1NXB A;  1TFS A;  2H5F A;  1LXH A;  2MJ4 A;  1CXN A;  2FD6 U;  2CDX A;  5IMT D;  2CRT A;  1ZAD A;  1I02 A;  1NTX A;  1IDH A;  1JE9 A;  1FFJ A;  2L5S A;  1MR6 A;  5IMY C;  1CHV S;  4RUD A;  1COE A;  1CVO A;  1FAS A;  1HOY A;  1IKC A;  2H7Z B;  1LX5 B;  1ONJ A;  2GOO B;  1CDR A;  1RL5 A;  2LCR A;  1FRA A;  1MAH F;  4DO8 A;  3KFD E;  1W6B A;  1IDL A;  2H62 D;  2MHY A;  4XJJ A;  1TGX A;  1QKE A;  2PJY C;  1NYU A;  2NBT A;  1LJZ A;  4OM5 A;  3LAQ U;  5DU1 A;  4OM4 A;  1KBS A;  1BTE A;  2QJ9 C;  4FAO C;  1CXO A;  1B41 B;  2H7Z A;  3EVS C;  2LA1 A;  1TXB A;  2H62 C;  1ERG A;  2H64 B;  2OFS A;  1KBT A;  1NEA A;  4IYE A;  1IK8 A;  1CDT A;  4UY2 C;  1ERA A;  1FSC A;  2UX2 A;  2X8B B;  1F8U B;  1CRF A;  3NH7 A;  1HAA A;  5DO6 A;  1KC4 A;  2VLW A;  1LSI A;  3U74 U;  1ABT A;  1HC9 A;  2JVE A;  1F94 A;  1PLO A;  2MJ0 A;  2K3G A;  4FAO E;  1FSS B;  2BTX A;  2MJY A;  2QJB C;  1CDS A;  2MUO A;  1KBA A;  2PJY B;  1KFH A;  1FF4 A;  1M9Z A;  1H0J A;  1QKD A;  3NEQ A;  2QJA C;  3U73 U;  1S4Y A;  3NDS A;  2CCX A;  1XT3 A;  2GOO C;  3QB4 B;  1CDQ A;  1JBD A;  3BT1 U;  1V6P A;  4BIK B;  2QC1 A;  1HC9 B;  1L4W A;  2UWR A;  5EBX A;  3VTS A;  1IDI A;  1KL8 A;  2L03 A;  1KU6 B;  4ZQY A;  1IJC A;  2ERA A;  4EY8 B;  1LXG A;  4LFT A;  1REW C;  1CB9 A;  4BDT B;  1JGK A;  1CRE A;  3EBX A;  1KS6 A;  4AEA A;  1BXP A;  1UG4 A;  1VB0 A;  2BHI A;  1G6M A;  1IQ9 A;  1KTZ B;  1RGJ A;  1COD A;  1QM7 A;  2HLR A;  2J8B A;  5DZ5 A;  1KXI A;  6EBX A;  2I9B E;  2CTX A;  2MFA A;  4P7U A;  2N99 A;  4HQP F;  2H8U A;  2CRS A; 
#chains in the Genus database with same CATH topology
 2H64 C;  3ERA A;  3KFD I;  1CTX A;  2HLQ A;  1NTN A;  1TXA A;  3PLC A;  2JQP A;  1IDG A;  3HH7 A;  3FEV A;  1HAJ A;  2ABX A;  1CCQ A;  1NYS A;  2MUP A;  1DRS A;  1NOR A;  3BT2 U;  1YWH A;  4QTI U;  1ES7 B;  1NXB A;  1TFS A;  2H5F A;  1LXH A;  2MJ4 A;  1CXN A;  2FD6 U;  2CDX A;  5IMT D;  2CRT A;  1ZAD A;  1I02 A;  1NTX A;  1IDH A;  1JE9 A;  1FFJ A;  2L5S A;  1MR6 A;  5IMY C;  1CHV S;  4RUD A;  1COE A;  1CVO A;  1FAS A;  1HOY A;  1IKC A;  2H7Z B;  1LX5 B;  1ONJ A;  2GOO B;  1CDR A;  1RL5 A;  2LCR A;  1FRA A;  1MAH F;  4DO8 A;  3KFD E;  1W6B A;  1IDL A;  2H62 D;  2MHY A;  4XJJ A;  1TGX A;  1QKE A;  2PJY C;  1NYU A;  2NBT A;  1LJZ A;  4OM5 A;  3LAQ U;  5DU1 A;  4OM4 A;  1KBS A;  1BTE A;  2QJ9 C;  4FAO C;  1CXO A;  1B41 B;  2H7Z A;  3EVS C;  2LA1 A;  1TXB A;  2H62 C;  1ERG A;  2H64 B;  2OFS A;  1KBT A;  1NEA A;  4IYE A;  1IK8 A;  1CDT A;  4UY2 C;  1ERA A;  1FSC A;  2UX2 A;  4KSN A;  2X8B B;  1F8U B;  1CRF A;  3NH7 A;  1HAA A;  5DO6 A;  1KC4 A;  2VLW A;  1LSI A;  3U74 U;  1ABT A;  1HC9 A;  2JVE A;  1F94 A;  1PLO A;  2MJ0 A;  2K3G A;  4FAO E;  1FSS B;  2BTX A;  2MJY A;  2QJB C;  1CDS A;  2MUO A;  1KBA A;  2PJY B;  1KFH A;  1FF4 A;  1M9Z A;  1H0J A;  1QKD A;  3NEQ A;  2QJA C;  3U73 U;  1S4Y A;  3NDS A;  2CCX A;  1XT3 A;  2GOO C;  3QB4 B;  1CDQ A;  1JBD A;  3BT1 U;  1V6P A;  4BIK B;  2QC1 A;  1HC9 B;  1L4W A;  2UWR A;  5EBX A;  3VTS A;  1IDI A;  1KL8 A;  2L03 A;  1KU6 B;  4ZQY A;  1IJC A;  2ERA A;  4EY8 B;  1LXG A;  4LFT A;  1REW C;  1CB9 A;  4BDT B;  1JGK A;  1CRE A;  3EBX A;  1KS6 A;  4AEA A;  1BXP A;  1UG4 A;  1VB0 A;  2BHI A;  1G6M A;  1IQ9 A;  1KTZ B;  1RGJ A;  1COD A;  1QM7 A;  2HLR A;  2J8B A;  5DZ5 A;  1KXI A;  6EBX A;  2I9B E;  2CTX A;  2MFA A;  4P7U A;  2N99 A;  4HQP F;  2H8U A;  2CRS A; 
#chains in the Genus database with same CATH homology
 2H64 C;  3ERA A;  3KFD I;  1CTX A;  2HLQ A;  1NTN A;  1TXA A;  3PLC A;  2JQP A;  1IDG A;  3HH7 A;  3FEV A;  1HAJ A;  2ABX A;  1CCQ A;  1NYS A;  2MUP A;  1DRS A;  1NOR A;  3BT2 U;  1YWH A;  4QTI U;  1ES7 B;  1NXB A;  1TFS A;  2H5F A;  1LXH A;  2MJ4 A;  1CXN A;  2FD6 U;  2CDX A;  5IMT D;  2CRT A;  1ZAD A;  1I02 A;  1NTX A;  1IDH A;  1JE9 A;  1FFJ A;  2L5S A;  1MR6 A;  5IMY C;  1CHV S;  4RUD A;  1COE A;  1CVO A;  1FAS A;  1HOY A;  1IKC A;  2H7Z B;  1LX5 B;  1ONJ A;  2GOO B;  1CDR A;  1RL5 A;  2LCR A;  1FRA A;  1MAH F;  4DO8 A;  3KFD E;  1W6B A;  1IDL A;  2H62 D;  2MHY A;  4XJJ A;  1TGX A;  1QKE A;  2PJY C;  1NYU A;  2NBT A;  1LJZ A;  4OM5 A;  3LAQ U;  5DU1 A;  4OM4 A;  1KBS A;  1BTE A;  2QJ9 C;  4FAO C;  1CXO A;  1B41 B;  2H7Z A;  3EVS C;  2LA1 A;  1TXB A;  2H62 C;  1ERG A;  2H64 B;  2OFS A;  1KBT A;  1NEA A;  4IYE A;  1IK8 A;  1CDT A;  4UY2 C;  1ERA A;  1FSC A;  2UX2 A;  4KSN A;  2X8B B;  1F8U B;  1CRF A;  3NH7 A;  1HAA A;  5DO6 A;  1KC4 A;  2VLW A;  1LSI A;  3U74 U;  1ABT A;  1HC9 A;  2JVE A;  1F94 A;  1PLO A;  2MJ0 A;  2K3G A;  4FAO E;  1FSS B;  2BTX A;  2MJY A;  2QJB C;  1CDS A;  2MUO A;  1KBA A;  2PJY B;  1KFH A;  1FF4 A;  1M9Z A;  1H0J A;  1QKD A;  3NEQ A;  2QJA C;  3U73 U;  1S4Y A;  3NDS A;  2CCX A;  1XT3 A;  2GOO C;  3QB4 B;  1CDQ A;  1JBD A;  3BT1 U;  1V6P A;  4BIK B;  2QC1 A;  1HC9 B;  1L4W A;  2UWR A;  5EBX A;  3VTS A;  1IDI A;  1KL8 A;  2L03 A;  1KU6 B;  4ZQY A;  1IJC A;  2ERA A;  4EY8 B;  1LXG A;  4LFT A;  1REW C;  1CB9 A;  4BDT B;  1JGK A;  1CRE A;  3EBX A;  1KS6 A;  4AEA A;  1BXP A;  1UG4 A;  1VB0 A;  2BHI A;  1G6M A;  1IQ9 A;  1KTZ B;  1RGJ A;  1COD A;  1QM7 A;  2HLR A;  2J8B A;  5DZ5 A;  1KXI A;  6EBX A;  2I9B E;  2CTX A;  2MFA A;  4P7U A;  2N99 A;  4HQP F;  2H8U A;  2CRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...