1NPHA

Gelsolin domains 4-6 in active, actin free conformation identifies sites of regulatory calcium ions
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
329
structure length
323
Chain Sequence
DDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQTAPASIRLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVGAGASEAEKTAAQELLKVLRSQHVQVEEGSEPDGFWEALGGKTSYRTSPRLKDKKMDAHPPRLFACSNRIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVRQGFEPPSFVGWFLGWDNNYWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Gelsolin Domains 4-6 in Active, Actin-Free Conformation Identifies Sites of Regulatory Calcium Ions
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Gelsolin
total genus 89
structure length 323
sequence length 329
ec nomenclature
pdb deposition date 2003-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1nphA03
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1nphA02
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1nphA01
3FFNA 4PKGG 4LIZA 4Z94G 1WM4A 1VFQA 1C0FS 1D0NA 1SVYA 5KYYA 2LXXA 1TVJA 2XFAA 1Q8GA 1NPHA 1PD1A 1PCXA 1NM1G 2NUPB 2FF6G 3EH2A 1MDUA 2D8BA 3CIPG 3FG6A 1EQYS 1M2VB 1D4XG 4CBUG 5HVKB 1UDMA 3EGXA 2FH2A 2FH3A 1WNJA 3EG9A 3DAWB 1HQZ1 1CNUA 1H1VG 1YVNG 3CJCG 2XF1A 3EFOA 5KYXA 4S10C 4CBWG 4PKIG 1M2OA 5FAEA 2VACA 1F7SA 5KYXB 2FH1A 1YAGG 1M4JA 2FGHA 3EFOB 3EH1A 1DEJS 1P8XA 1T3XA 3L50A 1VKKA 1C0GS 1WFSA 2NUTB 5KYWA 3TU5B 3CJBG 4KEEA 3A5MS 1KCQA 2VIKA 3EGXB 4JD2H 5A1MA 2I2QA 3A5LS 2FF3A 2L72A 1AK7A 1NLVG 5FAFA 3EGDB 2QTVA 1ESVS 3CI5G 1AHQA 5KYUA 1SVQA 1T44G 2VILA 5DD2A 4PKHB 1AK6A 2MOTA 1T2LA 3Q2BA 3EGDA 4CBXG 1PD0A 4BEX1 3A5OS 3A5NS 5KYUB 1V6FA 3FFKA 1X67A 5KYYB 2FH4A 1J72A 1Q8XA 2NUTA 5KYWB 5HVKD 4KEDA 2MP4A 1JHWA 4KEFA 2KVKA 1P8ZG 5KYNA 2HD7A 5L6WC 2W0IA 3FG7A 1TMWA 1T3YA 1COFA 2MV2A 1SVRA 1CFYA 1NMDG 1M2VA 2LLFA 5IVUA 1RGIG 2LJ8A 1QPVA 2NUPA 3EG9B
chains in the Genus database with same CATH superfamily
3FFNA 4PKGG 4LIZA 4Z94G 1WM4A 1VFQA 1C0FS 1D0NA 1SVYA 5KYYA 2LXXA 1TVJA 2XFAA 1Q8GA 1NPHA 1PD1A 1PCXA 1NM1G 2NUPB 2FF6G 3EH2A 1MDUA 2D8BA 3CIPG 3FG6A 1EQYS 1M2VB 1D4XG 4CBUG 5HVKB 1UDMA 3EGXA 2FH2A 2FH3A 1WNJA 3EG9A 3DAWB 1HQZ1 1CNUA 1H1VG 1YVNG 3CJCG 2XF1A 3EFOA 5KYXA 4S10C 4CBWG 4PKIG 1M2OA 5FAEA 2VACA 1F7SA 5KYXB 2FH1A 1YAGG 1M4JA 2FGHA 3EFOB 3EH1A 1DEJS 1P8XA 1T3XA 3L50A 1VKKA 1C0GS 1WFSA 2NUTB 5KYWA 3TU5B 3CJBG 4KEEA 3DA7A 3A5MS 1KCQA 2VIKA 3EGXB 4JD2H 5A1MA 2I2QA 3A5LS 2FF3A 2L72A 1AK7A 1NLVG 5FAFA 3EGDB 2QTVA 1ESVS 3CI5G 1AHQA 5KYUA 1SVQA 1T44G 2VILA 5DD2A 4PKHB 1AK6A 2MOTA 1T2LA 3Q2BA 3EGDA 4CBXG 1PD0A 4BEX1 3A5OS 3A5NS 5KYUB 1V6FA 3FFKA 1X67A 5KYYB 2FH4A 1J72A 1Q8XA 2NUTA 5KYWB 5HVKD 4KEDA 2MP4A 1JHWA 4KEFA 2KVKA 1P8ZG 5KYNA 2HD7A 5L6WC 2W0IA 3FG7A 1TMWA 1T3YA 1COFA 2MV2A 1SVRA 1CFYA 1NMDG 1M2VA 2LLFA 5IVUA 1RGIG 2LJ8A 1QPVA 2NUPA 3EG9B
chains in the Genus database with same CATH topology
3FFNA 4PKGG 4LIZA 4Z94G 1WM4A 1VFQA 1C0FS 1D0NA 1SVYA 5KYYA 2LXXA 1TVJA 2XFAA 1Q8GA 1NPHA 1PD1A 1PCXA 1NM1G 2NUPB 2FF6G 3EH2A 1MDUA 2D8BA 3CIPG 3FG6A 1EQYS 1M2VB 1D4XG 4CBUG 5HVKB 1UDMA 3EGXA 2FH2A 2FH3A 1WNJA 3EG9A 3DAWB 1HQZ1 1CNUA 1H1VG 1YVNG 3CJCG 2XF1A 3EFOA 5KYXA 4S10C 4CBWG 4PKIG 1M2OA 5FAEA 2VACA 1F7SA 5KYXB 2FH1A 1YAGG 1M4JA 2FGHA 3EFOB 3EH1A 1DEJS 1P8XA 1T3XA 3L50A 1VKKA 1C0GS 1WFSA 2NUTB 5KYWA 3TU5B 3CJBG 4KEEA 3DA7A 3A5MS 1KCQA 2VIKA 3EGXB 4JD2H 5A1MA 2I2QA 3A5LS 2FF3A 2L72A 1AK7A 1NLVG 5FAFA 3EGDB 2QTVA 1ESVS 3CI5G 1AHQA 5KYUA 1SVQA 1T44G 2VILA 5DD2A 4PKHB 1AK6A 2MOTA 1T2LA 3Q2BA 3EGDA 4CBXG 1PD0A 4BEX1 3A5OS 3A5NS 5KYUB 1V6FA 3FFKA 1X67A 5KYYB 2FH4A 1J72A 1Q8XA 2NUTA 5KYWB 5HVKD 4KEDA 2MP4A 1JHWA 4KEFA 2KVKA 1P8ZG 5KYNA 2HD7A 5L6WC 2W0IA 3FG7A 1TMWA 1T3YA 1COFA 2MV2A 1SVRA 1CFYA 1NMDG 1M2VA 2LLFA 5IVUA 1RGIG 2LJ8A 1QPVA 2NUPA 3EG9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FFN A;  4PKG G;  4LIZ A;  4Z94 G;  1WM4 A;  1VFQ A;  1C0F S;  1D0N A;  1SVY A;  5KYY A;  2LXX A;  1TVJ A;  2XFA A;  1Q8G A;  1NPH A;  1PD1 A;  1PCX A;  1NM1 G;  2NUP B;  2FF6 G;  3EH2 A;  1MDU A;  2D8B A;  3CIP G;  3FG6 A;  1EQY S;  1M2V B;  1D4X G;  4CBU G;  5HVK B;  1UDM A;  3EGX A;  2FH2 A;  2FH3 A;  1WNJ A;  3EG9 A;  3DAW B;  1HQZ 1;  1CNU A;  1H1V G;  1YVN G;  3CJC G;  2XF1 A;  3EFO A;  5KYX A;  4S10 C;  4CBW G;  4PKI G;  1M2O A;  5FAE A;  2VAC A;  1F7S A;  5KYX B;  2FH1 A;  1YAG G;  1M4J A;  2FGH A;  3EFO B;  3EH1 A;  1DEJ S;  1P8X A;  1T3X A;  3L50 A;  1VKK A;  1C0G S;  1WFS A;  2NUT B;  5KYW A;  3TU5 B;  3CJB G;  4KEE A;  3A5M S;  1KCQ A;  2VIK A;  3EGX B;  4JD2 H;  5A1M A;  2I2Q A;  3A5L S;  2FF3 A;  2L72 A;  1AK7 A;  1NLV G;  5FAF A;  3EGD B;  2QTV A;  1ESV S;  3CI5 G;  1AHQ A;  5KYU A;  1SVQ A;  1T44 G;  2VIL A;  5DD2 A;  4PKH B;  1AK6 A;  2MOT A;  1T2L A;  3Q2B A;  3EGD A;  4CBX G;  1PD0 A;  4BEX 1;  3A5O S;  3A5N S;  5KYU B;  1V6F A;  3FFK A;  1X67 A;  5KYY B;  2FH4 A;  1J72 A;  1Q8X A;  2NUT A;  5KYW B;  5HVK D;  4KED A;  2MP4 A;  1JHW A;  4KEF A;  2KVK A;  1P8Z G;  5KYN A;  2HD7 A;  5L6W C;  2W0I A;  3FG7 A;  1TMW A;  1T3Y A;  1COF A;  2MV2 A;  1SVR A;  1CFY A;  1NMD G;  1M2V A;  2LLF A;  5IVU A;  1RGI G;  2LJ8 A;  1QPV A;  2NUP A;  3EG9 B; 
#chains in the Genus database with same CATH topology
 3FFN A;  4PKG G;  4LIZ A;  4Z94 G;  1WM4 A;  1VFQ A;  1C0F S;  1D0N A;  1SVY A;  5KYY A;  2LXX A;  1TVJ A;  2XFA A;  1Q8G A;  1NPH A;  1PD1 A;  1PCX A;  1NM1 G;  2NUP B;  2FF6 G;  3EH2 A;  1MDU A;  2D8B A;  3CIP G;  3FG6 A;  1EQY S;  1M2V B;  1D4X G;  4CBU G;  5HVK B;  1UDM A;  3EGX A;  2FH2 A;  2FH3 A;  1WNJ A;  3EG9 A;  3DAW B;  1HQZ 1;  1CNU A;  1H1V G;  1YVN G;  3CJC G;  2XF1 A;  3EFO A;  5KYX A;  4S10 C;  4CBW G;  4PKI G;  1M2O A;  5FAE A;  2VAC A;  1F7S A;  5KYX B;  2FH1 A;  1YAG G;  1M4J A;  2FGH A;  3EFO B;  3EH1 A;  1DEJ S;  1P8X A;  1T3X A;  3L50 A;  1VKK A;  1C0G S;  1WFS A;  2NUT B;  5KYW A;  3TU5 B;  3CJB G;  4KEE A;  3DA7 A;  3A5M S;  1KCQ A;  2VIK A;  3EGX B;  4JD2 H;  5A1M A;  2I2Q A;  3A5L S;  2FF3 A;  2L72 A;  1AK7 A;  1NLV G;  5FAF A;  3EGD B;  2QTV A;  1ESV S;  3CI5 G;  1AHQ A;  5KYU A;  1SVQ A;  1T44 G;  2VIL A;  5DD2 A;  4PKH B;  1AK6 A;  2MOT A;  1T2L A;  3Q2B A;  3EGD A;  4CBX G;  1PD0 A;  4BEX 1;  3A5O S;  3A5N S;  5KYU B;  1V6F A;  3FFK A;  1X67 A;  5KYY B;  2FH4 A;  1J72 A;  1Q8X A;  2NUT A;  5KYW B;  5HVK D;  4KED A;  2MP4 A;  1JHW A;  4KEF A;  2KVK A;  1P8Z G;  5KYN A;  2HD7 A;  5L6W C;  2W0I A;  3FG7 A;  1TMW A;  1T3Y A;  1COF A;  2MV2 A;  1SVR A;  1CFY A;  1NMD G;  1M2V A;  2LLF A;  5IVU A;  1RGI G;  2LJ8 A;  1QPV A;  2NUP A;  3EG9 B; 
#chains in the Genus database with same CATH homology
 3FFN A;  4PKG G;  4LIZ A;  4Z94 G;  1WM4 A;  1VFQ A;  1C0F S;  1D0N A;  1SVY A;  5KYY A;  2LXX A;  1TVJ A;  2XFA A;  1Q8G A;  1NPH A;  1PD1 A;  1PCX A;  1NM1 G;  2NUP B;  2FF6 G;  3EH2 A;  1MDU A;  2D8B A;  3CIP G;  3FG6 A;  1EQY S;  1M2V B;  1D4X G;  4CBU G;  5HVK B;  1UDM A;  3EGX A;  2FH2 A;  2FH3 A;  1WNJ A;  3EG9 A;  3DAW B;  1HQZ 1;  1CNU A;  1H1V G;  1YVN G;  3CJC G;  2XF1 A;  3EFO A;  5KYX A;  4S10 C;  4CBW G;  4PKI G;  1M2O A;  5FAE A;  2VAC A;  1F7S A;  5KYX B;  2FH1 A;  1YAG G;  1M4J A;  2FGH A;  3EFO B;  3EH1 A;  1DEJ S;  1P8X A;  1T3X A;  3L50 A;  1VKK A;  1C0G S;  1WFS A;  2NUT B;  5KYW A;  3TU5 B;  3CJB G;  4KEE A;  3DA7 A;  3A5M S;  1KCQ A;  2VIK A;  3EGX B;  4JD2 H;  5A1M A;  2I2Q A;  3A5L S;  2FF3 A;  2L72 A;  1AK7 A;  1NLV G;  5FAF A;  3EGD B;  2QTV A;  1ESV S;  3CI5 G;  1AHQ A;  5KYU A;  1SVQ A;  1T44 G;  2VIL A;  5DD2 A;  4PKH B;  1AK6 A;  2MOT A;  1T2L A;  3Q2B A;  3EGD A;  4CBX G;  1PD0 A;  4BEX 1;  3A5O S;  3A5N S;  5KYU B;  1V6F A;  3FFK A;  1X67 A;  5KYY B;  2FH4 A;  1J72 A;  1Q8X A;  2NUT A;  5KYW B;  5HVK D;  4KED A;  2MP4 A;  1JHW A;  4KEF A;  2KVK A;  1P8Z G;  5KYN A;  2HD7 A;  5L6W C;  2W0I A;  3FG7 A;  1TMW A;  1T3Y A;  1COF A;  2MV2 A;  1SVR A;  1CFY A;  1NMD G;  1M2V A;  2LLF A;  5IVU A;  1RGI G;  2LJ8 A;  1QPV A;  2NUP A;  3EG9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...