1NPHA

Gelsolin domains 4-6 in active, actin free conformation identifies sites of regulatory calcium ions
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
329
structure length
323
Chain Sequence
DDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQTAPASIRLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVGAGASEAEKTAAQELLKVLRSQHVQVEEGSEPDGFWEALGGKTSYRTSPRLKDKKMDAHPPRLFACSNRIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVRQGFEPPSFVGWFLGWDNNYWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Gelsolin
publication title Gelsolin Domains 4-6 in Active, Actin-Free Conformation Identifies Sites of Regulatory Calcium Ions
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 89
structure length 323
sequence length 329
ec nomenclature
pdb deposition date 2003-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1nphA03
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1nphA02
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1nphA01
4LIZA 1WM4A 1Q8GA 2HD7A 3EH2A 1P8ZG 4CBXG 1TVJA 2FF3A 3CJCG 3CIPG 2MP4A 5A1MA 2NUTA 1C0GS 2VIKA 3EG9B 1WNJA 1X67A 1KCQA 3CJBG 2FH4A 3EGXB 3EH1A 2I2QA 4Z94G 1M2VB 1AK7A 3CI5G 1YVNG 4PKIG 1NM1G 1VKKA 3FFNA 4KEFA 1V6FA 1T44G 2MV2A 2NUPB 3EFOB 3EG9A 3TU5B 1M2OA 3EGXA 1SVQA 5FAFA 1TMWA 1AHQA 2VACA 1M2VA 4S10C 2FH3A 1ESVS 2XFAA 1CNUA 1UDMA 1M4JA 5KYNA 3DAWB 4PKGG 3FG7A 1F7SA 1QPVA 1WFSA 5KYUB 2FH1A 2KVKA 5KYYB 2XF1A 5L6WC 3A5NS 1PD0A 2LJ8A 1D4XG 1T3XA 3L50A 2LLFA 5KYXB 1SVRA 2MOTA 2LXXA 1RGIG 1PD1A 5KYUA 3Q2BA 4KEEA 5KYYA 3FFKA 3A5LS 1NPHA 5IVUA 1D0NA 5KYXA 2L72A 1C0FS 1CFYA 1NMDG 2NUPA 4PKHB 3EFOA 1HQZ1 1COFA 5DD2A 4CBWG 1JHWA 2FF6G 2NUTB 4BEX1 4KEDA 1T2LA 1J72A 3FG6A 2D8BA 5KYWB 2W0IA 5HVKD 1T3YA 1H1VG 5FAEA 1SVYA 5HVKB 1YAGG 1AK6A 3A5MS 4CBUG 4JD2H 2QTVA 3EGDB 5KYWA 1P8XA 2FGHA 1VFQA 1PCXA 2VILA 2FH2A 3A5OS 1Q8XA 1EQYS 1DEJS 1MDUA 1NLVG 3EGDA
chains in the Genus database with same CATH superfamily
4LIZA 1WM4A 1Q8GA 2HD7A 3EH2A 1P8ZG 4CBXG 1TVJA 2FF3A 3CJCG 3CIPG 2MP4A 5A1MA 2NUTA 1C0GS 2VIKA 3EG9B 1WNJA 1X67A 1KCQA 3CJBG 2FH4A 3EGXB 3EH1A 2I2QA 4Z94G 1M2VB 1AK7A 3CI5G 1YVNG 4PKIG 1NM1G 1VKKA 3FFNA 4KEFA 1V6FA 1T44G 2MV2A 2NUPB 3EFOB 3EG9A 3TU5B 1M2OA 3EGXA 1SVQA 5FAFA 1TMWA 1AHQA 2VACA 1M2VA 4S10C 2FH3A 1ESVS 2XFAA 1CNUA 1UDMA 1M4JA 5KYNA 3DAWB 4PKGG 3FG7A 1F7SA 1QPVA 1WFSA 5KYUB 2FH1A 2KVKA 5KYYB 2XF1A 5L6WC 3A5NS 1PD0A 2LJ8A 1D4XG 1T3XA 3L50A 2LLFA 5KYXB 1SVRA 2MOTA 2LXXA 1RGIG 1PD1A 5KYUA 3Q2BA 4KEEA 5KYYA 3FFKA 3A5LS 1NPHA 5IVUA 1D0NA 5KYXA 2L72A 1C0FS 1CFYA 1NMDG 2NUPA 4PKHB 3EFOA 1HQZ1 1COFA 5DD2A 4CBWG 1JHWA 2FF6G 2NUTB 4BEX1 4KEDA 1T2LA 1J72A 3FG6A 2D8BA 5KYWB 2W0IA 5HVKD 1T3YA 1H1VG 5FAEA 1SVYA 5HVKB 1YAGG 1AK6A 3A5MS 4CBUG 4JD2H 2QTVA 3EGDB 5KYWA 1P8XA 2FGHA 1VFQA 1PCXA 3DA7A 2VILA 2FH2A 3A5OS 1Q8XA 1EQYS 1DEJS 1MDUA 1NLVG 3EGDA
chains in the Genus database with same CATH topology
4LIZA 1WM4A 1Q8GA 2HD7A 3EH2A 1P8ZG 4CBXG 1TVJA 2FF3A 3CJCG 3CIPG 2MP4A 5A1MA 2NUTA 1C0GS 2VIKA 3EG9B 1WNJA 1X67A 1KCQA 3CJBG 2FH4A 3EGXB 3EH1A 2I2QA 4Z94G 1M2VB 1AK7A 3CI5G 1YVNG 4PKIG 1NM1G 1VKKA 3FFNA 4KEFA 1V6FA 1T44G 2MV2A 2NUPB 3EFOB 3EG9A 3TU5B 1M2OA 3EGXA 1SVQA 5FAFA 1TMWA 1AHQA 2VACA 1M2VA 4S10C 2FH3A 1ESVS 2XFAA 1CNUA 1UDMA 1M4JA 5KYNA 3DAWB 4PKGG 3FG7A 1F7SA 1QPVA 1WFSA 5KYUB 2FH1A 2KVKA 5KYYB 2XF1A 5L6WC 3A5NS 1PD0A 2LJ8A 1D4XG 1T3XA 3L50A 2LLFA 5KYXB 1SVRA 2MOTA 2LXXA 1RGIG 1PD1A 5KYUA 3Q2BA 4KEEA 5KYYA 3FFKA 3A5LS 1NPHA 5IVUA 1D0NA 5KYXA 2L72A 1C0FS 1CFYA 1NMDG 2NUPA 4PKHB 3EFOA 1HQZ1 1COFA 5DD2A 4CBWG 1JHWA 2FF6G 2NUTB 4BEX1 4KEDA 1T2LA 1J72A 3FG6A 2D8BA 5KYWB 2W0IA 5HVKD 1T3YA 1H1VG 5FAEA 1SVYA 5HVKB 1YAGG 1AK6A 3A5MS 4CBUG 4JD2H 2QTVA 3EGDB 5KYWA 1P8XA 2FGHA 1VFQA 1PCXA 3DA7A 2VILA 2FH2A 3A5OS 1Q8XA 1EQYS 1DEJS 1MDUA 1NLVG 3EGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LIZ A;  1WM4 A;  1Q8G A;  2HD7 A;  3EH2 A;  1P8Z G;  4CBX G;  1TVJ A;  2FF3 A;  3CJC G;  3CIP G;  2MP4 A;  5A1M A;  2NUT A;  1C0G S;  2VIK A;  3EG9 B;  1WNJ A;  1X67 A;  1KCQ A;  3CJB G;  2FH4 A;  3EGX B;  3EH1 A;  2I2Q A;  4Z94 G;  1M2V B;  1AK7 A;  3CI5 G;  1YVN G;  4PKI G;  1NM1 G;  1VKK A;  3FFN A;  4KEF A;  1V6F A;  1T44 G;  2MV2 A;  2NUP B;  3EFO B;  3EG9 A;  3TU5 B;  1M2O A;  3EGX A;  1SVQ A;  5FAF A;  1TMW A;  1AHQ A;  2VAC A;  1M2V A;  4S10 C;  2FH3 A;  1ESV S;  2XFA A;  1CNU A;  1UDM A;  1M4J A;  5KYN A;  3DAW B;  4PKG G;  3FG7 A;  1F7S A;  1QPV A;  1WFS A;  5KYU B;  2FH1 A;  2KVK A;  5KYY B;  2XF1 A;  5L6W C;  3A5N S;  1PD0 A;  2LJ8 A;  1D4X G;  1T3X A;  3L50 A;  2LLF A;  5KYX B;  1SVR A;  2MOT A;  2LXX A;  1RGI G;  1PD1 A;  5KYU A;  3Q2B A;  4KEE A;  5KYY A;  3FFK A;  3A5L S;  1NPH A;  5IVU A;  1D0N A;  5KYX A;  2L72 A;  1C0F S;  1CFY A;  1NMD G;  2NUP A;  4PKH B;  3EFO A;  1HQZ 1;  1COF A;  5DD2 A;  4CBW G;  1JHW A;  2FF6 G;  2NUT B;  4BEX 1;  4KED A;  1T2L A;  1J72 A;  3FG6 A;  2D8B A;  5KYW B;  2W0I A;  5HVK D;  1T3Y A;  1H1V G;  5FAE A;  1SVY A;  5HVK B;  1YAG G;  1AK6 A;  3A5M S;  4CBU G;  4JD2 H;  2QTV A;  3EGD B;  5KYW A;  1P8X A;  2FGH A;  1VFQ A;  1PCX A;  2VIL A;  2FH2 A;  3A5O S;  1Q8X A;  1EQY S;  1DEJ S;  1MDU A;  1NLV G;  3EGD A; 
#chains in the Genus database with same CATH topology
 4LIZ A;  1WM4 A;  1Q8G A;  2HD7 A;  3EH2 A;  1P8Z G;  4CBX G;  1TVJ A;  2FF3 A;  3CJC G;  3CIP G;  2MP4 A;  5A1M A;  2NUT A;  1C0G S;  2VIK A;  3EG9 B;  1WNJ A;  1X67 A;  1KCQ A;  3CJB G;  2FH4 A;  3EGX B;  3EH1 A;  2I2Q A;  4Z94 G;  1M2V B;  1AK7 A;  3CI5 G;  1YVN G;  4PKI G;  1NM1 G;  1VKK A;  3FFN A;  4KEF A;  1V6F A;  1T44 G;  2MV2 A;  2NUP B;  3EFO B;  3EG9 A;  3TU5 B;  1M2O A;  3EGX A;  1SVQ A;  5FAF A;  1TMW A;  1AHQ A;  2VAC A;  1M2V A;  4S10 C;  2FH3 A;  1ESV S;  2XFA A;  1CNU A;  1UDM A;  1M4J A;  5KYN A;  3DAW B;  4PKG G;  3FG7 A;  1F7S A;  1QPV A;  1WFS A;  5KYU B;  2FH1 A;  2KVK A;  5KYY B;  2XF1 A;  5L6W C;  3A5N S;  1PD0 A;  2LJ8 A;  1D4X G;  1T3X A;  3L50 A;  2LLF A;  5KYX B;  1SVR A;  2MOT A;  2LXX A;  1RGI G;  1PD1 A;  5KYU A;  3Q2B A;  4KEE A;  5KYY A;  3FFK A;  3A5L S;  1NPH A;  5IVU A;  1D0N A;  5KYX A;  2L72 A;  1C0F S;  1CFY A;  1NMD G;  2NUP A;  4PKH B;  3EFO A;  1HQZ 1;  1COF A;  5DD2 A;  4CBW G;  1JHW A;  2FF6 G;  2NUT B;  4BEX 1;  4KED A;  1T2L A;  1J72 A;  3FG6 A;  2D8B A;  5KYW B;  2W0I A;  5HVK D;  1T3Y A;  1H1V G;  5FAE A;  1SVY A;  5HVK B;  1YAG G;  1AK6 A;  3A5M S;  4CBU G;  4JD2 H;  2QTV A;  3EGD B;  5KYW A;  1P8X A;  2FGH A;  1VFQ A;  1PCX A;  3DA7 A;  2VIL A;  2FH2 A;  3A5O S;  1Q8X A;  1EQY S;  1DEJ S;  1MDU A;  1NLV G;  3EGD A; 
#chains in the Genus database with same CATH homology
 4LIZ A;  1WM4 A;  1Q8G A;  2HD7 A;  3EH2 A;  1P8Z G;  4CBX G;  1TVJ A;  2FF3 A;  3CJC G;  3CIP G;  2MP4 A;  5A1M A;  2NUT A;  1C0G S;  2VIK A;  3EG9 B;  1WNJ A;  1X67 A;  1KCQ A;  3CJB G;  2FH4 A;  3EGX B;  3EH1 A;  2I2Q A;  4Z94 G;  1M2V B;  1AK7 A;  3CI5 G;  1YVN G;  4PKI G;  1NM1 G;  1VKK A;  3FFN A;  4KEF A;  1V6F A;  1T44 G;  2MV2 A;  2NUP B;  3EFO B;  3EG9 A;  3TU5 B;  1M2O A;  3EGX A;  1SVQ A;  5FAF A;  1TMW A;  1AHQ A;  2VAC A;  1M2V A;  4S10 C;  2FH3 A;  1ESV S;  2XFA A;  1CNU A;  1UDM A;  1M4J A;  5KYN A;  3DAW B;  4PKG G;  3FG7 A;  1F7S A;  1QPV A;  1WFS A;  5KYU B;  2FH1 A;  2KVK A;  5KYY B;  2XF1 A;  5L6W C;  3A5N S;  1PD0 A;  2LJ8 A;  1D4X G;  1T3X A;  3L50 A;  2LLF A;  5KYX B;  1SVR A;  2MOT A;  2LXX A;  1RGI G;  1PD1 A;  5KYU A;  3Q2B A;  4KEE A;  5KYY A;  3FFK A;  3A5L S;  1NPH A;  5IVU A;  1D0N A;  5KYX A;  2L72 A;  1C0F S;  1CFY A;  1NMD G;  2NUP A;  4PKH B;  3EFO A;  1HQZ 1;  1COF A;  5DD2 A;  4CBW G;  1JHW A;  2FF6 G;  2NUT B;  4BEX 1;  4KED A;  1T2L A;  1J72 A;  3FG6 A;  2D8B A;  5KYW B;  2W0I A;  5HVK D;  1T3Y A;  1H1V G;  5FAE A;  1SVY A;  5HVK B;  1YAG G;  1AK6 A;  3A5M S;  4CBU G;  4JD2 H;  2QTV A;  3EGD B;  5KYW A;  1P8X A;  2FGH A;  1VFQ A;  1PCX A;  3DA7 A;  2VIL A;  2FH2 A;  3A5O S;  1Q8X A;  1EQY S;  1DEJ S;  1MDU A;  1NLV G;  3EGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...