1NPHA

Gelsolin domains 4-6 in active, actin free conformation identifies sites of regulatory calcium ions
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
329
structure length
323
Chain Sequence
DDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQTAPASIRLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVGAGASEAEKTAAQELLKVLRSQHVQVEEGSEPDGFWEALGGKTSYRTSPRLKDKKMDAHPPRLFACSNRIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVRQGFEPPSFVGWFLGWDNNYWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Gelsolin Domains 4-6 in Active, Actin-Free Conformation Identifies Sites of Regulatory Calcium Ions
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Gelsolin
total genus 89
structure length 323
sequence length 329
ec nomenclature
pdb deposition date 2003-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1nphA03
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1nphA02
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 1nphA01
2MOTA 1M2VB 4KEEA 2D8BA 1ESVS 3A5MS 4KEFA 5FAFA 3FFNA 3L50A 5KYXB 3A5LS 2NUPA 1YAGG 1T2LA 4CBXG 2HD7A 1VKKA 1P8ZG 1RGIG 2FGHA 4Z94G 4PKHB 5KYUA 1H1VG 3FFKA 3EGDB 1TVJA 3CIPG 1NLVG 4KEDA 1AHQA 1NM1G 1C0GS 1T44G 1CFYA 2FH3A 3FG7A 1M4JA 1KCQA 3FG6A 1WFSA 5KYNA 4LIZA 3A5NS 1TMWA 1VFQA 2NUTA 1WNJA 1T3YA 1D0NA 2MP4A 2VACA 1PD1A 3EH2A 1SVYA 1P8XA 1AK6A 3Q2BA 5KYYA 3A5OS 2FF3A 2FH4A 5KYWB 1C0FS 3EFOA 3EH1A 4PKGG 3EG9B 1Q8XA 5DD2A 3EGXB 4CBWG 2FF6G 3DAWB 1M2VA 1COFA 2VILA 1D4XG 1F7SA 3TU5B 2XFAA 1QPVA 2QTVA 3CJCG 5FAEA 1EQYS 1J72A 1SVQA 5KYXA 1JHWA 2NUPB 5HVKD 2LXXA 5HVKB 1WM4A 1X67A 5IVUA 1SVRA 1AK7A 1PD0A 1YVNG 4S10C 3CJBG 2VIKA 2I2QA 5KYUB 2L72A 3EGDA 1MDUA 2W0IA 1T3XA 5A1MA 2LJ8A 2XF1A 2NUTB 2MV2A 1Q8GA 1NMDG 2KVKA 1HQZ1 1NPHA 4CBUG 2LLFA 5L6WC 3EGXA 4BEX1 5KYYB 2FH2A 1PCXA 1V6FA 1M2OA 2FH1A 5KYWA 1CNUA 4JD2H 3EFOB 3EG9A 4PKIG 1UDMA 1DEJS 3CI5G
chains in the Genus database with same CATH superfamily
2MOTA 1M2VB 4KEEA 2D8BA 1ESVS 3A5MS 4KEFA 5FAFA 3FFNA 3L50A 3DA7A 3A5LS 5KYXB 2NUPA 1YAGG 1T2LA 4CBXG 2HD7A 1VKKA 1P8ZG 1RGIG 2FGHA 4Z94G 4PKHB 5KYUA 1H1VG 3FFKA 3EGDB 1TVJA 3CIPG 1NLVG 4KEDA 1AHQA 1NM1G 1C0GS 1T44G 1CFYA 2FH3A 3FG7A 1M4JA 1KCQA 3FG6A 1WFSA 5KYNA 4LIZA 3A5NS 1TMWA 1VFQA 2NUTA 1WNJA 1T3YA 1D0NA 2MP4A 2VACA 1PD1A 3EH2A 1SVYA 1P8XA 1AK6A 3Q2BA 5KYYA 3A5OS 2FF3A 2FH4A 5KYWB 1C0FS 3EFOA 3EH1A 4PKGG 3EG9B 1Q8XA 5DD2A 3EGXB 4CBWG 2FF6G 3DAWB 1M2VA 1COFA 2VILA 1D4XG 1F7SA 3TU5B 2XFAA 1QPVA 2QTVA 3CJCG 5FAEA 1EQYS 1J72A 1SVQA 5KYXA 1JHWA 2NUPB 5HVKD 2LXXA 5HVKB 1WM4A 1X67A 5IVUA 1SVRA 1AK7A 1PD0A 1YVNG 4S10C 3CJBG 2VIKA 2I2QA 5KYUB 2L72A 3EGDA 1MDUA 2W0IA 1T3XA 5A1MA 2LJ8A 2XF1A 2NUTB 2MV2A 1Q8GA 1NMDG 2KVKA 1HQZ1 1NPHA 4CBUG 2LLFA 5L6WC 3EGXA 4BEX1 5KYYB 2FH2A 1PCXA 1V6FA 1M2OA 2FH1A 5KYWA 1CNUA 4JD2H 3EFOB 3EG9A 4PKIG 1UDMA 1DEJS 3CI5G
chains in the Genus database with same CATH topology
2MOTA 1M2VB 4KEEA 2D8BA 1ESVS 3A5MS 4KEFA 5FAFA 3FFNA 3L50A 3DA7A 3A5LS 5KYXB 2NUPA 1YAGG 1T2LA 4CBXG 2HD7A 1VKKA 1P8ZG 1RGIG 2FGHA 4Z94G 4PKHB 5KYUA 1H1VG 3FFKA 3EGDB 1TVJA 3CIPG 1NLVG 4KEDA 1AHQA 1NM1G 1C0GS 1T44G 1CFYA 2FH3A 3FG7A 1M4JA 1KCQA 3FG6A 1WFSA 5KYNA 4LIZA 3A5NS 1TMWA 1VFQA 2NUTA 1WNJA 1T3YA 1D0NA 2MP4A 2VACA 1PD1A 3EH2A 1SVYA 1P8XA 1AK6A 3Q2BA 5KYYA 3A5OS 2FF3A 2FH4A 5KYWB 1C0FS 3EFOA 3EH1A 4PKGG 3EG9B 1Q8XA 5DD2A 3EGXB 4CBWG 2FF6G 3DAWB 1M2VA 1COFA 2VILA 1D4XG 1F7SA 3TU5B 2XFAA 1QPVA 2QTVA 3CJCG 5FAEA 1EQYS 1J72A 1SVQA 5KYXA 1JHWA 2NUPB 5HVKD 2LXXA 5HVKB 1WM4A 1X67A 5IVUA 1SVRA 1AK7A 1PD0A 1YVNG 4S10C 3CJBG 2VIKA 2I2QA 5KYUB 2L72A 3EGDA 1MDUA 2W0IA 1T3XA 5A1MA 2LJ8A 2XF1A 2NUTB 2MV2A 1Q8GA 1NMDG 2KVKA 1HQZ1 1NPHA 4CBUG 2LLFA 5L6WC 3EGXA 4BEX1 5KYYB 2FH2A 1PCXA 1V6FA 1M2OA 2FH1A 5KYWA 1CNUA 4JD2H 3EFOB 3EG9A 4PKIG 1UDMA 1DEJS 3CI5G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MOT A;  1M2V B;  4KEE A;  2D8B A;  1ESV S;  3A5M S;  4KEF A;  5FAF A;  3FFN A;  3L50 A;  5KYX B;  3A5L S;  2NUP A;  1YAG G;  1T2L A;  4CBX G;  2HD7 A;  1VKK A;  1P8Z G;  1RGI G;  2FGH A;  4Z94 G;  4PKH B;  5KYU A;  1H1V G;  3FFK A;  3EGD B;  1TVJ A;  3CIP G;  1NLV G;  4KED A;  1AHQ A;  1NM1 G;  1C0G S;  1T44 G;  1CFY A;  2FH3 A;  3FG7 A;  1M4J A;  1KCQ A;  3FG6 A;  1WFS A;  5KYN A;  4LIZ A;  3A5N S;  1TMW A;  1VFQ A;  2NUT A;  1WNJ A;  1T3Y A;  1D0N A;  2MP4 A;  2VAC A;  1PD1 A;  3EH2 A;  1SVY A;  1P8X A;  1AK6 A;  3Q2B A;  5KYY A;  3A5O S;  2FF3 A;  2FH4 A;  5KYW B;  1C0F S;  3EFO A;  3EH1 A;  4PKG G;  3EG9 B;  1Q8X A;  5DD2 A;  3EGX B;  4CBW G;  2FF6 G;  3DAW B;  1M2V A;  1COF A;  2VIL A;  1D4X G;  1F7S A;  3TU5 B;  2XFA A;  1QPV A;  2QTV A;  3CJC G;  5FAE A;  1EQY S;  1J72 A;  1SVQ A;  5KYX A;  1JHW A;  2NUP B;  5HVK D;  2LXX A;  5HVK B;  1WM4 A;  1X67 A;  5IVU A;  1SVR A;  1AK7 A;  1PD0 A;  1YVN G;  4S10 C;  3CJB G;  2VIK A;  2I2Q A;  5KYU B;  2L72 A;  3EGD A;  1MDU A;  2W0I A;  1T3X A;  5A1M A;  2LJ8 A;  2XF1 A;  2NUT B;  2MV2 A;  1Q8G A;  1NMD G;  2KVK A;  1HQZ 1;  1NPH A;  4CBU G;  2LLF A;  5L6W C;  3EGX A;  4BEX 1;  5KYY B;  2FH2 A;  1PCX A;  1V6F A;  1M2O A;  2FH1 A;  5KYW A;  1CNU A;  4JD2 H;  3EFO B;  3EG9 A;  4PKI G;  1UDM A;  1DEJ S;  3CI5 G; 
#chains in the Genus database with same CATH topology
 2MOT A;  1M2V B;  4KEE A;  2D8B A;  1ESV S;  3A5M S;  4KEF A;  5FAF A;  3FFN A;  3L50 A;  3DA7 A;  3A5L S;  5KYX B;  2NUP A;  1YAG G;  1T2L A;  4CBX G;  2HD7 A;  1VKK A;  1P8Z G;  1RGI G;  2FGH A;  4Z94 G;  4PKH B;  5KYU A;  1H1V G;  3FFK A;  3EGD B;  1TVJ A;  3CIP G;  1NLV G;  4KED A;  1AHQ A;  1NM1 G;  1C0G S;  1T44 G;  1CFY A;  2FH3 A;  3FG7 A;  1M4J A;  1KCQ A;  3FG6 A;  1WFS A;  5KYN A;  4LIZ A;  3A5N S;  1TMW A;  1VFQ A;  2NUT A;  1WNJ A;  1T3Y A;  1D0N A;  2MP4 A;  2VAC A;  1PD1 A;  3EH2 A;  1SVY A;  1P8X A;  1AK6 A;  3Q2B A;  5KYY A;  3A5O S;  2FF3 A;  2FH4 A;  5KYW B;  1C0F S;  3EFO A;  3EH1 A;  4PKG G;  3EG9 B;  1Q8X A;  5DD2 A;  3EGX B;  4CBW G;  2FF6 G;  3DAW B;  1M2V A;  1COF A;  2VIL A;  1D4X G;  1F7S A;  3TU5 B;  2XFA A;  1QPV A;  2QTV A;  3CJC G;  5FAE A;  1EQY S;  1J72 A;  1SVQ A;  5KYX A;  1JHW A;  2NUP B;  5HVK D;  2LXX A;  5HVK B;  1WM4 A;  1X67 A;  5IVU A;  1SVR A;  1AK7 A;  1PD0 A;  1YVN G;  4S10 C;  3CJB G;  2VIK A;  2I2Q A;  5KYU B;  2L72 A;  3EGD A;  1MDU A;  2W0I A;  1T3X A;  5A1M A;  2LJ8 A;  2XF1 A;  2NUT B;  2MV2 A;  1Q8G A;  1NMD G;  2KVK A;  1HQZ 1;  1NPH A;  4CBU G;  2LLF A;  5L6W C;  3EGX A;  4BEX 1;  5KYY B;  2FH2 A;  1PCX A;  1V6F A;  1M2O A;  2FH1 A;  5KYW A;  1CNU A;  4JD2 H;  3EFO B;  3EG9 A;  4PKI G;  1UDM A;  1DEJ S;  3CI5 G; 
#chains in the Genus database with same CATH homology
 2MOT A;  1M2V B;  4KEE A;  2D8B A;  1ESV S;  3A5M S;  4KEF A;  5FAF A;  3FFN A;  3L50 A;  3DA7 A;  3A5L S;  5KYX B;  2NUP A;  1YAG G;  1T2L A;  4CBX G;  2HD7 A;  1VKK A;  1P8Z G;  1RGI G;  2FGH A;  4Z94 G;  4PKH B;  5KYU A;  1H1V G;  3FFK A;  3EGD B;  1TVJ A;  3CIP G;  1NLV G;  4KED A;  1AHQ A;  1NM1 G;  1C0G S;  1T44 G;  1CFY A;  2FH3 A;  3FG7 A;  1M4J A;  1KCQ A;  3FG6 A;  1WFS A;  5KYN A;  4LIZ A;  3A5N S;  1TMW A;  1VFQ A;  2NUT A;  1WNJ A;  1T3Y A;  1D0N A;  2MP4 A;  2VAC A;  1PD1 A;  3EH2 A;  1SVY A;  1P8X A;  1AK6 A;  3Q2B A;  5KYY A;  3A5O S;  2FF3 A;  2FH4 A;  5KYW B;  1C0F S;  3EFO A;  3EH1 A;  4PKG G;  3EG9 B;  1Q8X A;  5DD2 A;  3EGX B;  4CBW G;  2FF6 G;  3DAW B;  1M2V A;  1COF A;  2VIL A;  1D4X G;  1F7S A;  3TU5 B;  2XFA A;  1QPV A;  2QTV A;  3CJC G;  5FAE A;  1EQY S;  1J72 A;  1SVQ A;  5KYX A;  1JHW A;  2NUP B;  5HVK D;  2LXX A;  5HVK B;  1WM4 A;  1X67 A;  5IVU A;  1SVR A;  1AK7 A;  1PD0 A;  1YVN G;  4S10 C;  3CJB G;  2VIK A;  2I2Q A;  5KYU B;  2L72 A;  3EGD A;  1MDU A;  2W0I A;  1T3X A;  5A1M A;  2LJ8 A;  2XF1 A;  2NUT B;  2MV2 A;  1Q8G A;  1NMD G;  2KVK A;  1HQZ 1;  1NPH A;  4CBU G;  2LLF A;  5L6W C;  3EGX A;  4BEX 1;  5KYY B;  2FH2 A;  1PCX A;  1V6F A;  1M2O A;  2FH1 A;  5KYW A;  1CNU A;  4JD2 H;  3EFO B;  3EG9 A;  4PKI G;  1UDM A;  1DEJ S;  3CI5 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...