1NPJA

Crystal structure of h145a mutant of nitrite reductase from alcaligenes faecalis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWAVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Reconstitution of the type-1 active site of the H145G/A variants of nitrite reductase by ligand insertion
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 89
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1npjA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1npjA02
1AANA 2J56A 2IDQA 1A3ZA 2IDTA 4KO5A 1ETJA 4A66A 1ET5A 1PLAA 3OD3A 3UACA 3SBRA 1PMYA 1KYAA 5D4HA 1ZV2A 4YSTA 2GSMB 3CG8A 2ZXWB 3PAVA 4N4YB 1BQRA 5F7AA 1ASQA 5IY5B 2R7EA 3X2QB 1JXGA 3NP3A 1ZDQA 5I6LA 2XV3A 1OCZB 4K9JA 2BW4A 1IBYA 1OV8A 4E9RA 3UADA 1VLXA 4DP0X 3T6WA 5B1AB 4CSZA 1MZYA 4A2EA 2XX1A 3OMIB 3PCYA 3NJIA 4FAAB 1KBWA 2GC4C 4RH4A 1JOIA 4BXVA 1DZ0A 5LDUA 3TU6A 1J9RA 4F7KA 2YAPA 4PAZA 5PCYA 5F7BA 3S3BB 2UX7A 4F2FA 4DPCX 3HB3B 3CZUB 4N8UA 3U25A 1IUZA 2BZCA 4E9WA 7PCYA 1BXVA 4UF7C 5D4IA 8PAZA 3FYEB 3PAZA 1AZNA 4A2GA 4AX3A 3GYRA 5AFAA 4A68A 2E86A 3FYIB 3WG7B 3FU9A 3X1BA 2IDSA 2UX6A 5EHFA 3T71A 3T6ZA 1IC0A 1HFUA 1A4BA 2HX9A 4BWUA 2YARA 2VW4A 3QJUB 1PF3A 1ZPUA 2VM4A 1X9RA 2FNWA 2QDVA 1M56B 2Q5BA 2UXTA 2FT6A 2Y1AA 2GI0A 1JXFA 4M4RB 1J5DA 3WNIA 3NSCA 3NJFA 1EHKB 1YLBB 1A65A 3FPYA 3C75A 2EINB 2VSKB 2AANA 1AS6A 3QJVB 3X1FA 4YVNA 3WNJA 3OQRA 1GR7A 5ANHA 3TBCA 1ILUA 2TSAA 3WIAA 4W9ZA 2VW6A 4KO6A 4YL4A 1JZGA 5TK2A 1SJMA 1FA4A 1TKWA 1L9QA 1AOZA 4KOCA 2XU9A 1BQKA 3QJRB 2WSDA 1GS6X 4Q8BA 4NB7A 2H3XC 4YVUA 1XB3A 3H4HA 1RZQA 3BQVA 1JZIA 2CCWA 3ERXA 3TBBA 1BYOA 3AG4B 1TU2A 1GY1A 3NJGA 3T6VA 3OM3B 2ZWNA 1OE1A 1NINA 2GBAA 4E9QA 3IEAA 3X1NA 1AIZA 1BAWA 1V55B 1PLBA 2R7EB 1OOWA 3EH4B 4UANA 2FQDA 1V10A 3OMNB 5AZUA 3NJHA 1FWXA 2J5WA 3IN0A 3EH3B 1W8EA 1AS7A 3CDZB 1V54B 4G71B 2OCCB 2ZOOA 1URIA 2BP0B 1CURA 1E67A 5AKRA 2WO3B 1AACA 3UAAA 2RACA 2AZUA 2PP7A 3QPKA 4GXFA 2QPDB 2PPAA 1NPJA 4GYBA 5TK4A 2UXFA 5D4JA 4BK5C 1JZJA 3SBPA 4QLWA 4AKQA 3AG3B 2EIMB 3FQ1A 2CALA 1SFHA 3S8FB 1NIDA 1L9PA 1FFTB 3NSDA 3RYMA 3MBWB 4HHGA 3ABGA 3SQRA 1NDTA 4KNUA 3DTUB 2MRYA 2XUWA 1SNRA 1SF3A 2BW5A 2EIKB 2OV0A 2BWIA 1OCRB 4X4KA 2I85A 3IN2A 2XYBA 3MX0B 1ZDSA 3FU8A 1KDJA 3CVBA 3QJSB 3NJNA 1CYWA 2QDWA 1JVLA 1HAWA 1CYXA 2X87A 1XB8A 3CDZA 4YSUA 1PNDA 5I5IA 2FQFA 1DYZA 3QQXA 1JZFA 2FT8A 9PCYA 1ID2A 2BP0A 1OE2A 1EZLA 1NICA 1RZPA 4GP8B 4P5SA 2HX8A 4FA7B 4YSQA 3ABMB 2DWSA 1IBZA 1J9QA 3ASOB 3GXUB 3T6XA 1SFDA 1AZRA 2UXVA 5FC9A 5I6OA 1SHXA 4UAHA 3T9WA 1M9WA 2XLLA 3IBOA 3X1EA 2AFNA 4HCGA 2BP8A 3NJMA 4DPAX 3ZDWA 2PP9A 3AW5A 2HX7A 4YSCA 2JFCA 3FPXA 1AS8A 1NIAA 3L45A 2IWKA 4KO7A 2CAKA 3FSAA 1NZRA 3WI9A 3PPSA 3G5WA 4L0PB 2I7OA 5B7EA 3PXLA 2PPEA 1W6WA 2UXGA 4JKNA 1NPNA 3H56A 4A67A 3NSFA 4M3HA 1MZZA 5PAZA 3KW8A 2NRDA 2X88A 3FSWA 7PAZA 5I6MA 2BWDA 4AKPA 2IH9A 4E9TA 4MFHA 1ADWA 3FU7A 6PAZA 2PCYA 3CVCA 1GY2A 1ILSA 3QJQB 1PLCA 2PLTA 5B7MA 2YAEA 2IWFA 1NWPA 4PCYA 1WS8A 3QJTB 4YSRA 1AZBA 3FT0A 1KV7A 2JXMA 4ENZA 1OCOB 2Y69B 3EF4A 5I6KA 3NYKA 2IDFA 4DP1X 1JVOA 2IAAC 1ET7A 4KO9A 3NSYA 4G70B 5I6PA 1GS7A 2IDUA 2LLNA 1L9OA 3S3DB 2DWTA 2FT7A 2YXVA 5I28A 2QT6A 1RKRA 1HAUA 4DPBX 3UGEA 1CC3A 3JTBA 2J57A 3FS9A 4EF3A 1T5KA 1A4CA 2PPDA 5B7FA 1PNCA 3N2JA 3PAUA 1PY0A 1WAEA 2FJSA 4WKXA 1PZCA 1E30A 2W8CA 4HCIA 2GC7C 1W6LA 1BYPA 1NIBA 2H5UA 4YSOA 3HEIB 2FQGA 2YAHA 1BEXA 1AG0A 1NIFA 3JT2A 2DYRB 4DP9X 5A7EA 4DP7X 5B3SB 5B1BB 1KCBA 3AZUA 1ASOA 4AI7A 1SF5A 1NIEA 2BP8B 4P5RA 1JZEA 1AQ8A 3FQYA 2CUAA 3UAEA 1MDAA 1ASPA 4DP2X 2QPEB 3N55A 2EIJB 2FQEA 2CBPA 3GDCA 3H4FA 2CJ3A 4E9XA 1CUOA 2VM3A 4E9YA 1UATA 3ABLB 5I5JA 3IE9A 1QLEB 3TA4D 2AVFA 3ZBMA 4BDVB 3AG2B 3FSVA 3X1GA 1M57B 4BXSV 5I5MA 1KGYE 3NJKA 2YAQA 4A2HA 4G72B 2J55A 1MG3C 4HHWA 5B1JA 4YSDA 2VMJA 2P80A 3BVDB 1F56A 4A2FA 4E9VA 2MTAA 2BHFA 2XXFA 1NTDA 1AZUA 6PCYA 1I53A 1GW0A 4G7RB 1KBVA 4G7QB 3FU7B 4BWTA 1R1CA 1AZCA 2HXAA 4JHVA 2XWZA 1WS7A 2B08A 5I26A 4HZ1A 2XV2A 2FTAA 2WO2B 1SDDB 2IWEA 4NAJA 1AAJA 3S3CB 5B1KA 1WA0X 1XMEB 2XX0A 3AG1B 2EILB 4KNTA 2YAOA 1BQ5A 4HCFA 2OJ1A 2PPCA 2JKWA 4YSEA 2W88A 2AZAA 2N0MA 4Q89A 2XV0A 1B3IA 3DIVA 1WA1X 3WKPA 4BDVA 2FWLB 5I6NA 2H47C 1L9RA 4A2DA 2VW7A 4W1TA 2IH8A 1X9UA 1N70A 2HRGA 2YAMA 2HLEB 2PCFA 3D12B 4AZUA 2A3TA 1WA2X 4DP8X 1J5CA 1E5ZA 4HALA 4E9SA 1N68A 1GYCA 3S8GB 1ET8A 1SDDA 2GB2A 1GS8A 3NJJA 4QKTA 3PLYA 3ZX1A 4YSSA 4AKOA 1BXUA 2YAFA 3CVDA 4JHUA 4ZK8A 1KCWA 1TEGA 5B1JC 1GSKA 4GY4A 1J9SA 1IKOP 3TASA 3ZIYA 2ZONA 4DP5X 4DP6X 1JERA 4TXVB 4YSPA 1KDIA 4F2EA 3AY2A 1MG2C 2GIMA 3NT0A 4NERA 4WTQA 2BO0A 3DKHA 3ABKB 2P80D 3FQ2A 1A4AA 4GP5B 2PP8A 3NP4A 4G7SB 2B3IA 1L9TA 1J9TA 2YQBA 1RCYA 1JXDA 4GP4B 2VSMB 2DYSB 2PPFA 2HRHA 4CSPA 1AR1B 3WKQA 1ZIAA 3UABA 1PZAA 1QNIA 4HAKA 3KW7A 1SHWA 1TEFA 4DP4X 2DV6A 2Q9OA 4KOBA 2DY2A 1OCCB 1JZHA 2XVBA 1OF0A 1XB6A 1NWOA 1BXAA 1E5YA 1QHQA 2XXGA 2YXWA 1L9SA 3ASNB 3FSZA 5E9NA 2VN3A 1ZIBA 3SBQA 1OE3A 1A8ZA 3V9EA 3EHBB 4HIPA 2BZ7A 3OMAB 2GHZA 4KNSA 1PZBA 1AG6A 3V9CA 2I7SA 1PCSA 1E65A 2HZHA 2TSBA 3EH5B 4BWWA 4YSAA 1PAZA 3NJLA
chains in the Genus database with same CATH superfamily
4JRXE 3OX8A 3IKKA 5KSAC 1T83A 2UZYB 4QOKB 2IDTA 1A0QL 3O0RL 1S7XA 2K6WA 3GGWA 4NPKA 2W65B 2EEBA 4L37A 1L7IH 2DH3A 1S3KH 2XV6B 1S8DA 3MUGB 1ETZA 5HI3C 4W4NA 5IR1B 2OYPA 1M6UA 3LNEA 4K7PX 3G5ZA 1S3RA 3PAVA 4OD1L 4LNVA 3RWEB 1ASQA 2BSDA 1V3MA 2XWJB 4D9QD 3VD0A 3KPTA 3KLLA 3G3LA 1JNNL 4K9JA 4C56E 3FQRB 4WFED 1XGQB 5D93B 2P8PB 4AYBA 1T5XA 4JGUA 4H0IA 3UO1H 1V7ML 4OQTH 3GRBA 3NJIA 1YY8B 5C9KA 1TCMA 5K9JH 5MEPB 3TU6A 3V4PH 3IETA 3MU3A 3K5RA 1SYSB 3D3VA 5DC0A 5E6YA 2X41A 2ZPKH 5KVDL 4BZYA 4FLOA 1XF5B 4Y1AE 2Z35B 1AO7A 4IMKC 3ZRCC 3FT2B 3DO7A 3RX7A 1MIEL 3QEHA 5IFJA 2F1BA 2HKAA 4RA0C 5K1JA 4K94L 4M6OL 1WIUA 1PY9A 2J43A 5G55A 5HHPA 3S88H 5HHVL 1HEZB 1OLZA 3FU9A 3V5KB 4UTAH 2XVGA 1A22B 5B3JE 2RMNA 1C1EH 4QGYA 3QEUB 4BH7B 5ALCH 5BO1L 1IM3D 1PF3A 3CK0L 2DYPA 3US0A 3NFNA 2ICES 2XVKA 3W2DL 1RURL 5ACZB 2WUBH 1T1XB 3L3KA 2Y1AA 3QFJB 1UXSB 1WT5A 2DI9A 4UAOC 5CJ8A 1GHFH 5LB1A 3SD2A 4MA1B 4PTUB 1EH9A 2PW2A 4PRNA 4X7CC 5EZJB 4N85A 1TLMA 1HJBC 2B1AL 2Y3AA 4ELMF 3TBVA 4WI2A 4LBEB 2JIXD 4HAFA 5EBWB 3VFOA 2APVA 3H42H 1CL7L 5JXED 1ILUA 2TSAA 4S1QH 3FNKA 3UJIH 4NO2A 3FUHA 4OFYD 3SDDC 3VD4A 5FA3B 1AOZA 1DO6A 4HEPA 3PGCB 1GGIH 3HG1E 4F37K 4Q8BA 3MLPA 2QSVA 3RNKA 3THML 3PPEA 4GQRA 2NYZA 1MJ7L 3SY6A 4EXKA 1AR1D 3HPJA 3PV7A 4YVUA 1F3DH 1FGVH 1ZCRA 1NL0L 1U8PA 2VISA 1DVFA 1MPAL 2R2EA 1X3DA 2WXHA 4Y4HA 2O5NA 4JY4A 4U6YB 2YPLD 3T6VA 3WFDL 4BM7A 1D5RA 2GIYA 2XTJD 3IEAA 4CMMA 2NY6C 2AS5M 2ZUTA 2MPVA 4FCHA 4AYEC 5ID1A 3U6RB 3KNBA 3EJQA 5DC2A 5E8DH 4Z3IA 2J6EA 1Q90A 3W39B 3OMNB 4R7VA 3JV5A 3QC6X 3SDCD 1DBML 1U6AH 4YDKH 4KI5C 1AS7A 3V6OC 1V54B 2MQ3A 4ZOCA 1DQDH 1NEUA 3P2BA 5KZCD 1A6VH 2AJUH 5HDQL 3V8OA 3RPIA 2R69H 4ZPVB 1E67A 3MRHA 1MAJA 5C3TA 3UAAA 1G9MH 2F53E 4FQXB 5IG7B 2PP7A 2I07B 5DI8A 1JS4A 2YGQA 2ZYSA 3BYYA 4NQDA 5KZCB 1OM9A 1JZJA 3QWQB 1KWKA 2G2RB 1IL1B 5A3IC 3OKYA 5BVPH 5C3LD 1OSZB 1UWGH 4M7ZC 1AJ7H 3IJHB 2NPLX 2O93L 3DTUB 3ARED 3QXWA 1VAHA 4W6XB 5DCCA 1G7JB 3SEPA 1X5XA 1KGCD 1WAAF 1CD8A 1EHXA 1DVSA 1QSFE 1RFDH 5FDWB 1AFVH 4F2MB 1AZVA 2QPFA 4NN5B 4G80B 5ICYA 1QEWB 4Q4IA 3CVBA 3WS6A 1OAXL 2HPTA 3IK2A 4UT6H 2XG4B 3U1QA 4JFYA 3UBFA 4JRXB 1QUNB 3M07A 4EI5C 2WWKO 4YXKL 2D7PA 2YZ8A 5I5IA 3LV3B 4UQ2A 3NZHH 1U8JB 3K5SA 2ESVA 2GBUA 3LEVL 4N2EA 1EZLA 1U3HD 4UV4L 2XFXA 4Q2ZA 2EE3A 4X99A 4YSQA 4NN7B 3V95A 1MCFA 1LM8V 3NQKA 2RD0A 3GXUB 4HFWA 3F7YA 2AITA 4WEBL 3AQXA 3QS2A 5E7FA 4HJUA 1EDQA 5BRZD 3UERA 4Z8FL 1A21A 1AP2A 1ZTXL 4WJG3 5E6ZA 4U0RB 3BWSA 2QHLA 4LLVB 4F57H 4LO9A 4YE4L 5LNEA 2ZIDA 3MBED 4XNUL 4UTBA 3MJWA 1SGKA 2PYEB 2IBZY 2NR6D 4ODUB 1I8UA 2X4TB 1NJ9A 3AY4C 2DQFA 2CDEA 2NX5E 4OFKA 3ZMEA 2CAKA 4C57C 5DD1L 4CVXA 1NZRA 3C6EA 1HHIB 2ZYRA 1IIKA 3LEXA 2NXYC 3LMJL 2I7OA 2PXYD 4L23A 3ARWA 2I27N 2ITCA 3L3HA 4NQSB 3RWFA 1WDAA 4PGCB 4M3HA 5DFWH 3VMOA 4QNPE 4IRSC 5I66B 2D3VA 1PFOA 2H2SC 4JDTL 3C5ZD 1QBLH 2X44D 2ZX8A 3DIDA 4KK8D 3US9A 4APQB 3VFPB 3JV4A 3M88A 4KTDH 4NRYB 3U6XS 1DEEA 2VABA 1JF1A 5E6ID 3SCMC 1PAMA 3HI6H 4RMRA 1LP9E 1L6PA 4AQOA 5D1ZA 1QEXA 5DVMA 3IAGC 3T77B 3NCWA 1EMTH 4LKCA 2Y2TA 1P84J 4HIIB 1B0GA 1DDTA 4IRJD 4IBWA 1WS8A 1QLFB 2P43B 2VL4A 2ZSVA 4ZD3L 4ZW5A 1YMME 4ENZA 1JVOA 1INQB 2IAAC 1TSHA 4IRJB 4G70B 4YH6A 5I6PA 1KV3A 1UZ6E 4RMBA 3BIKB 5EU5A 2FX7H 4MD5A 4ZXBC 2K0RA 1MCJA 1FVCB 3JTBA 2J57A 3A5VA 4YHLL 3QFDA 4NUGH 1RUAL 5CEZH 3P9WB 1XIWB 2VUOA 4M9PA 5IJVB 4BYHA 4YHNA 3D2UB 3IGAA 3KPPB 1DBJH 3K80A 4JFDD 1NC2A 2GC7C 2V2TA 2IOMA 2CIKB 2ZCLL 1MLCB 3NRPA 2QR0A 3ARRA 3V5DB 5JDSA 1B0RB 2FQGA 2VQUA 5DS8A 5TJWK 1R0AH 3QUZD 1UXLA 3AT9A 3GSQB 3FHEA 4LCCA 1AY1H 1B4JH 1IC4L 2YN3A 4TLKA 5CGMA 2CIIA 2HVKA 3CIAA 5KBNC 5D93C 1R3JB 2GQHA 1SF5A 5LVEA 2OR7A 2WZ6A 5GJSL 1IM3A 3OG6B 4QXVA 4XAWH 5ESVB 3UTSA 4LSUL 2XY1A 4LB8A 5C0DB 3HC2A 5T1JA 5GGRA 3O3AA 2FBJL 3ULUL 1LEIA 1SJHB 1UKSA 4G8FB 1IFHL 2AEOA 3X3GH 3VACA 1UWXH 3SDYL 3TA4D 2F53B 4OR1A 1OP3K 1EEZB 4OFYA 1EFXB 3MRLA 3LPOA 3CUPA 4G72B 4KMTH 4UT7L 1CLZH 2YXFA 2R1YB 3LZLA 4I2XA 3VFRA 4L1TA 1MREH 1NTDA 2A9ML 1K4CB 3K72B 3WE1A 2VGLM 4OI9A 4ZPTA 2HN7A 3WD5L 4FJYA 2EE2A 3OAYK 3A47A 3DWTA 3F6JA 4GW4B 4I87A 4KKCC 4K4KA 5C0BA 1QWHA 4DEUA 3QYNA 1KPRB 3D85D 4MMXB 5F88A 1JGUL 1P4BH 5F7DB 5DFTA 1U8HA 3GIVA 4M43L 3WEXA 3A6CL 5TD4A 1NAKH 2NYYD 2G2NA 4MA1C 4NUQA 1IFGA 4ODWA 1QRKA 2BNUA 3ZSTA 4OIFA 3OAZH 4U6XB 4X7DC 2C4FU 4JFHD 3TBYB 4YSEA 3EFFA 25C8H 3CXHJ 4GPVA 3S97C 4AVHA 1SDYA 1JRHI 1ZXQA 5E1AA 4Z0XA 5CEXB 1I3RA 2C4FT 3SHSA 3PJLA 2ZKWA 1SUJA 3GTTA 2CO7B 4I9WE 4RRPA 1CLVA 5GRJL 1DJIA 2WLNA 5TFSL 3VD5A 3ZE0B 4QCIB 3APMA 4AUUA 5DQ9A 1R24B 2KT6A 3H53A 5C6PB 3KYOA 4XTRC 4B6ZA 1BZOA 2A3TA 3UO8B 3OB0H 1NCBL 4ZUVA 1KG0B 2E76C 4HXAH 2IQ9H 4MSWA 1NMBL 5C0JB 4ZS6C 5B8CC 3U82B 5EEXA 1I9JL 1YEFL 3MZTA 5I9QC 3WV0A 1TETH 3BH8B 4RA3A 2NX5B 5GGTL 4JPWL 2OSLB 1KEGL 5CM1A 1ET8A 1P7QD 2NZ9C 5IQLA 1RL1A 1YQ2A 1ZWIB 3NGBB 5DJ0A 4OUOA 3DV6A 4E41A 4C4KO 4R4FH 5DMGC 4CVUA 4MA8H 1GJUA 1OTUC 4Z77A 4YDLB 5JR1L 4N90D 4OM1L 3IMSA 3SGEH 1E42A 1HC1A 1LO2H 1JYVA 3KLHC 5F9AC 4AIEA 3AABA 1ZSDA 2Y1VA 3SGDI 1PIFA 5CAYB 3VXNA 4KUZH 3VYOA 1J48A 3VSTA 4JHZA 4YAQB 4YSPA 4AIOA 2H9GA 4FQXC 3ZDYE 1YYLH 3LZRA 1AXSB 1MFEH 4OGXH 5EU6E 2WLHA 4XP1L 2N7SA 2WWKT 1NBVH 1F2QA 3VQ2C 1I82A 1P9MA 4M7JH 3OSVA 4PRDB 1QSED 4GAYA 1LE5A 2EVJA 3T8VA 3P1VA 1YMMB 2OMWB 3FQXB 2PPFA 4HWNA 4CSPA 4AW7A 5LXGL 1VERA 1P53A 3HNTL 2BVPA 5F71A 3ZE1E 1A3RL 2B39A 2CMRH 2HSIA 1M7DB 3SDAA 2A77L 1XH3A 5F2FA 3BSZH 4NN5C 5TQ0H 2AQ1A 3MRDA 3OC8A 2NSXA 3DJZA 1CMOA 1P4LA 4AE1A 2F9BT 1M05B 2XBTA 5DZLA 1IZJA 3T0EE 2YFNA 5AOJA 4IKJA 2Y72A 3CFDB 4MNGB 4X8CA 4UILL 2VN3A 3DETD 1OE3A 5D1QD 1DBKH 3V9EA 1DL7L 4Z7OE 5K9KB 4X4ME 4AQZA 1GZHA 3ZYZA 2M8XA 5HPMB 1EK3A 1PCSA 2Y7MA 3RWCB 2TSBA 3L54A 3BP6A 4FQ1L 2XQ0A 4JANB 4W9GC 3BKYL 1YZZA 4KO5A 1SLVA 3RHWF 5H4YA 5AAWA 2QVTA 4EZMA 3QG7L 4AXWA 4PJCA 1KCSL 3Q8BA 2BFGA 2DJMA 3R7RA 2W95A 1TZAA 2HFTA 5J7CC 3T65B 1A6PA 4MCZB 1G7QB 3SYOA 1MHPH 4RIRA 4K3GA 2V5RA 2OK0H 4XP5H 1Z0MA 1Y1DA 2XV3A 1P1ZB 1I9EA 1VIWA 3MXWL 5B3JF 2G3MA 2BNQA 2DLGA 4YHKL 2JKJA 1QO3A 4NIKB 4BQ9A 2ZSWA 4L8SB 4APQC 1F8TL 3ESVF 3EIFA 3LS5L 4PRID 3MA9L 4P46C 1RZIA 4EIZC 4ALAC 1T1YB 4JFDA 4JFVA 1QZ1A 5KBDA 5T33L 5DVKA 3KEHA 4N0FA 3OWRA 4PGDA 2BPBA 3BGAA 3ILQC 3MUY1 7PCYA 4LP5A 3QUZA 3RY6C 2F7PA 1IFRA 4F5CA 5IP4A 1W8OA 2VB5A 5GISL 3TA3A 3U30C 5LAXA 3W9EA 3LHAA 1VHPA 2KERA 2I5YH 3FH8A 4FTVD 4LHUG 5CEZD 4FXKB 2HX9A 3CHXA 4MCYA 4Y16D 2YARA 5DHYA 4OTXH 1X4YA 1H8OA 4IK6A 4JFPA 1KTBA 2RJMA 3QI9A 3V4UH 2A6KA 5HPOA 3MHZA 2NY0D 4R3SB 4RGOL 1ZGLM 1FLRL 4P5MB 3T8XB 2MJWA 1XIWC 5TH2B 3LD8B 4YXLL 1T2JA 3NSCA 1ZJAA 3NJFA 4MDRA 1D5IH 3BJ91 4G9DA 4D7BA 3CDYA 4HK0A 2VSKB 4HQQL 1WD9A 4IGBD 4KHTL 3MRNB 1GR7A 1X5GA 5EIIG 4HKBA 4AUYA 3UZQB 1SDAB 2E4TA 5TK2A 2X1QA 4G3YH 1CF8L 4GQZA 1KTDB 2OMTA 3HCVA 3IJYB 5A2AA 1A47A 3T3MB 1FNSL 3MYJB 4WKZB 1TNNA 1WFUA 4V11A 5BO0D 1I9RL 2VZTA 1JPST 1XB3A 2HLAA 1Q9WA 2AERT 3H4HA 3N44B 1FNAA 4XAKE 4XXDA 2GY5A 3VFWA 4N1EA 3VUAA 4MJID 3A6OA 3UROR 4Z3EA 3MCYA 1T4KB 1BYOA 1R3KB 5D7SL 3SZ6A 4D0BB 3NG5A 5IVOA 3AQYA 4QGTA 1OE1A 1P4IH 2PN5A 4XI5C 2WSKA 4G8IB 3ZIMA 3LNIA 1JIBA 3MLRL 4TOYL 3P73A 4P23C 4D8PA 3TIEA 2D4FA 4WUKH 3EYSH 5EU6B 4U7SA 1FE8H 3I6KB 4YDJB 4O00A 3H9SB 4JFQB 1D7CA 3DX9A 4QMEA 2WLLB 5ELIA 3UZEA 4ODHH 1TR7A 3MROA 2YRLA 4O02H 3PP4H 4TVSa 2LU3A 1ZLEA 1F45A 1SEQL 5F6HJ 5AG8A 3S3SA 2FR4B 4MMXC 2F1AA 4XNYL 1ODUA 2DIJA 3NFSH 2OL3B 4G6FD 1C5DA 4U1GB 2EIMB 3DX4A 1NM9A 4DKFH 1P7QA 3IU3B 3NSDA 3RDTD 3T0EB 2UWEF 3IDNB 1O7DE 3WFCL 5JO5A 2ADFL 4CKVX 3CSFA 3L2LA 3L7FA 4NQUA 2WBXA 4HUVA 1EVUA 3DDGA 4Z7OB 1C08A 2DPKA 3LIZL 4C4KT 5J1AB 2H2PD 1BAGA 5TF1H 4YUEL 3QJSB 4HWUA 4R2GD 4PR5A 2WUCH 2AXHA 3SPHA 4KK6C 1H19A 4LVHB 4KY1L 1LO3H 2M1KA 1PNDA 2X53A 3T3PB 1QSVA 1BVKB 1HHHB 4KKAD 1PKQE 2X12A 5C0RH 1K6QH 5D70H 3P3YA 3UPRA 1KYFA 2WIMA 1IBZA 3E7JA 2IPUG 2WZPA 4DT2A 3NGBC 4HH9A 1XCTA 3WFBL 1E9PB 2H1XA 1CU4L 1KXQA 1U93A 3F7VA 3HHSB 3OZKA 5AYUH 2BVQA 2GTWB 1Z9NA 2E6QA 5EZIH 1K72A 1M1SA 1X5MA 1LP9F 4YDLC 5GSRA 5T5FL 1MH5B 3NCCB 3N1PC 4IU2B 1JGVH 1P5VA 4FXGC 4LARL 4FNPA 4R9HA 3BFWA 1KTJA 3BWZA 3NK4A 3QUMA 3BW9A 3QDGA 1BECA 1ADQH 2LVEA 2OJZL 5BW7C 5CMAA 2NUPB 4DN4L 2E47A 4MDIB 4A67A 5KBKA 2PTVA 2VLJE 5ES4B 5M7QA 2P7TB 3HZMA 5DJYB 1UZ6F 5H8DA 1ZLWH 1SYVB 4AKPA 4AL8C 2IPKB 1CLCA 3DO3A 4XPGL 3VI4F 2OYLA 3EKCA 2PTTB 3TN0D 4DCQB 4NNPH 4ZFOA 2FCBA 2PCYA 3EBHA 4XNBA 4XNXH 5BS0E 1U0QA 4WLCA 4YHOL 2E4FA 5DFAA 1JUFB 3VDBA 1CFTA 4NZUL 4KBPA 2YLKA 1BOGA 4PVNA 3ROOB 3VWJA 1OANA 4M4PA 4Y0GA 3ZMRA 4DKTA 5CILL 4G2AA 3HHMA 2EEAA 1J86A 3E80A 2RFXA 5BZWB 3U9WA 3IFLH 5I6KA 5D5ME 3KL0A 3V0IA 4A55A 5FWQA 3B9EA 1J8HB 3B4NA 1EANA 4JFUA 5ECGA 4DFIA 1QBMH 2J3SA 1HIML 3UTZB 1Q4NX 1BVOA 3E1ZA 3F12B 3C2SA 3G6JA 3TEWA 4HUMB 5EBMB 4QXGL 1AE6H 2WIIB 2X4RA 4WU7B 2B3RA 5L2KE 4TNFA 5CR1A 3GJEA 3QUGA 2HT4C 1UACL 4BSVA 1MIMH 4WKXA 5BUPA 1YEJL 1YQVL 3DGDA 3M86A 4NQEE 3TVMD 1I9IL 2VTFA 1W6LA 1DUZA 4NENB 3B3IB 3GMMA 4GKSB 1HQRA 5FXCH 5I1DB 5IJKA 1Q1PA 4L3CB 1NGQH 4J4PA 2DYRB 3LRHA 1KELL 4OGYH 3RURA 2VDNB 3T04D 1GJWA 3D50A 1D5ZB 2X3BA 3F05A 2WVVA 2GT9A 2X4QA 1F41A 3I2CH 4QPEA 4WFGE 3S5ZA 2X0UA 2GIXA 4JRYD 1E8WA 1RAMA 2V5MA 4O58H 5GGVL 5TGBA 1FYTA 3ZTCC 4YJZL 4X80H 3WJJC 2B0SH 3MRIB 3WTYA 5TDNB 1A6ZB 1D7DA 1X44A 3MLYL 4QAMB 5CNHA 4P9HC 2EIJB 1DQLL 3EOAB 4G9FE 4EUPG 2GJ6E 1T80A 4MJ6A 5GRZA 1A7NH 4LLQA 3ETBJ 3DYMA 1F02I 2Y6SD 3MJGX 3ABLB 5ANME 4LSSL 4N0UE 4CSTA 2Y06L 4FS0A 3S5YA 1QLEB 3ARFD 2HTLC 1P5UB 3TBWB 4QY8B 1CI3M 3FMGH 3HR5B 4IOFD 2YAQA 2FD6L 4Y5VA 1AC6A 3ARFB 5DJ8A 3NCJL 4DOHE 1ZHNB 1NLBL 2VQ1A 1TQWA 1KFGA 1NA8A 1VSCA 3QUKA 2YMTA 1YJDL 3QBTB 3RY5A 3VFSB 1EHNA 1JCKA 3ZKNC 4HZ1A 2DI8A 1Z3GL 5GIRB 4NC2B 3WY2A 3E6HB 5I75B 1T89A 4XXCA 2CKBH 2JNZA 2H8PA 5J3HD 2Z93B 4FHKA 3LEYL 5FO2A 3KBHE 5B1KA 3OSKA 2C3GA 2J8UB 2P42B 3PXJA 5KN5A 3MRGB 2ZXDA 2G2PA 4XMUA 4G5ZL 3T2OA 2CG9X 4WY7H 3U46A 3FQWA 5EU4B 4AQEB 4M5YL 3VB8A 1J12A 1A02N 1NEZG 3VGHA 2HJFB 5DZJA 1PYWA 4OGAD 4YN3A 1EERB 2P52A 1PZDA 1B3IA 3VQMA 1XH0A 2FWLB 4K8RL 3VXRA 2H47C 3WNPA 4PRBA 2I9TA 3DHJA 3FKUS 1FFPB 4QXTA 1WFMA 4NP4L 3BQUD 1X9UA 4X0KA 4FZ8H 4AW4A 1CXEA 1JFQH 3N1MC 3ZDYF 1OGAE 3JWOL 4MKMA 3ABZA 5EBLB 2VDKB 1VGKB 4PRPD 4AZUA 1KXVC 3CHOA 4DN3L 1VDGA 1IAMA 3CFEB 2ZOKA 5EO0B 1E5ZA 3PFUA 4DTGL 1JYWA 3MNZB 1CDHA 4WV1B 5HYJA 1T7ZA 2A0LD 2ZUYA 5DJDA 3FF7A 1TTAA 4PWEA 1I8MB 3GSRA 3GHEL 2YAFA 3CVDA 4FL4B 4N5ED 4L3AA 4CU8A 3BRGC 4ZK8A 5CU5A 4ZUWA 5BV7L 2V7HA 3EFOB 2EDRA 5L9DL 3ZE1F 3V79C 3TASA 1C12B 1FSKC 1I7TB 3ALWA 4P57A 2Q76B 5T3XE 4FG2A 5JHMA 3UBXA 3DBSA 1AD9B 3U2SB 3QQDA 5FS5A 3W11C 4F2EA 4LLMB 4X5WB 3NT0A 2C9UA 1G7IA 3MC0A 5HHNA 4CADB 4ELKA 4XO5A 1LDPH 4ZTOL 4FRWA 1W8NA 4JFFA 1S5HB 3UIYA 4IBUA 1UFGA 3DJRA 3X12A 3H9YA 3T0EC 1JXDA 4TL5A 5FKAB 4ZJ9A 2A6DB 5IHUL 3G6AB 2NXZB 4XBPB 3FUJA 3HI5L 5D5MB 5GRUH 1WBYA 2DQDL 1BX2B 1QFUH 2BIPA 5L4JA 4Y9FA 5HHOD 4NQCE 4U1JA 4L8BB 3II2A 3SE3A 1HK6A 5A6MA 3N04A 1SPDA 5AKTA 3OLDA 3MV9B 4LCYA 3S35L 1BZ7A 2WWMC 4LVHC 2XTLA 2VCOA 3PIQB 3BJLA 3OMZA 4QRQB 5L2KB 2XXGA 3U7AA 3U9PH 3G9AB 1NC4B 4AQAB 1H3PL 3AT0A 4MA3B 5E94B 1Q38A 3IDGB 1JK8A 1G0YR 4HIPA 4NQEB 5I17A 4ONFL 3STZA 1KCRH 3FU0A 2K7QA 1BZ9B 2I7SA 3BSZA 4HS6B 1DQQB 4Y4FA 5CZXD 3VI3A 4EI6A 5E08L 4OCNC 4BWWA 1GGCH 1NLDL 2A6IB 4GKNA 4RCAA 2J56A 1R3IL 1FRGL 2YEQA 1E4XL 2EE6A 3VXQB 1NUDA 5T1LD 5ISZA 4ENEC 5CBAA 4YGVA 1ZA3A 2V5YA 1S9YB 1GVIA 1HXKA 4DKEL 2EDTA 2HYMA 5CKAA 3SE8L 5FCUL 1T20A 1FFRA 2AW2A 4XWOC 4LSRL 1RLWA 1U8QA 2CR3A 1E8XA 5KSAD 4PJGA 5DUPH 4G9FB 1CDYA 4LHUB 2GJ6B 1IM9B 3AAZA 1MQ8A 2EDBA 5E6RB 3VFTB 3PJNA 3II3A 1VESA 3NP3A 3OV6A 5T1KB 4WWKB 2V2WA 2NZIA 4N0UB 2Y2YA 3P9MA 4F7PA 1PX4A 4OLUH 5I74B 4KITB 2EDOA 1T03L 4LDLB 1TZIA 2NY2C 1BBDH 1G1KA 1IC1A 3NZ8A 4CVWA 3BKJL 3IDXH 3ZPDA 1H3VA 4RH4A 3UOAB 3RPBA 4JNXA 3QJHB 4GI8A 5DEFB 4MD4A 1BBJA 4PJAA 4K15A 5EIIB 3BO8A 4NPYA 2WXRA 3MN8A 1T04B 4A7GA 2HKFL 2EC8A 5JYLA 3SE9H 3GPEA 1OK8A 4N8UA 3NIDE 2IGTA 1BXVA 1UH4A 1M2VB 1YEGL 3PAZA 4MNQA 2FJFB 2ID5A 1I8KB 1TITA 5F3HB 1LQSR 3G5VB 4ABQA 4UOW0 4B27A 4JRYA 4OFQA 3L1FA 1N26A 4G8GB 3MRBB 5KJ7E 4RFNC 5MERB 4FG4A 1EUTA 2YS4A 3QJUB 2P8LA 3QZLA 4NCDA 3ZLQC 3MRFB 4KWUA 4RZKA 2OPCA 3CMOH 3QJOA 3QUYA 2Y1YA 4ONGL 2RQEA 4TSAL 1MRDH 2COQA 4PP2A 3B83A 1HXYB 1E5CA 1N6QH 5DUBA 3B7YA 3WOVA 4PGZA 1U91A 3R1GH 4JGNA 3LPPA 4OW6A 1AS6A 4C59B 3RVTC 1TMQA 4LPTA 4XCFL 2FZ3A 5J0BA 5ANHA 2KDGA 4L2LA 2VW6A 4LIQL 1SJMA 1ZT4B 5F7FA 1H3TA 1L0YA 1Z9SA 2XU9A 2V17L 2EO7A 2QJDA 2HRLA 2DL2A 5I8CB 4ABUA 3SDXE 1I1AC 4X7EC 3S2CA 2PO6A 2GTZA 4EN3A 4OM0H 3QQ3B 3TNMB 1AKJA 2DMKA 4WWOA 1TDQA 5DK2B 1NGXB 4AEIH 1NBZA 3HC3H 1PU0A 1EAJA 4OLVL 3SBWC 1U8LB 3OM3B 5AWNL 4AQ1A 5LWYH 4KC3B 5FOBB 3DTXB 4DGIL 1K8IA 5FHAH 3KVDD 2IH3A 5JYMA 1NBYA 3CXFA 3KPOB 1GGUA 4FFTA 1BD2A 3JZYA 1B6UA 2Y22A 1IKNA 1EDHA 2R7EB 1V55B 1QTPA 3I3DA 4K5OA 3TO2A 2FO1A 4GSDH 5MEOB 4EDXA 4QRUA 1TO4A 3EH3B 3LPWA 5FA4A 4PJIE 4KJYA 3PHQB 2WLJA 4NBYB 4G71B 4HOXA 3GMQB 3HJEA 1HZHL 4NUJA 1CT8B 2QQNL 1IKFH 4UZUA 5T3ZH 4NNXB 1A1MA 2PR9A 1CVSC 1O7DC 5AKSA 4FKEA 3DVFA 3QPKA 3CN2A 3DO4A 1KJ2A 1SRDA 4U1NB 3PAYA 3GMLB 4O4YL 4RVBA 3I9GH 4ODTL 3LRSA 2J1XA 4NQCB 4OCXL 3INOA 3C5JA 3MZGB 4DGWC 4L1BA 2ENSA 2OI9B 1MFMA 2CLZA 1SFHA 3EYOA 4N68A 4ZX6A 2VDQB 4RQQB 4QF1A 5A43C 3HE6A 2VXUH 4Y9BA 3SKJH 4JKWA 4OF0A 3CSPA 5IBTH 3EO0A 1KTLB 4GS7C 3SKNA 1VKXB 2BWIA 2CKNA 1ITBB 1M6OA 1KJ3L 5F7KC 3BP4A 4J1UA 4G1EA 4U4BA 2G30A 4Y5YB 1EXUB 5B39G 5EBGA 3P2TA 5I1HH 4OCYH 4X6FA 1LO5A 4I89A 4ANVA 3IGUA 5D8JH 5AW1B 5C7XH 1D6EB 3BRFA 4QYOB 3ZHKA 1W72H 3D39D 3X3FH 4ZTPL 1I1FA 4O2EB 4XP9L 2JMRA 3ILEA 3LZPA 4QRRD 3FCSA 1ID2A 2IIJA 4V1DE 2G3XA 4JJHA 4ZS7H 3KDMA 1RZPA 2BIIA 4NQVB 4ZFZA 3Q3GB 4WV1C 4EI5D 5GRYA 4TQHA 2YBGA 4OLWL 1IGMH 2OZNA 3LQAL 3PE9A 4ZO9A 1EXHA 1UGNA 4QRRB 3NIGE 2EEDA 5FGBA 3UTTE 1AGCA 1DP0A 3QIUC 2OTUB 2H7WA 1BFTA 4D9LL 2Y0SA 2W9DH 4I5BB 3F58H 2X70B 2AQNA 3JYCA 3U1SH 3FPXA 1DQVA 5DR5H 2VXQL 3RGBA 4G59C 3MRJA 4KO7A 4YO0B 5MI0B 1PG7W 4H8WH 1F3RB 5DUJA 4JDZA 1SXZA 2WNWA 2PPEA 2R4SH 2XCMC 4JW3A 4JKNA 3H56A 1CD0A 1NCGA 1FPTL 2VLMD 4PY7B 5E00A 5DJ6B 5D7LE 3P0YL 1G7PA 3RTLA 3RKDD 3NIDB 1WSST 2YUVA 2O6CA 2W9EL 2H0FA 3BP7B 4UM9B 2QGBA 4Z76B 5DTFA 2COVD 3CVCA 5KVFH 3HS0A 4WK2B 3C60A 4HWZA 4XN7A 4NJAH 4UQIM 2BIMA 3FTVA 2IOOA 1LYQA 4IRSA 4XRCA 3ELAT 1BFVH 4PJ8D 4MWFA 2OKMA 4QLRA 4HJIA 1HL4A 5I8EA 1IIIA 3C5XA 3O3DB 5KSAA 4NKMA 1J8KA 3SCMD 1FH5H 3C6SB 4C83A 1UQSB 5LBVA 1F90H 1KV7A 2Z91A 2LU4A 4QRPE 4DP1X 3C6LB 2H26A 5EU7E 1L7IL 1HH9B 2QQKH 2G3ZA 1S3KL 2LLNA 4EUPB 2WTOA 3RGVD 4DZBA 4O2CA 3IMRA 4Z5RB 3QXDB 3H2WA 4ZBJA 3GSXB 3Q48A 4AMKL 2Q2LA 5C0AE 2HT3C 1CIDA 4W6YB 5IB3A 1YECH 3SDXB 43C9A 2GCYA 1KPUB 2BERA 4XCCH 1R19A 3FOLB 5I18L 2EXYC 1E30A 4OQTL 3FUMA 3KAAA 5HHMD 5K9JL 5IZ7A 1S7TB 2AQQA 3Q6GH 5ERWB 4GG8B 1G7LB 3L3DB 3V4PL 3ARGD 5A7EA 2ZPKL 1YYMH 2ICWA 4P3WA 1KCBA 1KLUA 4X6BA 1GRWA 3TL5A 3MQIA 5D7HA 1GZQB 1SY6H 1UWXK 4IU3A 1AI1H 1IAII 2Z4QA 3UYPB 3ML8A 4A2LA 1SXAA 5J6GB 1T0NB 1K4DA 4PIRF 4PJIB 4LCWE 3D18A 4B7LA 2H6OA 3S88L 4UTAL 1NEZB 1C1EL 1KLGB 3KPQA 1JZ2A 4ZO8A 1JNHB 1ZANH 4H25A 2WXGA 3LSOB 5H37G 5D71H 5FYLE 3FZUC 5IM7A 2E9WA 4IEFB 1KGYE 1F58H 5IIEB 2WUBL 3TPUB 4HHWA 5E8EB 4EO5A 2GW5A 3PF2A 4G6JH 4IS6B 1N5AA 1GHFL 2X42A 4LL4A 5EZLB 5ICXB 1M2OA 3WUWA 5C0EB 1WUNT 1Y18B 3D4CA 3DYOA 5MENA 5GS1C 3VGFA 5I2IB 3OAZK 3H42L 3N1FC 3ALPA 5E2TH 4S1QL 5FAAA 2JB6A 3UJIL 4NLAA 4BQBA 4HWEH 1IEAB 5BQ7A 4UTCA 5LO7A 3VRJA 2HJLA 2ADYA 4B9KC 3EOTH 1GGIL 1C5CH 2XXMB 4XX5A 2HG5B 4EBQH 2V3EA 2N1KA 4NBXB 1J11A 1NFDA 4CVZB 4RX4A 2ZXGA 2FYYB 5AALA 3EBAA 1FGVL 1TCRB 3GXTA 3QRBA 1W0WA 1A4KB 2QQLH 2G5RA 4OIAA 5LBGA 2ICEB 3U0PB 2R2HA 1QYGH 1X9LA 3OB0K 3RZCD 5AOKA 1JV5A 1Q9OB 2CKBA 2L4OA 3Q43A 5DHVA 3OLGA 1J0KA 3MJ8B 2DBJA 5E8DL 3O4LA 3NIGB 3WSQH 2X6UA 2NY1C 3O8XB 3GJFH 3UTTB 1IARB 4JM2B 5BZZA 1U6AL 1IBHA 3PWLB 4YDKL 1U8CB 4DGYL 1F11B 1OKEA 1WA2X 1DQDL 3STLA 1M71B 4BSWB 1A6VL 2AJUL 2D4DA 3GUTA 3SKOB 4HCRA 2I69A 2AMUA 2XWTB 1E9OA 2R69L 4R7XA 3E0GA 2BP5M 3T1FB 3V52H 4JN1L 3ZX1A 1NKGA 1G9ML 3LXAA 4YSSA 2XA8H 2NY7H 4XTRD 4YR6B 5T3ZD 3RWDA 4FQJH 1RP8A 2Z3FA 2XSKA 3FT4B 4L8DA 2Q2EB 4K3JL 5D7LB 4L1LA 5HGDA 2GG1A 5B1JC 1GSKA 2M2DA 1UENA 3DDFA 1D5XA 2MPAH 4FOMA 5DHDA 4PJDF 4TXVB 5BVPL 1WC7B 1RHHA 3J7HA 1HESA 1UWGL 1AJ7L 3KH4A 1HEJC 3QDME 1R5VB 4K9EL 1HILB 2YC1B 1VZHA 1MRCH 4LU5L 4HKZB 1DJSA 1RFDL 1SEBA 1AFVL 2OMVB 4LCIH 1EO5A 4EI5A 2OI9C 1GKOA 3UZVA 1J9TA 2GKIA 1E0OB 4UT6L 2AC0A 2FHBA 2N7BA 4XP6H 5EC2A 3Q9PA 3DBXB 4WEEA 2E8YA 4QRPB 1YN6A 2CO3A 3NZHL 4B50A 1EQWA 1IT9H 3LKOB 1HCZA 2I26N 5B21A 2ARJA 5IEHB 5KYYB 2V0AA 4UOQA 3B7UX 3QUML 4BJLA 2ENYA 4GI6A 4N2AA 3G5YB 4BZ2H 1SMAA 3MRMA 4MYPA 3F00A 3QE5A 1G7MB 4PG9A 2P5WE 5C0AB 5F6IB 1W72B 1VADA 2E9JA 1JPGB 4QHMA 4WUUA 3VXOA 4AL8H 4PUBH 1S7QB 4Y5XC 5C7ZA 2DJUA 1SJVA 1UXMA 1FFOB 5AVRB 3A22A 3UG4A 1RMFH 1AIFA 4PBDA 4Y9CA 1TMCB 1S78D 1U9KA 3VDCA 4DIXA 4PWKA 3MSPA 4WHCA 3SE4A 4Z7QE 5F8QC 3FSOA 5IMLA 4GUQA 1NEPA 3OPZH 4XXWA 1LNUA 3A67H 2JCWA 5I0XA 2ZCZA 1EGJH 1VCAA 4RNRA 1ETJA 5HI4C 2AKRB 2EP6A 1PZ3A 3OD3A 4QRSB 5D7JD 3RDJA 1QBLL 4RAUA 1FDLH 5SWSA 1OZTG 1PMYA 5GS0H 2EVIA 1ZV2A 2VLRA 3SCMA 3HKZA 1F4WH 5HHQB 1RZGA 1THCA 2D31B 3HI6L 2FO4B 4XNDA 3Q2LA 1TEYA 3IM1A 1ORSA 4I1NB 1ACYH 2QQQA 3VTAA 4Z7UE 4BFEA 1EMTL 4BV1A 1OV8A 2Z1PA 4DP0X 2LV4A 1R33A 3T6WA 3GMNA 4PWFA 3QDJE 3VXUE 5B1AB 1SOSA 2DWEA 4ZNEE 3L3IB 3U4BH 3OXRB 4AYMC 1WWWX 4RMVA 4NCC2 3G08B 4U2ZA 1DN0A 5DRNA 1QRNE 2AV1B 3TBTB 1MCCA 4O2FA 1I8AA 3PREA 1JRHH 3MGAA 1MCOH 3SKMA 4ZXBA 4Z7VE 4AJ0A 2FX7L 4AYSA 1RPKA 4DPCX 1D9KB 2UZYA 1OCWH 4QOKA 4GXUN 1DZBA 4PJ5D 4K55A 2JQZA 2W65A 4NUGL 1E6JH 5CEZL 2QKIC 1N2RA 4I77H 5C08E 4ZDHB 3MUGA 2K6YA 3C6LC 5C0IB 1WFIA 3AADB 4L5FE 2VR7A 1DBJL 5JW3H 3GNMH 5KS9F 5ABZA 3RWEA 1LEGB 1R0AL 5LDSA 2YO3A 3FQRA 1CE6B 1AY1L 2GI7A 2VR6A 2LHAA 3BAYA 1NCUA 2B20A 5C71A 4PMFA 1BZDA 4Q9RH 2HA1A 1MN4A 1E2VA 2WAQA 3QCTH 1YY8A 4XAWL 1CCZA 2AANA 4KJWC 3RVUC 5MEPA 4YK4C 1CLYL 2RCSH 1UA7A 1L0QA 3T0DA 2ZX5A 1SYSA 1RU9H 5ACMA 4WWID 4NI3A 4MTMA 1XF5A 3POCA 2YD1A 2CHNA 3AXLA 2Z35A 4PS8A 3FQ4A 3FB8B 3FT2A 1BWMA 1XGRB 2F7RA 2KLRA 1NAMH 1WBXB 4N1HB 4PS4H 4JQIA 4KMTL 1CLZL 1HEZA 1TZGH 1BWWA 4QRTB 2D0GA 2EICA 4QXUH 1P69B 1MREL 5AUMA 5B38B 3NK3A 2DM2A 4P2OD 2EDQA 3K0WA 3QEUA 4XCYA 4BH7A 3NCMA 2KHAA 2YOCA 1AQHA 3OAUL 3HZVB 3QDMB 5B39B 5ACZA 2Y36H 1T1XA 3B1TA 4ZFQA 3NJHA 3QFJA 4KVNH 5LG1A 1CD9B 1P4BL 1Q0XH 1UXSA 3Q2VA 4L05A 4DK6A 4PTUA 5EZJA 3O41B 1PLGH 4TSCH 2ADJB 1NAKL 3UYOD 4YFEA 1UA6L 1J10A 4P23D 1AH1A 1A2YB 4WWPA 5EBWA 4HLEA 3O45B 5HDBB 2D7NA 1KJMA 3MA7B 4Z7IA 2IBGA 2WO3B 1TXKA 4JREB 5FA3A 2Q7AA 1WAPA 3PGCA 25C8L 4YXHH 3ULUF 3W0WB 2OP4H 4M5SA 3MLXH 5TK4A 5EORH 5SV4A 4Z3HA 1XTMA 3IWVA 4K5MA 5DO8A 4N3TA 3FQ1A 3S8FB 1CD1A 2PMZA 2DWDB 3PJSB 4U6YA 3S48A 2P5WB 3C87A 3GS4A 2FB4L 3PL6B 3IFNH 3MPCA 3V8CA 2ICEC 3MODH 5E8OB 4GNKB 5B8CA 4HXAL 5HP5A 3U6RA 4ZAKD 5DHMC 2GJZA 3HMWL 3ZT7A 3US1A 1B4RA 1TETL 2KC0A 3W39A 4FFVC 3GMRB 3UPAA 1Z1WA 5EF3A 4Z7QB 2QDWA 5I19H 3GJFB 3QARA 3O8XC 2VZOA 5I1AB 1SQMA 2NY3B 3VFMB 3ARBC 4R4FL 4MA8L 3HRPA 2DIEA 4IDLA 1LO2L 3IDIA 2BOBB 5JHLA 3Q8FA 4LBAA 1S9XA 4ZPVA 1EO7A 3EJJX 3LZFH 4KUZL 2K4WA 4KK6D 4PQXA 4FQXA 5IG7A 3TO4B 5KYUB 4OIIH 4CNIA 2DH2A 2X1OA 1SFDA 2JTYA 2EYTB 3MFGB 2EJ1A 4HETA 5SWQB 3W81A 3D4YA 3T2LA 4UAHA 3TZVD 2G60H 5CD3B 5I6OA 5D7IE 1YYLL 4ETYA 4GMTH 4JG1H 1ZHKB 4GH7B 4HLJA 4OGXL 1FNFA 2G2RA 5J1SC 1NBVL 3NSJA 1IL1A 5F9WB 3HAEG 3IPFA 1TQSA 3HJ0A 4YNYB 2P9RA 5ICUA 3QDJB 3EO9H 4N2GA 4M7JL 2VITB 3DSNB 5EFIB 1BQHA 1ZLWK 2P28B 3IJHA 4RDBA 1BPVA 1G6RB 4ZMQA 4X98B 4GQ9H 1G7JA 1U3YA 4S2SB 4I18B 4D9RD 4LQFH 3RWHB 1ONQB 4R26H 1QRNB 4UQCA 3K71A 2E0PA 4NOBA 3WN5B 4WI0B 1BZQK 1SUHA 2VLLA 3OR7A 2CMRL 4ZW6A 1QEWA 5CCGE 3DOIA 3P30H 1U33A 2ZX7A 4GAGH 5E2VL 2XG4A 3BSZL 1AGEB 4JRXA 5TQ0L 3KW8A 3QIBD 3VNYA 5C0GB 4AM0A 4M6AA 5KYNA 2AF2A 1U8JA 2Q3XA 4GIAA 2XZZA 5AVUB 5C08B 2G4EA 3HKFA 3R19A 5EU7C 2FEEL 1DBKL 2B16A 1ILSA 4KKQA 4NQDE 1MUJB 5BRQA 1E3FA 3K6SB 3RVWC 4Y1SA 3AWEA 4OSUL 1NWPA 2WTRB 2VAAB 4KK9C 1EHLH 3UTPD 3KDPB 4C56A 3L9RB 2YGPA 4LLVA 2F74B 4Y2OB 3MXVH 1SXBA 1KNOB 2OMUB 4H8PA 4ATTA 1G1YA 1H0DB 4ODUA 4X6CB 2F8IA 4FNTA 4EVNA 4KO9A 4RDQG 1H6EA 1J05B 1L9OA 3LOWA 1QFPA 4JG9A 1JZ5A 3C9NB 1HHIA 3EDKA 1HAUA 1ID5I 4XN2A 3CX5K 3TNNA 1BMZA 1MHPL 5GS0D 4N2OA 4NQSA 3WO4B 2OK0L 1T5KA 3ESNA 4PGCA 4XP5L 3FU6A 3WS3B 5I66A 4Y1AA 3HUJE 4XMPH 5JMOC 4APQA 4H8UA 4JM4L 3VFPA 3UP1A 3ZDZE 2DM7A 1UD8A 15C8L 1BQSA 4P46A 2C1OB 5FGSA 4L9LC 2JLLA 4KK5D 3T77A 3VVWA 2E7LC 4G6AD 4XB8A 4DP7X 3BP5B 4HIIA 3WLWC 1PX8A 1ZLSH 5INDB 1Q0YH 2L8AA 1WZLA 4APXB 1QLFA 4HFUH 4F80A 1V7NH 4M7LL 3RY6A 2WVUA 3FFOA 3ZTDC 4MCNA 2L7EA 3HZYB 4NO0D 3JBG7 3E3QC 3ZZ1A 1INQA 1NKRA 1DQMH 4HXBH 4Z95H 5F3FA 5LBSH 6TAAA 3AQDA 4HS8H 2YA0A 5IQNA 3P0VH 4AEEA 5K9OB 1MFBH 2H6PB 2Y9RT 2I5YL 3BIKA 3FUIA 1JZ8A 2BP3A 4KXCA 3RBGA 4NZTL 4AENB 1P7HL 2HJKB 2GABA 2AVFA 2FHCA 4X8XA 1XHHA 4OTXL 4HGKC 3HG1A 4CDGC 5ESQA 3V4UL 2VIRB 4XB7A 3OR6B 1XIWA 4F3FA 5CR8A 4BEIA 3VWKB 5IJVA 4KH2A 3KPPA 4N8VA 4TN9A 4RMSA 3VM7A 1ZOXA 4Q97A 1D5IL 3TGXA 2CIKA 4I0PC 1GW0A 1JWSB 4JKLA 2HTKC 1TQBB 5KTEH 3GSNB 3V5DA 3EG9A 3GSQA 3WE6B 4JPIB 4G3YL 2F54E 2HLFC 1R3JA 4FADA 4I3SH 1AKPA 1I1RA 4XPAH 5AZEH 4XNMB 2X2UA 3ZKND 2WBJD 4A6YB 3GIZL 3AMKA 2IFFH 1UD3A 2BNRD 3WIIH 4ZW3A 5C0DA 1XBDA 2FLBT 4MAYB 2P5ED 5JQHC 1YMHB 4HPHA 4G8FA 1P4IL 2AZAA 5DRWB 1QFWI 2VDLB 5SWZD 2QPSA 4P23A 2F53A 3QXVA 2YD8A 1L9RA 1MCWM 3PQYD 2VW7A 1KJ2L 1EFXA 2EDDA 5D7IB 4JQXC 4WUKL 3EYSL 3SOTA 3K91A 2XZQH 3AWGA 4GRMB 1FE8L 4K71B 5KSBB 1WFJA 2KQNA 3D12B 2ZUQC 3K72A 4OJFH 4KPHH 1BQLH 2X4PA 4QHLB 3QUHA 4ODHL 4GW4A 4HALA 3ZYOA 4O02L 1KPRA 3PP4L 1NOAA 3WCYA 2JKTM 5D1ZI 4MMXA 5J6SA 1NDGA 1QSFA 5F7DA 5FYJE 3QXAB 3B37A 4PP1C 3T0XA 3SJVE 3IPEA 5F0PB 3SYCA 3NFSL 3INUH 3UTSE 4ZTEA 2BHUA 4NHCH 3EF7A 4L29B 2CQVA 1IKOP 5HVHC 4DP6X 4U6XA 2BMKB 2UZXB 4J23A 3TBYA 4FG6D 1SLUA 1BV8A 3MRPB 4PJEF 2XWRA 3UAFA 4ADJA 5CEXA 1Q1JL 4HSAC 3P4MA 2NQCA 3QULA 4M1DH 1WWAX 4PHXA 1E8ZA 2ZJSH 2FIKB 2CO7A 3DJSA 1J8SA 5EMYA 1VEPA 4QCIA 5TF1L 4TNVK 5DD6A 1RJYB 2VL5B 2WUCL 4PEEA 1R24A 2AGJH 2RAMA 3PL6C 1LO3L 1KG0A 1E50A 2F8OA 4L18A 2LT9A 2C3VB 4N9GB 5C0JA 3FFCB 2GEEA 3QHTC 4PCTA 4PV8B 5C0RL 1K6QL 3BH8A 5D70L 2NX5A 4QHNA 4P2YA 1UB5B 4BFNA 2LAAA 4LOVA 2NTSP 2XZAL 4UNIA 4KDWA 4S1SH 4TV3A 1WTLA 2NY3C 2EXWD 2KS0A 2VDPH 2XKUA 3TBSB 5EZIL 2XPGB 3QIWB 1KACB 3B9KD 4DGVH 1ZIBA 2X3CA 4R0LB 5I71B 1A8ZA 5EUKB 3D0VB 1JGVL 1HHJB 4Z7UF 3ZDZB 2GHZA 4YAQA 2WQAA 3TO4C 5BW7A 1LP9A 3DARA 1AXSA 1E65A 1ADQL 3DECA 1UWFA 5EOTB 3QJFA 3S34H 1NQBA 3CPLB 3CQFA 5EB9A 5EIVA 3TT1H 4A66A 4CUCA 1ET5A 4PRDA 2IBBA 3FAWA 3WLBB 1X5FA 2Z64C 4Y2DD 1YMMA 4LEEA 2QHRH 4DF9A 4Z7VF 1OAUH 2CHZA 3CLFH 3DOSB 2JJSC 3QISA 3GO1H 3RUGF 5I0VA 3KHQA 4I18C 1XR8B 1C8QA 3AU0A 4NNPL 1XF3B 5CJQH 4NWUH 1DN2A 1M7DA 2Y07L 4B9CA 1IEBB 2ZT9C 4NGHH 1OHZA 2QGCA 3IAQA 4MMYA 4Y2DB 1TJIL 4XNXL 5CIPH 5DMIH 2OTWB 3DGGB 1M05A 1HHGB 2XETA 3VXMD 4HJEA 3QPXH 3CFDA 1MZYA 4P8QA 3D8MA 1RSFA 2XX1A 4A2EA 1CS6A 3C5SB 1MY7A 3LH2H 1KGIA 3IFLL 3TONA 5LDUA 5K9KA 3GBNH 4FF9A 2YAPA 5HPMA 2NY2D 4ISVA 2HT2D 3ZHFA 3HG5A 3I6LE 3NAAH 4JANA 4KX9A 5I1KH 5HD8C 3HB3B 4AH2A 1KYOK 2EDNA 2F54B 2JELH 1AE6L 1RK0B 2X89A 2Y7LA 3ET9F 4OFDA 5DVPA 1CFNA 2YK1H 4HOMA 2NNCA 4P5KB 5C07E 4PB9H 4KKRA 4A68A 2BS9A 3X1BA 3T65A 4XCNB 1MIML 2XFGB 1BA9A 3T6ZA 4MCZA 3FCTA 1G7QA 3SY0B 2BSRB 3F7QA 3N42F 2HMIC 1RV6X 3ME0A 1FGNL 1TZHB 4XNZB 4NO3B 5KAQG 4ORGB 3SDDA 1FNEB 2H6UA 1NGQL 2Y3NA 3TIDB 4YHYB 2WYIA 3I2CL 4QJ4B 3BZEB 3WEBA 3LQZA 4L8SA 1ZAGA 4O58L 2EH7H 1S46A 4TTGA 2V7NB 4X80L 2NMSA 2O6DA 2B0SL 2D2OA 4F92B 5HYIA 5HVGB 2APBA 1DO5A 4W9ZA 4MX7A 2VYRE 5CP3H 4P5TB 3BWUF 3KL5A 3KPMB 1RERA 1GS6X 4I3GA 4OFPA 4TTDC 1CJYA 1W16A 1KIUB 4POYA 2WLIB 3RVTD 4KXBA 1M7UA 1V7MH 1PVHA 3TYGH 1CE1H 2ZF8A 3IXTA 1O5PA 3FMGL 3SJVB 2CCWA 3BDXA 3VD3A 2V5TA 5JIHA 4X5XB 3B7TA 2YGVA 3BWUC 4UBDC 2A74B 4AV4A 2V2XA 4KROB 4BHUI 4Q9CA 1B0WA 4GKZB 4LOFA 4PRAB 3JUZA 2XQBH 1I1AD 2W91A 1DFXA 2JV6A 1AIZA 1A6WH 1DLFH 2DWYA 1PZ2A 4Q0XH 5CINH 3DUUA 1R6VA 1BSIA 4R3SA 1OB0A 1JN6B 3GC3A 3GSVA 4P5MA 3T8XA 1PSKH 5AZUA 5LG6A 4X50A 1BJ8A 2CKBL 5TH2A 2J5WA 3QEGH 1N9PA 2BK8A 1JZ7A 1THAA 1MW1A 1IQWH 1HL9A 5FYKU 1TQBC 2JKLA 3MRQB 2WXJA 4WY7L 1MHHB 3GZQA 1AACA 4HZLB 5T3XH 4ZFFB 1KTDA 2Q0ZX 3B7SA 4GXFA 2W07B 1ACXA 3IJYA 2X4NB 4AM0Q 2DMHA 5EEZA 3JWDC 1UHVA 3MYJA 4WKZA 5D1XD 2CRZA 2BM3A 4HU2A 4MCMA 2D0FA 1KTRL 2B1AH 3E38A 3N50A 4OBRA 4RGNE 5CXPA 3U7WH 4EIUA 4X6DB 1SHMA 1ND0B 1SOKA 4P2RD 1R3KA 1VENA 2Z8RA 2ZWZA 3HAEB 3RYMA 3GI9H 4D0BA 5CP7A 2AP2A 3ABGA 4FZ8L 1KXVA 2XICA 4KNUA 4MAYC 2MRYA 3L2NA 4G8IA 2GFBB 1VEOA 4HIEA 5E5MA 4AYGA 1EAOA 3ULVE 4N2BA 2X40A 1NMCB 2WZAA 4N0YL 2XYBA 2X38A 3ARDC 3QZMA 3VFVB 1UCTA 2D73A 2FEDC 2WXKA 2LE9A 3BKCH 5EU6A 4BFIA 2K8MA 3EZ8A 2BZDA 3I6KA 4YDJA 5FFLA 1VZIA 3H9SA 4JFQA 1D3CA 3BAJA 3P0GB 1HVXA 4Z7NB 4ILDA 2WLLA 1BCIA 5F7UA 2DWXA 1J0ZA 2EKSB 1NICA 1XAUA 2VXVH 5JPNB 4F15B 4KY2A 1GPOH 2OYKA 3ABMB 4HVBA 3CZFB 1OF2A 4U3SA 2FR4A 1W0VB 3UIZA 1AHWB 2OL3A 1RXLA 3BPCB 4ZMVA 4OT1H 2BP8A 4R97B 1LDPL 2MCAA 2CCLA 3A24A 3T0EA 1I7ZB 2W80C 2HX7A 3IDNA 2VXSH 1AS8A 4BK4A 3R8BB 4HJ0D 4QRBA 3S5LG 2WQRA 1KENH 2XVLA 4N2HA 5GRUL 3WI9A 3PPSA 4L4TB 2VLJD 1QFUL 4X4MA 4MJHA 5J1AA 1BVNP 2EDEA 3II1A 2XBZA 5E9DE 2L7JA 3VW3L 5DVNA 1QQDB 3CSTA 4FFWC 1MI5D 1ML0A 4L3EE 2JI3A 1BVKA 3RX9A 1HHHA 1KMGA 5C07B 3BN9C 3WJMB 4BELD 3U9PL 1T3FB 3FU7A 1DLHB 1MWAH 1KCVH 3FC8A 4YZWA 3LKRA 3HUJF 3KWWB 4KKBD 1E9PA 4FP8L 1KCRL 1F2XK 3HHSA 1ZGLP 3ISWA 1GGCL 4R8WH 2ZX9A 2GTWA 5GRWA 3FBKA 2VDPB 1MH5A 4IU2A 4PIBA 3QIWC 3BEWB 2FHFA 1NGPL 4UV4H 5I82A 5I71C 3UAJC 1SN0A 3LKSB 4N2LA 4BCZA 4IOSD 3B8YA 1OP4A 1GAFH 2AJVL 5DUPL 4NAMA 2W0PA 4FEMA 2UZPA 4N9OB 2F1EA 1EJ8A 5TE4H 4WNQB 3K2IA 5HSFA 3FCBA 3BOVA 4FKKA 2C7UB 3HC4H 2PWDA 2IAMD 4MZIA 4UNUA 5DJYA 1P84K 4XNUH 4OLUL 4YLBA 1SYVA 1TOXA 5EO1B 5I73B 3NZSA 2IPKA 2DN7A 3RB5A 2UY6B 3CXDL 4E0RB 1F6AB 1BBDL 3PDOB 4J8RB 4KRPB 2PTTA 1RIVH 4WW1A 3IDXL 2EDYA 4HIJB 4P2CG 4WFGD 5CJXC 1TLKA 2VC2H 1P2CB 2K9FB 5F7YC 1FAIH 1JF6A 1KN4H 3TFKC 1NIFA 3V0VB 5CIPB 2C1PB 2OZ4A 3HMXA 1JUFA 2GUYA 2HKHH 2Q86A 1QFHA 1WGOA 3JV0A 3BH4A 5JUEH 2EXYD 3ROOA 3O6FB 3BWAB 3SE9L 5BZWA 1MDAA 3T0AA 2OBGA 2CBPA 1E4JA 4QD2E 3GXMA 2MCG1 4TMPA 4S0HA 2PW1B 3DXAE 4MBOA 2VM3A 3KPSB 3TURA 3UTZA 2MEJB 4JO5A 3W56A 3V4VB 3F12A 1YDPB 1HT6A 3E2HB 3HZKB 4WENB 5EBMA 2WIIA 4A1RA 2VDRH 3HB3C 4WU7A 4Z18A 5F0MB 4B97A 1M57B 5D2NE 3H8NA 4MS8C 3NBNA 3CMOL 4F8QA 4DKDC 3TXAA 4B9YA 3Q6FB 2I24N 1MRDL 5IJBC 5L8KB 4K2UH 3EDDA 4EIGB 3U9UB 2BHYA 3C8DA 5IQ9B 3PHSA 2PR4H 2H0PA 3R1GL 4KGJA 4NENA 4OZGE 3CFNA 2G5UA 2KKQA 4GKSA 5I1DA 4L3CA 1S7RB 3WGVB 4FN0A 2WGNB 3IJ9A 2OQJB 1D5ZA 3N40P 4GKOA 3RILA 2IANB 5DQDH 4KRMB 3CHPA 5FGRA 5LGYA 3CBRA 1XCQA 3QZWG 4H1LH 4OM0L 5TDNA 2XX0A 1TPXB 2C26A 3IKCB 3Q2WA 1WWBX 4PJ9B 3V0DA 3EOAA 3SBWA 4YBHA 5E6UB 1ZPLA 3D0LB 4AEIL 3HC3L 3TTYA 5CHNB 2P45B 2QKSA 4YHPB 5LWYL 1ZLDA 4P5TC 5FLVA 3RPKA 2XN9D 3H7LA 1QG3A 4LCCC 1FFNB 1P5UA 3TBWA 1XR9B 1E28B 2G75B 3HR5A 1OGAD 1XZ0B 3CMGA 4RSYA 3SGKC 3POHA 2ZKMX 4GSDL 4P4KD 1F6LL 1MFNA 2HLEB 1ZHNA 2A74C 1OIOA 1YY9D 2HUHA 3MV7D 4QTIH 1CDUA 3ULUH 4X4ZA 4DP8X 1IFHH 1U8IB 3JV6B 3VFSA 4E5XG 5T3ZL 1N68A 2NY1D 3PY9A 4P4KB 4HG4J 1GYCA 2XN0A 5GIRA 4TYUA 2Z31B 3E6HA 3GBML 3CXHK 2HVJB 1I3GL 4AKOA 4UT7H 1ACZA 2A99A 3I9GL 3MRRB 5E9DB 3UC0L 4G11A 2J8UA 5CN1A 3MRGA 4LASL 3CZNA 3WIFB 4M9OA 4GY4A 4L3EB 2E6PA 4I1PA 4ZYKB 2WD0A 4ORZC 4AQEA 1RUML 4FEIA 4P0DA 5L0QC 2VXUL 3ZUCA 5E1QA 1PKQA 3SKJL 3K2KA 3DX8B 4W9FC 3PWPD 5IBTL 4FXLA 1MG2C 1RVFH 4KZDH 3ATBA 3GK8L 4Y2LA 3FQ2A 1A4AA 3B34A 3TLRA 1I7RA 5ENWB 1HNFA 2PP8A 4OCYL 1EPFA 3PWPB 1L9TA 5D8JL 5DZ9A 5C7XL 1XTLA 4PRHD 3IMTA 3WTSA 5CLYA 4AV5A 4P2QE 5EBLA 1VGKA 1QA9B 5GZOC 2GEQA 3X3FL 3FUNA 3QO1B 1KZYA 1N4XH 2JKXA 4LEOB 5EO0A 1NMCC 3MNZA 4OZFG 4WV1A 5T1MB 4ZS7L 4PRHB 1JI2A 2FEJA 1RD6A 3HOGA 2V8LA 2FJGB 5GRJH 2WQVA 2EABA 1IGML 3KVQA 4PJXB 5AD0B 3QIUA 4KNQA 1IAIH 1XB6A 2F5BL 1BQUA 1DCEA 3EFOA 4EAEA 1I7TA 1NMBH 2Q76A 2J8OA 4OUUB 3X14A 2W9DL 1I9JH 2NW3B 3F58L 3LNFA 4IHBA 1AD9A 2E7MA 3I50L 4FQIL 4LVOB 3U2SA 5JPNC 2YKLH 3U1SL 4F15C 3QQ4A 3VMPA 5DR5L 1FO0H 3BT2H 4X5WA 2OR9H 5C09E 3ARVA 5BS0A 4ETQA 1AHWC 3NJLA 5JPMC 4CADA 4H8WL 2EE9A 1N6VA 5JR1H 1NCDH 4KFZC 1UD4A 2C7FA 4BH8A 4LPCA 1MY5A 1IJNA 3RWGB 1T1ZB 2R2CA 3R06B 1HQ4B 2A6DA 3G6AA 4XBPA 2ZOLB 4GRWE 4OLEA 1KYAA 2JQAA 5D5MA 5D6DA 3RWJB 1WZKA 1AHMA 2XOTA 1X5ZA 2VLKE 1BX2A 2ROXA 4XO4A 3TV3H 3I75A 2Y5TB 2Y6TE 2ATKB 4WW2F 4B9PA 3DXAB 3FB5B 3KPRE 4XP1H 5KVFL 1JXGA 3LN9A 4OZIE 3FL7A 1WP6A 1OCZB 2X28A 1IBYA 1HH6B 1BFVL 5AZ2H 3MV9A 4XNQA 3DC0A 1P9MC 4MHHG 5AAPA 5D2NB 5L2KA 3GINA 4WW2C 1D2OA 1OO2A 1BVLB 1NC4A 4QYAA 1F90L 4AQAA 1GGBL 4WTXA 5E94A 3IDGA 4NQEA 1VCBC 1A3RH 3NH7L 5IGXH 2L3BA 4OZGB 4HS6A 3IB4A 1BZ9A 1OK0A 8FABB 1DQQA 4ODXB 3SDAC 3HTLX 12E8H 2A6IA 3LKPB 2XA3A 1P1VA 4KGLA 5ID0B 3OKLB 5FYLH 4UILH 4ZUUB 1S9YA 1YECL 4JJ5B 3L08A 2N7AA 3QWRD 4WHYH 4X5RA 1ZEAH 4XN8A 4A2GA 2P49B 5IB4B 2EIZB 4XCCL 1IQDB 2X9XA 4HAGA 4JVPA 4G9FA 4LHUA 1HFUA 2GJ6A 4WO4B 1IM9A 3V7MA 3CVHH 3VFTA 3F6LA 4LCUB 1G6VK 1R46A 4WWKA 2VM4A 1KF9B 1TFPA 1R3LA 2BVTA 4N0UA 4YDMA 5ANMA 3FH5A 4ACPA 5JHDD 4OI7A 1JGLL 2FT6A 2AJZB 1HHKB 1YYML 3UP6A 5A2CA 1KFAH 1JF5A 4DJMA 1SY6L 5F1IB 1ICTA 5I73C 1AI1L 5EZOH 2EINB 3DHUA 4X2UA 3X1FA 3W9DA 4TL4A 4KKLC 3N41B 2WANA 5DEFA 5CO1A 5EIIA 5CCKH 3UBXI 1JGDB 5C0NC 5CSGA 5I75C 3MFFB 1H8SA 1K2DB 2IADB 1HWGB 4G43B 5DJ2B 5A2IH 3IDYB 3LXUX 4YHKH 4YPGA 2H3XC 4AK1A 1PKOA 3RVUD 5D71L 5E5LA 1M2VA 2C9RA 4H8HA 4QWWD 2EIEA 5F3HA 1CBVH 2RB8A 3B2MA 1EAPB 4M62H 5AW7B 5IROC 2OMYB 4PJGE 4G6JL 2RBLA 4HP5A 3NJXA 3Q5YA 2G9KA 5MERA 4LQ1A 1XSJA 2APSA 1UEMA 1CGWA 1BAWA 2RR3A 3E2HC 4G1MB 3BD3A 4F7MB 2E9IA 2XNAA 5E2TL 3V9FA 4HWEL 2ALAA 4MXVE 4RGMB 5DK0B 1YNTB 3ULVF 3EOTL 5I0YA 1C5CL 1GZPB 2F6AA 4MMZB 1ES0B 1TT6A 4EBQL 3RP1A 4RGNC 2DQIH 3VMNA 3WMSA 1NKOA 5KOVC 3BGFB 4OLXH 1OGAA 5HYSG 3OF6D 2L0DA 3P9LB 3WXWH 4MB3A 1NCOA 1ZT4A 2QQLL 4XCEB 2OJEB 3MV8E 3ULVC 2QMKA 2ZKHH 5DJAB 2AXGA 1QYGL 2NY4C 5BPPA 5I8CA 2ZAHA 5C0CE 5HDRA 3QQ3A 4AKQA 2X9WA 3AG3B 3TNMA 1KWGA 2PYFB 3WSQL 1TPXC 2WXLA 4PJ9C 5DK2A 3HIZA 1NGXA 3VJ6B 4KHTH 1MELA 4R7LA 1CGUA 1U8LA 5E4EC 3WJLC 1VPOH 2CO2A 5FV1L 5C86A 2FEEI 2X1WL 5FOBA 3DTXA 2XUWA 3DX2A 2BW5A 3S5LB 2LLLA 4FGMA 4BD4A 4M48H 4X4KA 2KPNA 2B4CC 5AW5B 3L6FB 3ZTEA 2OX5B 3MX0B 5C09B 3KWXA 3ULUD 1XCXA 1LWHA 2FX9H 4K07A 4U3CA 3V52L 1KGWA 1CYWA 4PJBE 4WDIB 2XA8L 1CI5A 2NY7L 4TSBH 3IYLW 1R34A 4FQJL 2XC8A 4V1DD 4WK4B 3PHQA 3VA2C 3RJQB 1DYZA 2XDHA 3I85A 4M8VA 3TYFB 1CT8A 1EX0A 2ZOWA 4NNXA 2MPAL 2P5PA 2N01B 2BSED 2R83A 4GRWB 4MYWB 2K8QA 5DJZB 1NGWB 1T66C 2VLKB 1UEYA 3ASOB 1AYOA 2Z31C 4HS3B 4U1NA 3GMLA 3ARBD 4PY8I 3CLWA 2IVFC 4F8LA 3KPRB 1T1WB 4NQCA 5KVEH 4PGEA 1MRCL 3VGAC 1OB1B 4JE0A 3O9WB 2VSDA 4LCIL 4RQQA 3S4SG 3N43B 4FFZH 5FKPB 3OAYH 3QAZB 1BZ8A 3UZEC 1QACA 5K5YA 3NN8A 3CGTA 3K46A 1VKXA 4XP6L 4Y5YA 1EXUA 1IT9L 1JXKA 4AOFA 1XF1A 1UOKA 3Q1SL 5DA0B 2ZXBA 1D6EA 4QYOA 4NYLB 2NRDA 7PAZA 5GGQH 4JEGB 4BZ2L 1A9BB 1GH7A 2F18A 4O2EA 3WKMH 4OZ4B 4H20H 4OCMC 5DRZB 4ZMPA 4HC1H 5KBPA 5E99H 2Y24A 4AL8L 6PAZA 4PUBL 3L9YA 4NQVA 3QUXB 3PGDB 4YIQB 3UG3A 3LIZH 5EDXA 4LPXA 1RMFL 3TEXA 2C9VA 2IWFA 3VH8G 3RFZB 1UT9A 4PCYA 5ETUB 2OTUA 3OPZL 1AZBA 3A67L 2CR6A 1EGJL 3M45A 4I5BA 4LOEA 5EF1A 2Y69B 3O2WH 1G9NH 2N3JA 2X70A 2XXCB 1UM4H 3HN5A 5F8RC 1A3LH 3RNQB 4F27A 1T6VN 5FUCE 3BVNA 2IQAB 1MW2A 4LVOC 5EEYA 1FDLL 1RZKH 4XHJC 1F4WL 1CC3A 4PY7A 5DJ6A 1ACYL 2UZIH 4XBGB 2KLSA 3H3PL 2OSYA 2AV7B 4LARH 5IHLB 2FJSA 2RGSA 4QHKI 1AGFB 3TH3T 4HGMA 4UM9A 3BP7A 3U4BL 4JFEB 4Z76A 3QRGH 1VA9A 2GAZB 4MS6A 1E4HA 5E0FA 1KZQA 4QTFA 4GBXB 1QP1A 4PGBB 4YZFE 3JT2A 1V3JA 2TAAA 1JRHL 1MCOL 1XSKA 2J72A 3O3DA 4QT5A 4OKVA 3KS0H 3CFIC 1ASOA 4ESKA 3B56A 1OCWL 3PUCA 5D2NC 2QKIA 5JLZA 2G3NA 2B2XH 3L1OH 4WGVB 2Q10A 2E27H 3QZWB 4ZX3A 1E6JL 1B0IA 3C6LA 2JCCE 4PSPA 4I77L 1X5JA 1HH9A 2I9LB 2QLVB 3HFMH 4IW4C 4M93C 4EUPA 5FYLD 1JE6A 3U36B 4YHOH 3QHZH 5JW3L 3QXDA 3GNML 5F9OL 5CZVL 2ILLA 3GSXA 5DRXB 3MV8B 5F96H 1WJ3A 5FECB 3GZOA 1YCSA 1LWJA 1WVZA 1YSOA 2CPUA 3SDXA 5EO9A 1KPUA 5C92A 1IGYB 4ZRGA 4AUJA 3WU1A 1MG3C 3GMOA 3G6JF 3FOLA 3FRPB 2C34A 4Q9RL 4G42A 1I53A 3QCTL 4HDIB 4MGXA 1K8DA 3QJXA 3BAEH 3D0AA 3WIHA 1S7TA 2W38A 1MFDH 2HXAA 4ZUSB 4GG8A 1G7LA 2RCSL 3L3DA 4QXGH 4E5XB 5HVWA 2XV2A 2VH5H 3QQNA 1RU9L 3ES6A 3DURB 1QPKA 3EYQD 2IWEA 5J11B 4X4XB 2J1YA 4K0OA 1GZQA 4I0PD 5A16B 3UYPA 5J5EA 4PJBB 1B9ZA 1IZKA 1N8ZB 3LRGA 4MQSB 5C0FB 5J6GA 1T0NA 4WFHE 3O4OB 4UMGA 4PJIA 3IJ8A 1NAML 2D7TL 2EYSB 4HCFA 1F5WA 2OMZB 1TZGL 1R75A 3OKEA 5ADPH 1XGYL 1NEZA 1KLGA 3UTOA 4HIHB 1JNHA 4J4PC 3GB7A 1SOQA 3OKNB 2H3KA 3KGRA 1DR9A 3LSOA 4NWTH 4ICXA 5DURD 5F3BB 3HN8A 4IEFA 3ORJA 4LNRB 1R5IB 3JWDH 2YA2A 3RTQD 5IIEA 1OTSC 2Y36L 3IF1B 2F68X 3TPUA 1QR1B 1FN4B 2B9BA 5E8EA 4IS6A 4QHKJ 1H15B 5EZLA 5ICXA 5DMKB 5C0EA 3T5WA 2R0LH 1PLGL 3GKWH 3DK2A 3KL3A 4UQDA 4N28A 2WAHA 3RTQB 3VG9B 5I2IA 4MZ3A 4KFMA 2F7OA 4OZFB 4A7UA 1ITCA 1IEAA 3DROA 4K5NA 4XMXA 1RIHH 4OAWA 3V5HA 5CS7A 2R9HC 3PABA 4KTEH 4YXHL 1BPLB 4RGMC 2HG5A 2OP4L 3EDFA 1UZGA 1N0XL 3MLXL 5EORL 4CVZA 2EDWA 1DSYA 2FYYA 1NLBH 3Q1EA 1R5WB 5FYJU 3HG4A 1TCRA 5CLTA 3DMMB 3ZIYA 3BGFC 4X9GA 3HE7B 1X9QA 3VG0L 3U0PA 2ICEA 4M6NH 2RTTA 3IFNL 4PD4J 4ERSL 4V1DA 4YFLI 3AY2A 1Q9OA 2IFGA 5FB8B 2BO0A 1Z9PA 3HI1B 1Y0LB 1T89C 2B5IC 2JI1A 2NTFB 1JCVA 4PBWD 1CQKA 3MJ8A 2J6EH 1Q9LA 1DQIA 3IFOA 3NP4A 4G7SB 3ZGHA 1Z2KA 1PEWA 2AK4D 3O8XA 5I15H 3UTTA 4MNHB 4N0CC 5IOPA 1ZKAA 3ARBA 4FYSA 4HF5H 5I19L 3PWLA 4M5YH 1CGXA 2AJ3B 1CR9H 1U8CA 4HKJB 4GP4B 1F11A 2CM6A 3B2XA 1M71A 1NDMB 3WKQA 2CBOA 4AZ8A 4HAKA 3T1FA 3LZFL 3ZK0A 4MZ2A 5FLUA 3NCFB 5DZOA 2OSWA 4OIIL 4YR6A 5HYEA 3CTTA 2DY2A 3L4VA 1FL6A 2ZE0A 3FT4A 2ICWI 2G60L 2MH4A 3O81A 4L4VD 2X05A 5IV2B 3FDWA 4DKAA 4OU3A 4FFYH 4JG1L 4JGMA 5D7LA 5E2WH 5FUOH 5CGBA 4ZZFA 4DN3H 3PGFH 1OVZA 1J1OH 4P48A 4MJJA 3EO9L 1WC7A 4PFEA 4L4VB 2WHVA 3OMAB 2GJJA 3B6SB 2F2HA 3JQOB 5J1TC 4GQ9L 1R5VA 4LQFL 3QR1A 2YC1A 4K3DH 1O6VA 3V0HA 4YSAA 1A7OL 1MHEA 2OMVA 2X7LB 3P30L 4GAGL 3O9WC 1L0PA 2JKSA 4QHUA 1PJ9A 3SBRA 4GRLC 4PVMA 4AE0A 1BYNA 2I32A 3DBXA 4WRLA 4X6EB 4QRPA 3ILDA 3OKMA 3DPBA 2O61B 4WHTB 3FXIC 3VXUD 1UM5H 3BSGA 1DE4B 2H32B 3LZOA 1BMWA 1PEZA 3G5YA 1TVHB 5L4IA 1XL4A 2HVBA 5C0AA 1G7MA 3H3BC 5J12C 3LB6D 1EHLL 4HBQA 4CSZA 1TG8A 5A3ID 1JPGA 1JMXA 5IF0B 1KBWA 1S7QA 4UTBH 2SEBB 3VXPB 1IC7H 1FFOA 2IDCA 2DJSA 4BXVA 2BSCA 5JOFB 1QFWH 2OA9A 2WM0A 1U58B 2IJ0C 2C4XA 2R2BB 3GKZA 3L48A 4H5SB 4F2FA 2NY5C 5IMOB 2CSPA 5DSCA 3ZE2F 3QEQE 3RFZC 1LDSA 2ZUWA 2WXMA 2OZ4L 3HMXL 1MFUA 1QTYT 3NEOA 1ZTMA 3TPKA 1OQXA 2EDMA 2PWGA 2WCPA 4DQOL 2B14A 5GSVB 3VI3F 3SD5A 4XMPL 4NUMA 4LLDA 5AFAA 1DUYB 1TQCB 5EHFA 4B7IA 3T71A 4LCWA 2MNWA 1W80A 4L9LA 4FG0A 1QD0A 5HI5C 1NLDH 4QIRA 2A83A 2FUTA 2FO4A 2QTEA 5E24E 2E7LA 1JNLH 4KJQC 3U0TB 4XB3A 1HTYA 4BK5A 4Y19D 4PJGF 3APFA 4S0SD 3MLZH 2GI0A 5CJ5A 1ZLSL 1Q0YL 1HEHC 4XE0A 3L5JA 4HFUL 2VUKA 2RQ8A 3NPSB 3PV6B 1V7NL 4HKXB 4S1RL 2AQ3A 2FSEA 5F7EH 3G08A 2V9RA 3NCBB 2AK1H 3TBTA 2AV1A 3QCVL 4LK4A 3H9HB 4HXBL 4NKIH 3CVHA 3MMEB 4HS8L 4GBXC 4JRLA 3P0VL 1MFBL 1KN2H 3VXSE 2GK0A 1F3JA 3DI3B 1T03H 1B88A 4FQCH 4J3OF 5A2FA 3U83A 1KB9J 5DEJA 4IJTA 3FQUB 4LFHD 1S7XB 1NGZA 2I60L 2CJUL 1JHLH 4ZDHA 5E70A 2VLRE 1A25A 4ZMZA 5C0IA 4LAJH 1S6NA 1S8DB 4XPTH 1ECYA 1NINA 1QUPA 3QR0A 5L4FA 2MNUA 3KXFE 3KD4A 5IVNA 3RL2B 5IB1A 5M94B 1LEGA 2CXKA 1AGBA 3FO9A 4CU6A 1TQVA 1V10A 3FTWA 2MMXA 3EHBD 3PWUB 3LVEA 2MQ0A 3AB0B 3D3VD 4I3SL 3VYPA 4BFBD 4XPAL 3PNRB 3B2DC 1GTNA 2V9UA 3T0VA 4W6WB 2IFFL 1AO7D 3WIIL 3G6DH 35C8H