1NPJA

Crystal structure of h145a mutant of nitrite reductase from alcaligenes faecalis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWAVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Reconstitution of the type-1 active site of the H145G/A variants of nitrite reductase by ligand insertion
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
total genus 89
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1npjA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1npjA02
4WTQA 2VMJA 4AX3A 3QJTB 2PPCA 1WA1X 1AG6A 2BW5A 3CVBA 2IDSA 3FYEB 4DP0X 4GYBA 2B08A 2XX1A 3CZUB 3FSZA 1OV8A 3CDZB 3AG4B 3AW5A 3T9WA 4YSEA 2GBAA 4GP5B 2GC7C 4YL4A 4KOCA 3OQRA 3T6WA 3NP3A 2FT6A 2XWZA 3KW7A 1NIEA 2WSDA 2GIMA 3JT2A 2I7SA 1OE1A 3IBOA 1MG3C 3X1EA 1HAWA 4YVNA 2YAQA 4A2HA 2BP8A 3PAUA 2Y69B 1GS7A 1JVLA 2XXFA 1PLAA 3NSDA 4G72B 1VLXA 2IAAC 3QJQB 2AZUA 2GSMB 4G70B 2J56A 5F7AA 4BDVB 4AKOA 5I6MA 4AKPA 2A3TA 4Q89A 2XU9A 3QJUB 5PAZA 3NJNA 2CAKA 1KBVA 1L9RA 1XMEB 9PCYA 4HCGA 2J55A 3AZUA 1QLEB 3ZX1A 1AZRA 3AG3B 1JZGA 3CVDA 1NINA 1SNRA 3UACA 2VW4A 2FQEA 3DKHA 3GYRA 5A7EA 1ASPA 1AQ8A 1BXAA 4NERA 5B1KA 3TU6A 2PPFA 3TASA 2W8CA 2PPAA 4W9ZA 2AFNA 3ASNB 5B1AB 1E5YA 4KO7A 2HXAA 1GS8A 2BZCA 2VW7A 3EH3B 2P80D 1RCYA 5AKRA 2IWFA 1WA0X 2DYSB 2PCFA 3ABLB 3T6XA 1JZHA 1WS8A 1OE2A 1X9RA 4DPCX 1WAEA 2YAPA 5F7BA 2VSKB 1BQKA 5TK2A 3WI9A 1A3ZA 3X1NA 1SJMA 2XVBA 3D12B 4E9XA 2BZ7A 1EHKB 3S3CB 3SBQA 3NT0A 3FQ2A 3FU7A 1PF3A 2VN3A 1ASQA 1XB8A 2WO2B 1EZLA 4EF3A 4TXVB 3FSAA 3S8GB 2TSBA 2PLTA 5I6LA 3X1BA 3IN0A 1JZJA 3S3DB 1OF0A 4YSOA 1ZV2A 1IBYA 2QDWA 3UABA 1A4AA 1B3IA 2DY2A 2H47C 5B7MA 2UXVA 3RYMA 2AZAA 2EIMB 4YSUA 2EINB 1BXUA 4N4YB 1WS7A 2GB2A 1BYPA 1KGYE 1DZ0A 1ETJA 2EIKB 1JXDA 3UGEA 2UXFA 3OD3A 3UADA 1PAZA 5I6OA 2XX0A 4KO5A 4A2GA 3IEAA 4E9YA 1DYZA 1ET7A 3QJVB 3NP4A 1GY2A 3FSVA 2CUAA 4DP8X 2CCWA 3CDZA 4DPBX 2HX8A 2XV0A 5I28A 1TKWA 3ZDWA 4UAHA 1ZDQA 1OCOB 4AKQA 3NJJA 1BQRA 1PZBA 3WKQA 1L9PA 8PAZA 2B3IA 4YSTA 4Q8BA 2VW6A 2IWEA 4YSRA 2RACA 4GXFA 4PCYA 5I5JA 4BDVA 2XLLA 4HALA 1FA4A 3QPKA 1AS6A 2FQGA 2DWTA 3DTUB 4HCIA 2HZHA 2PP7A 3L45A 1NTDA 2HX7A 1N68A 1CURA 2PP8A 2Q5BA 2Y1AA 4WKXA 4HCFA 3H56A 1YLBB 4A67A 2PPEA 1ASOA 4FAAB 3WG7B 4BWUA 2R7EB 4JHVA 2YAOA 3WNIA 4JHUA 1V55B 4HHWA 4E9RA 5B7EA 2IDQA 4KNSA 1E67A 1J9QA 1MZZA 4G7SB 2VM3A 1KDJA 1JXFA 3PCYA 1PLBA 3NJKA 1JZIA 1SHWA 1RZQA 3CG8A 1PNCA 2EILB 3FS9A 5EHFA 1NIBA 2IH9A 5I6NA 5B7FA 2IDTA 3HEIB 2ZWNA 2YAHA 2IDFA 7PAZA 5TK4A 1KCWA 5B1BB 2UXGA 3ZIYA 2H5UA 4NAJA 2NRDA 2BW4A 2YXWA 1AS7A 3MX0B 2Q9OA 1ET8A 2OCCB 1J9RA 4JKNA 2BHFA 1GSKA 1M9WA 2QDVA 4DP2X 6PAZA 3FQYA 1MDAA 2FNWA 2J57A 3NYKA 2OJ1A 4G7RB 1SDDB 3PXLA 3FYIB 4A68A 4KO6A 3IE9A 2UX7A 1AIZA 2XV3A 4ZK8A 1NWPA 1PZAA 1AG0A 5B1JA 3X1GA 4DP7X 4F2FA 1M57B 3NSYA 5I6PA 5FC9A 3N2JA 2LLNA 2W88A 2PCYA 5D4IA 3QQXA 2HX9A 3BQVA 3NSCA 1PLCA 7PCYA 2ZOOA 1GY1A 3AG1B 1AZBA 4UF7C 4AZUA 2PPDA 1SFDA 2IDUA 5IY5B 1UATA 4YSSA 1A4CA 1AZNA 1GW0A 1L9TA 1N70A 3FPXA 3GXUB 4NB7A 1GYCA 3TBBA 4P5RA 1A65A 2BWIA 1L9QA 2FT7A 2GHZA 1W6WA 2BP0B 3KW8A 4HIPA 4P5SA 1W8EA 2PP9A 3FSWA 2H3XC 1RKRA 1ZIBA 3TBCA 1PZCA 4KOBA 3V9CA 2E86A 1NPNA 3EHBB 3NJLA 2TSAA 3WNJA 4A2FA 2AANA 3PLYA 1E30A 4YSQA 4E9WA 1TEGA 3PAVA 3EF4A 1ILSA 1F56A 2WO3B 1QNIA 2OV0A 2IH8A 1KCBA 2UX6A 3WKPA 4BXVA 1AOZA 1IC0A 3WIAA 3FU9A 2AVFA 3AG2B 2JXMA 1AR1B 2FQDA 2DV6A 4K9JA 3SQRA 5I5IA 1X9UA 4M3HA 2XXGA 1URIA 3H4FA 4DP1X 1ZPUA 1E65A 3S8FB 3PAZA 1IUZA 4AI7A 4DP6X 1AZCA 1E5ZA 3FPYA 3FQ1A 4YVUA 2R7EA 4RH4A 1GS6X 1XB3A 2XUWA 4GY4A 1FWXA 2FTAA 4UANA 5I26A 1J5CA 5E9NA 4DP4X 3V9EA 3JTBA 1V54B 2CBPA 1CC3A 1NIDA 3OMIB 1OCCB 1JERA 1NIAA 4BXSV 2GC4C 2VM4A 2FQFA 3IN2A 4BK5C 2HRHA 3ABKB 3NJHA 5I6KA 1JXGA 1PMYA 1RZPA 2DYRB 3X1FA 3G5WA 4CSPA 1J9SA 1BQ5A 2P80A 1SF3A 2YAEA 3DIVA 2HRGA 4G7QB 3S3BB 3FU8A 4BWWA 1OCRB 3QJSB 3MBWB 1A4BA 4KNTA 4BWTA 1NDTA 2QPDB 1AS8A 2DWSA 4DP5X 1SF5A 2YARA 2J5WA 4MFHA 1MZYA 1OCZB 4GP8B 1W6LA 2YQBA 2BP8B 5ANHA 2FT8A 2N0MA 4DPAX 4M4RB 1KYAA 4QLWA 4HZ1A 1CUOA 4X4KA 3CVCA 3EH4B 1J9TA 1TEFA 3NJIA 4YSPA 4PAZA 1CYWA 1SDDA 4G71B 1IBZA 2X88A 4W1TA 1TU2A 5PCYA 2UXTA 3T71A 1BXVA 2FWLB 3ZBMA 4A2EA 1XB6A 3T6VA 1NICA 3T6ZA 1KV7A 2XV2A 1WA2X 6PCYA 5AZUA 1ILUA 1GR7A 4E9VA 3NSFA 1NIFA 3N55A 5AFAA 1AZUA 1SFHA 1OOWA 2HLEB 1PCSA 3BVDB 3SBPA 2CALA 1PNDA 3TA4D 2CJ3A 1KBWA 4E9SA 1AANA 4HAKA 3QJRB 1NPJA 1IKOP 3NJGA 1CYXA 2EIJB 1BAWA 5LDUA 2BP0A 1PY0A 1HFUA 4FA7B 2X87A 2JFCA 4N8UA 1FFTB 1KDIA 3EH5B 4L0PB 1JZFA 3ABMB 3FT0A 5I5MA 4YSDA 2MRYA 3H4HA 3OMNB 2BO0A 5B3SB 2I85A 4GP4B 2XYBA 3UAAA 5D4JA 1R1CA 1AACA 2VSMB 1A8ZA 1MG2C 2QPEB 5D4HA 4HHGA 2GI0A 1ADWA 1BYOA 2MTAA 2JKWA 4F2EA 1JOIA 3NJMA 4DP9X 4ENZA 2YAMA 4KNUA 1M56B 3SBRA 3U25A 1J5DA 1ZDSA 1V10A 3ERXA 4QKTA 3FU7B 4F7KA 3UAEA 1BEXA 1OE3A 2BWDA 1I53A 1ID2A 1ET5A 1L9SA 4E9TA 4YSAA 1JZEA 3C75A 1AAJA 3GDCA 4E9QA 3ABGA 3OM3B 3AY2A 1NWOA 3NJFA 1ZIAA 1HAUA 1JVOA 4KO9A 1L9OA 2I7OA 1NZRA 3HB3B 3PPSA 4YSCA 2QT6A 2YAFA 4CSZA 2ZONA 2FJSA 4A2DA 2ZXWB 5B1JC 4A66A 2IWKA 3OMAB 3ASOB 1SHXA 3X2QB 1QHQA 1T5KA 2YXVA
chains in the Genus database with same CATH superfamily
5CZRA 3TA3D 3POHA 1DBJH 2R15A 4WTZA 3T0ED 5ITFA 3B5HA 3H0TB 2CHZA 4P23D 3BPOC 2BHYA 3QDMB 4IOFC 3CSPA 4JRXD 4MA8H 3AG4B 4AV5A 3ECWA 3G5YA 3PQYB 2WOYA 2EC8A 1FYHB 1MLBB 2BM3A 2BIQA 2XXMB 3IU4H 3VFNA 3BAJA 4XVSH 4Y2LA 4UOZA 2LU4A 5BUGA 5J6GB 3N85L 4I2XA 3U6RB 2W9DL 4IM8A 4U1SB 2Y69B 1WC7B 1NBZA 2H1LM 3EOTH 2C1PA 4V11A 2WUBH 3T8XB 12E8H 1GGCH 4Z23A 3UPRB 2G3XA 4OM1H 2XBDA 3V95A 1LP9B 3DVGA 2GSGB 3AROA 4NZJA 4IMKA 4UTBA 1QFWI 2DLHA 5I6MA 4XNZC 3HHSB 2CHXA 2K1MA 2ARJQ 3LPPA 2OFQA 4CVXB 1AGFA 5J3HC 1TO4A 2VDOL 1IAII 1NAKL 4XC1L 4Z7UF 9PCYA 4NFDA 3SO3B 2BSTB 1BQLL 1FVCB 2AJYL 2WKOF 4IBLT 4RESB 4QHKI 4FQCH 2E7MA 3KYAA 1KLUB 3MOBL 3X11A 2NY0C 3D0AA 1M1XA 4JPVH 5GS2H 1U8NB 3DSFH 3SKNA 4D8PB 2V5MA 3HG2A 4BHUA 2JLLA 2FQEA 5HVWA 3O3UN 5GGTA 5TDOA 4DKEH 3UZQA 1T0NA 1RK0A 4BFIB 1NBQA 5SWSB 4YE4L 5KN5B 5JDSB 1S7QA 3DV4A 3O8XD 3S8WA 2BSBA 4ZUWA 4XB3A 3FTUA 4F37K 4NNXB 1YECH 4KRPB 4XCEA 1EO8H 4UT7H 4DGVL 1OEZW 3VGGA 4LESA 4HA1A 3O3AB 3OKDB 3EH3B 2HB0A 2P80D 1LILA 1INEL 1RCYA 3QIBA 4ODSH 5IHWA 5I9QB 4YQXL 4LPUA 3TNMA 3X3GL 3MA7A 1JZHA 3LS5L 1IGJB 5D70H 2QPFA 4QXWA 4HS3A 4AYFB 2JK5A 3EYQC 5TK2A 3WI9A 3UTOA 3GDBA 1CT8A 3W0WD 1YC7A 1AIFB 4MCYB 5CGMA 3SBQA 1TJIL 5CP3A 1MW2A 3RG1C 5B38A 3PJLA 4M7LL 2IQ9H 2WVVA 3FQRB 5KOMC 4WHDA 1WUNT 4GUQA 4BZ2L 3L1GA 5I6LA 1JIBA 3FF7A 3S3DB 3MUHL 2CXKA 2QDWA 4QRPB 4LVHC 4LLDB 1XTMA 4O4YL 3UABA 4PRHB 5LBSH 4B97A 1BPLB 1RL1A 1CLYL 2CCLA 2O5YL 1QABA 1TZHA 2BK8A 4FLRA 5BO1H 4XH2B 1IBGL 3FT4A 1T5XA 1YNLL 4ZMQA 3V79C 3OPUA 4EKXA 4FNRA 1H0DB 4ORZC 1ZLVH 2P5EB 2R1YA 3L5WA 3DJTA 4G42B 4QHMB 5J4MA 3HZMB 2IPKB 4UOQA 1ROCA 4XWGL 3VG0L 2R2BB 3NCJL 2LAAA 4PGDA 4LHUA 3DGCR 2JB5L 2CR0A 2B16A 2DQHH 3KYOB 4JJOA 3BDYH 3VFPA 4FQLH 4GIPD 1Z5LB 2FH6A 3MLTB 1XGPB 4QY8B 1F3DH 4YR6B 5JLZB 3WGVB 3Q43A 5LDSA 1BF2A 3KVPA 4PWKA 1IL1B 5EOQL 4M6OL 4PG9B 2YN3A 2P47B 1HHJA 3N42F 3MLSL 5ID1B 5KSBF 3VNYA 5LQBH 1FQ9C 3FMGH 4DO4A 4I3GA 4UMSA 1FFRA 1T66D 1FIGL 3O6LH 3SYOA 2FD6L 2DWDA 1BZ9B 3KH4A 2OYPA 5I2IB 3O2DL 4XMTA 3A4DA 2W92A 3EOBA 3V4VB 3PUUA 5IGXH 3H56A 1KTBA 1M7IB 3QUYC 1KTRL 4IGBD 2BNUB 4IRSB 5ACZA 4DGUA 5ADPL 4G7YL 2PPEA 3G6DL 1R5VA 1PEZA 2QQLL 1NOAA 4JKMA 1T1ZB 3TJEL 2WB1A 2NR6D 1YYML 2AITA 3L7EB 4AGQA 2CHNA 1U8LA 4YUEH 1G9ML 3D39E 1NCWL 2ITFA 4IKLA 5KSAD 2ZUWA 3QIUD 5DYOB 3KYKL 1TZOA 3VAEA 4NQVB 2JKLA 1WITA 3RFZC 4PI0A 2FLRT 4XMLH 4UTBH 3ULUH 4QXGH 1GTFA 4WI6A 1BQUA 2D3VA 2J4WH 2BXZA 4W9HC 3BAEL 4PJFE 3V5HA 3CG8A 2QGEA 3BZEA 1G43A 2YAHA 1S7VA 5F97E 3CU7A 1F0LA 4IRJA 3SPIA 3TBWB 7PAZA 3EGXB 2F54B 5J6SA 5EUOA 2H2PC 4OR1A 5FYKU 4IU3A 5LCVA 3GNML 3VXMB 3B9KC 3AGVA 5D96B 1R3IL 3C6LA 1K2DA 1T0PB 4I7ZC 3UPAA 3LEVL 5MEQB 2UWEB 4JAMB 5GGTH 3UTSB 1GSKA 3VXSB 3MLXL 1XGUA 1JGLL 2VDOB 1UD6A 3AXLB 4IDJL 3KHQA 3Q9QA 3BPNB 5IOPB 1HEZB 2AJZB 1W72L 1YNTF 3FYIB 3LZLA 1E8WA 4IW4C 4MCZB 5LWYH 3TCLB 3ZE0E 5IIEA 1RJLA 2J6EL 3E6FA 1IGTA 3AU1A 4AJ0A 4EPSA 3D39D 1X5IA 1A7RL 2Y4SA 3P3UA 4OI7A 1P5VB 1RZGA 4IJ3B 1JK8B 2BOBB 2IFFL 1BWWA 3QQ4A 3N5AA 2VDKH 4YK4C 3IDUA 4N3TA 4NQEB 2B9BA 3UP1A 1XF4A 1EDYA 25C8H 3CU1A 3BFWA 4ODWA 5EZJA 3DX4A 2V33A 4GO6B 1K8IB 3CHXA 5CP3H 4HV8B 1FL3A 3EYFA 4P5RA 5CD3A 5HHVL 3QZWG 2ZCLL 5JHDE 4JDVB 4WI0B 4X80H 2EE9A 4JJ5A 2BVYA 4WAFA 4G59C 3BWUF 1WWAX 3W81A 5CJQL 4A7GF 1SDAB 3GBEA 5EOTB 1HT6A 1TIUA 1U8OB 4JANB 3KDMA 3OTTA 5GS0L 1GXEA 3BVWA 3FO0H 4R3SA 1I7UA 2DLFL 3VE0B 4ENED 1KIRA 3FTZA 1BG1A 5TDPB 5KS9E 1I31A 5EIIG 1ZKAA 1CFSA 5DMGC 2Y06H 1O75A 2XWBA 1CZ8H 3V2AR 2I9TB 1F4YL 5AWNL 5BVPH 4GW4B 3IMVA 4JO1L 4QD2E 1MCHA 4APXB 5J11B 2RFXA 4YPGB 3GSNL 2XA8H 1QA9B 2NQCA 3AG2B 3FU9A 3GEWB 5I1GH 2WCPA 3NSXA 3SDDB 3CSTA 1JD9A 3LKPA 5FUOH 3JV0A 1BZEA 3RJQB 3IDNB 1H3XA 5JORA 3BYTA 4OZHA 5KVGH 1DDHA 1TQUA 1SEQH 2XXGA 1TJMA 5EDSA 2C3XA 4WVRA 3Q8AA 1RULL 4KZCA 4KH9A 2ICWI 2PYEE 4NUJB 3FQ1A 4YDIL 5D2NB 5D7IF 1U93A 2B3RA 2R7EA 3MLYH 3OZ9H 5ETUB 3ZIMA 1DVSA 4R7NB 4HOWA 2XN9A 3GXFA 3A3YB 3K2UH 1KB5L 1AC0A 5AYQA 5JHDD 3E1F1 1MH5B 2P1YA 5JXED 1JZ7A 4N0YH 1AKJD 4FFVC 4PJBB 2OSXA 2P3YA 3GPSA 2J8HA 4PJ8D 2EYRB 5IJCC 2FJGA 4LSRL 4PWGA 5I1JL 3D08A 3ARFC 3DVNA 3MGOA 3DO7B 4M9PA 1EGJA 3MODH 1L6PA 1ZJAA 3SPCA 1AY1L 2Z1KA 3A0OA 1BF8A 3E7JA 3A24A 1IIIA 4F7EB 1QLRB 5IK3A 4PRBA 1PIGA 1MRFL 3HVDA 2J5WA 3V5DA 1Z3GH 2ESVA 1JGVH 2FJHB 1X6LA 1FI8C 3L4WA 4M61B 5EU6A 5C0JB 1JPTH 5CZKA 4RNRB 3HS0B 1D7DA 1QW9A 3BT2H 4NJ9L 5ITBH 4LPTA 4ERSH 2CDEA 4XP6L 4LSTH 2PYED 2XTLA 3C8DA 3L1OL 1CJYA 2PTVA 2V6HA 1T03L 1RLBA 5I1DA 1S9KC 1U41A 3BIKA 1G84A 1D6VH 3GXTA 3GMMB 1DBBH 4R7LA 1F3DJ 5A2LH 3EBHA 2E9WA 1K8DA 1LD9B 5AD0A 3ARVA 1WA2X 1Z9SB 1Y0LA 4WV1A 5EEUA 4ODTH 4QKXB 4L8CA 1I1RA 1KLFB 2Z7ZA 5D7SH 4CBPA 3HA0A 4ALAH 2HLEB 5LCVH 1UA3A 4TPRH 5IMMA 2G5BB 1CWVA 4UWQB 5E7BA 2HH0H 3ALWA 2QLVB 4AQ1B 4XXWA 4DPRA 5KW9L 1GZQA 2JCCA 4OF0A 1JPEA 1P7QA 3NGBC 5LGHH 1NL0H 5IEKA 3CIQA 5F7DB 4DGYL 2EDMA 3WNPA 2X3AA 4UT6A 5A2CA 3BWAB 4QXUH 1RZFL 4HC1L 3US9A 3VWJC 5IBLD 5B3SB 4GP4B 2WZ0A 4TVSa 5IVXA 3U36A 3T0EA 1ADQH 2OP4L 1ZHLA 2K9UA 5GSVA 1AQHA 3JV4A 2Y24A 2ZYSA 1MG2C 3LEXB 3KGRA 3LPGA 15C8H 4HJGB 1BJ1H 3LEYL 5E8EA 1DLFH 1X5XA 2ZX5A 2FIRT 4NZTL 1W72B 4XX5A 1RZ8A 4JZOA 4LLYB 4X4MA 1R3KA 4JFFD 3DYMA 4WWKB 3F7YA 5C6TL 4OTXH 1RUMH 5TTRA 4JG1L 1UM6H 4ZSOA 3KL5A 4MTMA 5IM7B 3FU0A 3SBWA 4AK1A 2AV1B 1ID2A 5CLZA 1C08B 1YN7B 3M7FB 1KACB 1ZTMA 3GDCA 3SZ6A 1AQMA 4QNPE 2R0WH 1CDHA 1I8KA 2HFFA 5DD1H 5KSUA 1AYOA 2EH8L 2KI6A 2WVUA 2ZXWB 1MJJB 3MNDA 5DD6B 5I0VA 3ZMEA 2XTJC 4KWUA 1T80A 1MQKH 2CO6B 3I9PA 4FXTA 1N19A 3A22A 5T1LB 3IMRA 3VI4E 1S3KL 5A3ID 2W65B 2YXMA 4K3HA 1ACYH 1LK2B 1W2KT 4XVTL 3L3OB 3HW7A 2FHFA 3I6GB 3HI5L 1G9HA 5KVDL 2B08A 5AVVB 3WHE0 4NHUA 5DTFB 2AK4E 2X89D 1H3VA 4PYHA 2VLRD 1T6BX 4P3DB 2GC7C 4KOCA 4H20L 1OZUA 3V4LA 4C59B 3KW7A 3MAWA 3O8XA 1PBYA 3GBNL 3HZKB 2OPCA 1VCAA 1VERA 1NEUA 1DJWA 3AWFA 1HEHC 4JFXA 4LDOB 1TLMA 3QEQB 1YPZE 3GSNB 1L3WA 4A2HA 3HR5B 1WF5A 1F2XK 4PWFA 1NC4D 2WLYA 2PCPB 3WN5A 2MHAB 4DKFH 2ZIDA 4RFOL 3VM5A 4ELKA 3GD1C 5D7EA 3QNYA 1BOGA 1YO4A 3WMSA 1J8HB 1FFQA 4H0HB 2VL4A 1X7TA 4GLRH 1NFDF 3Q6GH 4JREB 3L9YA 5IV2A 1XMEB 3RUGE 1EGJH 4J3UA 1WAAE 2YKLH 4U2YA 5FYJL 3WDJA 2I26N 3BP6A 3S2AA 1E43A 1O6SB 2HTKD 5GRJH 4ETQA 4J4PD 3C8KB 1M7UA 3GGWA 1MCFA 2LLGA 4MNHA 5E5UB 3SPGA 3OF6A 3U30B 1EV2E 3FCTB 3G5XA 5B1KA 2A74C 4OJAA 5BQ7B 2PPFA 3ARDD 4H25B 5FS5A 4JPSA 5EU3B 4CMHB 4GIAA 4NM4H 3NIGB 3GMNA 1OTSD 4MS8C 2CK0H 1IO4C 4JM0A 1WPCA 2JKJA 4LEXL 1I1YB 5F0MB 1ONQA 3AITA 4LF3A 4HPYH 3SDXF 1J1PL 2VR9A 2OSLB 2PCFA 4MJ6A 1UKTA 3Q2VA 5C0RL 4NSKB 2K3HA 4GUOA 4FD0A 2XG4B 2XVBA 1QYGH 4OV5B 2F6AA 4F33B 2X4PA 1DO5A 3ETBJ 3NT0A 2VRKA 2LFEA 4OKDA 3KGTA 2Q8BH 3BUTA 1NMAL 3P4MA 3MLVH 1AFVH 3ROLB 3BN9C 1IBDA 3PNRB 2PLTA 3VQ2C 1QFWM 3Q1EA 4K15A 2YD3A 4Y2NA 3RTQA 3SKOB 5IW1B 3VXQB 5IFHH 5FF6A 1QSVA 4NRYA 5JHLL 1RURL 2BNQE 1IARB 4EI5C 1JRHI 3TT1H 3IYLW 2YQ3A 1RI8A 4UT6H 4JM4H 5C0AE 5LXVA 3GSQB 4D3CL 2LHAA 5F6IC 2R0KH 4PBXA 1FZJB 2EICA 3RKPA 2X1PA 4P4RA 3HJ0A 4JO3L 4EN3B 2C3VA 2GB2A 3K8KA 4PVMA 1CG9A 3MJ8A 5DQJA 3O9WC 3SY0B 3ELQA 2X1QA 4X8JB 1NCAL 5MP6H 4G6AC 5KVFE 2NYKA 5LGKA 4IGBA 2KLTA 2A6KB 2F53D 2X12A 3WS6C 3QI9D 4FFZH 1JDAA 1FIEA 3LQAH 4I1RA 3QIWC 4Y1AB 3NFPA 1GHFH 2E9GA 3CDZA 1ZMYA 4XN2A 2XV0A 4RLDA 5FA3B 2LVCA 1S7RB 2NUPA 5FYKH 5JUEL 1NMCB 4I5BA 5TQ2L 3QIUA 5JZ7C 4FZEH 1M05A 4PWHA 3LH9A 4NO3B 4QCIA 4NN6B 4RA3A 1MNUH 1BZ8A 3CFKB 3X13A 4PYGA 3CK0L 3PL6D 1Q72L 4Y0GA 5E4OA 4YSRA 2EXYC 3TO4B 2Z7YA 4YDNA 4Z7OF 4Y16C 3RVTC 4K7PL 4YPJA 1KLGA 1R9FA 4PCYA 4PJDF 2HMIC 3BZFA 2B1AL 1NMBL 1LK3L 4JDEA 4EVNA 1SYVA 2N7BA 3U6XA 3QO0B 2C9VA 2WP3T 3GXPA 1J5HA 5I1LA 4R0LA 2E27H 1DVFD 1I75A 4CMMA 2R56L 2QZ5A 4PJ7B 3BZDA 3NH7H 4J6IA 4YHLL 3QG7L 4HCFA 5IQ7H 4BV1A 5DJYA 5E99L 4Z0BH 5CM1A 4DZ8B 5ID0B 3ZPDA 2PYFA 4GKSB 2PXYD 1S7UA 2YAOA 4N8VG 4N1CA 3KCPB 5FHBL 2P7TA 1W0WA 3HN3A 4L3AA 5IMOB 3IDMB 3O11B 5FFGA 3ECBA 3TBVB 1HWHB 1LNUA 5CEXB 1CFNA 4XHJC 3D39A 4C4KO 4A2MA 1GOFA 2BSED 5TF0A 2YPVL 4F7CA 2Z93B 2V5RA 2MCMA 1TQWA 2EDOA 3CFCL 2D7TL 4N5ED 3S9DB 3HRZC 1EANA 3MNMA 2E0PA 4PJFA 4PS7A 2C7FA 4LCVA 1KTCA 3TEXA 2GY7B 4LVOB 2YEZB 4B9CA 3QJHA 4TN9A 1G7IA 1N0LA 2NDFA 5T1DH 2EACA 3JWNE 4RMRA 4UV4H 1NAML 2J88L 1QMUA 1HQRB 4CU7A 4I18C 4X99B 5C7XL 4P9HL 2X70A 3QCUL 2OZ4L 3UIZA 3ZIYA 2NRDA 2R2EB 3M46A 1UFUA 2NT1A 3FOLA 4DGIH 3QR1A 4BQ6A 2ICEA 2WQVA 5HY9B 1UHVA 4CC4A 3ILDA 1YCSA 2DN7A 3QQ3B 3BXNB 5SV3A 2NSMA 1KIUB 2WXRA 3O3BB 3VJ6B 2B1OA 4A68A 1JGEA 5EWIL 5DDHA 2HT3D 4PRIB 3APDA 1UWYA 3ZE2B 5E08L 3PWNB 4U7MA 3E6HB 3EO0A 4I3SH 1C12A 4URKA 1MJ8H 5FDWB 3BUDA 3HKZA 3HE6A 3Q1SL 5AB9A 2A77H 2IG2H 1FYTB 2MJWA 1GY1A 1V05A 2APSA 4Y4KD 4DAGL 1UEMA 1MCNA 1EH9A 3B7TA 3CUPA 3HUJB 4IOIB 4ONFH 1GGYA 4Z78A 3EYUL 1F42A 2IDUA 5C8JB 3D0LB 3AACA 1AD9A 3GHEH 3PJSA 4G6ML 4M1GL 3A67H 5IKCB 2UZIL 1J7VR 3OLGA 3BQUA 1YYLL 1ZLWH 3BMWA 3B2XA 5FO9A 1GPOL 3TBBA 3BH8A 1CCZA 3BHBA 2BWIA 2NY2D 4HIPA 4O2FA 3ZKMC 3TIDB 5JHDA 2D9QB 2JWYA 1RKRA 3PPEA 1AKJA 2AXFB 3SYPA 3IF1A 1KEGH 2XT1B 2H7WA 3KPQB 4PJ8A 4DZBA 3EAKA 5KYUA 4WKZA 5HGDB 5FKPB 2A9AA 4K5LA 5KS9A 3SPVB 1U2YA 4OLXH 2VJ0A 4TOYL 1ZA3B 4H1LG 4M5SA 4HWNA 4Y19B 3FTWA 2GJJA 1BD2E 1WHOA 2IPUG 4UU9A 3N43F 2X4RA 3B56A 5J1SC 5D6CB 4KKLC 2NT0A 4ODHH 5K9KB 1T6WA 3UO1H 3QH3B 3ZDYB 2F8VA 5DJ6B 1CK0H 1FL6B 5FUZL 3GRWL 4ONGH 3FO2B 3UDWC 5GRWA 3V6BR 4HT1L 3STLB 1RSFA 2PYEA 3UBFA 3QXWA 4ZFOL 2X2JA 5I8KL 4LPYA 1OK0A 2C9QA 2ZKHH 3O6FB 2V3DA 5I24A 3VFVB 3MCKB 5DMKB 4HXBH 5I8OL 1GW6A 1V3LA 4M1CC 1QLEL 4HSQA 4QHNB 2JB6A 2HFEB 2FR4B 2CU9A 2GIXA 4AMKH 3U0WH 1HL4A 3WELA 1XDTT 5JPMC 3VQLA 5JPNC 4PW4A 2FQFA 1N5AB 4O02A 4JM2A 5E1AA 1RPKA 1A7BA 1DR9A 3GB7B 2D7QA 1IFHL 4RQQA 5I15H 4RGNB 4FLHA 4KUCD 4TVPE 1FUNA 1SJXA 2DYRB 1M7DB 1ES0A 3DX8B 1RXLA 3LH2H 1Q0XL 1S9WB 5TPWH 3WTSA 3FU8A 3IDXH 1OCRB 1X5LA 5I17A 1FO0L 4GQ9L 2R1WA 1AMYA 1EZSA 3DX7B 1NDTA 3WTUA 4AOFA 2B0SH 4TS6A 5AENA 2YARA 3RWHA 5D5ME 4PJAF 2YS4A 2BP8B 1UB6A 2YZ8A 1E0OB 5E8NB 3VH8A 4OZGE 3WXWL 1SBSL 3C2AL 3IGFA 5EPMB 3L95A 1JVKA 4M9OA 4YSPA 2ZSVB 3N0AA 3SGDI 3V0IA 1S2EA 1U8CB 4ZAKD 3W9DA 5ESQB 1QASA 2XJLA 5DC9B 3DTDA 3OB0H 4PRDB 4HIEA 4YHPA 5DHVB 2YPLD 5IUSA 1R3LA 3HI6L 4ZMYA 1CIUA 1P1VA 1XXDC 3O0RH 1KV7A 2QFPA 4WI2A 4S0HA 4OGQC 3THMH 1ILUA 3UBXA 4A7SA 1DJZA 1U30A 1VGEL 3QDAA 3IJHB 4OD3L 3DTXA 4XPTH 5DJAA 5HGHA 2WZPD 3RJOA 3W11C 5E8DL 1A1NA 5A6MA 2OJEA 3CC5A 1H15A 1U8HA 2BIHA 3OAUH 3EGDB 5DJ2B 3PE9A 4TVPD 3TA4D 2CJ3A 3CX2A 4MBRA 3FT9A 2X42A 1E7VA 4HAKA 3CHPA 1FORH 3Q5YA 4M7LT 4DKAA 1JWUB 3G6JF 5BRZE 3NCYP 1K72A 5F1NB 5EA0L 4UM8B 4JFSA 5MENE 2Y3AA 5DA4A 1NAMB 4TNVK 5E2TL 5FW8A 3D07A 1KBGH 1KN2L 1RUQL 4DF9A 4Y5YA 4TYUA 2ICCA 1MPAH 2QADB 4Z7VF 1H9DA 4IMLB 4HIHB 3PWUB 5D1ZB 5D4JA 4OZFG 2VSMB 1A8ZA 2EO1A 1T20B 2CCVA 3EDJA 4QOKE 5SWZB 2A7BA 3VI3B 2QV2A 2ZYIA 1M6OA 3K81A 4HDIB 2WQ8A 3SO5A 2EDEA 1BLNB 4XBGB 5CZXC 1BEXA 3NDYE 4P8QA 4QJ4B 2OK0H 1F58H 2VL5B 4AGPA 4E9TA 4X9HA 1SN5A 4IBTA 1AQKL 2AJXH 3T3PF 1CD1B 1XF2A 4ES8A 2VSDA 3RL2A 4NOBA 1RUAL 1OP3K 1U3HB 2RCSL 1XCQA 2NNCA 2YPKB 4TULL 3AY4A 4B0MM 5CSGA 2DD8H 3PWJB 1YJDL 3AREC 5IHZB 1EAQA 5F8QC 2AXHA 4YX2L 1FVDB 5K33A 1IEAB 1P4UA 2V5YA 3N9GH 2Y6TE 4FQXD 4LOVA 4YIQA 3WNOA 4M5YL 3D4ZA 4FLOA 4GSDL 5LAXB 2FBJL 4GFXA 4IJTA 4HUXA 2ATPB 5D4IA 3VI4A 2XICA 3RVVC 3OGCA 4IOFD 4MAZA 1U8KB 3OB8A 2AW2A 2QR0B 1HZKA 3HS8A 4OJFH 3K91A 3FYEB 3QDJB 1A1OB 5H37A 1V7NH 1RIHL 3O4LB 1L6XA 2UY6A 2CO1A 5JIDA 3CZUB 2AK4A 3FSZA 1CBJA 2Y36H 3OKNB 4HF5L 4O2EB 3S36X 2GBAA 1LE9A 4MAYC 5CEYA 2W38A 1I3GL 3ARDA 3KPRE 3MBWA 3GHPA 3H7LA 4XPHL 5TE6H 2O6CA 2XWEA 3F3HA 3H9HB 5E8PA 5IQ9B 4ZO6A 3R4RA 2OTWA 1YPZA 1T89A 2O6DA 3G5VA 4UYQA 3S5ZA 2D2OA 2ZX8A 3QORB 2GCYA 2QGBA 1PKQE 4ZO8A 5C0DB 5D4QA 4G72B 3MOAL 5CSZA 1UACH 2EP6A 4HUWB 4A7TA 2ZNWA 4MVBD 1RZKH 3BRFA 4BDVB 4R2GC 1JZDC 4O02H 5EG6C 3VMNA 3EO1B 4ORGA 4QYOA 5I1IH 2ZUUA 4DVRL 1BHGA 4ZFOB 1J48A 3FONB 3RUGA 4CAGA 2DIJA 4AYGA 2JELH 1WAAA 2IXQB 1KTJA 3N41F 1QLEB 1W8NA 1CTOA 1QFPA 3MDJA 4R5VA 3QDHA 3TN0C 1HNYA 1TETL 4GG8A 4Y9FA 4TTGA 1AXTL 2ED7A 3REWB 4KROB 4M5ZL 3DKHA 4R26H 1JWSB 4G8GE 1MWAL 2VN5A 3B8YA 3U4BL 3U4KA 2GY5A 3ZQWA 1EAOA 4H4NA 3CCHB 1CF1A 2R0ZL 4OIBA 4AW7A 1JYNA 1YEGL 1FO0B 3GI9L 2IH3B 2VABA 1TTRA 1SVCP 2EVHA 2E9IA 2P8MB 3KXFB 3DRTA 2SEBB 3KPMA 3EYQD 2VW7A 2WZ6A 4NQUA 4LEOB 2XN0A 3MO1A 3HPLB 4HP5A 4ICXA 1O9WA 1UM5H 1WIPA 3BE1H 3T8VA 1OE2A 3ARZA 3IU3B 1LYQA 4HSCX 4XXDA 5E0QA 5FWQA 3SOBL 4JFYA 3LMJH 4HJ0D 3GUFA 1OM3L 1D5MA 4QRFA 5DC4B 3EJYD 4KQ4L 2Y5QA 4OFVA 1BVLB 4CL7A 4ANXA 1MCPL 3HAEA 1X5KA 3FF8A 1ZGLB 4JFED 4OB5L 3R18A 4G3YL 4WJ5B 4YLCA 2HKHH 2DQTH 3RVWD 4OGXL 3A4AA 3BI9X 1PGRB 2OMYB 2WGXA 2BNQA 1OF2A 1ZV2A 5D6DC 1HIMH 3QPXL 1JI2A 4H26B 1UA6L 3I6LE 3MRGB 4G9FE 5C0AA 2YA0A 1JGDA 5CJXA 1HI6B 4B9FA 5JW4Q 3PABB 3WFCH 4XPBH 1IC7H 2OR9L 4EDXA 1ACZA 1DVFA 3MRQB 2IANE 2FJFA 4OCNC 3S37H 3IRCA 4M03A 4O51B 4A2GA 3QP3A 1TVHA 3P2TA 4M7KL 4WFFE 4Y5XA 1DYZA 3VSQA 4ISVB 1CGYA 3N44F 1XH3B 3W37A 2PXYA 3MRIA 3CC1A 5JOEA 4X6DB 1N2RA 1P5UB 2YBRA 1PX3A 5FGBC 3VG9C 3DOSA 3Q3GB 4IBUA 2VR7A 4FL4C 3DGDA 3FB8A 1IGIH 1MCSA 3CVIH 4X5WB 3SCMB 4FC3E 4E42A 4Y4FC 3MNWB 3B2UC 3ZDXB 2AXWA 3MRJB 4L8DA 1SN0A 3F7VB 4BBWA 4F37F 2I27N 4KX8A 1NDGA 2WLKA 2XZZA 3BVTA 3GO1L 5DR5L 1LTXA 2DBLH 5GS1B 2OKMA 2DM4A 4ZFZA 3DUUA 1NGXA 3I6LD 3WSQL 2BSSA 4PGEB 4HALA 5IVOA 3MNZB 2UZYB 3RWGB 2JXMB 2H6OA 3H6JA 1N67A 1QPPA 5E6IA 5H37H 3SQBA 4LRNL 4A7VA 2HZHA 2WLIB 3BWSA 3SDDC 2IAND 3F12B 4HD9A 4DO6A 2FNBA 2Q5BA 4XB8A 1I8IB 1G5GA 2FWSA 5FEBA 1N0XH 2EDLA 1A22B 2R23B 32C2A 3IJEB 5IVZB 3E2HC 4IKNA 3GZPA 5KJRH 5HHPB 2K0RA 1JUFB 1OAYL 5AVRB 3SGEH 1YMMD 4FJ6A 3VD7A 5HHXH 2OMVA 3BIBX 2BVEA 5D2NC 4F57H 4Z5RB 1P4LA 4OM0L 5B7EA 2O5XH 1R3JA 5E2VL 3KR3H 4NRZA 3X3FL 4L29B 1DBKH 4OCXL 4J3OH 2VE6A 5HYQA 5FHAL 5HYSG 5DUBA 3IAGC 2R1XB 3D18A 3L2LA 1BAGA 3BT0A 3G6AA 4LSSL 3BKYH 5F7KC 3ZRFC 1B4TA 4KITB 3TONA 2H2PD 1TUPA 3O41B 1NIBA 6FABL 1WZKA 4ABWA 3OZKA 3CN0A 2OYLA 4AEHL 1F13A 4BCZA 4GRMB 4PY7B 3B9KD 4ODVH 4AV4A 4JFZL 4ONHB 2B1HH 4TLTA 3MSPA 2D0HA 2H5UA 4AQ8A 3QULA 2YXWA 1TFHA 3U7YL 3Q2WA 4POZD 4YXKL 2EDXA 1IT9H 2OCCB 5DFWH 3HTLX 3NIDE 2ZJSL 3QHZH 3WS3A 2ZF9A 2XZAH 1DSFL 3H9YA 4HCRA 4QT5A 3T2LA 6PAZA 2XETA 2EQDA 5KYXA 5B39A 4L4VB 1P9MC 1JCVA 1P4BH 3L13A 4EUPA 2EEDA 4DW2L 1Z5YD 1FJ1A 3WHXB 5C0BB 3NZHL 2ZG2A 1IX2A 3L4YA 1SJEB 3KJ6L 4PJEF 4ZK8A 3AT8A 5FM4A 5AAWC 1AG0A 3KG5A 4RAUA 2NUTB 4B9PA 5FECB 2BY1A 1MWAB 3VD2A 1D7BA 1V7MH 4M56A 3UC2A 2IMMA 2VB5A 4TSCH 3QUZC 2YSSB 1G9MC 1PQZA 1N4XL 2I69A 4M43L 5DURB 4KAQL 5BVJB 4E5XB 4EIGB 1RPQA 5GGRB 2UY7B 3HAEH 2QKIC 4YSSA 1N70A 5CIPB 5BZXA 3MREB 1GMEA 2RR3A 3M8OL 5CKAA 4B5EA 1CTNA 1MCOH 1U2HA 3MGTB 1T4WA 3DNKA 4P5SA 1A7OL 4FQQB 4AQ1C 2AKRA 1W80A 2V7NB 4A37A 1B9ZA 1DBMH 1C8PA 4WWOA 4F8NA 5HHME 1G7LA 4KJYA 1WYJA 3RE0A 2O61B 5DMGD 1MHHA 4RISL 3P2DA 1TQCB 1FNFA 4P46C 5L0QC 3HC0B 3P69A 1IJNA 5ANME 4Y2DB 2HG5B 1DN0B 1VPOH 3UYOD 5KYWB 4WFGE 2IH8A 1EHLH 2EIZA 3MYJB 1KJ2L 1IBBA 4ZTOL 1I8LA 5KVFH 5AVTB 5B22A 1BD2A 3ZT5A 4OCSH 1H8NA 1HKLL 4WEMB 4Z77B 2ADJA 4WWKC 1ACCA 3ZJAA 5T3ZE 3IDJB 4X6BA 3UCQA 3O81A 4TUJB 1YQ2A 1SVBA 4N6RB 2B15A 2VZ1A 4FABL 1E4KA 2XVGA 4XNYL 2W60B 3PDOB 4ANUA 5CBAB 3C5JA 1C5BH 1AH1A 4M29A 1BIHA 4OT1H 3QZPA 4FFVD 5ALCH 1E5ZA 1MCWM 3G04B 2Z7WA 4NLAA 2AK1H 4ZAKA 3P40A 4BSVB 4Z1PA 4FXKB 3UO8B 2HJLB 1DBAL 4X4YB 2PWGA 5E9NA 4KNQA 5CKGA 4PJGE 1S6NA 5C07D 2WCSA 1CC3A 3Q8BA 2IADB 2CGYA 2DQUL 4AE0A 1UH3A 2VM4A 3V4VH 3Q6FA 2HVKA 1VF5C 1BJMA 3MV7B 1UTDA 4B9YA 2F7PA 1WH0A 3I84A 3K6SA 4IRZL 2WZ5A 4MJJA 1HJCA 1S8DB 2VC2H 2X28A 1C5CH 2K6ZA 3ATBA 4PJ9C 5GHWH 2LQRA 4LSPL 4O00A 1J9SA 3K3QA 1BQ5A 2SODB 4XNQA 3KHOA 4PJ5B 3HPJB 2ZCKH 1RU9H 1YQVL 3C12A 1SF5A 1NFDB 2GK0A 4JG9A 35C8L 4R4BB 3MX0A 5D5MA 3ZUCA 3GRGA 2Q7AA 4ZXBD 4NYLA 4OZGA 4WUKL 3DURB 3N85H 5C0CE 2W9DH 3EOAA 4W93A 4G71B 4Z7NE 2HLFC 1F6AB 2Y9RT 3ZOAA 4ODXA 2OA9A 4C56D 2UXTA 1MLCB 5DHMC 3MBED 4Y88A 5A2FA 3B3IB 2G2PA 3L54A 3U82B 2F58L 1XIWA 2OL3L 4WWPA 1A6TA 1E4WH 4A2EA 3T08A 5I30H 3T6ZA 1VFAB 3RDTB 3OKLB 6PCYA 1FFNA 3JWNH 4GRWF 5F96H 5CAYB 3N55A 4GUPB 1R0AL 3I02A 1OOWA 1E6OL 3MOBH 4GKZB 2XTJE 5J7CC 1JSYA 4EIZC 3NZ8A 3GZOA 5F3BA 4CGTA 1VENA 4E9SA 1XHHA 5CEZD 1N8ZA 4U2ZA 5C0GB 1E8XA 3D05A 4FQ2H 4HCRH 4LB8A 1I4FB 4PV8B 1CYXA 3JWDC 5BRZA 3TIEB 5JOPE 3VWJD 5DZLA 3VXNB 2EYSB 1N6QH 5MENA 4EUPH 3CFNA 3OV6A 4CMHC 4ZD3L 1U8IA 2Z35A 3FB6B 3L4VA 3VQMA 2NOYA 1MXGA 2C1OB 1IGFL 2JFCA 5LG6A 4PEEA 4K8RL 4YSDA 3UJIL 1MNNA 1F41A 4NT6A 4LBEB 1CFTA 1FNGA 2NY5H 3GK8H 1INEH 2LW3A 1BOYA 5D4HA 3FFCB 1BYOA 4DCQA 1LE5A 3RZCC 4QOKA 4NC2B 5DRXA 4QRRB 4W9EC 2IWGA 4F2EA 1N7ML 4OLVH 5K1NA 2KERA 5FO7A 1KPVA 3CVHL 1ZHKB 1U3YA 3V5KB 4CKQA 1K3ZA 1TJIH 4N0RA 4B96A 4NO0B 4HWBL 1KJMB 3Q0HA 3ZKXB 3C75A 1JMXA 2D2CC 3HHRB 1SHSA 3CDGA 3NJFA 5IHUL 1QWHA 5T5NF 4LCCB 3V0DA 4ZMXA 2FDBP 5ESVA 1EERB 4NQDD 3GIZH 4X5QA 3DUSB 4I0PB 1M1SA 2QT6A 4HZLB 3QAZC 3V6ZA 2FJSA 4A2DA 1VFBA 2RHEA 3DJSA 5IFJB 4XNMB 1UOWA 2K4AA 4L37B 4CGUB 2ATKB 1T5KA 4EN3C 2E76C 1KFAH 1BMWA 3Q5OA 5DRZB 2Q86A 1WA1X 1DQLL 5F9OH 3F58L 3ZTJG 3H9ZA 3GI8H 1KENL 1XGQB 1YNLH 3NIFB 5FYJU 1PG7H 2YFOA 3M1BA 3D0VB 3S35H 5I74B 2HPOA 1MF2L 1JXJA 2VISA 3PP3K 3LNFA 4JPWH 4FKKA 1MFEL 4H8WL 4BKTC 3UZVA 1RZIB 1X4ZA 1DQTA 4IBVA 1OAUL 3NCJH 3OQRA 1IE4A 3KPRA 2AJ3A 2WSDA 2GIMA 3JT2A 2I7SA 3NG5A 2C7UB 1NMCC 1KJ2B 5BS0E 2DIBA 4ECNA 2NPLX 1MVFA 1KIPA 3LJ3A 5HYJE 3ULVL 3PAUA 4Y9GA 2A9CA 4M4RA 2ED8A 1DE4B 3FQXA 5CJOL 4NZDA 2EECA 1LEKB 1ZK5A 2QMKA 1PKQA 1J1XL 1H3TA 1NGQH 3E8UH 4N20A 2EVIA 1MAMH 3DXAE 3T0VA 5F7AA 2DQJH 1I7RA 1EZVX 1ZEAL 2G2NA 2IGFL 4YDKH 2I5YL 3BJLA 3DECA 1WJ3A 2I25N 3P9LB 1GZHC 3ZY7A 1F18A 2NNFA 1OGAE 3OR6B 4U1GB 2J1ZA 4UINH 4APQC 1YG9A 1JNLL 4GEIA 1G1CA 4KK8D 4AYID 1BLIA 1F8TH 4YHNA 4PB9H 4J1UB 1T1YA 3CJJA 5K9QI 5H2BB 1KIQB 3UACA 5E8OA 5ADPH 4B3EA 5F7EH 5KUMA 4DTGL 5A7EA 2QQLH 4G8GA 1JZ3A 3LNDA 3TJEH 5ICXB 4OFDA 4PS4H 2P46B 4PUBL 3J7HA 1HZHH 3ARQA 2WLLB 1QSZA 4BH7B 1T04B 1NCWH 5BS0D 5GGUA 3BKJH 3NFNA 1GYWA 3U0TB 3EJRA 3DK2A 1A0QH 3PDDA 2F68X 3CFDA 1UWXK 3CLWA 5D1XE 1IKFL 5IJKC 3HMWL 2YAPA 1CDYA 3BKML 3DYOA 1HHKA 3DXAD 3QJXA 5J5EA 2X3CA 5A1AA 2UYLB 3ARUA 5DRWB 1OGAD 2D0FA 1L4IA 2AI0L 4CN6A 4RGMB 3VYPA 5ADOL 2OL3B 3I6SA 4XBPA 5DS8B 3FSAA 5DSCB 1GA2A 3LEVH 4OCMC 1MUJA 2MMXA 3X1BA 2QHRH 1OGTA 3ZHDA 3NJVA 1JBJA 3S7GA 4P5KB 1PFCA 4G9FA 3O9WD 5DS1A 2OYMA 2VNCA 5ALBH 2HWZH 1T2QL 3K6DA 1SM3H 3QUYA 5JW4N 3CFBA 4PBVC 1DEEB 1QNZL 3GMQB 4F20A 3CE1A 3EJCA 2BP3A 1TF4A 1B2WL 2EADA 2UXFA 1QTYT 2IANA 3P02A 3U1SH 3QIWD 4OCRL 3IEAA 1WQVT 5DEZA 5ENWA 2FSEB 1B9KA 4C8XA 1REIA 1Q0EA 2BOCB 2CIKB 2VRAA 4BUQA 1ZS8B 3JTTA 5HPOA 4HH8A 4OF7A 2NNRA 3RFZA 4G8FB 4Z7IA 1OAXH 2RB8A 2Y0SA 3MJ7B 5TFSL 4TF4A 4OFKA 1C9SA 4EBQL 2XNAB 2EXYD 3HLAB 4Y16D 3CVHB 1AXSB 3MTXA 3RVTD 1OAQL 1NLBL 1ZT1A 2R8SL 5AZEH 3L3IA 5FAAA 2NCMA 4P2RE 5HPMA 2YA1A 2QHLA 1BVNT 4RWHA 2CO2A 1R34A 5IB5A 3B9KA 5MEOA 4KGJA 1HNFA 1AR1D 1IGCH 4AYDC 1SBBA 1I85C 2P4AB 3LRGA 2ENYA 2VERN 2NZ1A 2CIIB 1F90H 4OGAC 1I1AB 4MQ7B 2WSPA 1FNHA 2K8MA 4KBPA 3SZKC 2OM5A 3DO4A 3TZVC 2DQFA 2I24N 4K0OA 4CDHA 3ARBB 2XQYG 1Z6JT 3W57A 3L5IA 2W07B 2IOOA 4UQDA 4XHJD 1NGYA 3KBHE 4PRAB 2NXZC 2K70A 2ADIB 2YMTA 4G8IB 4QO1A 4RMTA 1T22A 3LHPH 3ETBF 3MV8D 1SDYA 4PGCB 5FDYA 3SKMB 4XP9H 1EQWA 3UJTL 2ITCA 3O6FC 1KXVC 3CDCA 1UXSB 2ARJA 2P24A 1BBJA 5FA4B 3RVUC 2R69L 2MNUA 4UZUA 1XF5B 3OPZL 2VDPH 4PV9B 3T3ME 3WFBL 1OTUC 1TCRA 3O4OC 1A8JH 1CGVA 4G7SB 4S1SH 3K1DA 3TNNB 3MRRA 4IKKA 4ES9A 2CKBA 1PJ9A 4ZMNA 4X6EA 3DX3A 4JJHA 4OZ4B 2PWEA 4JFQB 2IAMC 5EHFA 4P2RD 4RGNC 1KTLA 2IDTA 1DJXA 5IQLA 1JHTB 4N22A 3WY4A 2PO6A 2M83A 1NCDL 4OIIH 3CHSA 2FCBA 5IW6B 1MEXH 1F3JB 1VEPA 3UXFA 3PHOA 1XGTA 3GSOA 1ZY9A 3KPLB 4NUMA 4KDWA 4HK0B 2ZUTA 1XGRA 3C60B 4WGWB 1JI1A 3VSUA 3CZLA 4TNWF 2PABA 2GSIA 4HWUA 4Z0XA 4A04A 3D4GA 1BZ7A 1EFXB 3GTTA 4HAFA 5DCCA 4IS6A 1A9BA 2MNJB 4HIXL 4P5TC 1VFOA 4QRQB 3QA3A 1KCUL 3LH8A 1FZMA 3DI2B 4BFGA 4DEPC 4JR9L 4XP6H 5E2WL 4X5XA 3KD4A 3V4UH 2EDHA 2CXGA 4JCLA 3BSGA 3MV9E 3MYZA 1OW0C 1CFQB 2FYYA 2MCPH 1YY9C 1L5GB 4A6YL 4Z3JA 4TSBL 5F3HB 1FNAA 1CE6A 4PSRA 3P11H 1L0PA 1FHGA 1GW0A 3ZKMD 5DA0B 2Z91B 4OZIE 2CHWA 2VYRE 4RAVB 5EO9A 4RMSA 4NNPH 4P2YA 2CZNA 3KW8A 2BP5M 5KAQF 3EFFA 3BGFB 1I7ZA 4QWWC 2J73A 4ZPTB 5EEXA 5K9JL 2G75B 3ARFA 1AQDB 2G3NA 2EDBA 3MZGB 4GAJH 4YWGH 4KOBA 5MEPB 3U46B 3WJMB 2JE8A 3CZJA 5HP5A 3RWCB 3EHBB 3NPZB 4NDMB 1CTMA 5KTEL 4K2UH 2Y2YA 3P3RA 4RWYH 3HC3L 3WKML 2QVMA 3PAVA 2HRPL 4JRYB 5I19H 1E8YA 4N2AA 5ANMA 1NKOA 4P4KB 1J5IA 5A6LA 4MD4B 2FH8A 4HUVA 2BJMH 1UA7A 4ZFQA 3JYCA 4AG4L 4KKLD 5IMLA 5C0NC 3STZB 1NOFA 3QUHA 3FQWB 4A38A 1D6EA 2JKNA 1VHPA 4Q2ZA 4R96B 2CLRA 4B7LA 3O2VH 5I16A 3KDPB 3BDXA 4U1JB 3WNLA 1URIA 3H4FA 4S0TD 1BVZA 1O7DC 1BAFH 4QGTA 5IEHA 3NDZE 3ET9F 4M1CD 4DP6X 5C2BH 4L3FA 3VXPA 4F15C 4AEFA 4FHBD 5EZIL 1MW3A 3MJWA 2XACC 3DHMA 3WLBB 1IM3D 3GSVB 1CL7I 4PJGA 4PJHB 4WO4B 4JRWA 4MNGB 1BA9A 2Z1PA 1NIAA 4UIKH 4H88H 4R90L 4OFQA 2DL9A 1MI5E 4FNLL 3CFEB 3VYOA 1INQA 3EG9B 4N2OA 1QUNA 5IWLC 5DJZA 5K93A 1J5OL 4WHCA 1JNNH 3QJZA 1XWVA 2XVKA 4Y4HC 1HX0A 3PQYD 5HGAB 2KC0A 1MJUL 1WK0A 3KPOB 4K9EH 4MQXC 3GUTA 4NPKA 3S96B 2IPTH 4AIXA 1RHHB 4KNTA 3F64A 3MNVB 3MKKA 3P30L 4WSGA 3VWJA 1XF3A 2M8XA 1G9NC 1JHLL 3GM8A 3OXRA 2WXGA 2LVEA 3NMEA 4YHZL 2FLMA 4XPFL 1MHCA 2LFGA 4JFOA 1NC2A 2UV3A 4Z7WE 3T65B 3JWOL 4U3SB 4LOEA 1TEFA 1KYFA 4PJCB 4S1DD 5C0CA 4KHXL 5EO0A 1E7UA 1QX1A 3UPCA 1MY5A 3FOMA 3I2CH 5ILTL 4RFOH 3VWKB 2XY1A 3FUHA 3GXDA 4P9ML 1K4CB 2D7OA 3W11D 3P4NB 3GSRB 3ZBMA 2FZ3A 1QQDB 4OGYL 1NLDH 1XEUA 3F5WB 3QXDA 1WHPA 3RQ3A 3LKSB 2PW2B 1MI5D 3BJ91 3IFLH 1WBXA 3O6KH 3SODB 1WUZA 1OP5H 1EEUA 4GG6B 2WXFA 4D7PA 4LPVA 5F1OB 1KSRA 4TQEL 4G5ZL 2J8UB 4GAYA 1J10A 2G9HA 4X6FA 2Y7QA 1QBAA 2F0CA 2JQZA 5I5RA 2VDQH 1KCKA 4U1IA 1A6ZA 1C5DA 2OSYA 4E0RB 3GHBH 3OG6B 5EBMB 3MUGA 5BCAA 4LCYB 4AT6A 4PGBB 2QSCH 2N01B 1MAKA 4PJ6A 1AO7B 1EMTL 4EZLA 2J5LB 3P0YH 4CILA 2YOCA 3MRLA 4FG4A 4HJJH 1T3FA 4K94L 2AAVA 1KXTB 3FZUC 4KVPA 1LEIB 1BPVA 4OLYL 5BPPA 5CZXD 3C87A 4UYPA 1OCWL 1A9EA 2OXHA 3C5SA 4MX7A 4NHCH 4H2CA 4LLVA 4ELMB 4M3KB 1E9OB 3EO9L 1FFPA 4UBDD 4JKKA 4WNSA 1S5IH 5FPIA 4HEPG 3ARED 3WN6A 3AY2A 2XKNA 4ZQKA 1YC8A 2V3EA 1DBJL 3AFLA 5F6HJ 1P2CA 2D9CA 3PS6A 4LLWA 4XN8A 5I1AB 3HKFA 4KKRA 3VD4A 2J1YA 4AVHA 3WE6B 4DN4H 3WUWB 5K39B 4CSZA 2E4TA 2X4OA 1JWMB 4NN5C 3IDIB 3IXTA 3OC5A 1KNOB 5B1JC 3RVVD 1VDGA 4NP4H 5I66B 4G1EB 2A9DA 3FNKA 1QO3B 1BIIA 3IETB 3X2QB 4NQXB 5DUPH 3BWUC 4HYTB 4UAOC 1XTLA 4P5MB 2WTRA 1N18A 3UZEC 3OQ3B 4XVSL 1EO5A 5CN1A 1AG6A 3BPCB 3OR7A 3QG6B 5F9JA 5E9DB 2A74A 4MAYD 1T7VA 3B9AA 2H3NB 3ZKSD 3OX8B 3EOTL 2WUBL 5T3ZH 4IHOB 2H6UA 3I6KB 5F7LB 12E8L 1GGCL 3PWVB 2YA2A 4OM1L 2OQJA 3T6WA 4PLOB 1MVUA 3BDBA 4DIXA 4GIOA 1EXUB 1NQBA 3IBOA 4WW2B 1SY6A 5EBWB 4L8BB 5BS0A 4JY4A 3ILPA 4PRPB 1HHGA 4IBWA 5D1QB 4WU7B 1YEEH 5HYJA 1NCIA 1FNEA 5DHYA 1NUGA 4G6FD 4FQCL 3OHXB 1TZGH 3ZE1F 1HDMB 3CK0H 2R2HA 4JPVL 4X7TB 4WDIA 5KSVA 3DSFL 1JV5A 1C1EH 2J56A 3DXAA 2R39A 4HQQH 4MXQC 5GS1C 1OY3B 4W9FC 4AGLA 4DKEL 1D2OA 3H53A 3MRCA 2B1AH 1NMBH 3QRGH 4K7PX 4V1DB 1QRKA 1OGAA 1KWKA 2X0VA 1BW8A 4X5RA 1A1MB 5CP7B 3FB5A 1KFGA 3AZUA 3DIDA 4NO5B 1M71B 2CDGA 3N50A 1YECL 4MD5B 3KPTA 4EI5A 1EO8L 1GC1L 4U7SA 4UT7L 3AG3B 2L3BA 4ODSL 2QSVA 1NFIB 1PZDA 2GTWA 3KYMA 4MJIB 3RJDA 2XWJA 5DHVH 5D70L 3OKEB 3O9WA 4K73A 1ZTXH 3VFMB 2CNYA 1HXKA 2ZG1A 3UTZB 2ETWA 4NLHA 4BCXA 1Z32X 3WS6A 4X98B 2X5PA 3B7RL 4L4TB 2YUVA 1AI1H 3H42H 3QIWA 3DV6A 2IQ9L 2D8KA 5DRNA 5T3XL 5ES4B 2F54D 2WJ7A 1WAEA 5D1XA 4QXTB 2VZOA 3VXMD 1ZHNB 4PU2A 1CXEA 3K6NA 5LBSL 1QFOA 3UTSD 3VXSD 4HX1B 1U42A 1UCBL 3ALPA 3ZRSA 2OZ4H 2X05A 5BO1L 4ZMZA 1MKFA 1OPOA 4EF3A 2Z4QB 2G5RA 3P73B 1HC1A 2ZSWA 4P49A 1TZIB 3CFUA 2V2WB 2NSXA 4BFJA 2F19L 1UXLA 5AW8B 4AIZA 4KTEH 2WOBA 1EFQA 2XOTA 1B3IA 2DY2A 1NFAA 5CUSH 4JS7A 3HG1B 2DDQH 5I1KH 5E70A 2WXLA 5D55A 4KVNH 4G1MB 4EO5A 4E68A 4UM9D 2DQHL 1YY8B 4JPIB 5CJ8A 1OL0A 3RZWA 3BDYL 1IVLA 4BFOA 1UQSB 4HK3N 3CFJB 5JO5B 4E9YA 1ET7A 2AJVH 2WBJC 2WXQA 3QJVB 4PW3A 5IBTH 4O5LH 2QGDA 2D31A 4M1GH 4HUMB 5DJDB 4GW1A 4Y4FD 1ORQB 2VDNL 3OGOE 3B2UD 4FYSA 1YYLH 3KYNA 5LQBL 4G9DB 1UC6A 1ZDQA 3FMGL 5AW0B 2TRHA 3MQIA 4QIRA 1JN6B 3HRZA 3O6LL 4AVIA 5K9OA 2JKXA 3SOTA 1ECYA 3LKOA 3LX9A 4XBEH 3WKQA 5DGQA 4BA8A 8PAZA 5FO8A 4GQRA 1XH0A 3MUY1 2VKXA 4I18A 2IWEA 5IGXL 3R06B 1WBZB 2E7BA 4BGDA 4P2RA 2XCMC 3VFWB 3QZWA 2ED9A 1XAKA 4F8OA 5IB3B 2BHUA 2IMNA 5D2LF 3SDDD 4MDIB 1NCBH 4KI1A 1I3VA 4DQOH 3CMGA 1QBMH 4BA0A 1WEJH 4U0RC 3WEXA 4YUEL 4AYEC 1YEKH 1UZ6F 3DTUB 4GS7C 4CADA 5BUPA 4AITA 4NKOB 5D7JC 1NTDA 2HX7A 4XC3H 4ANWA 5E24E 1HSAB 4OJCA 1JCKA 1IU1A 4XMLL 4UTBL 3U9UB 4QXGL 5T1MB 4YAQB 5EIIA 3ULUL 3VYNA 2JKSA 3GC3A 2DLEA 3CTTA 4MNQE 2J4WL 3AU0A 1FC2D 4FAAB 1SY6H 2GFBB 2YFNA 1QG3A 4MJHA 3LD8C 3GSWB 5G5DB 1OSEA 4HT1H 4L1TA 4OFYD 5F93C 2EKSA 4P59H 1NUNB 3EBIA 4YDJB 2ZWZA 4FXKC 1OPGL 3AM8C 2XWRA 5M95B 2H0JA 2NNAA 1KPRB 3G5ZB 4QLRA 3SQOH 4P2OB 3VFUA 4J2QA 4LEEA 2KS0A 2CLVB 5GGTL 3VACA 3H9SB 1E5UI 3QWOA 5HDBE 4KTGA 1ZD6A 3GKWH 2WPGA 3FS9A 1U4FA 2IH9A 2XKSA 4XPAH 3L3DB 5HVGB 1IFHH 3QFJB 4G80A 4AZ8B 4NQCB 1LO0H 2FATH 3QJFB 1RK1B 5LWYL 1E27B 2HYMA 1B88A 2UXGA 1EUTA 2V2TA 1T1XA 4NENA 1KCSH 1FO0H 1PYWA 5DI8A 3WTXA 1GZPA 4PTTA 3SE4C 1J9RA 2EUZA 3VTTA 4JZJB 1K4DA 3IJYB 1TG8A 2NW2B 3RWJA 4ZBJA 2F08A 2VDKL 3T77A 3K2KA 4JFDE 3WXWH 1SDDB 3D2TA 4MNQD 5E5RB 3MU3A 4PREA 1TU2B 5IMKB 3DROA 5AZ2H 3IVKA 2MKLC 1A66A 2FO4B 2XV3A 2P5WE 1LEGB 3DMMC 2EAEA 5EN3A 3DIFB 5F8RC 1N5YH 3MV9A 2CH8A 3U9PL 4B27A 4X80L 3HI6H 3U4EA 3I75A 1E9PB 2CDFA 2H32A 2BX5A 1E4JA 2D0GA 3LN5B 3UDWA 3GIVB 3D3VB 3FO0L 3FW6A 3L3KB 1VGEH 1UM4H 2E7LC 3LTVA 5CZVH 4WHYG 4M1DH 4S1RH 4YHYB 1Y1UA 3HVNA 2Y06L 3V10A 5E4IA 4AVKA 4OZIA 1CZ8L 1HU8A 1WBYB 3CH1B 1MXDA 1TT6A 3O3EA 4OJEH 4WFHD 5JPMA 5JPNA 2R2CA 1IM3A 2CR6A 2Z31C 4HLEA 5C0IB 3V9CA 5I1GL 2FB4L 1VADB 5FUOL 5BW7C 4X6CB 2X2UA 5HYEA 5KVGL 5E94A 3L9RA 5FGSA 1SEQL 5C1MB 1ZK9A 3FUIA 3TPKA 2PN5A 4O2CA 2Z7UA 3BRDA 4KQ3L 4WWKD 1MELA 4AUJA 2P5WD 3VTAA 3W2DH 3MLYL 3OZ9L 5AVUB 4WK2B 3K2UL 3W38A 4JX0A 2VAAA 3SSGA 5EV7A 1J12A 4N0YL 1FAIL 3OLIA 2N59A 3L5XH 5B3NA 4BGLA 1FGVL 1X9UA 3AAZB 4PJXF 4M7ZB 5SWQB 3P9WB 4DP1X 3ZL4H 4X7CC 1FV1B 1LGVA 3BP4A 3MFFB 1X3DA 3NPSC 3MODL 2AS5M 1PZ5A 1RH8A 1ZRUA 2A83A 2J21A 3A21A 3BP5B 4N9GB 4FYQA 2BFVH 4MHHI 1JPGB 4MGXA 2OTUA 2XI9A 2VDNB 1NIDA 3WIFA 1DSWA 4HPHA 1RMFH 1Z3GL 4P23C 5GS0D 1JGVL 2VO8A 4X8XA 1MI5A 3SY6A 4GXUM 4BK5C 5ITFB 3TM6A 2HRHA 3FQ4A 3QHTC 1Q9LA 3G5WA 3BT2L 3NTCH 4Y5VC 5ITBL 5IT2H 3G5YB 4ERSL 4WNJA 3ES6A 4LSTL 3QWRD 2GTZA 5T1JA 1OB1A 2HRGA 4LHQB 2KPWA 3FRUA 1CPUA 1SRDA 1AS8A 3VFNB 1D6VL 1A14H 1DBBL 4X7EC 4I13B 1CVRA 5I71B 1TITA 2ZAIA 4I2XB 4TUOA 1NBZB 2C1PB 2GVYA 4Z7WA 3MRDA 1NCGA 2QJDA 5D7SL 1CYWA 2DM2A 4KXZH 4ALAL 3DVGB 4XOEA 1IBZA 2X88A 5LCVL 5FIEA 2FSDA 4HIQA 4TPRL 5PCYA 3ZDZF 2WLMA 5KOVC 1R33A 3G9VA 3L4ZA 4Y8AA 2HH0L 1AGFB 1I7TA 2BVQA 1KT2A 2DKMA 2DQEH 1JAEA 3BLBA 5LGHL 1NL0L 5E2UH 3X11B 3BSZA 1H3PH 4QXUL 1M1XB 3IFOA 1SFHA 4X5LA 3AREA 1DVYA 4MA1C 3V8CA 3SKNB 4N2GA 3MRFA 2MQ3A 4ZG1A 1HH6A 4GO8A 2ATAA 2LOEA 5TDOB 1AXTH 1E4XI 1YHPA 3PNWA 3UZQB 1T0NB 1RK0B 1H3GA 15C8L 1WDAA 3F04A 1Z0MA 1DLFL 2P8LA 4ZNCD 1EDQA 2EIJB 5BV7C 5C6PB 1S7QB 3DV4B 4ZUWB 1Y18A 1NBYA 3EDKA 2R29A 3DSNA 3S48A 4XCEB 1B3JA 4OTXL 1RUML 1KDIA 1UM6L 3ABMB 3PV7A 5I5MA 3NSJA 2ADFH 3H4HA 3OAZK 1U8QA 1KUMA 2BO0A 3QIBB 1WFNA 2DI8A 5ABAA 4BUGA 2R2BA 3TNMB 4XMKH 4MAYA 4UQ2A 3MA7B 1FLTX 4NN7B 2VDLB 4ABVA 1N6VA 4HS3B 1LO5A 2JK5B 1GJIA 3OVUB 1MFMA 1QRNE 3W82A 4G83A 2VDKB 5E95B 1I8MA 2MTAA 2R0WL 3OSKA 5HVHC 1CT8B 4V2BA 5DD1L 3SOBH 2GJ6E 1O6TA 3F85A 4J8RA 1V27A 2CGZA 4TQHA 4F8TA 4FQIH 4Q56A 5B38B 4R7VA 1MQKL 2BDNH 2WVVB 3WJLC 2LTQC 1GGBL 4RGOH 4RGMC 4ZUUA 5AL0A 5B3JF 4S1QH 1ACYL 3OKKA 4UOW0 3RDJA 3UEQA 1IRAY 3OM3B 5CJBA 4PJIE 2FLBT 4W81A 5JIIA 3MMEA 3E0GA 3OSVA 1N8OE 3MJ9A 3FQTA 2I7OA 4YSCA 2UVEA 3P4OA 3Q13A 4EN3D 5J12B 1QI5A 1QBLH 4LHJB 3TBTA 1TZHB 2WYTA 3K4AA 4FA8A 3FT4B 3TN0A 3ASOB 4M6MH 1T5XB 2WO4A 4Z7QB 2DKUA 1N3NA 1EEYA 2ZWKA 4UQAA 5L2KE 4N2HA 4NAQA 3VMOA 1WD9A 3ARSA 2R1YB 3L5WB 4Y1AD 5B4MC 4WK0B 1W0VA 3TC9A 3EFOA 1V3JA 4YS4A 4RZKA 1T4KA 3D2UA 3K0WA 4LHUB 5HBBA 5C3TA 3AW5A 4DKFL 4K07A 5EZLA 4CC1A 2H6PA 2DOCA 2GJ6D 5JIQA 1TEYA 3NP3A 2GITA 3VFPB 9CGTA 1ZHBA 2X1OA 1CLVA 1KY7A 3Q6GL 3CXDH 4B9KC 1KZYA 1EGJL 4ZS6D 5C0FA 2I9LA 2YKLL 3H3PH 3TO4D 2DWYA 1GS7A 1HHJB 4TUKH 2BPBA 4GW5A 1SQMA 5GRJL 4FFWC 1T66C 5EO1A 4AKOA 1S9YA 4GUCA 5EULV 3BVNA 4KMLB 4WY7L 4WGKA 2ZXGA 5PAZA 2DWDB 1LP9F 5J6HA 1SXSA 4LDEB 2CAKA 4N2CA 4NM4L 5L2KD 1IB5A 2QTVA 2WXKA 1OIOA 3CV5A 3EOBB 2CK0L 1XGYL 5D6DA 1L6ZA 5EC1A 2ODIA 1AZRA 2HRLA 5FFLA 2VWEC 3L48A 2NR6C 4ZW6A 1R5VB 3H7BA 5F0JB 4J3OF 1S7XA 3NCMA 3QEUA 4HPYL 1SNRA 5AB2A 3ZGIA 1NFKA 1CXFA 5KSAC 4TQ8A 1E2VA 4NC1C 1IZKA 2BMKA 3KZ8A 1U8LB 2PR4L 1PW3A 4J7RA 4W9JC 2QVKA 4FQJH 2F74A 1QYGL 1Q0YH 2QTEA 4H8WC 3IJ9A 1QPXA 1P69B 4UM9A 3H6AA 3U6XS 2Q8BL 4U1HA 3SGJC 4NRXA 4I3RL 3U2SA 3ME0A 1CDJA 1J87A 1ZXKA 2E56A 3MLVL 3V5HB 1KTDA 1AFVL 2WXOA 5H8DA 3NQIA 4N8VA 5FGBA 3V0EA 3BZEB 2FEEL 1WS8A 2IH1A 1S7VB 1WZMA 5IFHL 1SJHA 4IRJB 5F7FA 4RIRA 3ATFA 3N3EA 4MDJA 4Y4FA 5EUOB 3TT1L 4AEHH 5CF3A 3BSZH 4UT6L 4IU3B 4JM4L 1E3FA 1V3MA 3C6LB 1K2DB 2R0KL 1SXAA 2WQXA 1XGUB 3V6FA 4TXVB 2FX9H 3FDWA 2PTTA 3DX6A 3P54A 5MP6L 2CO7A 3LPOA 2GTQA 2V3FA 3VGAB 1T7WA 2R29H 4WIQA 3MJ6A 5LNGA 1IBYA 4FFZL 1ZLSL 3SGEI 1T7YA 5IIEB 1R46A 1RJLB 3LQAL 3E6FB 1IGTB 3AU1B 2H47C 1GHFL 5AQ0A 2GPZA 1FYTD 1RZGB 5AW5B 1E6JL 1XZ0A 2EIKB 3QQ4B 4YFDB 3WKYA 1HYSC 4FZEL 2RMNA 3RBGA 5GISH 3EXJA 1XF4B 2EDRA 4OJDH 4ODWB 5TE4H 5EZJB 2ICES 2NZ9D 4JLRA 4ZFFA 3QDGE 1N4XH 2GJZA 2XHNA 1FL3B 3EYFB 3F7LA 5CD3B 3U9WA 2CRMA 4AQZA 1A6VL 4LPCA 2DJUA 4JJ5B 4UAHA 4RA0C 5EORH 2Z34A 1VKXA 2CM5A 3KDMB 4R3SB 1O5PA 1I7UB 1CVSC 4YE0A 1KIRB 2E27L 4XE5B 3VRLF 4JQIH 2WIIA 1X6NA 3NH7L 4Y19D 2N4IA 5IQ7L 1CFSB 4ZPVA 4Z0BL 2XWBB 1WGVA 2V5TA 1II4E 4AIOA 4U05A 4LNVA 1FBIH 5HHNA 2RFXB 4Z7UE 5ESAA 3GLAA 2Z6FA 3MTRA 3K6OA 5AKSA 3AXIA 2AJUH 4RFEA 2IO5A 3LKPB 3D52A 1P9MA 1EWHA 5JORB 3L45A 4OZHB 4WCYH 4HH9A 2NXZD 3IFPA 2W0LA 4XN5A 1CURA 1DDHB 2PP8A 1PZ3A 3ARGC 4TNEA 3T4AA 4H1LA 3QDGD 4PTUA 4MNQA 3H8NA 1UENA 3RURA 3O6FD 3F7RA 5T5FA 1U93B 2R7EB 3ZT6A 3RVUD 4JHUA 3EBAA 2IALA 2XN9B 4P99A 1OTUD 3P1VA 3P3TA 5T1DL 4UV4L 1C7SA 2NMSA 3QUZA 4H0GA 2H26A 2X4NA 3H2QA 2WNGA 4NUPA 1E40A 4MXVF 2FJGB 2IAMD 2QKIA 2WP3O 4HHAA 4KKBD 3VXUE 4RGND 4DGIL 3DVNB 1UG9A 2ZCHH 4F7PA 3WO4C 3MGOB 1OTTD 3SJVE 4LARH 5T5NG 1B0WA 3JZYA 5I6NA 3MGAA 1RZJL 1IMHC 3C09B 3B34A 2ORBH 3D4CA 3KJ4C 5K9QG 5IK3B 1DQQA 2XQ0A 4ANKA 4X50A 4PRBB 4NAJA 1KYUA 2VLMD 1FFOA 2WLJA 2ESVB 3BCDA 4I3SL 4P46A 3V5DB 1G7HA 1HNGA 1MJ8L 4P5TD 5LO7A 3GWJA 4U0QB 2W80C 35C8H 3CXFA 4Y89A 2A77L 2IG2L 5EU6B 5FB8A 2W95A 1URZA 2YN5A 2CPCA 4ONFL 2CDEB 2UWEF 4JFDA 1K6QH 5CJ5A 2WNXA 3GZKA 5D93B 5I73B 5I1DB 3GHEL 3BIKB 4FCHA 3A67L 4UTCA 1OLZA 2Z8WC 4P2AA 5MERA 4KUZH 2P5WA 5B8CC 2J6EA 2YD2A 4MB3A 2X0UA 1L7IH 5DJ0A 4DP7X 3VFOA 4F2FA 1K8DB 5CFAA 5AD0B 1TNMA 4RMWA 2AEQH 1Y0LB 4WV1B 1DFBH 3G08A 4X4XA 3NSCA 2HA1A 4H13C 4KDTC 4M8UA 2RA1A 4W70A 4L8CB 4GFTB 3VXUD 1KEGL 2Z0UA 5JDJA 3SJVD 3OC8A 4QWWD 5IMMB 5JIKA 4QF1A 1R0AH 1IGMH 5LKNA 1RSYA 4M4PA 3F00A 2FT7A 2GHZA 1GZQB 5LN8A 2JCCB 3PHQA 3R8QA 1P7QB 5IEKB 1EJOH 4ZFGH 5BZDA 1KJVA 5KYYA 2EC9T 4PJ9A 3TO2A 4ZD3H 2E86A 1XGZA 4GI9A 4ZYKA 4ODHL 3AB0C 3U36B 3UJJH 1G7PA 4FXLA 3T0EB 1MCRA 1MREH 3UO1L 3K72A 1ZHLB 5GSVB 3LAFA 2V7HA 3JV4B 5I23A 5KSBE 3Q48A 1HCYA 5C0ND 5E8EB 3ATAA 1CK0L 1HCFX 3JXAA 4ONGL 1NKGA 4UNTA 5TE7H 2Z0BA 1RZ8B 1R47A 4XAKE 4JO5A 4JZOB 1R3KB 2AJSH 1IC0A 3F7YB 2QVFB 3JV6A 1QEXA 1HN1A 4ZSOB 4HXBL 4KC3B 3C5ZB 4KK6D 3A4EA 5H4YA 4AMKL 4NZ8A 2A4CA 1QBBA 1U3HD 2FAUA 2Y2TA 4G8EA 4X9GA 3U0WL 3V0VA 4OZFA 2LABA 1ZPUA 1N59A 1I8KB 2NYYC 2JKRM 2HFFB 5I15L 3D34A 5KSUB 5FFOA 2C9PA 2L4OA 5A3IC 3LH2L 3SE9L 1OZTG 5FK9A 2XBZA 5TPWL 4UANA 2L7QA 1FWXA 1HXYA 2A6DA 1KB5A 2FTAA 3IDXL 5GGQH 4NXKA 1QOKA 4D9LH 2B0SL 5DMIH 5D71H 1JERA 1VSCA 1HOEA 2ZUVA 3OKMA 3QDJD 4PJBF 4MQXD 3SEPA 3FHQA 1TQBB 3RY6C 1ZCRA 1DQLH 3EF7A 4NHUB 1P6FA 4XODA 2X7LA 4M00A 1WZLA 4XAKD 5KZCD 2QPDB 1TMQA 1F6FB 2DWSA 2O6EA 3E1ZA 3O8XB 3RNQA 3E3QC 4JFXB 5T5FH 3ZYJA 2A0LD 4Y2OA 3B6SA 3KLHC 3DETC 4XN9A 1NBVL 4FULA 3THML 3ILEA 4XPTL 3RZCA 1AHWC 3ULVH 4GKLA 2O93L 2XG4A 3WN5B 3OHXC 4ELKB 4UIMA 5CJOH 4A7QA 3QNYB 5EU7E 2DQGL 1BOGB 3UTTE 1FORL 1QVOA 4O9HH 4EOWH 2ZT9C 5LBVA 5I8CA 1MIMH 1XB6A 4RDQG 5IV2B 3QNZA 5CN3A 4J4PC 3BP6B 5DEFA 3DOIA 3NSFA 3QZMA 3QHFH 1I82A 4FKEA 1KBGL 2QQKH 4QYAA 5AOJA 4ETQB 3GGWB 1TVBA 1MPAL 1T21A 4MNHB 5AW1B 5MHSE 2EZ0C 1I9RH 2DYPA 1OT1A 3NEOA 3G5XB 1AANA 2FWOA 5DZVA 3QUMA 3LKRA 1OTSC 2EC9U 1QHOA 4DTGH 2WANA 7CGTA 2WCGA 4QAMB 4LL1A 3GMNB 2A38A 2XWTA 2FUQA 1AZVA 3MFGB 4L3EE 3J27A 3CXHJ 4N8UA 3EH5B 5EEYA 4JKWA 1ONQB 3Q8FA 1MHEA 4LF3B 4PD4J 2OK0L 1F58L 4XZ4A 2PCFB 3NRPA 4NKDA 4LLAA 4MJ6B 1GOGA 5DUMH 2AJXL 2KKQA 1M42A 4ZTEA 1QRNA 3QNFA 2A4ZA 4P07A 4WJG3 3DBXA 4DESA 4HU2A 3MVSA 1SXNA 2DD8L 4JDTH 2GJ6A 3FUFA 2YRLA 3D8MA 2X4PB 3LQMA 3CBKB 4PD4K 1HSBA 3N9GL 3P4MB 1A7QH 1FCGA 2WQUA 2MOVA 4LSVL 4WFED 1KEML 2Z4TA 3IAQA 4YSAA 1S7TA 3RTQB 5D7IE 5FF6B 4NRYB 1UJ3C 4NCDA 4PJIA 2X44D 1AGCA 2NX5E 3I3EA 3IGAA 4OJFL 1GZHA 4CA4A 1BDYA 2A9NH 3GXIA 1V7NL 4DVBA 3VM7A 4AV0A 4APQA 4BE5A 2Y36L 4QTIH 1GJWA 3LRSA 4MCNA 4C83A 5IF0A 4P4RB 2IWKA 3EJQA 4D7BA 2C3VB 4DQAA 1RERA 1CG9B 3MJ8B 5DQJB 5TE6L 3WDHA 1FGNH 4ANVA 5A2BA 5L2KA 4PRNA 4XXCC 1T0MA 4IGBB 5CMAA 3CQFA 1OQXA 1JTTA 2DH3A 4OFPA 1MJ7H 3NESA 5ECGA 4DN3H 1ZANH 5FM5M 3NFPB 2DMBA 1SEBA 3IFNH 3HRPA 4BQ9A 2H41A 3CDZB 4AYMC 1I1FA 1UACL 3ISRA 2DMKA 2KMWA 3FQNA 3H2WA 4HUUA 3SCMD 2I60H 1RZKL 4OZFH 2NUPB 3GKZA 1OAKH 4I5BB 3QRLA 2P52A 2XWZA 3QIUB 4O02L 4K94C 1M05B 4BUHA 1TDQA 4LCUA 4QCIB 5ELIA 5DEGA 5I1IL 2ZXEB 4XTRD 3KLSA 4JQXC 1D7FA 2W59A 5IJKA 2CO4A 3X13B 2Z92A 5BO0D 1IC1A 1FE8L 1JGIA 3ZYOA 1OO2A 4MXQD 1FCCA 2YRPA 4NKMA 4OIAA 1P1ZA 1NLBH 5IB4A 4HUCA 2YD7A 4BSJA 1KLGB 4G70B 2M2DA 3BZFB 4JDEB 3ROOA 4EVNB 1SYVB 1OSPH 2DTMH 4R26L 5GSRA 3F7QA 4NGHH 4XMUA 3WMQA 4YEFA 2A3TA 5KAQG 5F7HA 3PWPE 1SLWA 1SYSA 4RBPK 2EIEA 3B4NA 3JWDH 1EAPA 1MFUA 2RJMA 5I1LB 4R0LB 5FGCE 4CMMB 2R0LH 3L81A 2B4CH 4XNAA 4EI0A 2FX7H 3WTYA 2V2XA 4HJEA 4XWOC 5CLXA 1XT5A 2WBKA 3DYPA 3QCTH 1DUZA 5DJYB 3TPUA 2PYFB 4LZKA 4OGZA 1S7UB 3FU5A 3OBAA 1UM5L 1N26A 2NQDA 2P7TB 3BE1L 3IJ7A 5LGJA 1W0WB 4NERA 2PETA 3S5LG 3ECBB 1LNUB 3LMJL 1CFNB 2R51A 3BVVA 4J2XA 3D39B 3KCWA 5FO2A 3AUVA 1DQKA 4PN6A 3R0NA 4AL8C 2BS9A 4F7CB 3AUWB 1JPST 2Y23A 5B1AB 1ACXA 4N0FA 3HFMH 3OPZH 4QHUA 5H35A 3NIGF 2BRQA 4I4WA 4PJFB 5AKRA 3KWWA 2HKHL 2DQTL 3QJHB 1G7IB 1N0LB 2J72A 4UNIA 5F7BA 1JZ5A 5CLYA 3BISA 2X70B 2NY4C 5KBNC 1EBPA 4E9XA 4XMVA 1HIML 4TV3A 2Y25A 4I9WE 3FO9A 5HYSA 1SUJA 3FOLB 3WOVA 2NY6B 2ICEB 3OXSA 4L4VD 2PWHA 1WD8A 3WTWA 1IC7L 4PLJC 1SXBA 3QUMH 4LLUA 5EEVA 4OLEA 4WHTA 5C0BD 4UV7H 2HT3C 2ZOTA 3HNTH 2ENSA 4LU5H 3OLEA 1JGEB 1UKSA 1I85A 5DDHB 1RV6X 3IDYB 1JZJA 5KJ7E 3KPSE 3PYCA 1SOSA 3FTXA 4FTVE 1Q9WA 4XGZA 3EO0B 4I9XA 4R83A 3ZE0B 5DWUH 1C12B 5ABDE 1WICA 1NGPH 4KRMB 3RYMA 1XSKA 2AZAA 3GSXA 3HE6B 3TZVA 1BXUA 2L7JA 4ZJ9A 5F88A 3MRPA 1NEZG 5DURD 1BYPA 5F1KC 2WBJD 2FVNA 3CVIL 1KZQA 3BPLC 3CUPB 3L8QA 4Z78B 1MFDH 2XV6B 3H3BC 1K85A 4CN4A 1AD9B 3NABH 3UFIA 3PJSB 2ZWYA 3QDGA 3AJ7A 5EU5A 4RCAA 3BQUB 1KXVA 5AUMA 2DBLL 5GS3A 3GT6A 5FO9B 1MRDH 3BH8B 3BHBB 5A2AA 3EYSH 4ESKA 4O2FB 5JHDB 1YEFH 5F6HI 1TKWA 5FOBA 1AKJB 3IF1B 4D9RE 2NW3A 2VXQA 3BUPA 1H6TA 4PJ8B 1ODUA 4DZBB 2I07A 2IAMA 1WFUA 5KBLA 5KYUB 5L8KB 2DB8A 4WKZB 4Y2DD 3ATDA 3DUHA 5KS9B 3BP7A 1N0XL 2B7DT 3TFKC 5KJRL 5ISZE 1NFDE 4FTVD 1W16A 1IM9A 2FIKA 5HHXL