1NPJA

Crystal structure of h145a mutant of nitrite reductase from alcaligenes faecalis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
b'ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWAVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
molecule tags Oxidoreductase
source organism Alcaligenes faecalis
publication title Reconstitution of the type-1 active site of the H145G/A variants of nitrite reductase by ligand insertion
pubmed doi rcsb
total genus 89
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1npjA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1npjA02
2VW4A 3FU7A 1JZIA 1BQRA 1WA0X 4G7QB 3PAZA 2X88A 2FQDA 4GXFA 4JKNA 1QHQA 4DP8X 1EZLA 2GC7C 3EF4A 2PPDA 4KO6A 3WKPA 2FQGA 1IC0A 3QPKA 3WKQA 4EF3A 1NIEA 2YAQA 2J57A 3CVBA 4F7KA 1IBYA 6PAZA 2BW5A 2Y1AA 4JHVA 1JZFA 5I26A 1RCYA 3KW8A 2BP0A 2FJSA 3NJGA 1URIA 1ASQA 3FYIB 1PCSA 3UADA 1TEGA 4A67A 1UATA 1X9UA 1SNRA 2XXGA 1KDIA 3T9WA 2RACA 4YSQA 1AZCA 2BWIA 4HCGA 1WS8A 2UXVA 3X1EA 1IUZA 3N2JA 2YAFA 4BDVB 1ASOA 4E9TA 1NWOA 2BZ7A 1EHKB 4YSTA 2FT8A 1M57B 5I6OA 2DYRB 4YL4A 3EH5B 1OCZB 3X1GA 1AS8A 3S8GB 3QJUB 3RYMA 2PCYA 2DWSA 2QDVA 3QJVB 1L9SA 5B1AB 1ZIBA 2DWTA 4TXVB 4E9QA 3JT2A 3QJSB 3H4HA 3FQ2A 3DKHA 1ZPUA 3PCYA 2J5WA 1ZV2A 1W6LA 2MRYA 4X4KA 1AZRA 2NRDA 1WA1X 4YSDA 3OMAB 2IH8A 4GY4A 4Q8BA 5A7EA 2W8CA 3NJIA 1TKWA 4AI7A 3H56A 2ZOOA 2JXMA 3CVDA 1BXAA 1PF3A 1JZHA 3PXLA 1A8ZA 1ETJA 4HHGA 2PPFA 4RH4A 1J9SA 1V55B 4G72B 2Q5BA 3AW5A 2PP9A 4UANA 4A2DA 1FFTB 4DP1X 1NIBA 2IWKA 3NSCA 4L0PB 2EILB 3WNJA 3QQXA 3C75A 4KO7A 4E9SA 2GBAA 2GB2A 1RZPA 2PCFA 3AG3B 1BYOA 4KOCA 4P5RA 1NPJA 2FQEA 2XV2A 5I5JA 2PPAA 2FNWA 1L9RA 3IBOA 4YSPA 2XUWA 1NZRA 1XB6A 3FQYA 2OV0A 1YLBB 1GSKA 2CCWA 5D4JA 1KGYE 1BQ5A 1T5KA 3CDZB 3NJKA 3S3DB 2GC4C 4AKOA 4YVUA 2J55A 4BWTA 5TK4A 3UACA 4HALA 2UX6A 1N70A 2PPEA 1A3ZA 1ZDSA 2HRGA 2ZONA 3AY2A 4DP9X 2MTAA 3TU6A 1JVOA 2I7SA 3UAAA 2H3XC 1SJMA 2PPCA 3OD3A 3ABKB 4PAZA 1AAJA 2B3IA 2CALA 2IDUA 3PLYA 3ZBMA 3QJRB 5I6MA 1AOZA 2IWFA 2UXFA 3DIVA 2FWLB 1AR1B 6PCYA 4N4YB 3D12B 2FT6A 1AG0A 4HCFA 3EH3B 2EIMB 7PCYA 1NDTA 1PLBA 2GSMB 2IWEA 2YXVA 2Q9OA 4K9JA 1GY1A 2IH9A 1VLXA 4BK5C 5I28A 7PAZA 3MX0B 1W8EA 1BEXA 1A4BA 2XWZA 3ERXA 3TBCA 1KYAA 4DP4X 2IAAC 3TASA 1GS8A 3IE9A 1MG2C 2BP8B 1SFHA 2IDQA 3IEAA 4A2FA 4NERA 2CBPA 3OM3B 4WTQA 1OOWA 2AVFA 4AKQA 2OCCB 5LDUA 4G70B 9PCYA 2CUAA 2HX7A 2CJ3A 1XB3A 2EINB 3AG2B 1NWPA 1ASPA 3ASNB 5I6KA 2E86A 3KW7A 1PZCA 1N68A 2UX7A 3SBRA 2VN3A 2XVBA 3H4FA 2PP7A 1OV8A 2YAPA 3IN0A 4Q89A 1QLEB 3ZX1A 3NJLA 2UXTA 4ZK8A 1JXGA 1OE2A 1AG6A 1E67A 1ZIAA 3FS9A 2X87A 1OE3A 1J9RA 1GYCA 3DTUB 1JXFA 5EHFA 3UAEA 5D4HA 5B7EA 1ADWA 3WNIA 4GP5B 3FSAA 4YSSA 4E9XA 3L45A 1MG3C 2W88A 1A4CA 1IBZA 3PAVA 3T6VA 1JXDA 4UF7C 4YSOA 2R7EB 5B1JC 5B3SB 5B7MA 1PLAA 3UABA 3NJHA 2JFCA 3AZUA 3BQVA 3T71A 3FPXA 4DP0X 3NT0A 2J56A 2Y69B 2UXGA 4KNTA 3NJNA 1HAWA 2IDSA 1WAEA 4BWUA 2YAMA 3FQ1A 2YAEA 4W9ZA 1KBWA 1OE1A 4A66A 1SDDA 2TSBA 4HHWA 3FSVA 3FYEB 2TSAA 1JOIA 1AANA 1SF5A 2BHFA 2B08A 2YXWA 3MBWB 2N0MA 4HAKA 2AZUA 4W1TA 4G7SB 3UGEA 3X1NA 1KDJA 3NJJA 2BZCA 2IDTA 3GDCA 1E65A 3SBPA 1XMEB 1A65A 1NICA 5IY5B 2XXFA 1KV7A 1NPNA 5TK2A 3TBBA 4BDVA 3OMNB 5B1BB 3NYKA 4KO5A 4CSPA 1OF0A 4HIPA 4F2FA 4NAJA 4PCYA 1J5CA 3IN2A 1OCRB 2VSKB 1GW0A 1DZ0A 1TEFA 2HX9A 3GYRA 4KO9A 3ABLB 2VW6A 1W6WA 4FAAB 4YSAA 3NSDA 1AZNA 4BXVA 3AG1B 1JVLA 4P5SA 2QPEB 3NP4A 3NJFA 1DYZA 5AFAA 5I5IA 4HCIA 2BP0B 1WA2X 1NTDA 1SF3A 3NJMA 5B7FA 2DV6A 4ENZA 3JTBA 1AS6A 1IKOP 5FC9A 1AZBA 1MZYA 4E9WA 1I53A 4MFHA 3ZIYA 1L9PA 4DPAX 2ZWNA 3T6XA 1GS7A 2OJ1A 1OCOB 1J9QA 3FSWA 4A2EA 1PNCA 2HZHA 2YAOA 3CVCA 1FWXA 2BW4A 1E30A 1RZQA 1ET7A 1ET8A 2DY2A 4GP8B 4DP6X 1GR7A 1BXVA 3CDZA 2VM3A 3CZUB 1KCBA 2QT6A 4AKPA 1JZGA 4BXSV 8PAZA 3NP3A 1MZZA 2FT7A 4YSRA 3SBQA 1FA4A 1GS6X 1HFUA 2BWDA 3OMIB 1ID2A 1J5DA 4A68A 1ILSA 2VM4A 3S3CB 1HAUA 1AIZA 1F56A 2BP8A 2XV3A 2HLEB 1AS7A 2XLLA 1KCWA 4WKXA 1AZUA 2XU9A 4NB7A 2XYBA 4M3HA 1BYPA 3V9CA 2IDFA 5AZUA 3N55A 1NINA 2WO3B 3AG4B 3X2QB 1PLCA 1BQKA 1BXUA 1WS7A 2QDWA 4BWWA 2CAKA 4F2EA 4G71B 2DYSB 4A2HA 1JZEA 4E9YA 2BO0A 1SFDA 3WI9A 2LLNA 2PP8A 5E9NA 2VSMB 3FU9A 2WSDA 4GP4B 4G7RB 3ABMB 3X1BA 4YSUA 1ZDQA 2WO2B 1M56B 3WG7B 5I6LA 1R1CA 3ASOB 4YSCA 2GHZA 2AZAA 4DPBX 4YVNA 4DPCX 4E9VA 1PZAA 4QLWA 1CUOA 1PY0A 2JKWA 1ET5A 1KBVA 2YARA 3EH4B 1BAWA 1NIDA 2H5UA 3T6WA 3WIAA 2R7EA 2EIKB 1ILUA 4AZUA 2ZXWB 3G5WA 3HEIB 4KOBA 4UAHA 1L9TA 2YQBA 3FPYA 1SHWA 4JHUA 3ZDWA 4KNSA 3NSFA 2VW7A 4QKTA 3S3BB 1X9RA 2FTAA 5B1KA 1OCCB 3FU8A 3PAUA 3X1FA 5ANHA 5PCYA 5D4IA 1RKRA 1CYXA 1CYWA 3CG8A 3QJQB 3SQRA 1A4AA 1CC3A 4GYBA 5I5MA 3V9EA 4M4RB 3FU7B 5PAZA 1XB8A 4HZ1A 2AFNA 5AKRA 5B1JA 2YAHA 3TA4D 5I6NA 2A3TA 1GY2A 4YSEA 3S8FB 4E9RA 1PNDA 1PZBA 4CSZA 1QNIA 3OQRA 2QPDB 2H47C 3FSZA 1M9WA 2GIMA 1PMYA 1CURA 5F7AA 3HB3B 2HX8A 3NSYA 2FQFA 1JERA 4DP5X 2XX1A 4A2GA 1SHXA 1L9QA 1V10A 3ABGA 2P80D 1MDAA 1J9TA 1B3IA 3BVDB 2HXAA 3QJTB 2I85A 2AANA 3GXUB 1V54B 4DP7X 3U25A 1AACA 4KNUA 2GI0A 3FT0A 4DP2X 1AQ8A 3EHBB 2PLTA 2I7OA 1E5YA 4N8UA 2EIJB 1NIAA 5F7BA 3PPSA 1E5ZA 2XV0A 1L9OA 1PAZA 1SDDB 2HRHA 2VMJA 1NIFA 3T6ZA 2XX0A 1JZJA 2P80A 5I6PA 4AX3A 4FA7B 1TU2A
chains in the Genus database with same CATH superfamily
2X1WL 4IOSD 3VXSE 2ICWB 4KZDL 2G30A 1GIGL 1P5VB 1KIPA 5FEBA 3DYMA 5EDXA 1ONQA 4QHNB 4OZGE 3O3DB 4JM2F 3S88L 4UB0L 1QACA 1JD7A 4A04A 5C0RL 1LL1A 4N2IA 3S2AA 1KB5L 3L4WA 4HQQH 3QPKA 4Z7AA 5AW5B 5AVZB 5TTRA 4EF3A 3PWJA 3K6NA 3SGKA 3EXLA 3V4VA 1RU9L 4CVZA 3FCUB 3FT9A 2V7HB 1HHKB 3QEUB 2PCXA 1KBGH 3F7LA 4RMWA 4FQJH 4N8CH 4QRQB 5M7QA 2BFVL 1YNTF 1NEZB 2LGNA 3MJ9L 3NABH 3NCJH 3PWVA 5KYUB 1XGPA 4L1TA 4WU7A 3LS5L 1GYWA 2A77H 4G9DA 5DJYB 3EJRA 2NY6D 3PABB 4GI8A 2RB8A 2G2RB 1OO2A 1X9UA 2WXKA 4K71B 1EDQA 4GSDL 3W56A 3TPUB 1P4UA 3KG5A 1AYOA 3HA0A 4N25A 1EXGA 3SO5A 4PQXA 3DO7A 1LTXA 1RPQA 1W0VB 4ABWA 1A1NA 1AP2A 3QYNA 1WAAA 1LDPH 2XVLA 4GXVH 4UT6L 5TDPB 2H2PC 4QHMB 3E6FA 3F58L 4GAYB 3EUDA 2UWEE 5FA4A 3D18B 4LSPH 3TZVC 5G5DB 2BERA 4U3HA 4KRPC 2AKRB 3O6FD 4MVBD 4PJEF 4OY9A 5BW7C 3DO3A 3B9KC 3Q6FB 2R0LL 4MZIA 2NSXA 5GGTH 5JYLA 1A0QL 1C12A 3O3AA 4K5LA 2D31A 2A38A 2YD7A 2YWZA 3N1GC 1QBML 5TGBA 3VWKB 1JBJA 3CHSA 3W3BA 3S0PA 1Y6KR 5CLYA 3QPQD 3CXHK 4APQA 2IOMA 1S3KL 1WIPA 1DEEA 4OLWH 2OJZH 5IWLA 4MVBC 2OXGB 1AIFB 4RMSA 3TV3H 3KAAA 5A16A 1S5IH 4DKTA 5DJYA 4JEGB 2J8UE 1NC2D 3HVNA 4HUKB 4E5XB 1OCWL 2P8PB 4ILDA 4FXKC 4AIXA 3NCXA 4X4ZA 3VD7A 4YHYC 5DURB 1RQ5A 4EZLA 4PSPA 4P5RA 4D0DA 3ZTJH 3QQ9C 5I5JA 2X2IA 2NOYA 3UZEC 3QO1A 2EH7L 1YYCA 4GUCA 2J88L 2WD0A 4LSTH 3T2NL 1S2EA 4QTFA 1DLFH 4Y9GA 3VGAC 1BQ5A 2QQLL 3DV6A 4QD2E 1J05A 1Q0EA 3NJKA 4XVOA 4UDTA 5L2KA 1IC7H 2AJUH 5DJ8B 3CFJB 2CO1A 1GZPA 2G9HB 4X98B 2XZQH 4OM1H 1XWVA 4O02B 5T5NG 1SJXA 1QSEB 4WI8A 4F9LC 1LEKB 4DP9X 2X2UA 3E8UL 3QRLA 3V6ZA 1DBJL 3BAKA 1OQOA 5D72H 4A7GF 3JZYA 4J3UA 5EF1A 3CN1A 1KYUA 1SJMA 5I0VA 1AAJA 3MX0A 4LIQL 3KGSA 3DJZA 4KY2A 3TYGL 3WN5C 2IWFA 3RI5K 1FLRL 6PCYA 3L4YA 2EYTA 2FT6A 3PUUA 4FN0A 5E9AA 4DGVH 4L4JA 2VWEE 1KN4L 1A6WL 3N40P 2D4FA 7PCYA 2X9WA 1IAII 1JJUA 1QRNB 2H26A 4X7TB 5DHVA 5EA0H 5HHOE 3RGVC 3IB4A 2VL4A 5EF2A 3RNKA 1NFIB 5ETUB 3T8XB 4OGXL 2J1XA 4HUNB 4RGND 1GS8A 3RU8L 1M53A 1UWGL 5IROA 4PIBA 4NERA 1IGJB 4WTQA 4B9IA 4PJGB 4WJKB 2DQEL 5AAWC 2H1XA 3LKPB 3QI9A 3MRQB 1ZTXH 3VD0A 4H1LA 1MAMH 5CIPA 5J3HD 3K4ZA 4AYMC 1QO3A 5ICUA 3K3QA 3PNRB 4GW4A 4MB3A 2K8QA 3PIQB 3EOYG 3LZFL 3HPLA 4Q89A 3TO2B 3UYRL 3V9FA 3HAEA 3SY0B 1OAXH 1NMBH 1UM4L 1JXGA 3BDBA 3T77B 2QKIA 1ADQA 2ED8A 1E67A 1P7QA 3O8XA 4UNVA 4L2LA 3BFQG 3LZOA 3JV0A 5JW5B 2OR8A 4ODBD 4GP5B 3RX9A 1AZZC 5I1JL 4EPSA 1TOXA 3VWKC 4XCFL 3OPZL 1YN7A 4G8AC 1OTUD 2J6EL 2RBLA 1MG3C 1MCWM 4OFPA 2DQ6A 4G6KH 4OD3L 1JRHL 2WCPA 4BHUA 5CLZA 3FNKA 4PS7A 2HFGL 5B3SB 4UT9L 1MCLA 2ZXGA 2XA8L 3WNLA 2ZCHH 4MQXD 3TJHD 3IPBA 4J4PA 2E9BA 3CZFA 2JTDA 3NJNA 1PIFA 2PTTA 4R4BB 1NDMA 2YPVA 4NQCA 1RIUL 1KIQB 1RZ8B 4B41A 3CU1A 1BQHA 2BINA 4QJ5B 3MBXH 4ZW5A 3C5ZB 1WRFA 1FNFA 3MBWB 3FCSB 3L81A 3POHA 5I1HL 1YMMB 4DCQB 3WDIA 4F8PA 5I8KH 1AJ7H 2HMID 3I6GA 4X80L 1UG9A 4JW3A 3MSPA 5C7XL 4PRNA 3GDCA 3LKNB 5ITFA 1FGNH 2XBTA 2LOEA 3FUDA 1CF1A 1EJOL 3TN0A 2MPVA 4MCNA 3VSQA 5C92A 3FOMB 4MCMA 4LCWB 3GMMA 3F04A 3CFNA 1P5UC 1TETL 4EUPH 3VTMA 1FN4A 5E2VL 4CADB 2IAMC 2KI6A 5A3IC 3VQMA 4JPWH 4DZ8A 1S9VA 2WBJA 4GO8A 1A4KA 2D73A 4XMKL 4QRSA 4FAAB 1N2RB 1QWNA 2DQEH 1P4LB 3NP4A 2XWBB 3T1FA 5C0JB 1R75A 1UWGH 1ND0A 4LOEA 2KDGA 5DD5L 5FHBH 4NNYB 2YBRA 2YZ1A 4XN9A 2FE0A 4FQLL 2W65B 3SYPA 4YHYB 3WMPA 1NBYA 3I3DA 4MQSB 5GSVB 4DPAX 2RFXB 1EZSA 3RGVB 5FUZL 3T6XA 4JPVL 1O7VA 4K55A 1OCOB 4ORZC 1BFOA 4IOIB 5IR1A 3MOAH 1ZT4A 3CVCA 3JWNE 3RBGA 2C3GA 3VGAB 3H3PL 3P30L 2WXPA 2QSCL 2MCMA 1IIIA 4X9HA 4DGVL 3JWNH 4A7QA 1GGBL 1OAUL 3G08A 1TJGL 1Y07A 4X2UA 1ACCA 4XO5A 5D8JH 4LCYB 1U3YA 4XXCC 5G4NA 4N0RA 2XY1A 3QQDA 2OMXA 4AL8L 4DKAA 3M17B 3I6GB 5LXGH 3JV4B 2GBVA 4EI5A 4ZS7L 1CICB 5F88A 4YO0A 1E28A 2XBDA 2ZKHH 2ADJB 2D7PA 2ROXA 3HRZA 3LEYH 3R06B 4QJ3B 5EZLB 2ZP0T 2O26U 2ZSWB 5CD3B 7FABL 1UZ8A 3U7AA 4O2EB 4D9LL 4MKTA 1ETA1 3W39A 2BP8A 5JOFA 1YEEL 3KPRE 1F8TL 1NSNL 1P5UB 4CADA 2HJFA 3FFCD 3I3EA 4EMZA 2R0WH 3WD5H 2DQFB 5KS9E 1N18A 2IDFA 1T1YB 3KHQA 4DTGH 4I48B 1OK8A 1OGAD 1HYRC 4JKMA 4KJPC 5AOIA 1JF1B 5I8OL 5C0GB 4EN3A 5JUEH 1U8PB 4LHUD 4KDTA 1XBDA 5B3JF 2YO3A 3ORJA 4NUMA 3ESVF 3F5WB 5L8JB 3RWHA 1N5AA 4M1CD 4KTEH 4JZJB 3V0FA 3GSNL 4WV1B 5AB2A 4JY5L 3GGWB 4AENA 3KPTA 5DJ0A 5L7XL 4HIHA 2ZG1A 1ZLDA 4WTXA 1PZUB 4PHXA 4L4TE 4R5XA 5HD8C 2Q8AH 1EBPA 2O5ZL 3O4LA 4U3SB 2AGJH 3Q48A 1FNSH 3BMWA 3CAFA 2JJUA 4YHPA 3V10A 5IHHA 1N4XH 3OZLA 1X6NA 4PGBA 2OMTB 3ALWA 1EAPA 1HKLH 1X5LA 4U6HB 1IEBA 4X4YB 1JK8B 5CJXA 4PJ5A 2O1AA 1E28B 2ZJSH 3W1ZA 2VIRB 1OAQL 2IGFL 1K8IA 5GGVL 3FO2A 1KNOB 4QKTA 4EVNA 3U9PH 2GT9B 3ZQXA 3MRBB 2JLPA 1LEGA 3OKMA 3QORA 4OV6F 3RUGB 3KYOB 2J7LA 1PZ3A 4MGXA 1CICD 4TNWK 4HWBA 3T65B 2X4UA 4NDMB 3IRCA 1R4XA 4GRWH 1XIWB 1Q94A 3MREA 3QUYC 4OLYH 4U6VL 3V9EA 1ZTMA 3FU7B 4N2DA 3WU1A 4WKZA 4OR1A 2H32B 3C08L 1WV7T 4E9RA 4CSZA 4J1UB 2VDNL 2FX9H 1S78C 4OAWB 5DK0A 1BMZA 2VLKD 1KYOJ 4LL4A 5FB8A 3TIEB 3EJZC 4A2GA 4ZS6D 2WXIA 3GMOB 4HOXA 2A4EA 1ANUA 3OKLB 1JE6A 2F18A 5BRQA 1SXSA 3U9UB 1XH3A 1AE6H 2FBJL 3EKCA 3GHEH 5AAWA 4DOHB 3SZKC 2YJQA 2ARWA 3RY6C 4P2QA 3PWPD 4Y9FA 4LHUA 4PRDA 3V55A 2ZSVB 4DQOL 2ENJA 1BVLA 1MEXH 3QYMA 3L5XH 2J5LB 2NXZC 4KK9D 2CUMA 5GHWL 3VGBA 4I18C 4Z7WB 1RJYA 3TH3T 2A7BA 1LWHA 4Y5XA 3QXUA 1RZJC 2JCCB 5EG6C 1H3PL 3QHFL 3BH4A 3FBQA 3NMEA 5F71A 1MJ8L 5I6PA 4F7TB 5BRZB 1EJ6A 4WO4A 2MJWA 1KCUL 3GSOB 4WDIA 3Q3GA 4R26H 4UTAA 4X6BB 4U1SA 5IBTL 5IQNA 2Z8VC 5CJXC 3MO1B 12E8L 4TQHA 4HXBH 3WFCH 1VCBC 3EAKA 4JM4H 5F0MB 1E50A 2MEJB 2PXYC 1RJZA 2BNQB 3K2UL 4OZIB 1SDAB 1HWGB 1RFDL 3CQPA 1U95B 4Y4FC 4UTAH 3ZTNH 3R0MA 1OTSC 1OAYL 4OUUB 2EVJA 2J43A 3NCYP 2VXSL 2R15A 1E27A 4Y5VA 3U0WH 1PD0A 3Q8AA 3B43A 4GKSA 4MBRA 1BDYA 3KWVA 4ZX3A 1FJ1A 2E9IA 3BN9D 4PUBH 1BVKA 2C9AA 3N1PC 3SD2A 4CN6A 1I7RA 4FQCL 2GUOA 3FFCB 4PH8A 2NYYD 3K2IA 3NESA 3MV7B 3QDMB 4NQTA 2R51A 3FT2A 3O6ML 1QUNA 2Z91A 3EO1B 3MLTA 4HCGA 4OFKA 3MJ9A 5FHAH 3VSVA 5EU4B 3BQUB 2IQ9L 2UZPA 4WEBL 5C0ND 5TJWK 1IUZA 4Z7VF 1PQZB 4GQQA 4LEEA 4BFIB 3IU4L 1UQSA 1ASOA 2DI7A 5A2BA 3P9LA 3BVWA 3LSOB 5F9OL 2VJ8A 3D0LB 4J3OG 2CM6A 2IXQB 5LGHH 2UZIH 4KKRA 1T22B 1MI5E 4D7BA 2I69A 3CN4A 3QFDA 3EFOB 4KKNA 4Z5RA 2H1PL 1UYWL 3DBXB 5JLZB 4HWZA 3UTQB 2IPTL 3JYCA 4QJ4B 1QTSA 3ES6B 1S7XB 3N41B 5E94B 5IEHB 1L9SA 2PNDA 1WWAX 5BOPA 4LLUA 5JIDA 5KVEL 2WLMA 4KXZI 4WFED 5L0QC 1AZRA 1XTMA 2VKXA 3QIBD 4FERA 3U36B 5H4YA 4BQ9A 4R83A 3BYTA 1BD2E 5K59E 2CO4A 3QZNA 5A7EA 1A3RH 1N59A 1EHLH 2NLJB 1RUMH 2WP3O 1FG2B 3SKUD 4LLMA 3AT0A 4Q9QH 4M48H 3L6FA 5CKGA 1R19A 3N1MC 4JO4L 4AJWA 1AKJD 2OXGA 3ZE0F 1J9CT 3ET9F 4ENED 3ZUCA 6FABH 5E9DB 1WCBA 3U0PA 3SO3B 1XZ0A 3VFNB 1I3VA 2NCMA 3K4DA 4H4NA 3WLBB 3WEOA 3DO7B 4GBXD 4N2GA 1L9RA 1T4WA 1DN0B 5IFJB 3LSOA 2YPKB 1YLBB 5DRXB 5INCB 4B9KC 2EUZA 1RZJH 1UZGA 5KBMA 3IETA 1V05A 2CHNA 2CKBA 2HUEA 3VX1A 2QGDA 4P3WA 2FLMA 4M7LT 1XIWC 2OZNA 5E6IC 2UVFA 4X7SL 4RWYH 5FM5M 5LAPA 3NGBC 2EE0A 1BQHG 4FG4A 2UVEA 1N70A 2ZOKA 1ZDSA 3ARFA 2FO8A 3E0GA 4FYRA 4QOKA 3JV6B 5HPMB 1GA2A 1U41A 3ILPA 4W9EC 4NQDE 1IKFL 2B3IA 1IGIH 1QLFB 3MA7B 5G4OA 2VR9A 1IAMA 3U4AA 1R3IH 3DRTB 1KTLA 5DEJA 3F7VB 5J1AB 1DQJB 3MNWB 5DLLA 5D7LE 3HG2A 4NZ8A 5AKVA 4P2OD 4ZNCD 3TEYA 2CJUL 4C59B 1UTDA 1GYUA 1FYTD 2VLRB 4L1SA 3MROA 2YXVA 2V3EA 3OAYH 3I84A 4LLQB 4PV8B 4ODWA 1UT9A 7PAZA 3KPQB 5DD6A 1ITCA 1INQA 2AAVA 2K6ZA 2YD6A 3KPSE 4O02L 4PJDF 2GJZA 4M7ZB 5C3TA 1G7JA 3S36H 3MLSL 1FL6B 2GIXA 4JFXA 2M83A 4OVUA 5FXCH 3P11H 2IAAC 3DGGB 4RMVA 1OGAE 4NQEE 5LGJA 4A2FA 4HU8A 1V7NL 4JREC 4AKQA 4AEFA 3V5HA 4OJAA 2CWRA 5TF1L 1JPFA 2VDRH 3PP3H 1C8QA 3VFRA 2AQ1A 2WLNA 5ISZE 4N22A 2ZKMX 5IW3A 4NKOA 1NLBL 1KPUB 2BSED 2KC0A 1N26A 2PW1A 3EG9B 2H2PD 2BOBB 5CCKH 3H4FA 5L2KB 3GBDA 2CA4A 3CDCA 3UZQB 4K3GA 2VXQH 1H3TA 5C6PB 1PPIA 4ZAKB 5HDRA 4EDWH 4GW4B 2R29L 3GTVA 1QSEA 5H2BB 1OE2A 3QG6A 5DJ2B 4F37K 3HE7D 3ILPB 1CL7I 3QR0A 1WFMA 1NCCH 1PG7H 1VJSA 4WI7A 5DA0B 1ZJBA 4A6YL 1XGQB 4AMKL 4Z7OF 1DVSA 3H3KA 1J0KA 1D6VH 3WTWA 1KBPA 1G5GA 4KJYB 4KFMA 4PLJC 5KBDA 2NCEA 1UYWH 3B37A 2WTOA 4LMQE 2F7OA 2N4IA 2XICA 3DSFL 5FAAA 5B1JC 1E9OA 5AB1A 4K8RH 5D1QA 2AK4B 3MA9H 3J07A 4XC3H 2H26B 1HSBA 2KMWA 1BG1A 3NDYE 4JFEB 1YMHB 2OL3H 5MHSD 1ICTA 1OLLA 4ZFZA 4DUVA 4ZTOH 5CUSL 4NNXB 3SGJC 3VRJB 3A3YB 2J1WA 4BUHA 4Z3JA 2ZNWA 4BFEA 4JJOA 3KPOA 4NO2B 3HBQA 2D9CA 3IXAB 2WVVA 1CCZA 2G4EA 3MCKA 1Y1DA 4LSRH 2PO6C 1E4XH 3HG1A 2VDQH 1DVFA 1WLHA 4OCRH 3MLVL 1Z9NA 2GFBA 4ZBJA 5AVYB 2AZUA 3L1OH 3FQNB 3I85A 4J3OF 4WNQB 4WFGE 3O3BA 4NRZB 1TSRA 1KSRA 4PJBA 1C5BL 2X4QB 3WTTA 4GO6B 2EIZB 1XMEB 2H4EA 3HE7C 1NICA 2YMXL 3D39A 3Q9QA 4PJ9C 3DIFB 3HAEB 2WIMA 1I8LC 3RAJL 3LJ3A 1TSHA 4PJCE 4ZAKD 4YNYA 4S10A 2VSKB 2EYRA 4Y2DC 2PWGA 3GYRA 5IBLC 1D5BA 5JZ7C 4KI5C 3BUBA 4I3GA 4YC2B 5DO2C 1AQHA 3ZU8A 1HYSC 4LOUC 1U8IA 4X5QA 4Y16D 1YC7A 4LPUA 5AFAA 5EORL 5EU6D 3RA7H 1SBSH 5F1IB 1MFAL 4PJ8C 2XWBA 4XNBA 1MLBA 5I30L 1CBJA 4K23H 3JTBA 4RGOH 3QJXA 3I50H 3KYAA 4TPRH 2IPKB 3BWSA 5DQJA 1B9ZA 2ESVD 4YPGB 1NBYB 5A43C 4X8JB 5G4MA 2J4WH 4P23A 2XWXA 5FA3B 3CZNA 4WEBH 1LQSR 2AQRA 5CJBA 3H9SA 1ET8A 1F6AB 3WXWH 4Y19D 4NQVB 4RGOL 4FP8L 1ADQH 1FL3A 3KCPA 4DFIA 2GFBB 2CU9A 3ZLQC 2Q7NA 4D0BB 3LKQA 3BIBX 3NJVA 5T3ZD 4N0CC 3RI5F 2V9QA 4WIQA 2MCAA 2F68X 2FEJA 2QPFA 1FA4A 2DMHA 5DUBA 1JHLL 1Z9OA 5E8NB 5C6TH 1Z9SA 3RWFB 3IMWA 1GZPB 1EJ8A 5GZND 4BBWA 2Z6FA 4A7GA 4ELDA 3T3MB 1ODUA 4L3EA 1T7YA 3TF7C 1FDLH 2Y6TE 2F9BT 4LVOC 3GUTA 1RHHB 1HI6B 3V9CA 3V5KB 5KANG 4IRJD 5GZOC 3P77A 4JANB 4RFOL 1L0YA 4K73A 4X4ME 4UUJB 4YE0A 2VAJA 4JE0A 3CBKB 4PJBF 3D06A 3MRKB 1HOEA 4EOWH 4PP1C 5DT1H 5FYJE 1NOFA 4WHYH 2FJHB 3WL9A 4PRHA 5H37H 3APDA 1UA6H 4WUUB 4B9ZA 4U1KA 5DRZB 2KPNA 1R24B 1CFBA 1NOLA 1RUPL 5DJDA 1MFUA 1CR9L 4M6NH 4Q74A 1SN5A 1DEDA 3U2JA 5HHPA 5H35B 1OAQH 4JN1L 5JW3H 1W8NA 5SWQB 4IBVA 4JZJA 1NCOA 1S7WB 3KBEA 2PTVA 3CFBA 4K94H 4K15A 3KPRB 5CEYB 1KJVA 1MJ8H 4I77L 2A1WL 1J8HB 4C58B 1HDMA 1BLIA 2QZ5A 3P0VL 5KYYB 1MCOL 2K1MA 3WG7B 5K1NA 4YFLF 2GHZA 3L3KB 1NC4B 5B3NA 5MEOB 4LVEA 3ALPA 3EOAB 1E8WA 1OW0A 2RAMA 2G60L 1BYNA 3DSFH 1P9MA 2H5UA 3DPBA 4GRWB 1GGIL 1UJTA 3O2DL 3P9MB 4KRNA 4F33A 2HFEA 4PLOB 5EORH 3HW7A 1MJUH 2BY2A 3CCHB 5CIPB 3BP5B 4RETB 3MTXA 4F3FB 4FA6A 2PMZA 1RMFL 1JK8A 4ODHH 5I15L 4FXGB 2O5YL 4LSVH 2OS7A 2B1AL 4BZ2L 1R47A 4MMXA 4JZOA 1RPUA 3LKRB 1LEGB 2QEJA 1UC6A 3TNNA 4IOFD 3IS0X 4F2ME 3QJFA 1UD4A 4F3FA 5A2AA 4M4RB 1OARH 4M1GL 3JWNC 4XNXH 1XB8A 2PWEA 2EO9A 1BFVL 3CLEL 2NQDA 3SE9H 1NGWB 2AAAA 4Z78B 2VLRE 1QNIA 3JUYA 2ZUQC 2FCBA 3L2LA 4D9LH 2LAAA 5DWPA 1JZ5A 2FQFA 2V3FA 3QUZC 1SHXA 4AENB 3HS0B 1DJIA 3JXAA 5AOJA 1NANI 1QR1B 4IJTA 5KSVB 3ULVL 1E9QB 3GXUB 2QADC 3MXVH 4KKQA 4U3XA 4X9FA 3TIEA 1TQSA 4R3SA 2YRBA 2JELH 2X3CA 3CIAA 3P4MA 5D7IF 2Y0SA 2E59A 5ICXA 2BIIA 3L3KA 3VGHA 3KPRD 4H20L 3UG4A 3O45B 5B8CA 3H3PH 3P30H 1VZIA 2I7OA 3AS3A 5DA4A 4KQ0A 4WQOA 3HVDA 1NIAA 4C4KO 3D9AL 4MNQE 1U2YA 5DUMH 5IHLB 4V11A 1KIQA 3GT6A 1TCRB 2AJ3B 1Q1JL 4K3DH 4PJ9B 5BXFB 1NBZA 2HLFD 5EBLA 1JFHA 5ECJE 4GW1A 2VOTA 1ZLWK 2PYEE 1UB5B 2ID5A 3HMXH 1WA0X 4FOMA 4G7QB 5BRZA 2WLIA 2VDPL 1ZSDA 2ESVB 4Q6IA 5ID1A 2XKSA 1NCHA 4H26A 2CR0A 4LE8A 1UOLA 1AVAA 5EEXA 1UT1A 1WFNA 5T1LD 1D2OA 1S7QB 3TX4A 4J6RH 3DBSA 4MA1C 1RJZB 2BNQA 4PBWD 4E42A 1UM6L 3K8MA 2I9LB 3CVBA 4G8IA 4OH2A 3D05A 1WZLA 1NGPH 5AW4B 1A47A 3IGUA 4WEMB 3MLXL 3OX8A 2F54A 5IQ9B 1YEDA 4X4XB 1E9QA 3ZRSA 4L8CB 4GKSB 1HHHB 2XN9E 2YUZA 4ETYA 1T89C 1IGYB 5DJZA 3UBFA 2Z8SA 4ZXBD 1NFDA 5ESAB 4AG4H 4QMEA 2Z7WA 1TJGH 3QW9A 5DQDH 3FU6A 4JO3H 3D25A 1UATA 3U83A 5E8DL 4U1JA 3PWPB 2GIYA 3S35L 4AM0A 1N4XL 4UM8B 1XSOA 4OIAA 1U8KA 2DQIL 1N5YL 5BO1H 4LPVA 4H25A 2B2XH 4NM4L 4GRLA 1IVLA 3WV0A 5D7KD 4JPVH 1MXDA 3AGVA 4U1HA 2R56H 4HGWA 1A3RL 1SLUA 2DQGH 2RCSL 1EHLL 5DK2B 4AYID 5L88H 5LXVA 4QAWA 2BIMA 4FQLH 5BRZD 3BGMB 4U1SB 2B14A 3G04B 3UTSB 2HTLC 2Y24A 5JPMB 2FX8H 3QDJE 3QORC 2WUBH 2OP4H 3ESUF 2IADA 1R3LA 4M8UA 4NQXA 1U8QB 4OBSA 1JN6B 2VLKE 4BFFA 2YUWA 1KFAL 2WVTA 1X3DA 1A7PH 3H4HA 3FU3A 3FQXA 3HN3A 3K8LA 1RLWA 3Q2VA 4M6OL 3ARVA 4I48A 3AQYA 4JN2B 2YIHA 1NMBL 5I0YA 1U8PA 1YEEH 2WBWB 1IE5A 1MUJB 3U36A 3VRIB 3H56A 4PMFA 3U2IA 4WHYG 4Y1TA 3LKOB 3CVDA 1FCGA 5LCVA 5JOEA 1JZHA 4X80H 4FNRA 1DANU 1AJ7L 2P5WE 1BJ8A 1SN0A 3QGVA 4HIHB 3I75A 1I9IL 2C3VA 4Y9EA 1U91B 2YFNA 2QADB 3D25B 6FABL 4PJDE 4QYAA 1YNTA 3QDMA 3L3IB 4XNXL 3MV01 5D7JC 2EKSA 1IL1A 2XC8A 1XF3A 1DBML 4DN3L 1BYOA 4XOAA 5AW7B 4FZ8H 1VEPA 4OKVA 3INUL 1IVTA 1XDTT 2H6PA 5D71L 1DUZA 1XZ0B 3QXDA 3VXRD 2WKGA 1MFCL 5D4JA 5EB9A 3RPIA 2ETWA 4UQ9A 4JRXB 2VDKB 2WK2A 1T5KA 3QORD 3S3DB 5JHDD 3IJYB 1I7UA 4PWGA 1HWWA 4IRZA 4UT9H 3NDZE 4JQIH 4X7DC 5CBEA 3ULSB 1QLEH 3DURA 4PJHF 3ESNA 2X0WA 1DJSA 4Z5RB 2OX5A 1TZIA 2V2XA 4HH9B 3MBEB 4Q9RL 4J12A 1A3ZA 3NFNB 4MXQD 5CEZH 1PYWA 1BOGA 4M5YL 4IQHA 5D7LD 4ZYKB 2R1WB 1KIPB 2MTAA 4KROC 4MAYC 3K2UH 1I1FA 5FDWB 5GGRY 3EHBC 4UBDC 2V2WB 4LGPB 4QF1A 4ZW7A 4ODTH 1K4CA 3QWOB 2GABA 3ZBMA 2IDUA 4FLRA 3O2WH 4OJYA 3MN8A 3JV5A 1XX9C 2WJ5A 4ZOAA 1I8IA 2H1PH 2Y5TB 4MDIB 1GPOL 4PHZA 5TH2A 2CO7B 2VR8A 5KSAC 4NO5A 1NKRA 5CCGE 4RZKA 5LNEA 2FH8A 3BUQA 4K4KA 3X13A 3VNYA 1IZKA 2DJ4A 2VDKH 4LLMB 4V1DE 2PCPB 2BS8A 4Z7NB 4GNKB 4XNUL 5LNDA 4KI5F 5T5FA 5F70A 1IZJA 1SXAA 5GGQH 3A67L 5AB9A 3QR1A 3ERXA 1TTFA 3C8HA 3OVUB 4C47A 1J8KA 4WI0B 3ZXAC 4HFWB 3GHBL 4L4VA 3QXWA 2JIXB 2VZ3A 1G7JB 4J28A 4ZSOB 3WHE1 2X6CA 1UCBH 3WDJA 3IVKA 3BRGC 4KRPD 3MMEB 2CO6B 5LVEA 4WAFA 1DCLA 1WFUA 1UACL 1UB6B 4XP4L 4EE2A 1BSIA 1NWPA 4MNHB 5KJRH 2G3XA 4P49A 5EA0L 1E7VA 3SBWA 2HKHH 5BJTA 4OLWL 3RJQB 5D9SA 3QWNA 1LP9F 3QXAB 3D4CA 3UAJA 3W2DL 4OFYA 2OZ4L 2RMNA 2VAAA 5BZZA 2KLTA 2L7EA 2VB5A 4NJAL 4PY8J 2LAGB 3ZKNC 4GAYA 3MAWA 4OJDH 4B9CA 1NKGA 3K91A 1A66A 2H0FA 4OZ4A 4XMLH 1INEH 1JMXA 4PI2A 2AKRA 4S1RH 5DEGA 1XGQA 3P2TA 2BY3A 3LXAA 1FPTL 3ABZA 4N0FA 2APFA 1ZGLM 3ENEA 5CO1A 5E6UB 4DKDC 5J06A 4JZNB 4L37A 4JFUA 3D48R 5D93C 1RK1B 3OAWA 4XNAA 3FQWA 2WCGA 4ODWB 3HC2A 2EC9T 3NJHA 1T4KB 1CTOA 1CIDA 2JFCA 5DC2A 1M1SA 2J56A 2VLLA 3QJHA 3QAQA 5F1KC 4HOMA 3P02A 3O6KL 1M7UA 3SKNB 2XWTA 1DJXA 5BZXA 1EVUA 1S9XA 4YLBA 2FVNA 4JDTL 3TBVA 4KKCC 3S4SG 1IJ9A 2DLFH 2D3VA 2OJEB 3U46A 3NJJA 5ICYB 25C8H 4HIJA 1ZT1A 2BOBA 4NZRH 1NGQH 2LLGA 1C1EH 1QHPA 3IXTB 1A65A 1JTTA 2WB7A 4HA1A 3S4SB 4WNQA 4L2YA 5MI0B 1CL7H 5CU9A 5TK2A 4XR8C 4FFWD 2YHGA 5CF3A 4XP9H 4X42A 5ACLA 3L3DB 4S0TD 4TLTA 2VZVA 3FK3A 1F90L 3VFSA 4PWJA 4X5WA 4M9OA 4OZ4B 4AJYV 5DGQA 3EUUA 1I1AB 3CFJA 1ONQB 4R90H 5E08H 5AEAA 4ZMTA 2V9UA 1QVOA 5DEGB 1F11B 2CDGB 3ISYA 3STLA 5F7DB 3AAZA 2AJZB 2EDTA 4XPTL 3L7EB 4PJ7E 5I9QC 1JGLH 3FB6A 43C9B 3SCMD 2ZJSL 4ZD3H 5IROD 4IHOB 5L9DL 2DWXA 3UO8B 1AXSA 3CN0A 4NQQA 4NX0A 3VXMA 1H5BB 3D39D 3MKGA 4HWBL 5CSZA 5SWZE 5FC9A 1W72H 1A1OB 2VXTH 4KXDA 4CGUB 4MFHA 2ED6A 2IALA 1QRNA 1W0YT 2XFGB 3DJSA 4MD0B 5BV7C 3VRJA 5CN3A 1P7KB 4ZFQA 1WC7B 5DQJB 3IJ9A 2XN2A 4OLXH 4I1RA 2DIJA 4UV7H 5E4AA 5KUMA 2D0FA 5D96B 5AENA 3VXSD 1R0AL 2AVGA 3UP6A 3H9SB 4G3YL 1UWFA 5DI8B 3NTCL 5DTFA 5HGHB 3LS5H 4HIJB 1RK0A 1AQDB 2FT7A 3MRQA 1H3WM 3IDNB 3MRFA 4XCYB 3SKOA 4Y9CA 3OMIB 1AQKH 2FRGP 3UZEA 3HLAA 1QO3B 4EDXB 4TVPE 2DF3A 3EFFA 2CE6A 2VN7A 3KVQA 1ZAGA 3QDGE 4TSBL 3D18A 3ZKSD 2FSDA 1M7XA 1SYSB 1Q9WB 3AWEA 2CIKA 1SXBA 4RWHA 1J1PL 3VU1A 1YJDL 4TQEH 1ZLEA 1EEYA 1ZS8B 3BP6B 3N55A 2NTFA 3G5XA 4HQQL 3X2QB 4HAFA 1D5BB 5FM4A 2QDWA 1QLFA 4U0RC 3PFUA 2Q8BH 1JDDA 2R0LH 4BWWA 4UB0H 4FFVC 4HK3N 1U8IB 2F6AA 1IAKA 1JTOA 4M6MH 2NY4D 5JHLA 2OULB 1CGUA 2BO0A 3MV8D 1NGZB 2DBLL 2CRMA 4KX9A 1TNMA 3RVWC 1BV8A 3F12A 2OP4L 2NUTA 3RIAK 5LB1A 2VSMB 1ID5I 1DQDL 4NFBA 1ORSB 3HLKA 1BMGA 2EH8H 4I13B 4R2GD 3MLYH 2WO2B 1AIFA 2BSEA 3HPJB 5F89B 5JPNC 5I6LA 4K71C 4GMSL 4WTWA 4NZRL 4G8EB 1HDMB 1VPOL 4E9VA 2WMPB 1LXMA 4WGWB 3F85A 1NCAL 2JKWA 3MRIB 3BPNB 4GS7B 3KCPB 3UBHA 1KPVB 4H8WH 4U1MA 4I1PA 3OJVC 1P2CA 3VCLA 4F9PC 3V5HB 5KZCD 1SVCP 5LQBL 3C5ZA 1IILE 1U3ZA 4AV4A 4FMFA 4XPHL 3TZVB 2YQBA 3VFOB 5I1IH 4ADGA 5ES4B 2ED7A 5CZKA 4QT5A 4QNPF 1X9RA 2ZWKA 3RWFA 1OCCB 4AW7A 3HRZC 3QRGL 4O51A 4L5FE 5I75C 3VI3B 3A4FA 5FYJU 1YMMA 2Z31D 4DCQA 2GW5A 4L9LC 3QIWD 1PDKB 2APVA 3CVHL 2VDKL 3QG6B 1A4AA 5DJ2A 1NAKL 4GYBA 5FCUH 3VW3H 3G5XB 2VJXA 5F6HI 3RGHA 1UWEH 3EGSB 3LQZB 1Y7VA 4A1RA 4PRAB 3GIZH 1WBXA 4LL1A 2BVYA 1Q38A 1PNDA 4YPJA 4AQ1C 5FECA 1W72A 2QPDB 1PY4A 5AVTB 3QHTC 4V1DB 4W9DC 2GIMA 1ZTXL 1HZKA 4JFEE 1G7MB 2BVQB 3C60C 2EEXA 1U33A 1PLGH 1ZOXA 5H35A 3C6SA 4KJWD 2AITA 2IAMD 4ZPTB 3D51A 3QFJE 1I7TB 1KB9J 2R4RL 3QULA 1D5IL 4TVPL 3RU8H 4K8RC 4F2MB 3ULUD 3FT0A 5IREA 2HKHL 3MRMA 1YMMD 2Z31A 1OHQA 1MKFA 1YDPA 1J8SA 5TQ0H 5DUML 4M1DH 1UFUA 3VTTA 3FUHA 1T0NB 3KJ6L 4X6FB 2YS4A 5ABDE 5C8JB 2W07B 1R5IA 4ZTPL 4U7MA 1BZEA 3BH8A 2P80A 2JB5L 3C9NB 1XXFC 1KXQE 3P54A 3ZHNA 3VYOA 4HUVB 1WFOA 2K8MA 5HGAA 1GZQB 2WQRA 4RAUB 4AG4L 5J89A 3RE0A 3TO4A 1E40A 1J0ZA 2EDDA 3WMSA 1J8HD 2XG5A 5I9QB 1HU8A 1XXDC 2DH3A 4BRVA 3SE4A 3MGTB 3I02B 2ADJA 3R06A 2P5ED 1AKPA 2YZ8A 3L4XA 4LVNB 3CFDA 4HUXB 1UXSB 3MRJA 2CHZA 4H26B 3A24A 3H9SD 3VW3L 3AT9A 5F0JB 1EZVX 3ZW3A 3GSWA 1IT9L 4G6JH 2YAQA 3FTVA 3UROR 1NGWA 4I85A 5C0GA 1A6VL 2BZDA 1ECYA 1SJVA 1FIGH 5DO2D 4H40A 4OJCA 4LXFA 3V0DA 3ZDXB 2IWGA 3F5WA 2ADFH 4U6XB 4NENB 4NIKB 5IFHL 2GG1A 2NNAB 5T1KB 3KD4A 4YEEA 4HKXA 4ZMNA 2DM7A 3GRWA 4Z7UE 5C08A 4Z0BL 5CGYD 1R0AH 4FKHA 4G1MA 5DJZB 4YSQA 3HCVB 3DYOA 2Y2YA 1UD2A 1EGJL 4JFYA 3RB5A 1OB0A 1JZ4A 2B9BA 2OTPA 3UEQA 3BISA 4FKKA 4H0IA 1PZ2A 4PGCB 2YUXA 4CU8A 1MCPH 4AC4A 2WO4A 1KYDA 4TUJA 1TZ8A 3RKDD 2KL6A 1DFXA 1K3IA 1Q9OA 1K3ZA 1WHPA 3C9NA 1MHEA 3ML8A 4P2AA 4AQEA 4MJ4A 4DZBA 3APNA 4GQZA 4L29A 3ZDXF 4B96A 4JPKH 4J3WA 5CFAA 1OSPL 3M46A 4CKQA 1ZLVK 1KLGA 1GJUA 4AT6B 2Y7QB 1O7DE 3II3A 4NKIL 4ZD3L 3CV5A 4EVNB 2K45A 3TO4C 4A7VA 3QJVB 4JHZA 5FKPB 1DVTA 1J48A 2CRYA 4S1RL 5D70L 4E9QA 1XEDA 3BXNA 5C0AA 3T2OA 5JTWA 3BVTA 3TVMD 2G5RA 5D2LF 4EZKA 2MRYA 4Z0XA 4K7FA 4JM2B 5C9JB 1IC7L 3GB7A 2R9HC 4M1GH 1TKWA 2OK0L 4JN2A 4OFDA 2C9PA 4NUGL 4GW5B 4IKLA 2FLBT 5HHPB 4X6CA 5D1XB 2KPWA 2OMVA 5DJCA 5AB0A 2EDXA 5EUOA 3IJEA 1Q8MA 1EWHA 4OT1L 4Y1AD 2BHYA 4BUQA 1S7WA 2DWYA 2HRPH 1ZHKB 2QR0B 4YDLB 3ZHFA 4WO4D 1IBFA 1L7TL 4JDTH 3ARDD 3L4UA 1CBVH 3NH7L 4NPKA 3C75A 1KCVL 4LKCA 4LPYA 1T0OA 3DJ9A 2RCSH 1FHNA 1KELL 1KB3A 4F8NA 3BUPA 4K2UH 2DQUL 3MHZA 4CC0A 4M61B 3NK4A 3ZMNA 5I75B 4NQDD 2NR6A 3HI6L 4WWPA 1T5WB 2WLLB 2GC4C 5A2LH 4JCWA 4XN2A 5AQ0A 3NIDF 5J6GA 3RPIB 3VXPB 3JWNG 3UACA 3V52L 4F93B 1EV2E 4RFNB 5IB5B 2FWSA 3ULSA 3D5OF 5CBEB 4QEGA 4LNVA 5I30H 2JK5A 2QQNL 2ZONA 1M05A 2MNJB 3ARSA 3R7RA 4HJ0C 3S36X 2ZT9C 5I73C 2EVIA 5DD0L 1PYWB 4B7LA 2IH1B 1G0DA 3PV6B 1UEMA 1G9NC 4OCNC 5C9JA 1AOZA 1NL0L 3M1CA 3PDOB 3BKJH 4WGKA 3DXAE 1P4BL 3N50A 5E6ZA 1F3DH 3CK0L 2FD6H 4HF5L 1F58L 4OUUA 4W68A 5K69A 3P73A 5KSBB 5CM1A 1NJ9A 3PQYE 3SHSA 4J8RA 1GY1A 1XF5B 2DYPB 4ANKA 4MWFB 4KK5C 4N28A 4LB8A 3NA9L 1S9KC 3D2UB 2B1AH 2YKKA 2X5PA 4F15B 1XBRA 5E5MA 4YUEL 1TQVA 4HUWA 2QQKL 2VUOA 1A14H 2H0JA 2K70A 1HQRB 1Y18A 1UCBL 3ZE2E 2A77L 3MLVH 3D34A 3RTQC 4ZMZA 3EJJX 2VZTA 2AABH 1Z0NA 4ZMWA 1I9JL 4N0UB 1XGYH 3FFCA 1QNZL 4HW6A 4PYHA 3D3VE 1XSJA 1EO5A 1Z6JT 2Q20A 3CUPA 3D9AH 4BSWA 5DS8A 2E7CA 1FO0B 3SY6A 3UTTA 3DTXA 4EUPA 4K0OA 1HHGB 1I7UB 3KWXA 1HHJB 4PJCA 4FABL 1LM8V 3L3OA 1IGFH 2EP6A 4K3HA 4TPRL 3LYRA 4YWGH 4H44C 2GJJA 3LRHA 2F15A 1LO4H 4K94L 1BF5A 3D39E 5SWZD 1ZSDB 2R2EB 2OFQA 2GT9A 2GSIB 1GPOH 3QWQB 3LRLA 4WF7A 1A7PL 1A64A 5HGDB 2PN5A 1KLUA 3NG5A 4XMLL 4BSVB 5IB4B 2OMUB 5KSUA 1GIGH 5CEXA 2BSTB 2JQZA 2QPUA 3LHPH 4Z7UF 1CK0H 4M5YH 4XX5A 1U2HA 1JGVH 4GT7A 4UU9A 5D7IB 4Q9RH 1IBZA 1TEYA 3IFPB 4IOSA 3DX7B 3SCMC 5BVJB 1KWKA 1JCVA 5AW3B 3GRBA 5JA8B 1XAKA 3FKUS 2CMRL 4IKNA 1VB9A 4KMLB 4A2MA 4UT6A 3BESR 4XH2B 2HUHA 4MJJA 1V8HA 5KJRL 2G5BA 4NC1E 3T71A 1QPPA 4ONFL 4E9LA 3O3EB 1RMFH 5KG9B 3NIGB 4AQ1A 3F7QA 1HAWA 1JPST 1AO7A 3VUAA 1QOKA 1DBMH 2VE6A 4DN3H 2XPGA 2YAEA 3NACL 5D2LA 3SDAA 3EZ8A 2VLLB 3ARFD 3NIFF 3PWPA 3QJHB 3ZK0A 3FHAA 2VLJE 3SYAA 4MJID 5C2UB 2BM3A 4DGIL 5E6SB 2YD1A 3QDJB 5HI3D 3EJYD 3X1NA 1HK6A 3U1QA 5IW6B 5K59F 1YYML 2C9XA 3HN5A 1QFUH 1CDCA 2DKUA 4I18B 2XXFA 2BVPB 1IEAB 1ZPLA 5I1CH 3DOSA 1OB1A 4K23L 4OZGF 3FC8A 4JG0L 4AYFB 4PCYA 2BDNH 1U2CA 4A7TA 3RA7L 1EO8H 1TEFA 1YY8A 3MYJA 3WTUA 4L18A 2HSIA 1C08A 2VW6A 1CLCA 3D50A 5BUAA 1SJHB 1B3JA 2B16A 1FHGA 4QRPB 3TPKA 3FCTB 2WUBL 3IFPA 4H8QA 5J1AA 3STLB 2F8XC 4DERA 3MRCA 3OKNA 2EAEA 2BP0B 3F01A 5DZNA 4CVZB 2DV6A 1J0IA 3BPCB 5KSAA 2QADD 3UG3A 4BZ2A 3AU0A 5TGBB 4E9WA 1I53A 4P2YA 3HC3L 3TWCH 5CGBA 2W91A 5CSZB 1BVKB 4WFHE 4GIPD 5D71H 3FN0L 5CZVH 3SDAB 1K9TA 1JD9A 2IBBA 5DFVC 3CDZA 4AYDC 3N42F 4JPIA 1XR9A 2VM3A 1XF3B 1AZVA 4OFIA 5MEND 5JHDB 4QRTA 3T0DA 3ETTA 3SDDC 4BXSV 1I9IH 1LHZA 3ARED 3N1FC 4HCRH 4B9JA 4M3JA 4K5OA 2WYTA 2Y36L 5DURD 1VACA 5L2KD 1H8NA 3ULUF 2PW1B 3EG9A 1LO3L 4PV9B 1QSFA 4C4UA 3EDFA 4X9IA 3GSRB 5HYFA 4L5FH 4NUQA 4EDXA 1I85C 5H2BA 4YL9A 4KVPA 3RFZA 1P1VA 2B1HH 2JKNA 2V33A 2ZD0A 4XCCL 1M2VB 4MLIA 2NX5A 4FG6D 2L3BA 4W81A 4ZSOE 4KGLA 4MNQD 1ZHNB 2Z7YA 4PD4K 4PRIB 5I8CB 4B3VA 2JQAA 5CGTA 2ORBL 3MUZ1 2A9NL 1EJFA 4MMYB 5FV1L 5HHVH 1UM5H 3KYNB 5E9NA 3EH2A 2OKMA 4L4VE 4X83A 4UAOC 1IC5H 1F4AA 3VFWA 1NAMA 4ADJA 2CGYA 3UOAB 1HSBB 3WHXB 3TEZA 15C8L 2FK9A 3C5XA 3GO1H 2V5MA 5DRNA 4C83A 1P1ZB 2FWUA 5C0EA 2F5BH 1MQ8A 5JXED 1DQLL 4L8SC 4YHOH 1YEWA 2OMZB 1LNUA 3P3TA 4UIKH 3VSUA 2YMOA 4BCXA 1PY0A 2YARA 5I19H 3ULUH 4H8HA 3CXDH 4N3UA 4JFHE 2AQSA 3IXAA 3MV9D 4IIQC 3WN6A 1CFNB 3JVFC 3ZDZE 1WCBB 4XMVA 2NY6C 5E2UL 4G8GE 4AVIA 4G59C 4TNVF 8FABB 1O0VA 1ZHBB 4QXTB 2DKSA 1Z9LA 4GLRI 2WXJA 1SY6A 2PW2A 2X4TB 2WTRB 3EOBB 1LO0L 3KJ4C 4BFGA 4MX7B 2EIZA 3HBPA 1X5JA 2GI7A 4IEFB 5ANHA 4IBZA 1DQLH 1X5XA 3P69A 2HT4C 3TBSB 2ZIDA 4LDCA 3QJQB 5GS2D 3FQRA 1CC3A 3RZCC 3ARFB 1UM6H 1CFQA 1CJYA 1MCNA 1CGYA 2ODIA 4RMTA 3PL6B 1XF4A 3ILQC 1FDLL 1FBIL 4UQBA 3V6ZB 4HKZB 3O41A 4BZ2H 2WQAA 2YD5A 3KWWA 2WBJC 4P2RA 4JL1A 1CK0L 2O6FA 1IKFH 4H8WC 1P7QB 3MUJA 3O8XB 3HB3B 4ODHL 3NSYA 4PJFF 4OW6A 2XX1A 2FSEA 1D9KC 5JDJA 1WZ1L 3OB8A 4DH2A 5LN4A 1A7QL 2D9QB 1RULH 2HXAA 12E8H 3C6LB 1CO1A 5KAQG 4ANUA 3FDWA 4MA7L 2BDNL 3CFUA 3EGDA 4KVNH 5T3XE 5I1GH 5JMRA 1AACA 1Q1JH 3BZ5A 4K3DL 4LLQA 4PV8A 1JDAA 3LHAA 4TOYL 5FKAB 3U1PA 4TTGA 2CDEA 4QY8B 1I8KA 3P3UA 5DMGD 4GFTB 5AVUB 2GCYA 5F7BA 4MXVF 2WNWA 5GHWH 4E0RA 4QAMB 4QRPD 5IJKA 2BNRA 3EOTH 1L9OA 1RH8A 3MRMB 4G9DB 3ZE1E 3BPLB 5AAPA 2HPOA 1ZHBA 3B5HA 2G2RA 4TOYH 2PO6A 5AW6B 2C3WA 5B3JE 3OC8A 1I9JH 4GKZA 3HNSL 3N85L 3KXFB 4BINA 4PJ8D 4V2CB 1IGTA 1AD9A 4FCAA 1UWXH 4LCUB 3VI3A 5CZVL 1Z5LA 1IGCH 2AF2A 1BXXA 4IDJL 1SOXA 3MUUA 3OR7B 3PIQA 4KK6D 2HWZL 4F8LA 1LD9A 3WKQA 2CKNA 1N19A 1OAYH 4CAGA 2F74B 3KWWB 1LJMA 1TQCC 3CH8A 4G80A 2CIIA 4LCWA 5C08E 4LF3A 2NW3A 4TN9A 3FB6B 4ETQB 1BZOA 3A23A 5I26A 2X42A 1TJXA 1FNGA 2FGZA 2BSRB 3MRKA 4OCWL 4KVCH 3A4EA 1ASQA 2Z0UA 1MXGA 2NW2A 3FW6A 4IRJA 4LPXA 5FO7A 2MKLC 1KB9K 1R24A 6CGTA 4XMTA 5IBTH 1CE6B 1ZA3A 1Y0LA 2WAHA 2XKNB 1TEGA 4X7SH 3KYMB 1UT2A 5FO2A 3DMMD 3VXUE 1YMHA 1H3PH 3QHFH 2EDLA 3KS0H 4JJ5A 2UXVA 4L23A 5HSFA 5I1CL 2FO1A 3UJJL 3IU4H 1SEBA 3N6YA 4ZUTA 3LN4A 3W0WD 4XCNB 5EU3B 5I0ZA 3HUJA 1TT6A 4P23D 1F4YL 1RSFA 5HGHA 3PJLA 4YSTA 1B88A 5LBSL 4D0DB 4PWFA 3GLAA 5E6IB 5HGAB 2J8HA 1EEQA 4HJSA 4QKXB 4JL2A 2DIBA 2FJFA 3NACH 3OWEA 4Z7OB 4YK4B 3G5YA 3M7OA 5HHQB 5JMOC 4FQQB 3EYFA 5L7XH 3L7FB 4XVTL 1L7TH 2C1PA 2DWTA 4QTIH 3RIFK 1R3KA 2VDNH 1KV3A 2WZ6A 2C4FU 3APCA 4JKPL 4S2SB 5F88B 2EVHA 3FOMA 1PL3A 3MODH 4UQ2B 4YR6A 2PYEA 3ZKXC 4CW1A 1LMIA 1PG7X 1WA1X 2R69A 5GZNA 4G80B 1OP5K 4NXKA 3F6IA 4MZ3A 5FGBA 4IBWA 1A21A 2W8CA 3NJIA 4X7FC 5HVHC 2WBJB 1JGVL 2YMXH 1EK3A 1J1XH 1RFDH 2GTQA 5FYLL 2W0FB 2KLSA 1DLHA 2WXMA 3O4LE 3PP4L 4LCCA 4Y16A 4YDVB 4LQFL 3PXLA 5MHSE 4P06A 3Q01A 4OI7A 4IRJB 1ZRUA 3RVUC 3ZDYB 2YXFA 3IKCA 4UANA 2MFNA 4DP1X 3A4AA 1JGEB 3KPSB 3OJ2C 2Y36H 4KPHH 1CMOA 1E4XL 1ZE3H 5C0AD 2CKBL 1RIVL 5T1LB 3QQXA 3QZWA 4OF0A 5DD1L 1XTLA 3GS0A 5K33A 2GBAA 2OYMA 2GB2A 3MUGA 3OKDA 3WO3B 3N91A 4HX1A 1TZHB 1JPEA 3MQIA 1SMDA 1TNNA 2FIKB 4UNIA 4LVHB 3K2KA 3P4MB 4ZTOL 5HVFB 1P7QD 1R3JA 3O8XD 3UJJH 4F7CA 1RJLA 1YMME 3KDPB 4MCYA 4LSUL 2OTUA 2O5ZH 3L95A 5C0NC 3V0EA 1QNZH 1MWAH 4PJGA 1O75A 2BNUA 3KGUA 4WHDA 2N7BA 4KVNL 1ZVSB 4G9FA 1KCSL 4NQCD 2WWMC 1DSFH 2J12B 2J25A 3VXOB 3WIFA 2WLIB 4WNSA 1L0XA 1NPUA 2ORBH 4FI7A 2QQKH 2X4RA 5MEPA 4KFZC 1LP9E 3E7JA 2FX7L 4NOFA 4IRZH 2VT0A 5I17A 2W95A 3T1WA 4LT7A 4WEEA 1QI3A 1VIWA 4JO5A 2K4AA 3KLQA 2EIMB 2W0FA 4LCCB 4Y16B 5ADPL 1WWCA 2K7PA 2GJ6D 1J10A 4L5FL 5EIVA 4Y4FD 2H8PA 2NQ3A 1JGUH 2HVKB 3OZ9L 4WW2A 5DRZA 5D55A 3Q13A 1HJCA 2ZOTA 4NYLA 2A9AA 4Y1AB 2PWDA 1KYAA 5E4IA 2EZ0C 2FWOB 5LAXB 3QUZA 1SDYA 1J8HA 3H9HB 3BD4A 4I5BA 4BGLA 4HUWB 3DXAB 2BIPA 4ZODA 3CBJB 1MCKA 3RTQA 2KH2B 4KDTC 3BHBA 2Y2WA 5F3HA 5FWRA 3KLHC 1MCCA 2CGRH 3IDGB 5JYMA 3LPOA 2CJ3A 3QR2A 5TE6H 1MWAB 2QZQA 4X6FA 2YKLL 3HR5A 3S96A 1U6AH 4OJFH 3TA3A 1NDMB 1PTZA 4S1DD 4ONFH 5C0CE 4DQOH 3VG0H 4K8RL 1EAPB 3IN0A 1JWSA 4MB1A 4J6IA 3ROOB 1B6UA 1GZQA 4RAUA 2CXKA 4Q6YA 3PPEA 3MBWA 4NBXB 3KZ8A 1SYVB 1WAPA 1E5CA 1NBVL 3IDXH 1WF5A 4LP5A 2BSSB 4DVRL 5D5MF 1E4WH 1OEZW 3MGTA 1YYLL 4TTDC 2FBRA 1PX3A 2CO2A 3AABA 2ZCKL 5TPWH 2X2YA 5CEZD 2E9GA 5CILL 5B39B 5M94B 5BZDA 1Q94B 1TYJA 5HY9A 1YO4A 4FQ2L 2R0WL 2HN7A 4PRPD 1HYSD 4U05A 2NZ9C 4HZAA 1T66D 3T0EE 4TQIA 5IG7B 3NEEA 4RAVB 5D6DC 4TVPD 4FNQA 2AI0L 4LDLB 3FPXA 1G5AA 4DP0X 3O4LD 2Z35B 2MQ0A 3M7FB 4NZUH 1NDGA 1J1OL 3OGCA 1KCRL 1DE4A 4OCYL 2ATPB 3ARDC 4XHQA 1EAOA 5KG9A 1SDDA 1NGXB 1NLDH 1XEUA 1ML0A 3WJJA 2ZYHA 5B4MC 2VE6B 4FQCH 4KMQA 1OTTD 4WI5A 4OZHE 4B27A 3QDMD 1GGTA 4JFDD 3EHBD 5DJAA 5JOPE 4O02H 3BEWB 4R96B 1JYVA 4QXGL 3F05A 2ZX6A 1SQ2N 1HHGA 2J73A 4CMMB 3N1QC 2QVKA 2BXYA 5EPMA 4GEJA 2O30A 3QAZC 2JCCA 1AD0A 3RY6A 1MAJA 3ULAB 4M8VA 5F7FA 1K5NA 2CMRH 3DUUB 4KRLB 4CSPA 4N8PA 4F9LA 5HDQL 3P9WB 1J5CA 1IJNA 4DN4H 4LRNH 5TE7H 1F58H 2A9NH 5DD5H 1BQLH 3LDBB 1TUPA 1D7BA 1DZ0A 4KO9A 4DK6A 4HIQA 1UZ8B 3BKJL 1HH6A 1R6VA 1GOGA 5IW1B 3JWDC 3VFPA 1XVSA 5F6IB 5I1JH 4JM2A 1FYTB 4IS6A 4P5SA 2V2WA 2KS0A 5HY9B 1FIGL 3HG1E 4AOFA 4YDJB 1M3IA 1CLVA 4APXB 5ITBL 1TDQA 5KBKA 3QIUD 4DO6A 5L4FA 3U9WA 4QLRA 3V0AC 4X50A 2WNKA 4MDJA 3IMSA 5E9DE 4X6CB 4PTTB 5D1XA 3FO0L 3NCBB 1UOKA 5HHOA 1MAKA 2QR0A 1QFUL 1S78D 4OF5A 3WY1A 2F1BA 4YFEA 3TV8A 1CN4A 3BP7B 5FHAL 4E41A 4MBOA 4OV5A 1NFDB 2MQCA 3C09B 5ID0A 1I7RB 2KZ1B 5IMOA 2OYKA 4UTBA 4NQDB 1F0LA 2NY5L 5FW6A 5I1KH 3AXLB 2OCFD 1FFNA 1QEWB 2HJKA 1IMHC 1RIUH 3OB0H 4HFWA 4OFYD 3RX8A 1U93B 3K5RA 1M7DB 5KSBE 3ROLB 4M5SA 3R7QA 4FTVB 4JHWH 2Y25A 2EEDA 4L3CB 3SE4C 5LHDA 1ILSA 2XZAL 1S5IL 3GS4A 3HC3H 3TWCL 4IU2A 1OSYA 3ZZLA 1E90A 4LOVA 1DN0A 4I88A 5J12B 2P46B 1IARB 3BUTA 4AYFA 4B9GA 4TNEA 1QBBA 1BYPA 3FMGL 1O9ZA 4H1LH 3FU5A 2Q76A 3E2HB 4Q2ZB 4ZUWB 3LKSA 1BVNT 5DVMA 3OKMB 3QORB 5I74C 2QTEA 3FXIC 4F5CE 1FFOA 3BZEA 3TYGH 2QJDA 2GVYA 5DLML 2NY0C 4LLUB 2FUTA 3FCTA 3LEXA 3UIZA 1M1XA 3DX6B 4XMKH 1A6ZB 2DDQL 3B7RL 3W9DB 3HS0C 3LQAL 3LS4H 3WY4A 4WFFD 1VGEL 1FVCB 2DMCA 2E7MA 2G75B 4J8RB 5SX5K 4HWEL 2DZEA 4PVMA 1ETZB 4GG6A 5E8EA 4YSUA 3B9AA 1J1PH 4NS0A 4AVHA 3AMLA 3MNWA 5KANI 4FTVE 4HEME 4WNJA 4HMDA 2LR4A 3L5XL 4GAJL 3P4OA 3VFWB 3KVDD 4JY6B 1PZAA 1CGXA 4WLCA 3EJPA 4IW4C 4QXWA 3WJMB 4PJDB 4DGIH 2BVOB 3SDCD 4KUZL 2X4SA 4MQ7B 1RP8A 5D7LA 1ILUA 2FJUB 1B2WL 5D96C 1JV2A 3NTCH 4N2BA 4PY8I 3ROLA 5ISZB 1CFNA 1OXYA 1SHWA 5DS8B 1I8AA 3NCYS 1LYQA 3RB7A 2LFGA 3LN9A 4Z77A 4HS6B 3F7KA 1LGVA 2E7HA 2XNAA 4TKWA 1XFPA 3UDWC 4ODVL 4ELMF 5INCA 4X6DB 3IAQA 1UH3A 3QAZB 5I18H 3TJEL 3QWRA 3ETBF 2QMKA 1CXLA 3B2XA 1JF5A 2DTSA 3PJNA 2R2EA 3QZPA 1D7DA 1MRCL 2XQYG 3D07A 3NFNA 1FUNA 2HA1A 5FFGA 5FO9A 3LV3A 3PWNA 3SOTA 5ABZA 1W72L 5KVGE 3T6QC 3WD5L 1MRFL 5I76A 3FN3A 5HGDA 1MCSA 1KMGA 4LBEB 3RVTD 2XZCH 3TP4A 5H37A 3FO9A 4ZMQA 3G6JE 4MNQB 3A47A 4HUCA 2D3NA 5E8OA 5FUCC 1HXYA 2VR4A 1JNHA 1FVCA 1XL6A 4EAEA 4NO5B 2A6DB 5C71A 4NKIH 4G7VH 3QEQB 4FQIL 3BUYB 1ZWIB 1YQVL 4FQXA 1H5BA 1KPRA 1OAXL 3K0YA 2CZNA 5ERWB 2VKWA 1MRFH 4MD0A 3AM8C 4K94C 2CJSA 2NYZA 1DLFL 1MCPL 3H7LA 1TTGA 1HEJC 2X4SB 2JJTC 4M4PA 3RDTC 5AKTA 5J3HC 1KCLA 4IK7A 2C7FA 1CGSH 1BBJB 2K9FB 5F6HJ 1FL5A 5LDSA 2CO6A 3JQOB 4PM1A 4PR5B 5DI8A 1IGML 5DTFB 5GGRB 3RFRA 1E6JH 3QPXL 4ORGA 5C86A 2MHAA 3CPUA 3VFMB 4WRLA 1EH9A 4P99A 4OGXH 5GS0D 3VGFA 3HZKB 3KL3A 3QEGL 1TZAA 3SDDA 3EJSA 5C09B 4AZ8B 3DVNB 4JKNA 1TLKA 1QWHA 1KPUA 3ZDYF 3WLWC 4JJHA 4M8QA 5GGSA 4RQQA 4DP8X 1LK3H 4XCYA 3SKOB 5HYJA 1IC0A 4GAJH 1OM3H 3DBXA 1MCRA 3ECBA 3LPPA 4QPEA 4OLYL 4XHJD 4TVSa 5I74B 3NN8A 3O41B 4I89A 4DT2A 4OD2A 4HCRA 5EO1B 4NWUH 4BQ8A 2A83B 5DD0H 3TJHC 2BP0A 1NMAL 3L13A 3GXFA 4G7YH 1ZWIA 4FFYH 4FQXB 4KJYA 3LMJH 3C5JA 1OLZA 3FB7B 1PBYA 4KKBC 1GHFL 4DIXA 4PU2A 4ZO7A 1LK2A 1RIHL 3FCGA 4G6AD 1XGZA 2OR9H 2XXGA 4P57B 3E1F1 2NUTB 3RL1B 3EFDH 4ALAC 1MRCH 3DETD 2YSSA 5D7KE 4E5XG 3VWJC 1NEZA 2WMPA 5D1QC 3ZT6A 4Q9BA 4XBPA 3K6FA 3VXTA 2NY1D 3HC4L 1AC0A 1MW1A 1TQTA 2N1TE 1IM3B 1QD0A 1RUAL 3VFNA 1CQYA 4Y8AA 5IROC 1JIBA 1N0LB 2Y6SC 3MLYL 1OCZB 2W9LA 3KLHD 5HDWA 3VTAA 1P2CB 3VCLB 3LKPA 2PCYA 1Q9KB 4UOZA 1RZKH 4MD4A 3OBAA 1HN1A 4GINA 1E4HA 5JUEL 3S3PA 3A67H 3FQ2A 2WN3A 1PDKA 3VXRB 3VDBA 1W6LA 4J3VA 1I1YA 5GQBA 1WITA 2Q86A 4ICXA 3SKMB 1E4KC 2J8UF 4QOKB 4F27A 2QKIB 5FGBC 1BJMA 1I1AC 1SXZA 1T7VA 4L3EB 5EO1A 3ZGIA 4HWEH 5IZ7A 3AQXA 5LWYL 5FECB 3SJVA 4LZKA 2V5TA 2UWEF 4PP2A 4JRYE 3WFEL 3HI5H 2ZKHL 4XAKE 2BVQA 2Q2LA 1PY9A 3IF1A 3EYOB 2WM0A 4P2QE 3T0WA 1AXSB 4PJGF 1WBYB 1LLAA 1E4JA 1FFTB 4HIIB 2X1OA 3FFDA 4F37F 3FQ4A 3MBXL 1W0WB 2GK2A 4U1NB 4R4FH 3KMDA 3BP4A 2FX8L 3OHXC 3RY4A 3W2DH 4EBQL 1RZPA 3AG3B 1VADA 3LZNA 3QQ3A 2A6KA 1CFTB 4O4YH 4FQPA 4F2MA 3GZQA 3VXTB 2C8NA 4W6XB 4OBRA 4NQVA 2J20A 2XQ0A 5F93C 2EICA 4POZD 3DUSB 4BWTA 4Z7OE 1U42A 3F7YB 1E0OB 4JG5A 3TFKC 3S35H 1EBAA 4ZO6A 4MD4B 4B97A 3VFRB 3G5YB 4LO9A 4JDVA 4DGYL 1GHFH 3QG7H 2NY5H 5E4EB 3RKDC 2F8IA 2F0CA 1OL0A 3K81A 1H6UA 5IOPA 3EXJA 4NNPH 4FJZA 3ABKB 1CFVL 3LKNA 4G7YL 4IKJA 5ITFB 1ACXA 3FQRB 4TL5A 1P84J 5D5ME 2WVSA 4QHPA 1UXSA 3MRJB 2FWLB 2YA0A 5FW7A 4KDWA 4N4YB 5BVPH 7CGTA 1NGPL 2OLDA 5LWYH 1HI6A 4WWOA 1AG0A 3SGDH 1RVFL 3DVFA 4KQ4L 5C7ZA 2MCG1 1PLBA 2GSMB 5A1AA 4EIGB 4JVWA 4YXLL 4BFRA 2BNRD 3MKKA 4NQSB 3ZL1A 3MX0B 4URTB 2WXOA 3GI8H 4NENA 1DVFD 1KFAH 5I8KL 4WUUA 3FRUB 4GUPB 4W93A 3IMBA 1GXEA 2XRAH 2DIAA 1YCSA 4U1NA 5HYIA 2WWKO 1RZKL 2CM5A 4OKDA 2AMGA 3E3QE 5F3FA 3KPPA 3S98A 2VDPH 1VADB 4F5CA 2KZBA 1KJVB 1AGFA 3VH8B 2NDGA 5FM5O 1KTCA 4XB7A 2CCLA 1HH9A 2JB6B 3G5VA 4LLDA 5IJDC 2DPKA 4HKXB 4JQIL 3UAFA 3AFLA 4JFYB 4OZFA 2QL1A 4YHNB 2DQGL 3HS9A 3MRIA 4L3EE 4PMEA 3WELA 3D1MC 2ALAA 3PE9A 2QLYA 4NUPA 1BVNP 1VZHA 2DLHA 1OPGL 4AQEB 3ML9A 2F53E 3GNMH 1KJMB 1YA5A 2DQJL 1A6WH 1CG9B 2CUHA 1IGJA 3NJLA 4TNVK 5HHME 3T3ME 4F20A 5EBLB 3CMOL 4I3RL 2ZF9A 4FXGC 2VLMD 4O58L 4W9FC 3OR7A 2ZUYA 1F45A 1B0GB 2X0VA 3S8WA 2Q8BL 5GZNC 1DQMH 2ESVA 2RD0A 1U8OA 1R46A 3GWJA 4HG4J 4PRAA 3UGXA 3GB7B 3TA3D 1BFVH 3CLEH 2OXHB 5FF6B 4ETQA 5DXWA 2IVFC 4JVUA 5JW5A 1TJIL 3BH9A 2Y7MA 3JTSA 4H2CA 4N9GB 4Y1AE 4ZOCA 1FNGB 2X6VA 2EE6A 1FFPB 2W80C 4FZEH 3QSKB 4UTBH 1B4JH 4XNMB 2UY6B 4I2XA 4PVLA 5KAQF 3EH1A 5CD5D 2O5YH 4A63A 3GGWA 4XP4H 2QVIA 4ZUUA 2JB6A 2WAQA 2Z35A 1GMEA 1ODAA 3FSVA 4MA8H 4RSYA 3MRHA 3GSXB 1GAFL 1CI5A 1IGMH 5EIIG 2FUQA 4FLSA 1H8SA 4J8QA 4W1TA 5EU3A 4XN5A 5KVFL 3CZFB 3MJ9H 3NCJL 4NHUB 3UYPA 4YHPB 3TVMB 3BH8B 4DPRA 4J23A 1N5YH 3BEWA 4R96A 4Z3EA 4PJBE 5D2NE 1HVXA 4KKLC 4K3JH 1OF2B 4FEMA 4MDRA 3R19A 4JO3L 4LESA 4KBPA 4UI2A 5LCVL 2IOIA 1OP5H 2V7NA 2HKFL 2DBLH 1OALA 1OCRB 2C1PB 4XMPL 5J6GB 3FTGA 3FO2B 2MH4A 1GW0A 1RLBA 4XPTH 2IH1A 2ZUVA 3K7UA 3EDDA 3Q5TA 1RZIA 1AZNA 2X70B 2AMUA 5DC0A 4OLVH 2FDBP 4P46C 4QNPE 1K2DB 1HCZA 4LOFA 4HFUL 4QIRA 2QBWA 3P77B 4IS6B 4JANA 4AY0A 5B7FA 1FYHB 4TUOA 1MRDL 1NJ9B 2YUVA 3GBEA 5D1QE 3B9EA 4JDZB 4F91B 3VFUA 2UV3A 1AZBA 3JYBA 3FMGH 4ICWA 3B2VH 4AGMA 4X9YA 2R8SH 4AQAB 4DKFL 1C1EL 3MJGX 2ZUSA 1B9KA 1NGQL 4EIUA 4J1UA 2E7LC 4PLNC 2HG5A 1E30A 1NMCC 1PD6A 4HLJA 2WKLA 5AZEL 4ATWA 3BAIA 3UTTD 3TT1L 4AV5A 3O9WB 2LABA 2OMNA 5D1ZA 2KKQA 1FNHA 3BP7A 1P0SE 3I2CH 4E41B 1COBA 2IBZY 3VFTB 4BA8A 3V4PB 1HQRA 1KCSH 2X1PA 2WB1A 3CX5K 1KULA 1TF4A 1QSEE 4HKJA 3BN9C 5CINH 3O6KH 1KF9B 3BUDA 2BWDA 4QRPE 1MFBH 2LVEA 4H25B 1EVTC 5GJSH 3W9EB 1M71A 1SXNA 4AW4A 2BNUB 3CUPB 1VFAB 4FI6A 2XV3A 3TJPA 2P8LA 5HHNA 3ZMRA 2HLEB 1AS7A 4H20H 4HWBH 4WKXA 3VQLA 3QQDB 5BQ7B 4AT6A 2O5XL 2FL5A 3UTSA 3NRQA 3D08A 2X4RB 1K72A 5FIEA 4FQIH 1BX2A 4J3XA 3APMA 1H6FA 1YN6B 5IJCC 1BXUA 3MLZL 2BSCA 3MBEA 1JN6A 4K5PA 2EJ1A 2BSTA 1QA9B 1CT8B 1MCEA 2CLRB 2WLJA 4N2LA 4PBVC 5FK9B 5C0IB 4K7FB 4NCDA 1I1FB 5JA9A 3FFOA 4PG9B 3KWUA 4KZDH 2ED9A 5K9JH 2XZCL 4FMVA 3UP1A 3VFUB 4KKAC 4XXWC 1TKWB 3QIWB 2HKAA 1BQLL 4W9JC 2DM2A 1T66C 1EANA 5D6DA 1J11A 1SMOA 4WHTB 4EN3B 5J8OA 5D1ZD 3F3HA 3RAJH 1E27B 2WY3B 1Q1PA 1XMWA 2AZAA 3CFQA 1N5AB 2Y7OA 3OSKA 4N1HB 4S1SH 4DGWC 4DPBX 25C8L 3DIDA 4OZHF 3G7TA 1KBVA 3S7GA 1U91A 4NQDA 5DJ0B 2DLFL 1T04B 2HVJA 2XETA 2XPGB 3B7UX 5FYJD 3WIAA 2R7EA 2BH0A 4N68A 4A55A 4M6AA 1S7TB 5FUCE 3GHBH 2Y07L 3ZDWA 2QVFB 2LT9A 2APWA 2V4LA 4LL9A 3TESA 3NSFA 2VW7A 4MJ2A 4GQPH 4HKBA 1MJJB 3X1FA 3U7YL 4Y0GA 1H8LA 3D85D 5BQ7A 4GW1B 2XNAB 3SE8H 3SQBB 2A9ML 5EOTA 4CBZA 2VLKB 1RU9H 4LVNC 3OKEA 3WY2A 3WEMA 5JIQA 1YEKH 1TZIB 4LPTA 3QNYB 4U1IA 3QCUH 4GQ9H 2EDRA 4NZDA 2A3TA 4PJAA 3MRBA 1S7XA 4M6NL 3BWUF 3OXSB 1CIUA 1M1XB 3DX6A 1WISA 3WEXA 1XIWD 4IU3B 3DHMA 1JERA 2N7SA 5FGCB 5L0QB 4JFVA 3L2NA 5ESQA 1YYLH 1B3IA 2EDBA 3E6HA 1XHHA 2GHWB 2Z4QA 3BPCA 4N2CA 2P5EB 1V54B 4TLSA 2OYLA 3TEXA 3KE0A 3UJTH 1QLRB 2R23B 3OKNB 1A02N 1RSYA 1FZMA 1AXTH 1WPCA 4N8UA 2VXQL 5I24A 5FB8B 4LMQI 2B0SH 3PPSA 1F6FB 1E5ZA 4JRYD 4ZX6A 1JI1A 4TYUA 1C5BH 1SDDB 4FQXD 5EBMA 4GG6E 3MNDA 3OAUH 1T4KA 2NY7L 2WYIA 2YKLH 1XH1A 2RHEA 4M7KL 1JZ7A 1IFHL 4FA7B 4YBLC 2N59A 4NT6B 2ZSVA 4HKBB 2J6WA 2MMXA 3KH3A 1KZYA 3DTXB 3NPSB 2UY7B 4MD5A 4EUPB 3CFMA 4Q6IC 3GFUA 4PV9A 4XNUH 4HC1H 1ORQB 3CQQA 2ZWLT 2GC7C 1MPAL 1K5NB 3KPLB 1OY3B 4KO6A 2CHWA 4F7TA 3NSXA 4X0KA 2WANA 2WXQA 4ZO9A 2GSIA 5F21B 3ARPA 1V7MH 2Y1VA 3IXTA 1MLCB 3ARFC 2IADB 4GRWF 1PX4A 3C8DA 3LRMA 3GRWL 1P5VA 1OAZH 4I9XA 4KROD 4HK0A 5HPMA 4R97C 1FYTA 3FH5A 1P4IH 1ZHNA 3GLEA 1RL1A 3KR3H 3FOLA 3A6OA 3FHQA 3VXMD 4ONOA 1EX0A 2ZOWA 1QVOB 3PDGA 4N0FB 2P5WA 3GXNA 1VFOA 4HGKC 4JFFB 4Y88A 4F15C 3KLLA 3B6SA 3FN9A 3QIWC 1G1YA 3IDJB 4ZAKC 1TQBC 5KOVC 4PTTA 4N8VG 3UADA 5I8CA 4DN4L 3DX4A 1MJUL 4NC2B 4A67A 4XCCH 3ESPA 4ELME 3PF2A 4BUGA 1AZCA 4JQVA 4NGHH 4RLDA 3UBXB 4RWYL 4FE9A 1T1XA 4AMWA 1EAJA 5L8KB 2XWEA 1MFCH 4KJPD 4MASA 4ZX5A 2NR6C 2GJZB 3BCDA 4LSUH 4IGBB 3W11D 4EZJA 4C56D 1AYRA 1YNTB 1LO3H 4WU7B 2QFRA 1AHWA 32C2A 4RZCB 4FXKB 1EHKB 2OMZA 3GBNL 3IJSB 3H9YA 2EEFA 2HPTA 4YL4A 2W0PA 4Z95H 5FR3A 4Y9BA 3QDJA 3IMVA 2NPLX 1ZD6A 3QJUB 3ULVH 5EU4A 4GRMA 1A3LH 2ADGA 4XP6H 3TPUA 3EYUH 5EULV 4IU2B 4FGMA 3WNKA 3QDGB 1S9YA 4FNPA 1Q9KA 5K5YA 3RNQB 1ZV2A 5LGYA 3D0VB 4YSDA 3O0RH 4NN6B 1BOGB 5DFVD 4GY4A 5ADPH 3NN8B 1U3HB 1KB5B 3OLEA 4IJ3B 3HJEA 3ZKND 1JMZA 3ASWA 4ESKA 4HJ1A 4DK3A 4QF1B 2NZ9D 3T2QA 1YRKA 2NNFA 3HB3D 4WI6A 5EC1A 2VO5A 4D0CA 2COQA 1QKZL 4QRPA 2J6EA 4M56A 3L5HA 4LCIL 3PS6A 4OZHA 4QRRB 3ZT5A 1WZKA 3IDJA 5HYQB 2PPFA 1UZ6E 4RA0C 5DHXB 4P2RB 1BZ7B 3AW5A 4A2DA 2ZYSA 1DSFL 4E9SA 4LEOB 4EDWL 1GMIA 5F7EH 3HR6A 5FKAA 2EO1A 3R4DA 3OKKB 5K9KA 3L08A 3X11A 2N3JA 1KFGA 1JPSL 1XB6A 1RZJL 4P2OA 2ZUTA 3SGJA 2MQ3A 2VLME 5D7LB 2I5YL 3KPOB 5T1MA 4FF9A 4E5XA 2FEDC 2VDRL 4MAZA 2UUDH 4PJ8B 2EABA 1M2OA 3GKWH 3MCKB 3GMNB 3HC0A 3QFJB 1IAOB 1UB6A 2FECL 5CGYC 1N10A 3MRRA 5LN8A 1X44A 1WIOA 4G2AA 1T03L 4NZFA 4Q14A 4TSAH 3WGVB 1Z1WA 2NY7H 4NC0B 5H4ZA 3ZVVA 5CJ5A 3OZ9H 4LKXB 1NCNA 2WLHA 2UXFA 3OXRA 4Q9QL 1II4E 2NY2C 2VMFA 1AR1B 3MRGA 4MXVE 3PQYD 3J7HA 2VRAA 2GQHA 2VXSH 3MNVB 4LAJH 3EH3B 3X17A 4H13C 1I9EA 3MACH 4YXHL 4YN3A