1NPJA

Crystal structure of h145a mutant of nitrite reductase from alcaligenes faecalis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWAVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reconstitution of the type-1 active site of the H145G/A variants of nitrite reductase by ligand insertion
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 89
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1npjA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1npjA02
4NB7A 4BWTA 2BZ7A 3GDCA 4A2DA 5IY5B 4DP5X 1SNRA 5B3SB 1OF0A 2CAKA 1EHKB 3UACA 4E9WA 4A2EA 2P80A 3FSAA 3OMAB 1OOWA 1J9TA 1AOZA 1L9QA 2UXFA 4BK5C 3ABLB 1IC0A 2JFCA 4NAJA 1URIA 1ET8A 4HALA 1HAUA 2IDQA 1AANA 3WIAA 3WNIA 2P80D 1PZCA 2GHZA 2WSDA 4CSZA 1A4CA 3GYRA 1SF3A 1PLAA 1E5YA 1AZCA 1ASOA 2HX8A 1TEGA 1AIZA 2AZAA 2FTAA 3NJIA 2HLEB 1KCBA 1ZV2A 3DKHA 3FQ1A 2VM3A 1ZDSA 4KNUA 2IDSA 3T71A 3ZBMA 4P5RA 3T6ZA 2CALA 1EZLA 2PPDA 5B7MA 2WO3B 3FU8A 3C75A 1NPNA 5PCYA 4F7KA 4HAKA 3ABMB 3OD3A 1AS7A 4E9SA 1PZAA 3FQ2A 2RACA 1KGYE 2R7EA 1AS6A 3PLYA 2YAHA 1JVOA 4GP5B 5B1JC 4YSEA 1NIDA 3IN0A 2XVBA 1V55B 3FS9A 1J9SA 2IH9A 3EF4A 4A2GA 3AW5A 1TEFA 2IAAC 2OJ1A 1AZNA 4HHGA 1KDJA 2YAQA 1PZBA 4FA7B 1NTDA 3TASA 2CBPA 4E9YA 2UX6A 3AG4B 4PAZA 8PAZA 2DV6A 4BWWA 2HRGA 1OE1A 2ZOOA 1AG6A 1RCYA 1ZIBA 1ILSA 1IBYA 2YAFA 1GS8A 5LDUA 4AX3A 1TU2A 1PY0A 2VSMB 2FNWA 4AI7A 4DPBX 2ZONA 4JKNA 3T6VA 5FC9A 4QLWA 3RYMA 4NERA 3FU7A 5TK2A 2IH8A 2BP0A 2IWKA 4ENZA 2CCWA 1WA2X 1IUZA 1AR1B 2FQFA 4BDVA 2OCCB 2CJ3A 2UXGA 4RH4A 4E9QA 2YARA 5I6LA 3NJLA 4YL4A 1ADWA 2MTAA 2XXGA 2ZXWB 5B1AB 4FAAB 2OV0A 1OCRB 3KW7A 3QJVB 5E9NA 4HCFA 2JKWA 1ASPA 1M56B 1MZYA 1KDIA 1CUOA 5I5JA 2XU9A 3CG8A 2HRHA 2AZUA 1PLCA 1SDDA 3T6WA 3DIVA 1JZJA 5I6NA 5I5IA 3HEIB 2FT6A 3ASNB 3QJQB 4K9JA 1KBVA 3ASOB 1WA1X 4A66A 3L45A 4CSPA 4G70B 1GSKA 1ZIAA 1J5DA 3X1NA 1GY1A 1GS6X 1RZQA 1CC3A 2VSKB 3X1GA 4DP2X 1L9OA 4DPCX 2FJSA 3OQRA 5B1BB 4AKPA 1WS8A 1PAZA 2J55A 3UGEA 3SBPA 1A65A 2HX7A 2PPAA 2GC7C 1IBZA 1XB3A 1NIFA 2XV3A 3FSZA 1UATA 3FYIB 5A7EA 4X4KA 2JXMA 2VW6A 2AVFA 4KNSA 3G5WA 3OM3B 3EHBB 3ZX1A 2EIJB 2EINB 3BVDB 2XX1A 3NSCA 1NZRA 4DP6X 3WKQA 1NWPA 4KO5A 5D4JA 3PAVA 1PCSA 4UANA 5AKRA 1FWXA 2NRDA 3UABA 1SJMA 2I85A 3FQYA 3QJSB 4AKQA 2TSAA 1DZ0A 1PF3A 2IWFA 3S8FB 1W6LA 2BP8A 1CYWA 4PCYA 4KO9A 2FWLB 3N2JA 2XYBA 1E65A 4DP1X 3NJKA 4HHWA 3SBQA 2QDVA 2BZCA 3V9EA 4F2FA 3AZUA 1DYZA 3QJTB 3V9CA 4HZ1A 4BWUA 4AKOA 2MRYA 7PCYA 2PCFA 2BW5A 1OV8A 1BEXA 2GI0A 1J5CA 1NDTA 4DP7X 4JHUA 2HZHA 3FT0A 4L0PB 3NP4A 4G7QB 3TBCA 2GB2A 4KO7A 1JZFA 1JXFA 4E9XA 1BQ5A 3IBOA 4UAHA 4GXFA 1NIBA 1T5KA 5AFAA 2Q9OA 1TKWA 1SFDA 2XX0A 3NJNA 1NWOA 4E9VA 1R1CA 3S3BB 3U25A 3ABKB 4DP4X 2XLLA 1GS7A 1PNDA 2VM4A 3AG1B 3IN2A 3MX0B 1NPJA 2BP0B 3PXLA 4G7RB 3FU9A 4BXSV 4DP0X 3WKPA 4A2FA 4W9ZA 1PMYA 2I7SA 1OE3A 1RZPA 3NT0A 1QLEB 5B7FA 2H47C 4YVUA 2QPEB 2FQDA 3QJUB 2J57A 1GR7A 1BQKA 1XMEB 1V10A 1VLXA 1B3IA 1BAWA 2UX7A 2PLTA 4GY4A 2E86A 2AFNA 4YSUA 4A2HA 1BQRA 2VMJA 2YXVA 2B08A 3NSYA 2VN3A 3GXUB 2J56A 2H5UA 1HFUA 4WKXA 4DP9X 1WAEA 1JOIA 3T9WA 2YXWA 1SDDB 3H56A 1AACA 1XB8A 2DWSA 5B7EA 5D4IA 1YLBB 3N55A 4KOBA 4AZUA 1E30A 2EIMB 3CDZA 4BXVA 1F56A 2DYRB 1MG2C 2IDTA 3QJRB 1M57B 2AANA 3NSDA 1JZIA 1E67A 2Y1AA 4M3HA 1MG3C 4A67A 1CURA 1CYXA 3ZDWA 3QPKA 4E9RA 2BWIA 1MDAA 2W88A 1BXAA 3SBRA 1N70A 3S8GB 2VW4A 3S3CB 2DWTA 2PCYA 5I6MA 1J9RA 3WG7B 5ANHA 2J5WA 4GYBA 3AY2A 2XV0A 1SHWA 4HIPA 2QDWA 1GYCA 3TBBA 1RKRA 1JERA 1KV7A 2CUAA 4DPAX 2EIKB 1JVLA 1IKOP 1NICA 1PNCA 3AG3B 3NP3A 1N68A 3H4FA 5F7AA 3CVCA 2IDUA 2FT7A 2W8CA 4KO6A 1BXUA 1V54B 3NJGA 4F2EA 1A8ZA 1W6WA 2PP8A 4GP4B 2GC4C 2XUWA 1ET7A 1NIAA 3KW8A 4EF3A 3NJMA 2Q5BA 1M9WA 3EH3B 1J9QA 2ZWNA 3HB3B 1PLBA 2GIMA 5PAZA 3WNJA 3FU7B 2YAOA 4YSOA 1OCCB 2GSMB 2I7OA 3NJJA 2UXVA 3T6XA 4N8UA 1FFTB 1AS8A 3IEAA 3NJHA 3NYKA 2BHFA 3ABGA 4G72B 3ZIYA 1L9PA 4ZK8A 1OCZB 4HCGA 3PCYA 3CVBA 1AZBA 4A68A 2A3TA 1FA4A 2XV2A 1ILUA 1L9TA 4HCIA 5I26A 3PPSA 1QNIA 3FPXA 3PAUA 1AAJA 3OMIB 1JXGA 1BYPA 6PAZA 3UADA 3FSWA 3X2QB 1ET5A 1JXDA 4G7SB 2BWDA 4KNTA 4DP8X 2B3IA 4YSSA 1JZHA 1WA0X 2FQEA 1GY2A 5I6KA 1L9SA 1AQ8A 1GW0A 1OE2A 5F7BA 2FQGA 4QKTA 1SF5A 1KBWA 3CZUB 2H3XC 3TU6A 1SFHA 2HXAA 3CDZB 5B1KA 3QQXA 1WS7A 2PPEA 1AZUA 2X87A 4N4YB 3NJFA 5I6PA 1A4BA 3FYEB 2PP9A 1ETJA 1A4AA 2WO2B 5TK4A 4P5SA 4YSAA 2YAEA 9PCYA 4G71B 2GBAA 1NIEA 4KOCA 4YVNA 3CVDA 1I53A 1ASQA 3DTUB 3UAAA 2YQBA 1BXVA 3PAZA 4MFHA 5EHFA 1BYOA 3EH5B 4TXVB 4YSPA 2PP7A 3X1BA 1JZEA 2BW4A 3TA4D 1KCWA 1HAWA 2X88A 1L9RA 2R7EB 3JT2A 4M4RB 2BO0A 3X1EA 4GP8B 1AZRA 4W1TA 3OMNB 3FSVA 5I5MA 2BP8B 2IWEA 1MZZA 3SQRA 4YSQA 5D4HA 1NINA 1QHQA 1AG0A 1ZPUA 2VW7A 3EH4B 2PPCA 4YSTA 3UAEA 3NSFA 2UXTA 2QPDB 4E9TA 6PCYA 2XXFA 1JZGA 5I6OA 1X9UA 3WI9A 1A3ZA 1ID2A 2Y69B 2QT6A 5I28A 2PPFA 3X1FA 4YSDA 1ZDQA 2DYSB 3D12B 4YSCA 4YSRA 1E5ZA 3AG2B 2FT8A 1XB6A 1OCOB 4Q89A 4UF7C 4WTQA 3MBWB 5B1JA 2DY2A 2HX9A 1X9RA 4Q8BA 5AZUA 2EILB 7PAZA 2YAPA 3JTBA 3FPYA 2IDFA 4BDVB 2XWZA 2TSBA 2LLNA 2YAMA 3IE9A 3H4HA 3ERXA 1SHXA 3S3DB 4JHVA 1KYAA 1W8EA 2N0MA 3BQVA
chains in the Genus database with same CATH superfamily
4G6JH 1CYGA 1JZ6A 3GF8A 3FQNB 3U4BL 1YEFL 3DJZA 1PZ2A 3GK8H 2FUTA 1F8TH 1NEPA 3FQTA 1U36A 4WWNA 5AOMA 5IJVB 1W72B 2CGZA 1M6OB 3N06B 3PRZA 4G8GD 1N5YH 3BKCL 2OSLB 2EDYA 5D2LF 4ZNCD 5L7XL 2ID5A 4ZNEA 1P1VA 4I0PC 4K7PH 5FYKH 4KI5E 3RGHA 3BQUA 4CDHA 2NW3B 4EI0A 5GS0C 4NQCE 3B7TA 1HAUA 1BD2A 3II3A 4LSUH 2OP4H 5AENA 1RJLB 4DF9A 2FBRA 5DEJA 3S5ZA 5HPMA 5MHSE 5GRVK 2WWKO 1T5WA 3TZVD 4NKDA 1OZUA 1SF3A 3QFDB 1WAAE 3B9KA 3OKEA 1AXIB 4BUHA 4GJTB 1PG7W 3LN9A 1TITA 2H0FA 1T20B 3CXDH 3LH9A 1T6BX 1CGYA 2PO6D 3DDGA 1NFKA 4WGWB 1N6QH 2JKRM 1XGYL 4QCIB 4N9GA 3RNKB 2YPLD 3QIBC 5I8OH 4OZ4B 1RUPH 3AUWB 1OHZA 5BO1H 4LE8A 4X4XA 4H5SB 3HE6A 1TJIL 3MJ9L 3ESVF 2BSED 1WUZA 3MFFB 2G0LA 1A1NA 1MCSA 2YJLA 1NBZA 3MAWA 3NZHL 4HWBH 4XO9A 5EZJB 3WELA 2IADA 2R4SH 4IU3A 4P06A 2FL5B 1CFTA 2VNCA 5I1GL 1HEHC 2RQEA 3AWEA 1QEWA 4NUGH 5KJRL 5LBVA 2ZSWA 3NCEB 4P2OB 2RH0A 3QR2A 4UOJA 2UWEA 3RAJH 5CGYC 4C8XA 3FQWB 2IH9A 3AC0A 3MHZA 2BMKB 3K6SB 3CHXA 4Y5VB 5GS1C 3MNVB 3F62A 1UCTA 1L0PA 5G5DA 4U6HB 4XWGL 1RSYA 3D9AL 5E2UH 5LXGH 3FW6A 2EUWA 1NCWH 1K6QL 2COVD 2D3LA 2ZPKH 1CL7I 2H2SD 3QRFM 2OZ4L 4WK4B 3BVVA 3GBDA 3O2DL 4JO1L 3HG1B 1TU2A 1KCSH 1ZWIA 4G83A 2VSMB 3UTSE 2FNWA 3RURA 2H1XA 5A7BA 2E8YA 4NM4L 2UZPA 3UAFA 2EACA 4XP4H 4C4KO 4ENZA 2ARWA 2D9CA 2HG5B 3HC0A 1IJNA 3LDBC 5I82A 1I3RA 3SKOA 3UIZA 3WFBH 1E40A 1G9HA 4CC4C 3UBXI 1FL6B 3L3HA 3COOA 4HWZA 4JFED 4L8DA 1RK1B 4NGHH 5IKCA 3UPRB 2KKQA 4AQ8A 1MHEB 4KJQD 2MCPL 3D08A 2VSCA 4YL4A 5JQIB 1TYRA 1U3HA 1BZQK 4ERSH 1CFNB 1WZKA 3QUHA 5G2NA 3GNML 1EFXB 4ZMWA 4OVVA 2GEEA 1F3RB 2NY3D 1XCWA 3MRLA 3DX8A 2VXTH 1MJ8L 2WK2A 3GSNB 2P4AB 4X0KA 1IQDA 4KVPA 1YY9C 2DZEA 1KDIA 5IVXF 3PHQB 2AQ1A 4PMEA 2KLTA 3CDYA 1UQSA 3WJJC 4AQ1C 2FATH 3KBHE 3B43A 3CH1B 3MLZL 1QWNA 3IAGC 4GUCA 2Z8VC 3IDJA 3S5LA 2X6VA 3SDYH 4YR6A 4MMXC 3LEVL 3LZOA 7FABL 5IJVA 3WFHB 1L4IA 5FYJH 3X1NA 1NBYA 4DP2X 1L9OA 4NN7B 4MA1B 3GINA 5CBAB 2NY5C 4X6DB 2FBJH 4XPGL 1THCA 1JNHB 3OQRA 1PAZA 2ZUQC 3TIDB 1FH5H 5DCCA 2FJUB 2E6JA 3H3BC 3VXNA 3U83A 3ZGIA 4QHNB 1MW3A 4L5FE 4UINL 1I9JL 2GBTA 4FYSA 4OQTL 3ECQA 4LK4A 3GI9H 1MLCB 1X5YA 4XPHL 1CK0L 5EV7A 4X4KA 2Q6WB 1ECZA 1ZXKA 4JN2A 1UKQA 3BEVA 1U2CA 3OM3B 1SHMA 1KYFA 1DDHA 2XX1A 1N3NB 2AK1L 4DP6X 4Y4FD 3SGKA 2HSIA 3A22A 1E42A 4YDLC 1K8DA 5AAPA 2NX5E 2VL5A 4PTTB 5I1JH 5ITBH 1SJMA 4RFEB 3SJVA 4LASH 3P1VA 2ZCHH 2WGNB 2CHWA 4F7TB 4HSCX 5C7ZA 3LZQA 2J44A 3MR9B 4XP9L 4WJKB 2XXMB 3MLSL 4HA1A 4KRPB 4TQIA 3AREA 5EU3A 3QEQB 2HG0A 1RULH 1UFGA 2QHRL 4WFHE 5BOPA 5HXMA 5L6YL 4G59C 1QMUA 2DD8H 2Z91B 1KY7A 4H13C 3QJTB 3THMH 2JLLA 3D69B 3QXVA 1WBYB 2CJTA 1KCRL 3D85B 4G8AC 1ANUA 2VQTA 1L7IH 4Z7WF 2P8MA 4MS8D 3MLTB 2JH2A 2LU3A 1NEUA 4JRFA 3TGXA 4W9HC 3HI1A 3QUXD 3A6CH 2P24A 4Y1AB 2DL9A 2YZ8A 2NX5D 4PRIE 3TCLA 1RK0A 3TBTB 4F5CE 3QEUB 3WFEH 2VAAB 4YPJA 4FG6C 3BQUB 3OXRB 3UAJD 3DSNA 1ND0A 5C0RL 3VXPA 1DTUA 2O6DA 5INDB 2IH3A 4HGWB 3REVA 5KJ7E 3WAKA 4ZO7A 5LHDA 4NX0A 2OKMA 5CCKL 1UB6A 4Z6AT 4R2GB 4EPSA 5BS0D 2XNAB 5HYIA 1M05B 3GSWA 1TZHB 3R0MA 3U4AA 2WXIA 3A6CL 3M17A 3VFGL 3VI4A 3ZHLA 4AC4A 1BJ8A 4I87A 2J72A 5IHUH 2Y5TB 1BIIB 2GEQA 5TF1H 3MV8B 5CSZA 4IS6A 4E0RB 1YEWA 1JV2A 2HAZA 3DK2A 3GIZL 5FCUL 3MRGB 4NNXB 1F11B 4JO8A 5T3XE 3ARVA 4O00A 4HCRA 1LE5B 3OC5A 2YD7A 2J8OA 2J8UE 3CBKB 1I7TB 5ADOH 5I8KH 1G6RL 1K2DB 4NJ9L 1MREH 2FJHB 3NCWA 1N8OE 4NQVB 1A2YB 3JWNG 4RFOH 4KX8A 4KPHL 5JW4R 4HWUA 4A7VA 2DMCA 3CPUA 2VH5H 4NP9A 5TE4L 5I8CA 4JRLA 1RZGB 2YFOA 4HF5H 5AG8A 3BT2H 2RQ8A 3DX6B 1UH3A 1U93A 4H8UA 2A9MH 2PW1B 4HEME 4NJAL 4MDJB 4TUUA 4XMLL 5BS0A 5IR1B 3KYMB 2YJQA 3OAZH 3CHSA 2C9VA 4GEIA 5C0AB 3S3CB 3VFVB 5T5FH 4GRWE 1TLKA 4FJ6A 1I3GH 2FK9A 3AY2A 5EBLA 1XVSA 3LDBB 2YWYA 1KIQA 2R0WH 1UXSB 2FIRT 3V6BR 3GI8L 3U7WH 3DC0A 5JNYA 2JB5L 4QJ5B 2JI3A 3ARZA 4S10A 4N1EA 5JXEA 3K2UL 4G6ML 3NP3A 3V9FA 4C56D 3ZW3A 3BH9B 3ECUA 1F4YH 2I9TB 2FT7A 5DA0B 2K70A 5FFGA 3BZFB 4PJ9B 2APXA 3ZMRA 1NGXA 3SBWA 3HI6H 1T7YA 1TETL 3LNIA 3IDMB 4G6MH 5B39B 1B2WL 1AXSB 3U30B 4C56B 4XNMB 2HFFA 3GI8H 2FYYB 1BEYH 2FHCA 3O3EA 5F21B 5CD5C 3BE1H 4EZLA 4QHMA 5E2WL 3KNBB 2XV6B 3T6XA 3MZTA 4B95C 4JHZA 1U8NB 4YFLF 5FF6B 3BO8B 3QZOA 3NJHA 4HPHA 5AW0B 4AQEB 3H8NA 4GI8A 4RAVB 4MXVF 5DHYA 5I66B 5JW4M 3MROA 2AP2A 5D71L 3STBA 3WV0A 3ZDZF 4DO6A 5IV2B 2AF2A 5I2IB 1YYCA 4ELKB 1OP4A 1TYJA 1BQHA 1HE7A 1YEDB 4MSWA 3FPXA 1HSAA 3OKNB 3OMIB 4NGHL 4RWYH 3RJOA 3FTZA 5DSCB 4XTRD 4RIRB 1IAIH 1ROWA 1RZJC 3FSWA 4HS8H 1JXDA 4IMKA 2X2IA 1KBGH 2CWRA 4QRUA 4WW1A 5IM7A 1A6TA 4XODA 5CGBA 3KBEA 4KXAA 4OSUH 1PKQE 4AGMA 1SOQA 3C60A 1WA0X 2FQEA 4PJ7F 5KOMC 3V6FB 4P23B 1MH5A 1IGIL 3AXIA 4M7ZB 5KAQG 1OE2A 4H8QA 3TO4B 5EORL 5IREA 5E2JA 3IJSB 4O5LH 1KENH 3T08A 4C57C 4U3XA 3G5YA 2YN5A 1P4IL 2C8NA 3IMUA 4LDCA 3VFGH 1H0DA 1S9WB 4BSJA 4X83A 4N0YL 4BH7B 5T33L 1HIML 1FG9C 1A4BA 4L0YA 4YXLL 1A7RL 2IPKA 1P7HL 5TK4A 4AEHH 3EYUL 3IJHA 3QI9D 5ABZA 5L4JA 5I75C 1A0QH 1FZKA 3CC5B 4ZPTB 5HDOA 1TQBB 1VB9A 4KOCA 3ARBB 1V3LA 5K9JL 1IM9B 4OH2A 3WOVA 2R29A 4OFKA 4QRTA 3OB0H 5EHFA 3KWVA 4UNTA 1MJ7L 4E41B 2BIIA 2RHEA 3Q2VA 1HK6A 3FUJA 3RVTD 3HUJE 2EH7L 4KC3B 4O9HL 3K74B 4BFJA 5ADPL 3MBEB 4NN5B 4Z9KB 2VDPL 3GSUB 2D7MA 3L3OC 1OP9A 5F7YC 1RUPL 4ZDHB 2G2RA 1PX8A 4W1TA 1IKNC 4XO5A 4R26H 1IMHC 3GC3A 1MZZA 5ALCL 1AE6L 4MDIA 2R2BA 4OUUA 5FKPB 3I6GB 3IXTB 3U0TA 1YMMD 3CFCL 1QHQA 2EUVA 5L6YH 4Q52A 1E9OA 1BMZA 3IF1A 4MAUL 5DZJA 3K6IA 4X98A 2XBDA 3MV8E 3EFOA 1KPRA 3TN0D 3V6OE 3CQFA 4B9CA 2O61A 1OQOA 32C2B 1AXTH 1DLHA 5IMKA 1X5AA 2RB8A 4TLSA 4ABWA 2X89A 2CRZA 3X1FA 3LEXA 3SE3C 3N04A 4LXFA 3AG2B 4IMLB 4G6KL 1H15B 1FN4A 4O2CB 1OCOB 2OI9C 2LV4A 4GS7C 1JFHA 2F54D 1ZTXL 4DZ8B 3FPYA 2BINA 1KCKA 1MCQA 4L4VA 1HHHA 1CF8L 5E8NB 3W0WB 4U1SB 4LLDA 2DLEA 3GMNB 4M9PA 1EFQA 2LLNA 2XN9E 4MQ7A 2EUXA 5C6TH 4FKEA 2C1PA 3IGAB 1OAQH 3DX3A 3ERXA 2K6YA 3FB6B 1FFNB 3OKDA 5DR5H 1YMMA 4MYPA 5D2NC 4MKTA 4ICXA 4PP2A 3G5XA 1OPGL 2AXWA 5DJAB 5AB2A 5HYQB 2OYMA 4YX2L 1UG9A 1V7NL 2IH3B 4GAYA 1QSED 1XT5A 1EHKB 4RVBA 2ZX6A 3GJEA 3RTQA 3QEQE 4AGLA 3VGEA 3SYCA 4YHIA 4K55A 1A6AB 5D8JH 1ZA6A 4UT9H 3HZYA 1JHKL 2F5BL 5FWRA 2Y2WA 3L1OH 3KPOA 4HIHB 3D3VA 2P5WB 5DK2A 5BVJB 1AQDB 4BZ2H 3H3PL 3STZB 3AU1A 3G6DL 5FGSA 1N9PA 1VFAB 3PV6A 1H6EA 2BSSB 5C08B 4JZNB 4MNQA 5SWZB 4EI5B 3FO0H 3KPRA 3FUKA 3GMMB 1MWAB 2HMIC 4DVRH 2G5BB 4UOW1 3LZRA 4LNRB 2X7LB 2YWZA 4XMKL 4NBZB 5JOPE 4PJCA 5E08H 3T3PB 4X4XB 3BSZL 1K5NA 2JB6B 1CDIA 1EEYB 3FHQA 4RGMB 3KLHD 3HHMA 5B3NA 1XGZA 4FLHA 5D4QA 4MB3A 4LCIH 4HX1B 2GAZA 2R69A 1PKQB 5PCYA 5DJ0B 3UC0H 2CLRB 3OD3A 1PDKA 4MJIA 4X6DE 3O6FA 5SWZD 2AW2A 3LKNA 4F2MB 2Z8SA 2IFGA 4Z7IA 2ALAA 2X89D 2BRRH 1QZ1A 4A38A 3EFFB 2B1OA 2P44B 1BA9A 2XWJB 3KJ6L 1FL3B 4XZ4A 4M8VA 1T1ZB 3FH5A 4F37F 2XRAL 2OZ4H 4UNVA 2Z0UA 5KG9A 2EEDA 5D1QC 4YAQB 4ZNEE 3QCVL 5C86A 3QJXA 2F58H 3SHSA 6TAAA 4LSPH 1DVXA 1OLZA 3SE9L 4E9YA 4Q58C 3WKYA 4M5SA 3CXHK 1XQ4A 3UTTB 1KYDA 3M7OA 4AYID 4X6BB 4L4TB 5T3ZH 3SODB 2IGFH 5LXVA 2DQGL 2WWOA 4MRBA 4U1NB 2F2HA 2YQ2A 5I1GH 5GJSH 1GGBL 2F1BA 5J6GB 3PJSA 4C56E 3FQ4A 4LRNL 4KFMA 5BMFH 1G0YR 2PUQT 4H0LC 4QAMB 4KTEH 1J0HA 3S37L 1IAMA 4I0PA 4ZQKB 1TJIH 1D9KB 5LVEA 1FYTE 2FQFA 3ZOAA 3NA9H 2EEFA 3BX7C 5EF3A 3A67L 5MEPB 4Z7AA 1E8YA 3GRGA 3BVUA 1BZ9B 1UOVA 4JY4B 4UIMB 5I6LA 4RGOH 4KQ0A 1K8IB 3MRLB 1E28B 1KJ3H 2ENJA 1FDLH 4PJ5E 5C0DA 4EUPA 5B1AB 2QL1A 3FZUD 4N85A 4GBXD 1FNLA 1PU0A 5GGSA 3RHWF 4J1UA 1QNZH 5C0AE 3L3KA 3BIAX 1UC6A 1RZ8A 2B7DT 4CN1A 1KJVB 2DWEA 3JVFC 1QABA 2WNGA 5F3BB 3VD5A 2FX8H 3OF6A 4KI5F 4BFIA 3ALXA 3QJQB 3QZPA 3V0WL 4NRZA 5GRYA 2VQ1A 3EYSH 3NEEA 4HQQL 1NANI 3RWDA 3SE9H 3UYPA 4NO2B 4N2DA 3KXFD 3R4DA 1KXTB 1O0VA 2QSVA 4C47A 5FCSH 5F7MC 2GSIB 3QCVH 4N2FA 4OZGB 1JI2A 4BH7A 3KYNB 1GZQB 3L54A 3LN5A 3UJTH 5EUKA 4M29A 5E1QA 1XL6A 2ESVB 3WS6C 1V8HA 4DGVH 2GC7C 4JR9L 4MA3A 4ZPVB 3TVMA 4F20A 2B15A 2GABA 2EH8H 3L48A 3PG2A 5CEXB 1DHKA 5KSVB 1CGSL 3IGLA 1KFGA 4L4TD 3FOMB 2OQJA 2R2CA 1AC6A 1S7RA 2YEZA 1XZ0B 2YGPA 2HJFA 5CMAA 4ZMXA 2XPZA 3DO3A 1TJGH 2JB6A 2PCFB 4ES8A 4KO5A 2P28B 5A2KH 5JPNC 2NRDA 5D6DC 3FXIC 3CCHB 3OWEA 2BJML 4LLMB 1S9YB 2WUBL 4JQIA 5L2JA 4KKCC 2X44D 5J11B 4OJFH 5E6RB 1DEDA 1FORL 1J8HD 1TZIB 4LKCB 1F18A 4OIFA 1C8QA 4PRPB 4LBEB 35C8H 1H3TA 1DN2A 2PCPA 3RTLA 1EHAA 3SBQA 4B6ZA 4NZTL 2ED6A 4F33A 1PPIA 3LHPH 2HRPL 5KSBA 2QADB 2YLKA 5IZ7A 1NCJA 2AQ3A 2F5BH 7PCYA 1CD8A 1R47A 4JAMB 2Y7LA 1ZHBB 5GISL 1F00I 1NDTA 2VE6B 1JXKA 3PWLA 4LSRH 3FT0A 2CCVA 4KXCA 1OT4A 1C5DB 2GB2A 1P4BH 4S2SA 3MRQA 1IC7L 1JGIA 3U1QA 1DQJA 1MCWM 3BKJH 1I8LA 3DV6A 4PY8I 4L3ED 2WZPA 1IQWH 2XG4B 2ZOLA 5AFAA 1SQMA 5EU7E 5CEZD 1SRDA 4P3DB 1AJ7L 4KKAC 2GQHA 1F90L 3B9DA 4Q7DA 3QNFA 4KK5C 1OB1A 2CRIA 2DI7A 5D9SB 3O81A 2FEEI 3JUZA 3JV6B 4G7VH 3V55A 3P3UA 3MX0B 1DUZB 3TCXA 2L04A 3V52L 4GBXB 4Y9GA 4I13B 1IE5A 1HNGA 3S35L 5EC1B 3T2NH 3L3GA 2VMFA 1ZLVK 2ZYHA 1A9EB 1S7XA 1UJ3C 1ZLVH 1RU9H 3FB8A 4IW4C 1WISA 1EH9A 2ZCKH 4K2UH 3CLWA 2F61A 4IHOB 1BVLB 3KPOB 2WBWB 5GSRA 3UTZA 3EJPA 1WT5A 1ZHKA 2G75A 4U0RB 3WXWH 3T9WA 3GPEA 2YA1A 2OZ4A 3WD5L 2GSGA 1WAAF 1D5IL 4KOBA 1GRWA 2ZUYA 4DTGH 2D73A 3HCVA 3MA9H 3QG7H 3ZK0A 1IGTB 3E7JA 1E2VA 5IB5A 1E3ZA 4OLUL 1JZIA 4WSJA 4A6YB 3KPSD 4O58L 4EKJA 3DETD 2JCCF 3CFTA 5B38B 3T3PE 3SBRA 2WIIA 2ICCA 1GZQA 3EOYG 3S6CA 1P7QB 4K3HA 4PLNC 4PREA 5CEZL 1F6FB 4X50A 4QEGA 3QJHA 5H94A 4DJMA 4M4RA 1XXFC 1MLBA 2ZXAA 4E5XG 3QAZC 5ESQA 5C08E 3O6FB 4WDIB 1JERA 5DD0L 4WHTA 1IV8A 2NY6B 4WTXA 5T1JA 2WJ5A 4XVJL 4FEIA 5DMGD 1OAYH 4IJTA 5EUOB 2NNAB 3PQYA 5DUML 2VDOL 4M5ZL 5F9WC 4Z5RA 3QDJA 1NBVH 2ZXQA 1DVUA 2LTQC 3CQPA 4MYWB 1KCVH 2FR4A 4XP5L 4BQ6A 4QTFA 2DKMA 4EO5A 2KZBA 3HBQA 2R23A 3SGEI 5JA8B 4PGJA 1QSFB 1NIAA 4Y4KB 1ACYL 4NIKB 4OJAA 2Q5BA 3MOAH 4NM8L 4YHNA 1CD0A 1EEZA 1YAZA 4O4YL 4PS4H 3FU7B 2VXSH 1DEEA 1VA9A 1VFUA 4YSOA 1OCCB 1J8KA 3K80A 3LYRA 2WXGA 2COQA 3IPFA 4X6BA 3SPCA 2X1OA 3BQUD 5H8DA 4HG4J 1T3FB 1GGTA 2QADD 1E9PA 3DVIA 1M1XB 3CDGA 3SSGA 4QXUH 4OCWH 3KWUA 4WFHD 5I0VA 3CMOL 1OCZB 1BSIA 1F86A 4LOUC 2UYLB 1WIPA 1Z0MA 2NSMA 4DEUA 2WKOA 4CKVX 2BOCB 2QEJA 3EXJA 1KMGA 2VISB 4XC1H 5I1LA 2IG2H 5MP6L 4CBPA 3UCQA 5D7HA 1IO4C 4ZS7H 1NCOA 1PSKH 4PJGE 1U42A 3VO0A 2MFNA 2H3NA 5KVGL 3KEDA 5FA3A 2ORBL 2W60A 3BW9A 4LGSB 3QHFH 4D3CH 3CZJA 2EP6A 1GGUA 3RI5F 1WGOA 1H0DB 1S9WA 2ADIA 3ISWA 3PHOA 4NT6A 3JBG7 2KUTA 2IBZX 5F3HA 2NXYC 1NMCC 4YBQD 1IC5H 1NCCH 5DLMH 1HX0A 4X5LA 1W0VA 3IJ9A 3WIIH 5LAPA 4GOSA 4HVBA 3O0RL 3VD3A 1A4AA 4R7DA 1BECA 2A4ZA 4NFCA 3H2PA 3LKQB 3K2MC 4PJ7E 5KVGH 2PF6A 5IF0B 2VN5A 1GYVA 1AD9A 1AP2B 5F7EL 4NQCB 2YGOA 5CJQH 1W80A 4Y16B 4NZJA 2LTQB 3MLVH 1M2VA 5EOCH 3KR3H 1JI1A 5HJGA 3RWCA 5KSBB 1ZV5A 1EJOH 2H6PB 3ECWA 3WIFA 2GJ6D 3DJRA 3KPRD 4GP8B 2A9CA 3LSOA 1T89A 1U2YA 2YSTA 1ZCRA 4ZXBA 2IWEA 4LFHD 1M71B 3HUJA 4HUWB 4WU5B 4PJ9D 1JWSB 2D03H 1NFDB 3MFFA 3AT8A 1Q90A 2A0LD 4P5MB 4UMSA 3VB8A 5JLZB 4F7PA 4IU3B 5KSAB 3H0TB 2JJUA 3NCJH 4FQXC 3MA7A 3VXSA 2Y69B 4D94A 1EFXD 2BNUB 3D4CA 3O6ML 2NCEA 3ZN6A 1S7VB 2HKFH 5TGBA 5MENB 3QI9B 4YSCA 4NYLA 4PRHB 4LAQH 1EAJA 5FECA 1A22B 3PE9A 4UDTB 1OALA 3P0YL 4CVWA 4UOZA 3NCBB 3BUPA 3LKSA 3D34A 1VACB 3D33A 4Y1TA 1I4FB 3NFPA 4Z7UB 3U2IA 1VCBC 2YRZA 5DD1L 1JGVH 3B37A 5GRJH 4N1CA 3I85A 4C4UA 4EN2A 1R3IH 5DRNB 4G7YL 3IE9A 3EJYC 3D7PA 2ZWZA 3GMOA 4FZ8L 1SHXA 3PWJB 5K93A 1ZLSH 5FLVA 3JTTB 2CGYA 3BLKA 4EN3B 1IL1A 4A2DA 4G6AC 5DFTA 5SWQB 3QXDB 5ACLA 4DEPB 2P45B 5E99L 2D4FA 3IRZA 4LEXH 1BBJA 2WMPA 1GC1L 3W56A 5DXWA 1E4WL 4JY5H 1CFSA 2XKSA 2ZSVB 4G9FE 4GG6B 1TKWB 2F7QA 4PCKA 3U1PA 1U92A 1J1XL 2G5BA 2H3NB 4WI9A 3D2UD 4B9JA 5B8CC 1CBVL 1X5MA 2WLLB 2X0UA 1ZS8A 3HAEB 5E1IA 5E99H 4KKCD 4ZS6D 2XQYK 3FTVA 1BAGA 3UFIA 4GRWB 3WO4C 5E8DH 2HX8A 1KUMA 3HVDA 4JFDA 4PB0L 5LCVL 4NKDB 4E42B 4ZZKA 3TLRA 3VVWA 3DKHA 1A6UL 2QJDA 2Y06L 1UJTA 3T1WA 1J88A 4IKJA 4OCRL 1OD7A 1KNOB 3QG6A 3UTQA 1ORSB 5C3IA 5KS9A 3QYNA 2O5YH 4L8SB 1B4JH 4ODWA 4KI5D 1DVYA 1P4LA 3ML8A 2HB0A 1Q0XH 3QQNA 2UWEE 3TASA 2KZWA 1NAMB 3B4NA 3P0GB 4FQCH 2C4FT 2XVGA 3VRJB 3FQ2A 3ZE2F 4BINA 4IIQB 2ADGA 2UV3A 3EGDB 1TU2B 2VDKB 3SDXA 5L88L 1BVKB 1KC5H 1JVOA 5KS9E 3QDME 1KPUB 3FK3A 1RL1A 2AJUH 5E03A 3RGVB 3EJRA 1J9SA 3A4EA 3MVSA 4HC1A 4A2GA 5E00B 2WB7A 3MRCB 3UAJA 1O9WA 4ABUA 3KGSA 3BP5A 2EDNA 1H3PH 4A7TA 2AJXL 1NAML 2JTYA 4Z3JA 3WHE1 5HDQL 3CDCA 5D1QD 2N1TE 5JORB 1N0LB 4PAZA 3PQYB 1IBFA 1NDMA 5AOLA 5EU6D 1LO5A 5ENWB 1A4KA 1E6JH 2HRGA 5LUMA 2X9ZA 4FFWD 2NNXA 1TMCB 3L95A 4BFEA 5LDUA 1KGCD 1TEYA 3S0PA 3QORB 1PY0A 5C0BB 4X0NA 4ZQKA 4OZFG 1O7DE 4JKPL 4HWZB 4L8DB 5CF3A 4YHLH 2R8SL 3MODH 3PL6D 4MA1C 4NN6B 1MJ8H 5BUAA 5GZND 3D07A 3E1ZA 3GLZA 2C5DC 4K7PY 2K6WA 3TFBA 5JPMA 3RNQB 3GSXB 2X53A 4KQ3H 2C1OB 4GW5A 1RHHB 4QO1B 5I30L 5LNDA 5CGTA 4GSDL 3ZL4H 4YOKA 1RPKA 2BK8A 1SN0A 1Q72L 1LO4L 5F9JA 2HTLD 4ZUVA 2YUVA 1XCTA 4JZJB 2KT6A 3P9MA 3B7UX 2W59A 4HUVB 1MPAL 1HHJA 4HJ1A 5E5MB 2YK1H 4YHZH 3IDJB 3L8QA 4A7GF 2EVFA 3B7SA 5IK3B 5JXAH 3OLGA 3QIUA 1MRCH 3LEYH 4B53A 1LP9A 1QO3B 4WFFE 1JD7A 1I7UA 5KBPA 2H9GA 1J18A 2PR9A 4UNUA 3F7YA 4P57A 2FWSA 1QACA 2IOOA 4JBSA 4XWGH 4LCCA 1GY1A 1ZT7B 2VSKB 5KVEH 1LDPL 2UZIH 5DK0A 5F88A 1XF4A 3H2WA 4DPCX 3LY6A 4JFDE 3CTTA 4WW2C 1GPOL 1QNZL 3QIBD 5IB3A 4XPBH 1CIDA 2FIKB 3G6JB 4KJQC 5F7DB 4I0KA 1BX2B 3RFRA 4GW1B 4MHHI 1NDGA 3AREC 3FOMA 5ICYA 4HUNB 1AP2A 3H9SD 4WI0A 2JXMA 3NZHH 3BPCA 3VFPB 4NQDD 1BV8A 3C5XA 2BNQB 1YN6A 3ZX1A 3ARPA 3FN3A 3G9VA 1EAPB 1WHPA 1CPUA 2EINB 2NY7L 5EO9A 2XIBA 5EZPA 2YBRB 3TWYA 3HUJF 4OKVB 1CDJA 1HOCA 4HLJA 4PD4J 2ZKHH 3ZL1A 1NANH 5AKRA 4CDGC 5IUCA 3KPSB 5EIQA 3UCRA 3FB5A 3N1QC 4JANB 5H2BA 3HC3L 4RMTA 1S7WB 5E1GA 3RWGA 2Q10A 1SVBA 1HYSD 5BUGA 3SE4C 2VLJA 2V6HA 3PL6A 3FCBA 2DQFA 2BCMA 1HZKA 3KYKH 3QUMB 2A6KA 2CCLA 2ZF8A 3DV4B 2ENQA 2PTTB 2X6MA 2XYBA 4PJ8A 2YOAA 3MRNA 4YHPB 2DWDB 4UILL 4AYFB 2DJMA 4PRHD 4L23A 4NNPH 1DL7L 1UKTA 3P73B 1S7SB 4FQIH 1CO1A 5C7XH 5D7IB 5FYKL 4KJWD 4G1MA 1I1CA 3EOBA 2GI0A 3WTSA 3D5OF 1K4CB 4LCVA 3FSOA 4BQBA 2V17H 3NP4A 3O11A 4XE0A 3MV7D 5EOTA 4CMHC 1NGXB 4KO7A 1RIUH 3SE8L 4F58H 3FT4B 1EXGA 1HJCA 2AXJA 3NQKA 1G9MC 2GITA 4DOHE 1U91A 2W91A 4DN4L 3L2NA 4GXFA 1J0ZA 4X9BA 1R24A 4UUJA 2YK1L 3QUML 1RK0B 3QB7C 2RBLA 5EF2A 4B7IA 2V9QA 1J12A 3BP7A 4R97C 3HJEA 1K4DB 2PABA 1E5CA 2GJ6B 4U6TA 1NGQL 2BP0B 4G7RB 2A9DA 2AXFA 2CJUL 4OZHA 4LIQH 4LSSH 4QRBA 5AEAA 1SXBA 4FQXD 3EH1A 4MJIE 1QWUA 4DN3L 1G7HA 5FPIA 4MTMA 2Q86A 3FUHA 1A1OA 1NFDF 4LHJB 5EO0B 4YHLL 3EADA 3ATAA 5ACZA 4JFEB 5DS1A 2PLTA 3OSVA 5FYLE 4YSUA 1U9KA 4JFFD 3P9LB 4OCXL 1FGNH 4J4PA 5F7LB 3ULSB 1QBMH 2VDRH 3L4XA 4UQ9A 4WKXA 2G4GA 2APVA 1JHKH 1NGWA 3PGFH 4BYHA 2MCPH 2O26U 2DYPA 1GGIH 2RALA 4FI6A 4ZYKB 4DKEL 5AWNL 3HMXA 4Q6IB 1SDDB 4PB9L 1XB8A 1EZVY 2LQRA 4R84A 5JXEC 3E8UL 4WRLA 4AMWA 3Q1SL 2E7DA 4LLYB 1RUKL 2DI9A 2DQEL 5DF0A 5IQOA 2FD6H 5BS0E 3EUUA 5FM4A 1NAMH 4KUZH 1OPGH 1H3XA 4OT1H 2YQ3A 2NY2B 4P4RA 4PJBA 1A2YA 3NTCL 2VDML 1BZOA 3QRGH 2FL5A 3REWB 2AJUL 1BXAA 2MPAH 4QMEA 4C56A 3BWAA 4R96B 3WJLC 3MRRA 4ZMTA 4TQHA 3NCCB 3GO1H 2VDMH 2NR6A 1JN6B 1EQWA 4OFIA 4FQ1L 2N7BA 3VG0H 3BH9A 1EEQA 5C0GB 3D25A 1T66C 2A73A 2F53B 2B59A 3Q1SH 4ESKA 2X4OA 4TULL 1AD0A 3CVCA 5IFHL 3DOHA 2H45A 3KYOB 2GTWA 3MRCA 3HBPA 1IC1A 4GXUM 2HPTA 1IGYB 5C0NC 3PV7A 2ZKYA 2YPLB 2R0KH 4K9EL 5HDBB 4ZMQA 4PJDE 3HPLA 4WK0B 1ICTA 1MHCA 2G3MA 4HKZA 3VTMA 2N56A 3BRFA 4A6YH 4IMKC 4M5TA 4CGTA 2VLJB 4X98B 5FYJU 1MI5A 3WNKA 1AHKA 2OTUA 1J9CT 4GXUN 4O02A 2CIKB 4BE6A 2VUKA 3EOAB 1U0QA 4JW3A 4MGXA 1NEZB 3JYCA 1HZHL 4X9FA 4PRAA 1NMAL 3OKLA 2NY7H 4K4KA 3BP4A 4O9HH 5BV7B 1OVZA 2B16A 2HVJA 4K5PA 4WTZG 5E8EB 5FHBL 4HG4K 1S6NA 5AYTA 3PPSA 5DGRA 3IFOB 3A4FA 5C2BL 3ULUE 1P7QD 4U2YA 4E2OA 2P47B 5MHSD 3ZE0B 4YBLB 5C1MB 3R1GH 3NESA 4FTVD 1QWHA 4JUSA 4M6ML 4XB8A 2GUOA 1PL3A 4ZPTA 1DQDL 2QQLL 3DDFA 1L9SA 4NFBA 3IFLH 4OZGF 1IFGA 1KBWA 3CZUB 4YPGB 2H3XC 2OK0H 4PW3A 4LMQI 5AYUH 3X3FL 4G8FB 3P0YH 3UTOA 2EABA 3GJEB 1HQ4A 4C4KT 4IRSA 1S9XA 1MY5A 2CG9X 6CGTA 4X7TA 3KYKL 1ETJA 4N2BA 4JMNA 2LT9A 5ALBH 4YHZL 1XGUA 4MDIB 4OI7A 3WHXB 2NNFA 5GS1A 1G43A 1KJMA 1O7SA 2IMMA 2VC2L 2EDWA 3IXAA 4ZFZA 1I53A 5I1DB 3IDXL 4N22A 3PNWB 1BXVA 4HH9B 4OF0A 4MFHA 4LCYA 2NY0C 2DYPB 3Q43A 1M1SA 4ZYKA 3RFZA 3IWVA 3U6XS 1QUNB 4K7FA 3GSNL 1GZHA 3IJ8A 3HIZA 4D9QE 5D71H 4HYTB 2FX9H 4CU7A 1WJ3A 3K4ZA 1DQIA 1GYWA 2K3HA 2EDLA 1HKLH 4NZUL 4PLJC 1BM3L 5CZXC 4X6EB 3UPCA 3ZDYE 4DQOH 1DBJH 3VUAA 5J56B 5JHLL 5DZNA 1MFCL 3BXNB 4AXWA 5DZPA 4F7TA 3LMJL 2FLBT 3DMMA 4GG8B 2HKHH 4YQXH 3KR3L 1YNKH 5HYSG 1AG0A 3P4OA 1BZ7A 2ZXCA 4F9LC 1T03H 4ONHA 4ALAL 1G7JB 1OSPL 4AJWA 3OC8A 1N6VA 4PJ5D 4XH2B 2FAUA 3QIWA 5C0EA 3EZJB 3DV4A 1CQKA 1A4JB 1JPST 1W72H 1VACA 4DO5A 4ELMA 1H3GA 2AJXH 5F6HI 3W2DL 1E5ZA 4KUCD 5KBDA 4FQ1H 2HJLB 4POUB 3GO1L 1MIMH 3QCTH 3MBWB 3QEUA 4R0LA 3VFRB 3ZKXC 1J1PL 1I9RH 2D7TL 1DSYA 1A6VL 3INUH 2W95A 3JTBA 4AEIH 3ROOB 2NQCA 3MCKA 1MCBA 2IQ9L 2WZ5A 3ARXA 3KWWB 4MMZA 4WFFD 2V2XB 5C09A 1G7PB 3GXNA 3SKMB 1HKFA 2B39A 3F6JA 3KPLB 1PQZA 4I48A 4OFQA 2BP5M 3H4HA 1FIGH 2A1WL 3T0EE 4OCLC 5I18L 2MNJB 4WIQA 2E9GA 4FE9A 3U9WA 4Z23A 5J1SC 4MASA 1OB0A 5SWQA 3BRGC 1NL0L 1OTTC 5E1AA 5TE4H 1C5CL 3ILPB 3GTVA 2VABB 1QASA 3V10A 1A6AA 2V5TA 4TQ8A 5FHAL 4AUJA 2AV7B 3H3PH 5E8EA 1L6ZA 3EYQC 2YMXH 4JLRA 4M7ZC 4U33A 4PGEA 1CB4A 1YG9A 5HYSB 2VWEE 5HYJB 1U8JB 2WLLA 3HAEA 3HOGA 4HALA 5MEQA 2QQNL 1PCXA 3L9EA 1S4IA 2XFXA 4Z7WA 5EA0L 5HDLA 2ODIA 3BC9A 2E74C 2ZTBA 1A7QL 4RISH 5AVYB 1U8KA 2P80D 1RV6X 4AIZB 1FUNA 3RIFF 1VEMA 4C59B 2CDGB 3VXUB 3DVGA 3MOAL 2Y07L 5AD0B 4RETB 2Y5QA 5GXBB 3BKYH 5BRZB 5KYXB 3LD8C 1SJHB 1B0WA 2H2PD 4MJID 4XB3A 1AGDB 5EBWA 3WE6A 4XP5H 2QVKA 2VM3A 4ACTA 1K3ZA 5KSAC 2G60L 2V0AA 1EZVX 1OAYL 2Y6TE 3MXWL 3Q2WA 4AIOA 1OARL 1YHPA 3Q5TA 2VN6A 5HGBB 3FN0H 3DX7A 5BO0D 3V0FA 3G6AB 1AS7A 3LH2L 2FHFA 1QFUL 3P4NB 1KB5A 4NQCD 4OQ1A 5F3FA 3V6ZA 2VJ0A 5HYFA 5HHOE 2R7EA 2ESVA 3D4ZA 3GRWA 4OCRH 3WFEL 4YSEA 5HP5A 2Y06H 2BVEA 3GKWL 4KGJA 4PWKA 4YC2B 3HE7C 3AS3A 2WZPD 4ANKA 3MV9B 2HT4C 4PH8A 5BV7C 5J1AB 2G60H 5EU6B 4PJFB 5F89A 1XF3A 3BD4A 3FTSA 4P4KD 3A21A 2UX6A 2EEXA 3AG4B 3V4UL 4UIMA 3WD5H 1AG6A 4IK7A 4GI9A 1HI6A 2W0LA 2NCMA 3GIVA 4NN7C 2YAFA 1E4KA 4K2UL 1HH6B 3C8HA 3L3KB 3MACH 4RA3A 1S9VB 3C5SA 4LEXL 1X9LA 2R1XB 1NCUA 4C83B 2Q20A 1M3IA 5I2IA 2YPKB 3VG9B 2N7AA 3FQXB 5F9DC 3ECBA 3PFQA 4M56A 4M6OL 1K8IA 4JPVL 5EBMB 3SGJA 3U9UA 3CUPB 3GT6A 4E9QA 1NCDH 4S0SD 4I89A 3BLPX 4OF7A 1I7RA 1UXLA 3QE5A 1ADWA 1CK0H 1E8XA 2H4EA 4PJIB 3QEHB 5G4NA 25C8H 1BOGB 2A5UA 2HVJB 4C54A 3NACL 2AV1A 3MCKB 4NQEB 4AJVA 3L81A 2Q2EB 5F7EH 3LQAC 1MH5B 1F58L 3UTTE 1FIGL 5IROD 4IKNA 1Q94B 3D2UB 4FHJA 1P4IH 4IRZH 4JL2A 2FNBA 5I0YA 3N40P 5JPNB 2XN9D 1A7BA 4GAJH 4N0FA 3T6WA 2P9RA 1BQSA 1UD3A 2VZSA 3DIVA 4JKWA 1QPKA 2HH0H 4ODUB 4LARL 4F8QA 3BZ5A 4JDVB 5EFIA 3FOLA 4K9JA 3GKZA 1ZEAL 2NZIA 3RUGB 1AQMA 4ZUSA 3VWKB 3QQDA 3IJHB 1RZQA 2N3JA 2ZOWA 3MLZH 3DLQR 3DPBA 1BF2A 1YJDL 3HR5B 1KELH 2CK2A 5IQNA 3HLKA 4EN3D 3US0A 1OTSD 3I9AA 5CLTA 2VXTL 4J5VA 2I07A 2XFXB 3P30H 4K23H 4I7ZC 1SY6H 4FQLH 4BFKA 3HKFA 3O2VL 4G43B 5GS1B 2CKBL 2MJWA 4LVHC 3CQQA 1J8SA 4U49A 4YIQA 2NY5L 1D5ZA 2XT1B 3TV8A 3RWFB 3CCHA 1URLA 3ZDZE 1BPLB 5CM1A 3QGVA 5AB0A 1KIQB 1WD9A 1FHNA 2WCSA 1MEXL 2B9AA 2WYZA 3UBGA 1XZ0A 3CN0A 2YEVB 2I85A 5DWUL 3V0VA 1IFRA 1BHGA 2QFRA 2YD8A 3D05A 4Z7QE 3DX7B 1LP9E 3CZNA 5JPMC 1W0YT 1TVBA 1O9VA 4F91B 4QRFA 1ULVA 3TBYB 3FH7A 1FVEB 1TOXA 3BHBA 4KK6D 4DP1X 5A1AA 4NQQA 2AK4A 4HP5A 5D2LA 4GRMA 5IEKA 5DI8B 1C12B 1GVIA 4OM0H 3RUGF 5K9OA 3ZTEA 1Z9LA 1CICD 1OV8A 4XMVA 3QDJB 4LCWE 1A4JA 2EXTA 5CJ8A 1B90A 3N85H 4PY8J 2ORBH 3C60C 3VXQB 2R56H 4ZUTA 3VJ6A 1SEBB 3GMPA 5GGVL 3ZT5A 5FUOL 4BH8A 4HBQA 4ODHH 4ZRGA 4U1IB 1K85A 5BRZD 1AO7E 3IJ7A 4KZCA 4OKDA 3O4OC 3BH8A 5CO1A 1F3JB 1S7QA 3BAKA 4GBXC 5I9QB 3Q6FA 5C0BE 3WNLA 4PB0H 4PJAA 5LCVH 2PYED 3L1EA 4NJ9H 4QYOA 3S4SG 2VLKD 4JVPA 1M6OA 2OM5A 4ODVL 1IARB 5HYEA 5E1AB 4N8VB 2WPGA 2JF1A 1RK1A 1FNGA 2GT9A 2H47C 2OXGA 4Z95L 5EOQH 4YVUA 5FCUH 3U9UB 4GRWF 5CN3A 4U6YA 4K5NA 1TJMA 3QJUB 4QI3A 2AITA 3HW7A 5CGYD 1F4XL 2WWMC 4EZJA 3NZUA 2AKRB 4GY4A 1HSBB 2OP4L 2OX5B 3B8YA 4WI7A 4Y2LA 5GIRA 2HT2C 2WHVA 4FMVA 4CJ0A 1HVXA 4FYRA 3TBVB 1B3JA 4XOEA 4APQC 3AABA 4IHOA 4XCCH 3SCMB 1YEGL 2UWEB 4L37B 4B0MB 4M7KL 3W57A 5A16A 4R4BA 1J0YA 3PWUB 1QW8A 2QGCA 4P23D 4JHAL 1WLHA 3CFKA 4PJFA 3OB8A 1C5CH 1CG9B 2RFXA 5E8PA 4G7VL 4M3HA 1JYWA 2JJSC 4OY9A 5GGVH 1HWGB 4NENB 1JGVL 4QTHA 4GW4A 2ZSWB 1UUSA 5SX4I 3OAZK 2W65A 1S2EA 2GJPA 3Q3GB 5J9PA 5B38A 3CSFA 4ABQA 3UZVA 4F3FB 1IEBB 3O45A 4NQCA 3LPGA 5BZDA 1MAMH 5DYFA 3ZMEA 1DE4B 4ETYA 4ZFFA 4OFPA 1PGRB 3G08A 3RWHA 4H1LH 3H9HA 2JSFA 3TYGL 3VA2C 3NTCH 4FP8L 4Y8DC 3TXAA 5IW6A 2AMUA 3BKYL 1QUPA 2F19H 2HLAB 2J5LB 5IVXA 3MV9A 3OHXC 3BSZH 4LEEA 5CJBA 5FDWA 2PP8A 3TTYA 1U8CB 1Z5LB 4FNLL 4HZAA 5KOVC 1XCQB 1ZGLP 3O4OB 1ET7A 3C6SA 2FR4B 1I82A 3L9RA 4PVLA 4YNYA 4DKEH 3QFJB 4NI3A 2GW5A 4DGUA 5J6GA 4YDIL 1PLBA 4X4MA 2QLVB 1A7OL 4LVOB 4XB7A 4YWGH 4NSKA 5B8CB 4E68A 3BI9X 1M1XA 3CXHJ 4LCWA 4GIPD 4WUUB 3WKNA 2ZF9A 4P2QB 1J5HA 1CE1H 2WNKA 3QSKB 3DK0A 3MYJA 3W9EA 4PJBE 3V52H 1KWKA 4QXTB 2BHFA 4MQ7B 4UQ3B 1L9PA 1I9JH 1B4TA 2AMGA 2FX9L 4HCGA 5KSBF 4YBHA 4A68A 4NKOB 4GKZB 2WC7A 4KDTA 4U6XB 3LJ3A 3RUGA 4YX2H 3ZHDA 4F9PA 2QFPA 3ARDA 1D5RA 2F5AL 4FD0A 4RX4A 4EBQL 1INQB 4EN3A 4G3YL 5DYOA 1CFQA 4DZBA 3CHOA 2A38A 3TJEL 3GTNA 4S1RL 2XWCA 1LO3L 2ODHA 4N2NA 5CWSB 15C8H 2CIIA 4FXKB 2EKSB 4I3SL 5HDRA 2ZUVA 4JFVA 5D5ME 4X6DF 3TPUB 1MHPH 3MPCA 4WWKA 4ZX4A 1RERA 4FYQA 3BWUF 4M62L 2KI6A 2ZXEB 3X17A 5ABDE 1W72L 4JFPA 4HMEA 1Z2KA 1NCBH 3IE4A 5E5RB 5D7KD 3C5ZA 4XO8A 4XOBA 3KDPB 4JQIH 1BG9A 4XVTL 5HHNB 1OP3K 3GUTB 5D7SH 2ZXDA 5EFIB 3NFNB 3CSTA 3UL4A 2M83A 4GAAA 2EDOA 5DRZA 1F6AB 2DLTA 4HPOL 4MCZB 2G2NA 4PWIA 3NIGF 4BEIA 9PCYA 3RJQB 3ZQWA 1UD4A 3QPQD 3EYFA 3NSJA 1MFCH 5D7LB 4YVNA 3CVDA 3HMXH 2KLSA 1DBJL 1MWAH 4JPVH 4OCWL 1TJGL 1A47A 2EKJA 3UYOD 4HUXB 2AJSH 3POHA 1BYOA 2VQ4A 5EU3B 4PY7A 2FGWH 4MNGE 3X13A 3F7PC 4S1QH 2DWXA 4LHQB 4ZTPH 3U4EA 3RIAK 1E43A 5IGXH 3BAEL 1DBMH 4L8CA 2H6PA 3WIFB 4NQED 4KZDL 1D7BA 4Y5YC 1N26A 3WSQL 3SB3A 3C5ZD 5DRXB 5EPMA 2C3HA 4XX1G 3HNSH 1UZ8A 5DUPH 5F0LB 5HDBF 3C9NA 3ROLA 3T3ME 4A6YL 4R83A 2XQYG 3DJ9A 1HESA 3B2UD 3CJJA 1DCEA 4KTGA 4ACPA 1OAXH 3D85D 4RBPH 5FFOA 2HT3C 3IS1X 1RFDH 1YN7B 4ZFFB 4YSDA 1KBKA 4TNWK 3BP5B 4YSRA 2NW2A 4HS3A 3S34L 1FNAA 3PP3H 4UF7C 5C09B 2XRAH 5GZOD 4WGKA 1XIWA 1OT1A 3KGRA 5CJOH 3ESPA 3U1SH 1Q0YH 2YR3A 5DUJA 2VC2B 5FO8A 4GUOA 3FTUA 1OB1B 5DT1H 2V2WB 1SZNA 2OS7A 5C2BH 3QORD 4RSVA 1PTZA 3AY4C 2D2CC 5C0DB 5C0BA 1IKFL 4JHVA 2ICWB 3OB0K 3MLUH 4FFVD 3TBVA 1EAOA 1JUFA 3FT3B 3JVGA 4Q4IA 5AVWB 3SDCB 4BKTC 4BRJA 4DP5X 3CAFA 1A6ZB 3P3RA 1HILA 2BIHA 3F2LA 5DEFA 4E42A 1OIOA 3CZGA 3HG2A 4BQ8A 3MLRH 3QWOB 5GHWL 3T0VA 5IVNA 2ZCKL 3SZKC 2VM9A 4B97A 4L5FL 2Q0ZX 1WDAA 1ZRUA 4Z7VB 3HRZC 4KVCH 5IEHB 4GAGL 1CE1L 1KXVA 4TVPE 5EUOE 3S35H 4NKIL 1WBZA 4AQOA 1UWFA 1A3RL 4PV1C 2IOIA 4XPTL 2WAQA 3NCFB 2OI9B 2GHZA 1XH3B 4GAGH 4GS7B 3F7KA 1F8TL 4TNVK 3WTVA 2IV8A 2W9EL 2FVNA 4OU3A 1S8DA 4KX9A 4JM2C 3SYAA 3U4BH 1AHMA 4N2IA 5DJZA 3LQZA 1YDPB 4XXDB 4JG0L 4BFGA 4Z0XB 4H20L 4YUEH 4NHCH 3G5YB 1HHGA 3QORC 3SCMA 4QAWA 2LFGA 1JPGB 2PPDA 3PP4H 4JFXA 5JW4Q 3C75A 4XMPH 1IM9D 4HAKA 1GMEA 3MRKB 1AQHA 2CHNA 4AJYV 1YC8A 3RIKA 4D0BA 5IBLD 5L2KA 2WQAA 5C8JB 2A4EA 2IQAB 2WXQA 1XSJA 2JKJA 4R0LC 1UB5A 1Q0XL 2KPWA 2Q76B 1UWGL 1M53A 5J9PB 1BLNA 4V1DD 4XP6L 1IT9L 1FNEB 1SYSA 2WXKA 3E8UH 2EDEA 3EJYD 4LLUA 4L3EA 3L5HA 3VFNB 3WL9B 3FU3A 3B2UC 5I1HL 2VGLM 5DO2D 4J3OH 3NCXA 2VR7A 5E0FA 3NJVA 4TRPL 2CBPA 1CR9H 3D3VE 1FORH 1OAXL 3WLWD 1HXKA 4BWWA 3MRMA 3PWVB 1RIHL 3ES6B 3FB5B 4Z7OE 1ILSA 5HHME 1WAAA 1B4RA 1AOHA 4JFOB 4KROD 1GS8A 1FO0L 3CFDB 5CAYB 2GCYB 4N0UA 4LRIC 4WNSA 1D2PA 1NOAA 5C3LD 4AI7A 4DPBX 3K1DA 5AYQA 5CWSA 3NCYS 3SDAC 5IVOA 5ICXB 3KWXA 4B9KC 2Z7ZA 2GK0A 2K4AA 3GSRA 3QJFB 1MIEH 4L4VE 1LP9B 1KJ2H 4XGZA 4PJIA 1F97A 2P1YA 2XA8H 1IKFH 1KCLA 4IIZA 3GSOA 2XXCB 2X3BA 2ZXWB 1OAQL 3DHMA 3K2KA 3O11B 2ED7A 4J3OC 4HUVA 3FT1A 1BAFL 1M2OA 4AV0A 5TQ0L 1X5JA 4BCZA 2NNCA 5IIEB 1JDDA 1T4KB 4B27A 4TOYH 4Y4KC 1FZKB 3CC5A 3EYSL 1E6OH 5DYOB 4X5WA 1W8NA 1MQ8A 3ZZSA 1FG2B 2AZUA 4G6KH 2XY1A 2YEQA 3G5XB 4I4WB 5HYQA 5A2FA 1BVLA 1NCBL 2J43A 1DQDH 3MRBA 2E7LC 1SLWA 4XNAA 2E6PA 2NXYB 3HC2A 5C92A 4G70B 1JRHI 4GLRH 1AIFA 4XAKD 3QFDA 1P1ZB 4JHWH 4DAGL 4NRYB 1IKNA 1SJEB 2EIZB 2IAMB 4K3GA 5TQ0H 1FAKT 4PJGF 5C07A 3F7YB 4P57B 2WXHA 4ZAKD 3X1GA 5ANMA 3U2JA 2X4UB 5MERA 1B0IA 5MEOB 2EVHA 3Q5YA 3MSPA 3U0PA 3HC3H 2GJRA 1UWXK 4N87A 4JZOB 2JXMB 3MJWA 3PL6B 1IBZA 2WXPA 4A6YA 1V5JA 3ZUCA 1DBML 1X5GA 2QVMA 1NKGA 3MTRA 5ADPH 5D7LA 3S37H 3G6JA 1FFPA 2EC9U 5E95B 2WUCL 1OWWA 1FRGL 4YE0A 3AXLB 3ZDYF 2DTML 4J3WA 4ISVB 3CVHH 1QP1A 1EZSA 1CDBA 2CBMA 4U2ZA 1YN6B 1FWXA 2QMJA 4FXLA 5M7QA 1BZDA 2PTTA 4H88H 1DZ0A 1N7MH 2VR9A 3LOWA 3Q5OA 1G7QA 1TUPA 1W6LA 1MRDH 2XTJD 3KPPB 3WTWA 4WFGE 2OJZH 4HD9A 1E6JL 3WU1A 5ESAB 2F0CA 3OMZA 3VU2A 2FBJL 4XPGH 2XWJA 3K1KC 1UH2A 1PJWA 4MX7B 3UTSB 1I8KA 2DEYX 3LKSB 2ZUXA 3W39B 4O5LL 1KOAA 2F19L 3BZ4A 3UG5A 1U30A 2JLPA 3FUIA 3KCPA 4W9FC 1RH8A 2CO2A 2XZAL 2XWDA 3RTQB 4Q6YA 3FQUA 1R24B 4XO4A 3NCYP 5A6IA 1V3KA 3DVNA 3LTVA 2ARJB 5F96H 4F37K 2Y5EA 1UACH 1FFNA 1OCWH 3L16A 2VLRA 4J8QA 2GBUA 4TMPA 1XGRB 3RRQA 4L29A 4MD4A 2YSSA 4XMKH 1CI3M 4Y4KD 2VLLA 1E27A 3VGGA 4NBXB 4PRAB 2Y36H 5SWSB 1V3JA 1OE3A 3ARED 3JV5A 4BQ9A 5KAQF 5D1XC 4HIHA 5DK2B 4HFUL 1NC2B 1MFDH 4E5XB 1MHEA 3EOTH 1TTFA 2FQDA 1QTPA 4LSVL 3ETSA 3SZ6A 5K1JA 3KLAB 4Q2ZB 1BAWA 5DHVH 3KYAA 2AFNA 4MBRA 3OZLA 4DT2A 4KMLB 2LOEA 3NSYA 5EZJA 3CLEL 4WNQA 1B0RB 2EZ0D 3OKKA 2B77A 5BV7H 5C0BD 2YXWA 2WBXA 5IHUL 3MLUL 3OJ2C 1X5LA 1NCWL 4G8GE 5CFHA 1C5BL 1WC7B 1FNEA 1SYSB 1DQTA 4ODVH 4Y4HC 2JK5B 5T3ZE 4L8BA 3TYFA 1GYAA 3RDTB 1E2ZA 3LRMA 2BX5A 3E6FA 3WLBB 2XDHA 3NSDA 3PQYD 4GSUA 3S88L 2OPCA 4XC3H 1U58A 2HWZH 4FNQA 3ZDWA 1L0XA 5KYYA 3NK4A 3H9ZA 5H37A 5MEOA 1WQVT 3LN5B 1ZHLB 4ZTEA 3MRIB 3DWTA 4GYBA 1GYCA 3STLB 1CICA 3PDDA 2IAMD 1GGYA 4FQIL 3NEXA 1MLCA 3ARQA 2QVFB 1YEGH 1NICA 3O9WC 4Y2OB 2F54E 1U8CA 1Z5LA 3VYOA 1AGEB 4KO6A 2XBZA 3IETB 5DMGC 2NTFB 3MCLL 3O6MH 3KVDD 3RVWC 1J87A 1XTMA 4IKIA 3GIZH 3GSOB 3VXOA 1KG0B 1UA3A 2GTWB 2OMYB 3GZKA 3B2DC 3HBGA 3R0NA 4F93B 1JZ4A 5HHMB 3ZHNA 3RY6A 2WCGA 2NUPA 4LASL 3R19A 1RZ8B 4N2HA 3RNQA 3C5JA 2Y7SA 3BEWA 3S36H 5D7JA 2XN9B 1MJ7H 5CCHE 4G9FD 3GXMA 2CO7B 3O3DB 2LLLA 3QBTB 4CAGA 3HNVL 3WN5C 4ZK8A 2O6CA 4UTBA 3HMXL 4UQDA 2Q7YA 5FGRA 2VQ1B 3SPJA 3HJ0A 4X8JA 3WMQA 4QLRA 3MREB 4WFGD 4LL1A 2TRHA 3VD0A 2ZG3A 3ZRSA 1WFJA 3HBZA 1BYPA 2UZIL 5ABAA 2CO6B 3FQNA 1QQDA 4BKLB 4K71B 3G04B 1L9MA 4N0YH 1L5GA 2JJVA 1UZ6F 3ARFA 4OTXL 4Y5YB 4UTBH 1JYXA 1JZHA 3VFSA 2NOYA 3MJ8A 1CFSB 1ID5I 1IGMH 2Z7YA 4QHNA 3O0RH 2BNRE 1FQ9C 3LEYL 4CC4A 3RFZC 2HXAA 2NMSA 3CDZB 1JV2B 2HKFL 3INUL 1LK2A 5F7NC 3QO0A 1U21A 4I9WD 3RY4A 1W8OA 3WFZA 2ZJSL 2Z7WA 5SWSA 1FVDB 1HL4A 2CDFA 2SEBA 3VXRB 2EUZA 4KVNL 4MD0B 2JE8A 4V1DB 2EO7A 3AWGA 3DHJA 3O3AA 1IAIL 2V8MA 4I85A 4M3JA 1FZJA 3QHFL 3CHRA 3W82A 3P11L 4P4KB 2D03L 5IOPB 4LLMA 2ZCHL 2BP3A 3H2QA 3FT2A 3QZLA 2Z8RA 1XGUB 3GGWB 3F12A 4ES9A 2MIZA 4ZUWB 3D3VD 2R2HA 1VEOA 4RQQA 5LGJA 3GHBL 5JHDD 4ONHB 4Z7VE 1GXEA 3JWDL 1BQLL 3NRFA 3OG4B 2ZNWA 4WJ5B 5D7LE 1IBDA 3QIWC 5J89A 5IR1A 3DOSB 1YNLL 1Q9WB 1IM3A 4G80A 2PO6B 2KQNA 1PFCA 5KANG 3BZ4B 4JCMA 5L0QB 1NSNH 2AJYL 1S7WA 2D7OA 5TH2A 3HE6B 2J2ZA 4HKJB 1YY8A 4RFNC 2PMZA 1SBSL 3TVMD 4KK9C 4KZ0A 1XWVA 1OGAD 2QPDB 2BSCA 2NY6D 1Z9MA 1T7VA 2X9XA 4ELMB 1H3PL 5IJBC 3LKOA 3QDJD 4P3DA 4AM0A 1A3ZA 3D0VB 1UXSA 1ODAA 4XCFL 5EEXA 3PWLB 3BSZA 4UM9D 4NO0A 2ZP9A 5L88H 1UCBH 4UTAH 2FT8A 5JQ6L 1JPFB 4MA7L 3SGKC 4I3RH 4Y4FB 3LB6C 4LPUA 5GSVA 2B1HL 2DY2A 3GSWB 4PUBH 4DKTA 3KLKA 2OK0L 2HJLA 2FX8L 1S5IL 2Q1EA 4EIZC 4XMLH 4R7NA 4UM8A 3PFUA 5F1SA 2VXQA 1X5XA 2JCCB 1GH7A 4PW4A 4JDEA 5DK3A 3IVKA 4MMYB 1ETZA 2Y2YA 2X4TA 3QFGA 3TC9A 5JIMA 1MJJA 4Z7WB 4AGNA 4MB5A 3RVVD 4IRJB 4PRBA 1JNJA 1WT5C 3GMLA 4PWHA 4XBPB 4P9ML 4HHAB 1ZSDA 1OP5K 4YDJA 3L3OB 2AV7A 1XGRA 3VFUB 3L7EA 4Q9RH 2XA8L 3L3IB 3FSAA 3PUUA 3OMAB 4P2CG 5EO0A 1R33A 2HVKB 4PRDA 2AEQL 1MIEL 2WINA 5AVZB 4QCIA 3RNKA 1IVTA 1R4XA 3LRKA 1F4XH 1P2CB 3IMRA 3A3YB 2KHAA 3ABLB 3ARBC 4MJ5A 2WYIA 5JHDA 3OV6A 3Q7JA 5TF1L 4AMKH 5JIKA 1OHQA 2VDQL 5ELIA 3VQ1C 3D39B 3NIGB 5FK9B 3LB6D 1DVSA 3BUTA 3N6YA 4M00A 2V4LA 3ARRA 1H8SA 3C6LB 3DIDA 3KBFA 5K59F 1NCTA 1MLBB 3TO4A 4NO5A 2KMWA 5DUMH 2VL4A 3PPEA 4Y9FA 3PAYA 4ZW8A 5AUMB 2PWEA 5DD0H 3GKWH 1G7MA 1HL9A 1ZOXA 4D9RE 4KJYB 5KJRH 3WCYA 1L7TL 2TRYA 1KB9K 3V6ZB 2I60L 5JDSA 2X40A 3VGHA 1QSEA 3BGMA 4KFZC 1U4EA 4HU8A 3IKCA 3KJ6H 1KG0A 2OMYA 4AUYA 5DD5L 3VXTA 3VQMA 1HOCB 3N41F 5C0GA 2FEJA 2A77H 3DI2B 3TV3L 4YHNB 4F15C 3UP6A 4PGCB 3EYVA 4R4FH 1G7IA 2NUPB 3ASWA 1AR1D 5IMLB 3S3JA 5LQBL 1TEFA 2LU7A 5GGRA 4PTUB 2UVFA 4PSRA 2J73A 1CXIA 4NHCL 3IMVA 1LK3H 3EFDL 2DQEH 3KCWA 1LLAA 1S78C 2F8IA 3I50L 4P2QE 5J1AA 4YDVA 2YD3A 1UUNA 4N0UB 5GS2D 1TZ8A 4B9YA 2G30A 4LGPB 4P2RA 3FN9A 1GGIL 4JPWH 5I1LB 1FGVL 1T03L 4XPTH 1HI6B 1R3LB 3T6VA 2QKSA 4FMFA 1T2QH 5EBGA 5TK2A 4DEPC 4Y88A 1JGEB 3CC1A 4G42A 1ZLUH 3NN8B 2WO4A 4NAQA 3QQ3B 5D93B 4NZUH 5D96C 1U3HB 5LCVA 2A74C 5I6XC 3D52A 2FEDC 4G6JL 4NCC2 4Y1AE 1NMCB 2BHYA 1P9MA 4L0ZA 3JWOL 2XN0A 5GZOA 2Y1YA 5JA9A 3QDJE 2YN3A 2GTQA 3IDXH 3ULUL 5F96L 4Z76B 2J6EL 3W0WA 5FGBA 5F1IB 3FUFA 4DUXA 1TQBC 5FYJL 2CA3A 3LKRB 4RGNB 2CH8A 4JDVA 1J5OH 3VXSE 6FABL 5LAXB 2X5PA 4B3VA 4H25B 5ETUB 3NABH 1RURL 1JGLH 1YMMB 2DQJL 4JFQA 5I6NA 3UEQA 3UROR 2ATKB 1XO8A 1KN2L 4YE4L 3DX9A 3O8XD 4O02H 1L6PA 3M45A 5IMOA 4F8NA 3EDKA 1M05A 4R90H 4NCC1 5J6HA 3UJIL 35C8L 2P5EB 4IIQC 5IMMB 4PJDF 1IFHL 3FDWA 3MV8A 3DGGA 4JZOA 4PJCB 3RX9A 5KZCB 3S9DB 3SDCD 2HKHL 5JHDB 3I9GH 4TL5A 3OAYH 1HU8A 4ETQB 5IQ9A 1U8IA 4P07A 1QLRB 3Q8BA 3QUKB 4JPKH 2E59A 5SV3A 2KC0A 2VZ1A 3FCGA 2ZWYA 1PD6A 5HHQA 2QSCL 3W9DB 4AEFA 3MA7B 1IAOA 2BSRA 1R9FA 4AOFA 1G9NH 2L0DA 2EH8L 1E5AA 3BAEH 4JDZB 4PN6A 4OD3L 3HAEG 3GFUA 4PS4L 5IBLC 3DIFA 2EH7H 4HFWA 3DSFL 3LNGA 2UZYA 2B59B 5IJDC 1CIUA 2QTEA 1U4FA 1CLVA 5FO7A 3RL1A 1BGXH 2OTPA 1CU4H 4LSTL 4X6FB 1LYQA 3VFWB 5DJ0A 4DVBA 2IWFA 5ALBL 2BIPA 4PJ9C 4GSRA 3VCLB 3GMNA 4XPBL 4Y9EA 1LWJA 2DDQL 1IEBA 4EKXA 4HHWA 4RMQA 1G9EA 2BZCA 2J71A 3GS7A 4O51A 4DKFH 3VFRA 5CD5D 3LKPA 4YXLH 4HHAA 2DBJA 3PU7A 4S1DC 4AKOA 4IGBD 2E3VA 5AKVA 3MYZA 3VGAC 1VPOL 5ID1B 4AEEA 5DZAA 2CUMA 3GMPB 3HTLX 2P5ED 1N8ZA 3M8OL 4N90E 5AOJA 1RIVH 2C4XA 4XE5B 2R2EB 1QBBA 1U33A 4O58H 2AAAA 1C7SA 3VE0A 4HEPG 4LP5A 2QKIC 3PWJA 2E4TA 3IDYC 2HTKD 2EIEA 3ZO9A 1MPAH 3B5HA 4HC1H 3QG7L 2RCSL 3JWNC 3GPSA 5B8CA 4N2GA 3M1BB 4ODSL 3QXDA 4HJJL 2QSCH 4CW1B 4E9VA 3L3JB 5KS9F 1CTNA 3GBEA 1G4MA 4Q6KA 4DP4X 1TJXA 1YEIH 2XZCH 3AG1B 3BPOB 3MO1B 2IBBA 1NPJA 4IU2B 3US9A 3BO8A 4DKDC 1JHLL 5ERWB 4E5XA 3NN8A 1ZAGA 1MSPA 1T0MA 3V8CA 4P2RD 2P5WD 5LGKA 3ME0A 3QNZB 4LRNH 5T1DL 5HYSA 5BW7C 1GGBH 4CBZA 5AAWC 2H3KA 4GG6A 5IBUB 2XC8A 4GQPH 5L2KE 1VKXB 1ZJBA 1VLXA 1Q9OB 1KIUA 3SYQA 1IGFH 1QSEB 5I0ZA 4YH6A 4F57L 4AQ8C 4KK8D 3TEXA 4G5AA 1CLZH 2FCBA 5ESVA 1U3HC 3P40A 3VI3B 5AKSA 1AACA 2RA1A 4NO3B 3JWNH 5JNYB 1YLBB 4JM2D 1CLYH 4AGQA 3DX6A 5G4MA 2DYRB 3P9WB 4Y2DB 5EU4A 2D3VA 2Y25A 1K5WA 1QI4A 1JWMA 1YPZE 4FP8H 4OAWA 2NZ9D 2VDKL 5B39A 2ZUQB 2Z65C 3S8GB 3MKGA 2D7TH 2IGTA 2ZQKA 4P2QD 4NPYB 4DK6A 2W0FA 5CILL 3HE7D 4XRCA 5JOPD 4LPTA 5IW6B 3FQRB 4GW1A 3UBXA 4PJIE 4PYGA 3LHAA 2A9ML 4XP1H 5DJDB 5A3ID 3DGDA 4OGAD 5FDWB 1S78D 4PJ5A 3H9SE 3CFJB 3QIBB 5AOKA 5KBNC 2GFBB 2AEIT 4JPWL 3KD4A 1SUJA 5IWLA 1DL7H 4KDTC 5CJXC 2VDRL 2VLJD 4ELKA 4P0DA 4ENEC 2PXYB 3PWNA 4YQXL 4L2YA 1NH6A 4EF3A 3NJMA 1ZD6A 3IFPB 3VM7A 2H2PC 5J7CC 1KEGH 1KULA 1TYEB 4PLKC 3JWOC 4UT9L 2VJXA 3C6SB 4U3HA 5BZWA 2BOBA 3ROLB 3F7RA 3UDWA 2IH1A 5IP4A 5H4YA 1MFAH 5FV1L 4HWBA 3DUHA 2P8PB 2AGJL 4X80L 1CGSH 3QIUC 4NRXB 3TPUA 4GUPB 2Y7QB 1NGQH 3KM1A 1TDQA 3IJSA 3MREA 1MCPH 2CNZA 4Z95H 3RTQD 2DB8A 3AJ7A 4QGYA 4CC1A 3ZMNA 4CA4A 1CFQB 1FVCA 3CVIL 2ARJQ 3BWUC 3T1FB 1ZLSL 2NZ1A 3WFCH 4CADA 4FFVC 1ET5A 3MRPB 3U1SL 1CZ8L 3AS1A 2BWDA 4J3OD 4LCUB 4XBMA 1XV8A 2CBOA 4KNTA 4XI5D 3HHSA 2FUQA 2C1PB 3IGAA 3NZ8B 2B3IA 1BDYA 2DQHL 4P04A 5FOBA 1IM9A 2H0EA 2LE9A 1GW0A 3QUKA 4P5TA 3UO1L 1VERA 3VFOA 1VHPA 4QKTA 5E8OA 4TN9A 5T5NF 5GGVY 2DQUL 3FT3A 2OXHA 2OZNA 3VI3F 1XGQA 3NFNA 4LQFL 1NAKH 1WS7A 3QQXA 2VIRB 4QF1B 2PPEA 3HMWH 4JO4H 4GAYB 1FIEA 1Z66A 4JY6A 4ZUUB 1GOHA 2G3XA 3OSKA 5BRZE 1ZHKB 2G75B 4LOEA 4CSSA 2O6EA 3ZY7A 4IBUA 1GCFA 5GRXG 5LWYL 1GKEA 2CRYA 1BXXA 3FT2B 3L4VA 4MWFA 5DTFA 4D0CB 3Q0HA 3T5WA 3V79C 2XWTA 2IBGA 4R97B 2YD1A 2PYEB 1G1YA 1SN5A 2KPNA 4G43A 1KBGL 3MLSH 1HH9B 4KMTH 4QT5B 3SE4A 1T5XB 5DRZB 4JREC 1OSZB 3IJEB 4CUCA 1BPVA 1NGZA 2D0FA 1EEYA 4YHYC 3PIQA 5EO9B 2X4RA 3DOIA 4Q4EA 4RLDA 4HIEB 5LO7A 5L8JB 1I1YB 2PP7A 2BWQA 3FONB 3QAQA 4MMXB 4TVPL 4O51B 1KCWA 4H7VA 1ZTXE 2OSXA 2JIXD 4M4RB 2BO0A 4D8PA 3LEXB 1ZPLA 2AK1H 3TM6A 3SJVD 4HWEH 3LPOA 4G1MB 3C08H 1LEGB 2FZ3A 5HI5D 2A83B 1GL4B 4KKPA 2R8SH 1XIWC 4A2MA 1FE8L 3HI5H 4JKPH 4BKSC 1SMOA 2CQVA 3TH2T 5HI4D 1YYLH 4FG0A 2UUDH 3EYUH 2GTZB 3QR0A 4MA7H 3OR7B 2UZYB 1CWVA 4YBQC 1HYRC 5L0QC 4NPYA 1YZZA 3RJDA 4NZFA 3UIYA 5KVEL 5L2KB 5LNGA 3O4LE 1JZGA 4AQAB 5EZIL 3UPAA 3I3BA 2QT6A 3M1BA 3BN9C 4M6NH 1CT8A 3TEUA 2C3XA 5GSVB 3BRDA 5DJAA 2WTRA 3BGFB 5DFAA 1F02I 3UTPE 1SN2A 3K6SA 3KBPA 4AYBA 1VAHA 3WIIL 3SKNB 2VXQH 2Z1PA 3CWGA 3LEVH 4Z8FH 4Y19E 4YO0B 1QSFE 1T3FA 3NPSB 4I8DA 2YAPA 3AMKA 4AG4H 5DEGB 4JDTH 3JSSA 1FL6A 2VQUA 1I3GL 5DJ8A 4J6IA 5BXFB 3Q9PA 4HKZB 4AZ8A 3IFPA 5IEHA 5AVTB 2TSBA 1P7BA 1T66D 5LBSL 1EEZB 3ZT6A 1J8HA 1LQBC 3CN1A 3CPLA 1WBZB 4LKXA 5CU5A 2YRLA 4FFZL 3CH8A 1AYOA 1BJ1H 4XNQA 3IU4H 1KLUB 1W8EA 1OE1A 2VLJE 4FMKA 4PJXA 5MP6H 2YKKA 5C0FA 2VH5L 3ZDYB 3EHBD 1OAZH 5DO8A 4KPHH 5B3SB 3PGFL 1UASA 4NUJB 3SDDD 1FSKC 2LR4A 3QDGE 1JS4A 3RL2B 3B7RL 1J9TA 3TT1H 3D51A 2ENYA 4P2OC 4ODUA 4YDMA 1D9KC 3BAJA 1JPGA 3RWJA 2UY6A 1KYOJ 1WFTA 4NUPA 1MVYA 3B34A 1ES0B 3GM8A 5HVFB 2Q8BH 4BFIB 4Z8FL 1LO2H 2WIIB 1B2WH 5JDJA 1HHKB 1VRSA 3H7BA 4L9DA 4IBSA 2V8LA 3FFOA 4Z0XA 4DERA 4F1ZA 5HDQH 2YUZA 4HULB 5FOBB 5I73C 2JI2A 2EO1A 5IF0A 2VDQB 3NJIA 2FTAA 1XF1A 3MU3A 3SQOH 4JHBA 4ZFOL 2ZOKA 1IBHA 2R83A 3FQ1A 5L2KD 2HFEA 3L1GA 2WLKA 1PAMA 3WDIA 5C6TL 1XD1A 2IDSA 4RRPA 4P5RA 1KY6A 2NLJB 1CF8H 4LP4A 2GJZA 4GI6A 4AV4A 2F1EA 5ANMB 4KJPD 5CEXA 5IB2B 5KSVA 2JCWA 1GSMA 1JWMB 3QRLA 4IGBA 4PJCE 3SGEH 4E9SA 2AHIA 2CE6A 2FJGB 2OMZA 3I02A 3BH4A 3DXAB 5EC2B 2HJFB 2GCYA 1F45A 3K5RA 3PJSB 2DLIA 3EF4A 3UBHA 1R3KA 5FO9B 1QFPA 4XCCL 4QNPF 5F71A 1KCRH 1XGYH 2ZYRA 4N90D 3TBYA 1CGUA 2FSDA 3SQBA 4KMTL 3S5YA 5B3JF 3O9WD 2E7MA 3VXSB 3WL9A 4LDEB 3FFCE 3N42F 1QAWA 1R46A 1EO5A 2Z0BA 3BGAA 3CSYB 4OFYD 2EAEA 1HHIB 5IUSA 1T0NA 2ICES 5FYKD 1DJGA 2O72A 4U1JB 1AC0A 2LAAA 1G7QB 2GJ6E 1FAIH 4NQDA 4P2QA 4A63A 2BVOB 2Y1ZA 5FGCE 3HVNA 2JIXA 4W9EC 4RDBA 1NJ9B 1MCLA 2W60B 5DC2A 1W0WA 4OD1L 3DTDA 5KSUB 2MNWA 2Z7UA 1YEJL 3TBSB 4JRXE 4EUPB 5IB4B 4IRZA 3CFUA 3DROB 2XG5B 5JW5B 5C09D 4IBWA 3L5XH 4EIBA 4P2AA 3NJLA 4JY6B 2VLKA 1A0QL 4G8FA 2B8OT 5DMIL 3S88H 3MOBH 1KXTA 3S35X 1IAKB 1ZVSB 3MFGB 1OCRB 3KS0H 1QHPA 1NL0H 1UFUA 1R3IL 4FXKA 3GEFA 3HC4L 1HIMH 1KTLA 5JIIA 4BRVA 1D2OA 1JPSL 5D1XB 2R56L 3WMPA 4U6YB 1CUOA 1ND0B 1T6VN 3RX5A 1AMYA 4KBPA 4PBVC 4ENED 5GGTA 5DFWH 3W5NA 1XGPB 1OK0A 1JZJA 3Q05A 3PIQB 4M43H 4YGVB 4X80H 4WEMB 2FT6A 3MX0A 3BVWA 1JZ2A 2Y2TA 5J6HB 1FFPB 1GZHC 1EWHA 1LO2L 3ASNB 4KROC 4LPXA 4Z7QF 5D7JD 3I6KA 2MNUA 4APQD 1X44A 3QXAB 4X2UA 4CSPA 1ZIAA 1BBJB 5HTSA 4XPFL 1M42A 4HXAH 1KEGL 3I6SA 2F53D 1CL7H 3IT8D 4XP9H 5D2NA 1KTDB 2WP3T 1OP5H 3ARGC 3QQ9D 2FJSA 2BNQE 3V0GA 2ZOTA 1XF5A 5IVZA 1HC1A 3RTQC 5C07B 3T2LA 3GSVB 4K5OA 4OF6A 5JHBA 1MCOL 4Z18A 4WU7A 5AW5B 3KPPA 1I3VA 4AENA 1HH9A 4IEFA 3VNYA 3Q2NA 4HUMB 3NSXA 3TO4D 5EN2B 4JFDB 4UQ2B 2YKLH 1U41A 2RMNA 4R7LA 4Q0XL 1BM3H