1NPJA

Crystal structure of h145a mutant of nitrite reductase from alcaligenes faecalis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
ATAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWAVVSGMNGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reconstitution of the type-1 active site of the H145G/A variants of nitrite reductase by ligand insertion
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 89
structure length 336
sequence length 336
chains with identical sequence B, C
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2003-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1npjA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1npjA02
1KV7A 2XV3A 1DZ0A 1KDIA 2XXFA 2BW5A 9PCYA 3JT2A 4BXVA 1WAEA 1ZV2A 2R7EA 2EILB 4YSQA 2TSAA 1PMYA 2QDWA 2GIMA 5A7EA 5D4IA 2XV0A 4KO6A 1QNIA 2FT6A 4W1TA 3SQRA 1FFTB 1AZBA 4F2FA 2ZOOA 3FSVA 4YSEA 2FTAA 1JOIA 1OCCB 3NT0A 7PCYA 3N55A 5F7AA 1EHKB 2XLLA 3UADA 2BWIA 2YAOA 3WI9A 2I85A 1OF0A 3RYMA 4DP0X 4DP7X 2MRYA 3T6XA 4DP2X 1GW0A 1L9TA 3AY2A 2IDFA 1R1CA 2BZ7A 3UAAA 1SJMA 1A65A 3EH4B 4P5SA 1N70A 2IWFA 3T6WA 5B7FA 4HCFA 1X9RA 2VM4A 4E9RA 3DIVA 4AI7A 5I28A 1BXVA 2QT6A 1JXFA 2FWLB 2A3TA 4AKQA 2QDVA 4YSTA 4CSZA 1AQ8A 1ID2A 2YARA 4MFHA 3CDZA 4KOCA 4GXFA 1W6WA 1PLCA 2EINB 1NIAA 3FU7B 3OMIB 1W8EA 1JZIA 2BP0B 4EF3A 2EIKB 2YXVA 2H3XC 3KW7A 2GB2A 4BDVB 4E9WA 5D4HA 3EH3B 4AKPA 3CZUB 4BWUA 2XUWA 3DTUB 3X1FA 2EIJB 3CVCA 2YAPA 3KW8A 1NIFA 3WNIA 3IN0A 2AANA 4G70B 3CG8A 1HAUA 5I5MA 3OMNB 2WO3B 4HIPA 1L9OA 2Q9OA 3WIAA 5ANHA 3UACA 3TASA 2IWEA 2XX1A 3ASOB 2BP0A 3CVDA 3FSAA 3AG4B 1GS6X 4YSDA 4A66A 2W8CA 1JXGA 2HX9A 4F7KA 1MDAA 1BXAA 3V9EA 3IBOA 1NINA 1KYAA 2PCYA 2CCWA 1CURA 4DP1X 1SHXA 3NJKA 3NP4A 4W9ZA 1OCZB 1IKOP 3ERXA 4A2HA 1ZPUA 4UANA 3ASNB 4A67A 5I6OA 3D12B 3NJNA 3NJLA 4N4YB 2I7SA 3OQRA 3NSCA 1BYOA 1J9RA 2WO2B 4AX3A 1E65A 3NJHA 2YQBA 3QQXA 4HHGA 3WKPA 4QKTA 1F56A 3JTBA 3UGEA 2IAAC 3FSWA 1SFHA 3NYKA 2FNWA 3FQYA 3TA4D 4DPAX 2Q5BA 1GSKA 3FYEB 4CSPA 5EHFA 2XV2A 2UX6A 3TBCA 4WTQA 2Y69B 1ET8A 2GBAA 2VMJA 1L9SA 2YAEA 2R7EB 1AR1B 1KDJA 2DV6A 5B1BB 1RCYA 3QJQB 1QLEB 3WNJA 4BK5C 4YSSA 1QHQA 2N0MA 3NJFA 5TK2A 1AG6A 2X87A 1TKWA 4UF7C 1NPNA 4G72B 2HX7A 4QLWA 1FA4A 1ADWA 1L9QA 4NERA 2UX7A 1SF5A 4KO7A 3EH5B 1IC0A 4HCIA 2PP8A 2ZWNA 3X2QB 3AW5A 5IY5B 4GP5B 1J5CA 4NAJA 3ZIYA 1SDDB 2GC4C 2FJSA 3QJUB 3QJRB 1XB3A 3BVDB 3S8FB 3QJSB 3ABGA 4JHVA 4BDVA 2B08A 5B1JC 3ZBMA 3FS9A 6PCYA 1AZNA 3QPKA 1WA2X 1ZDQA 4F2EA 1IBZA 2CALA 1ZIAA 4DP8X 3X1GA 1CYXA 1GR7A 1ETJA 1WS8A 1J5DA 2NRDA 2Y1AA 1PZBA 2VSKB 1PZAA 2VM3A 3S3DB 3ABMB 2P80A 3ABKB 3NJIA 4E9QA 3FU7A 4E9SA 3QJTB 4A2DA 1JZFA 1JZJA 1OE3A 1EZLA 2CUAA 2QPDB 3NJGA 3OD3A 3UAEA 2DWTA 1SDDA 1NTDA 2IDTA 1M56B 4GP8B 4GYBA 5PAZA 2BW4A 3G5WA 4E9XA 2DYRB 3IEAA 1ASQA 5I26A 2LLNA 2OCCB 1HFUA 5B1JA 5B7EA 5I5IA 4GY4A 4JHUA 3X1NA 2XWZA 2BP8B 1GYCA 2GC7C 2YAMA 1WA1X 3X1EA 1JXDA 4FAAB 3TU6A 2AZUA 1AS6A 1L9RA 1BEXA 1JVLA 2XXGA 2VW7A 2IH9A 4M3HA 2BZCA 4NB7A 2JXMA 3FQ1A 4X4KA 1NICA 5AFAA 2HRHA 2XU9A 2IWKA 1L9PA 4DPBX 2JFCA 2YAQA 1E67A 4JKNA 2AFNA 4E9VA 1CC3A 2AZAA 2IDQA 3CVBA 1GY1A 2UXFA 4DP4X 3AZUA 2XVBA 1WS7A 4G7QB 2FT7A 1NWPA 3WKQA 3FU8A 1ILUA 2TSBA 2VSMB 3PAZA 3IE9A 1ZIBA 3NSFA 2HZHA 4HCGA 1TEFA 3FT0A 1WA0X 1MG2C 3AG1B 2DYSB 4A68A 2FQEA 3OMAB 4DP9X 4A2FA 2BWDA 3BQVA 4G71B 2YAFA 5B1KA 2PPDA 3SBRA 1BQRA 4YSRA 3EHBB 3U25A 1CYWA 3GDCA 4BWWA 5D4JA 3C75A 7PAZA 1OCOB 2EIMB 2XYBA 3FQ2A 1AZRA 4BWTA 5LDUA 3ZDWA 4DP5X 5TK4A 1ASPA 1OCRB 1AZCA 1AG0A 1J9QA 2BHFA 2UXGA 1TU2A 5I6PA 3HEIB 3PCYA 2VN3A 2JKWA 3IN2A 4L0PB 1GS8A 1N68A 1A4BA 4DP6X 6PAZA 2PP7A 2PPFA 2CBPA 3NP3A 1FWXA 2J55A 1PLAA 2GI0A 5F7BA 3SBPA 4KO9A 1CUOA 1B3IA 4AZUA 2UXVA 1V54B 2WSDA 1M9WA 4K9JA 3AG3B 1OE1A 1M57B 2OV0A 1J9TA 4HAKA 1BAWA 2MTAA 1BQKA 3L45A 1JZEA 3MX0B 2YXWA 1A3ZA 4PAZA 5FC9A 3NSYA 4YSOA 1JERA 1KCWA 1OV8A 3SBQA 4E9YA 1XB6A 3CDZB 4WKXA 3WG7B 3S8GB 4PCYA 2HXAA 3PXLA 4HALA 3PPSA 1VLXA 1SHWA 4ENZA 4G7RB 4GP4B 1KGYE 3ZX1A 1KBVA 4FA7B 1SF3A 1AAJA 1KCBA 3X1BA 5AKRA 4KNSA 2P80D 2J5WA 3TBBA 2IH8A 1AACA 4DPCX 2B3IA 2FT8A 1YLBB 1E5YA 4E9TA 2AVFA 4TXVB 4YSCA 5I6MA 3T6ZA 4Q89A 3UABA 3OM3B 1KBWA 1OE2A 2PLTA 1A8ZA 1SFDA 3H56A 1BQ5A 1PCSA 8PAZA 4N8UA 5I6KA 1PNDA 1PZCA 2RACA 1NZRA 1W6LA 3V9CA 1RZQA 3FYIB 4UAHA 2PPAA 2W88A 3T6VA 5I6LA 2IDUA 1GS7A 1URIA 2H5UA 4HHWA 1I53A 4YL4A 3FSZA 1AS7A 5I6NA 1HAWA 2E86A 2XX0A 2FQDA 4KOBA 4Q8BA 2UXTA 2YAHA 1MZYA 1E5ZA 4KO5A 4RH4A 2H47C 5E9NA 3ABLB 1MZZA 1IUZA 1NDTA 1ET7A 1X9UA 4YVNA 4P5RA 4YSUA 1NIBA 3FPXA 2BP8A 3HB3B 1PY0A 1JZHA 5PCYA 1TEGA 1XB8A 2DWSA 1SNRA 1PAZA 2HLEB 1BXUA 4G7SB 5I5JA 2I7OA 3GXUB 3EF4A 1T5KA 4AKOA 1AANA 5B3SB 3S3CB 1DYZA 3GYRA 1JZGA 2PP9A 3DKHA 3H4HA 3NSDA 2PCFA 1XMEB 1NPJA 1AOZA 1A4CA 3FPYA 4HZ1A 1RZPA 4KNTA 1RKRA 2X88A 4ZK8A 1AS8A 2GSMB 1AIZA 3MBWB 1ILSA 4KNUA 4BXSV 1J9SA 1UATA 2J57A 3S3BB 4A2EA 2J56A 2HX8A 1BYPA 2CJ3A 1MG3C 3PAUA 2ZXWB 3PAVA 3FU9A 2VW4A 1V10A 2OJ1A 4M4RB 1PLBA 1V55B 2PPEA 3QJVB 1PNCA 3N2JA 4YSPA 2BO0A 3AG2B 3H4FA 2QPEB 2VW6A 2HRGA 1E30A 2PPCA 1OOWA 1NIEA 4YSAA 4A2GA 1AZUA 5B7MA 2CAKA 2GHZA 1IBYA 1PF3A 1GY2A 2DY2A 3NJMA 1ET5A 1ZDSA 2FQFA 5AZUA 1NIDA 1NWOA 4YVUA 3T71A 1JVOA 2IDSA 1A4AA 3NJJA 1ASOA 2ZONA 3T9WA 5B1AB 2FQGA 3PLYA
chains in the Genus database with same CATH superfamily
3MSPA 3ESMA 5IWLC 3B8SA 1D9KB 3Q8AA 4U4IA 2KYIA 5C07A 3W0WA 3ALWA 1GJUA 3FB7A 4MJIB 1EXHA 4FFWC 4WZ9A 3WNKA 2DEWX 4BK8A 2GSIB 1HQRB 3VRJA 4QF1B 4XNAA 2WXMA 3U82B 1G4RA 3S3JA 1N9PA 3DX6B 3VFMA 1EO5A 3AGWA 5LGJA 1UZGA 3L08A 2X4UB 5GGQH 1PTZA 5KVGE 3VO0A 2O6PA 2JTDA 2HT4D 3V4VA 2W60B 3FSVA 1HWWA 4EQ2A 3CMOL 2YPLD 3M1OA 4M7LH 4GXVL 4NDMA 3V0VA 5G2NA 3V4LA 4F8NA 1A7BA 4HC1H 3IMTA 4M02A 4Q0XH 3NFNA 4K9EL 1I85C 1U3JA 3V8CA 4PQXA 5I1HL 5EPMB 3B6SA 3T6XA 4LL9A 3TVMA 4RZCB 5CO1A 5AL0A 5D2LE 4AC2A 1FNGB 3UCQA 4P2QE 5TDOB 4X7EC 1TZIA 4DQAA 3HI1B 5DQJB 2YOCA 2VM4A 4CADA 4XZ4A 1IFHL 2X09A 3U30C 3ARGD 1CICD 5J6HA 2JB6A 2HWZH 2XTLA 5IBTL 4KQ4L 1RK7A 1SLWA 3ROOA 2A3TA 3BSZH 4RA3A 1PKQE 1H5BB 2LVEA 3ARRA 2G0KA 4ZOCA 5FYLE 5GS1A 4P2OA 5DS8B 1PLCA 1ZMYA 1NIAA 2ILLA 4G42A 4IW4C 2BP0B 3AXIA 1JHLH 1N4XH 4EF3A 5KVEH 3RY6A 1NCGA 2H3XC 3OLEA 4Z5RA 5HY9B 1JGEB 1KFGA 1MWAA 3W2DH 2HLFC 3VGHA 5GSVB 2NYKA 3HR6A 3V6FB 3KYKH 4IHOA 1MW3A 3LYRA 1KIQA 1NEZG 4PG2C 4UM8B 1CU4H 3WNIA 2Z31D 4BFFA 1D5ZA 4PVBA 2F9BT 2OM5A 4K3DH 1Y0LB 1X9QA 1XIWC 2CLRA 1WFNA 3FN0L 2F7RA 1CXEA 5DUMH 5C2UB 5KVEE 2Z91A 3EO1B 1HE8A 4ISVA 4FQQA 4C83B 5B3JF 3CSTA 3I6KA 2DQUL 4PV9A 2VDLL 3SYQA 3DV6A 4RMVA 4WO4B 5D1ZA 2Q2EB 4Q52A 4YWGH 5JO5A 3M1CA 1DN0A 1DANU 3FBQA 3V4UL 1M6OA 1EDHA 1GPOL 5HVHB 1KYAA 4EUPH 4L4TB 5GS0H 4ZXBD 3AADB 4LSVL 1AY1L 1G84A 1IAOA 3MV7D 2YD0A 3MFFB 1ZHNA 1FO0B 3NJNA 3NA9L 4RRPG 2FJGA 5FUZL 2DLFH 3TNNB 4LASL 3QARA 3FDWA 5LCVH 3SPJA 5JPMA 2YXMA 3GIZH 3QFDA 3LRHA 4S1DD 3RKDC 2V5RA 1W8NA 2PETA 3DURA 1F4AA 3UGXA 3TA3C 1FFPA 3Q6GL 3MRIA 1ZHLA 3L7EA 3NYKA 4OLUH 1VDGA 3A4EA 4JFOA 3Q8FA 4LBEB 1GC1L 1ZT7A 4MJJA 2OPCA 1FYHB 3D2UA 2QADD 1ORQB 4ZOBA 3MJ9A 1QSED 2OX5B 1CLCA 5AOIA 5SV4A 2IAMC 5DMGD 1ONQB 2DLFL 1AO7A 1E9PA 1EK3A 1U3HA 3QUZB 1CDCA 2R4SH 5FYJH 1LQBC 1QLEB 1YDPA 1CWVA 3JV4A 3T0EE 2EUWA 4KXZI 4QHMB 3RLSA 2VZ1A 1CYGA 1FNGA 3TCXA 3LHPH 1MCBA 4Z7OE 4NERA 2WB1A 5J1AA 3CXHK 1A7QH 1H8OA 4PEEA 4PTTA 1K6QH 5HDBB 3KLHC 3OJVC 1LLAA 5HDWA 2P7TB 2DM7A 2IOMA 3GKWL 2QHRH 3ULVF 4WFFE 4P23D 3SDXE 1BVNT 5E94A 1RIHL 3H53A 3VI3F 1KGCE 4EMZA 1HHHB 4H0GA 2VDNL 3MJWA 3V7MA 4EI6A 4IJ3C 1VF5C 4P46C 4OZFH 4YBQC 1ZLEA 1NCTA 4HBCH 4XE5B 2IAMD 4F7TB 1EHLH 2VDPH 3IPFA 3BFQG 4S11A 2P24A 4S0TD 1VFBB 1OAZH 1Q9KA 5LCVA 3CV5A 4L3EE 4V2CB 2CR3A 2FWUA 2M8XA 1KPRA 1J10A 3TF7C 1FL3A 1GR7A 2ADGB 3T77B 1U8IB 1S7WB 1XGTB 4U3SB 2ARWA 3C6LA 4JPKH 4YPGB 4ZAKB 5BXFB 1DJYA 3MV9E 1G9EA 4D3CL 3VXUD 4FE9A 5HJ3B 1PGRB 2BH0A 3ARDD 4G9FD 4ZXBB 5KVFH 1MNUH 2UY6A 4YHMH 4LK4A 1DQTA 3HMWL 4AQ1A 5DRZB 4DO4A 3PWLA 4HFWA 1WIUA 4K15A 4UTAH 2AJSH 4ZTPL 2EABA 5D7IE 1MPAL 1MJUL 5D4QA 5TF1L 3SE4C 1T3FA 2D2OA 3QZNA 4F8OA 4ZFOB 3MACL 4A63A 4GT0A 5EEYA 1WA1X 1LWRA 2BVPB 4HU2A 2PXYA 4FAAB 4APXB 2CKBB 3GJEA 1P1ZB 4GI9A 5CZKA 3OKYA 4OB5H 3P9LA 4Y8DC 5AVQB 5IROD 3TYFA 4J1UB 3H42H 1EH9A 3QSKB 4JFHD 2PYEA 3AQDA 3FH5A 2D73A 1NBZB 5E2UL 1NICA 3EYVA 4WUUD 2NY2C 1SEBB 5FM5M 3D18A 3NCFB 1U92A 3GBNH 3VX1A 4OV5A 4DNLA 4IBVA 4X6FA 1SQMA 4MNHB 3SGJC 2DQCH 5I74C 1MRFL 4KI5D 2A6DA 1E67A 4AZ8B 3LPPA 5G5DB 1CC3A 1A5FL 1MLCA 2WBKA 4LCWE 2XWDA 4HVBA 3GSVB 3SGJA 2EH7H 2XVBA 3W57A 4HSQA 2YGOA 2ZCKH 1ITBB 4Z23A 1ES0A 4W9HC 5JIKA 3E6FB 3BZDA 4X8CA 3TO4C 3DPDA 3NSFA 2PO6A 1AMYA 5CF3A 4L3EA 1T4KB 2EDXA 3GUTA 5FV1L 3MRBA 2HKAA 2VR4A 5CGMA 4NQSB 1A14H 2AK4D 5FM8A 2FJGB 4LLDA 4XTRD 1UVQA 4JR9H 3SBRA 4HGMA 3GLEA 5D4JA 4FS0A 4CC4A 4PRPB 3D3VE 4FQ1H 1F4WH 5SWZB 4FABL 2A74C 2ZKHL 4NUPA 4MA7L 3T3PB 3TZVB 3V6BR 3VG0L 5EIVA 2RFXA 3MRLB 4KY1L 4MD0A 1HHJA 3CHRA 3EBAA 1S7XB 1MVUB 4RGOH 2NW2B 2X1WL 2CNZA 2CR6A 1TKWB 3ULVE 3RUGE 1PZUB 1P5UC 3BP6A 2OBGA 3UPRA 4KZCA 3TL5A 2G3MA 4U0RB 4PV8A 3KD4A 2MCPL 3IGAA 2GAZB 2WVSA 2F54B 1X44A 3LNGA 4LGRB 1GHFL 2HG5B 3SPIA 2FX8L 1FNEB 4HAKA 1CO1A 4U3HA 1VSCA 1TQCC 4XPAH 3ZE2F 2V2XB 3FUDA 4OCLC 3KR3L 4LHUD 4HK3J 4PWFA 1XFPA 4N22A 4F8LA 4U2ZA 5E2JA 5FKAA 2C3HA 3HUJE 4R83A 1MFAL 2C9XA 1KGYE 1MKFA 2HN7A 4HLZH 3QHFH 5I1HH 5JPNA 1OAUH 1KCBA 1UGNA 3IU3B 2OMVA 3B1UA 4FXKA 5AKSA 5KTEH 1B4JL 1U8HB 4EI0A 4LSSH 5ABDE 2J5WA 2OR8A 2WANA 5GGRY 3BPLB 5KSAB 4Y2OA 1MNNA 3HHSB 4HOWA 2E27H 4TXVB 4Y19D 4Q89A 4CNIB 1G6VK 3QIBB 1CLVA 1S9VB 4P2CG 2P8PB 5FDYA 4AJVA 3ZKNC 3QUMA 4QTHA 1EBPA 1E4HA 4YPGA 4N8UA 1RAMA 4I3RH 4GH7B 3GXDA 3LY6A 3MA9H 5J9PA 5JOFB 4A6YH 5DZPA 1H3WM 3SDAD 5AAWA 4UDTA 4B3VA 1F3DJ 5G5DA 1UWEL 2X6UA 2QLVB 3GMLB 4KMQA 3Q06A 4LKXB 2EVFA 1GYWA 4OZIB 2C34A 3ZHLA 1EXUB 3OVUB 2ED6A 1IC1A 1Q90A 3WFZA 3DDFA 1VACA 3E8UL 3G08B 2HRPH 2HA1A 1HQ4A 4YGAB 3GI9H 5HDOA 5I18L 1MCKA 4L5FL 2KKQA 4DAGH 1VENA 3B3IB 2BCMA 3AT9A 4QRPA 1Q9WA 1S9KC 1E5ZA 4WSJA 5E6ID 2IV8A 1QBMH 2D7TL 3GJEB 3PFQA 3X12A 1GJWA 1MI5E 4DESA 5I6XB 3MO1A 1JZ5A 1OSZB 1PL3A 1H3TA 5D1XE 4RBPK 2B59A 4WEEA 2JCCF 1DLFH 5D7EA 5DLLA 1UOKA 4EI5D 2WIMA 5E6IB 5T3XD 3L4TA 3N9GH 5TDNB 4YHZH 1YYLL 2H32B 3BN9C 3FQNA 4BJLA 1C16A 5HHMB 2CUMA 4XC3L 1LO0L 4LQFH 1DQVA 3KPSB 4EZLA 1MXGA 2EUVA 5KSVB 5BV7C 3IU4L 5GGSB 3RWJB 3V5KA 5L2KA 5J11B 1OAUL 5C0BA 1T1XA 3S5LG 4OZ4B 1EPFA 2PYFA 1T0MA 1PW3A 1ZHBA 1RZPA 3O41B 4IOIB 1D5MB 4RSVA 1NLBH 3EDDA 4XO8A 4ELKA 1BEYH 3IGAB 2KMWA 1UATA 5EC1B 5ID0A 2UZXB 1JNHA 1SGKA 3L5JA 5AOJA 3QDJA 5FFOA 3UBXI 3V6ZA 1YRKA 3CCHA 2X9XA 3PAUA 2ZXWB 3PAVA 2ORBL 1V10A 1T5XB 5DLMH 3US9A 2JKIS 4UTCA 5CS7A 4I5BA 3TBVA 5EORH 4HMDA 1UA3A 1A3RL 1RZ8B 3FN3A 1UENA 4G1MB 4OD3H 3FULA 1M53A 4BZYA 3CN0A 4W4NA 4H5SA 4PGCA 1U8OB 5DWPA 5A2FA 1OGAD 5E0QA 3LV3B 3LN4B 1I8IA 3OR7B 4Y9GA 4V33A 2ZONA 5DI8A 4Z78B 3S5ZA 1KV7A 3RL1A 1HL8A 4GBXC 1AQDB 1RSYA 4P59H 3VH8G 2AV1A 4PP1C 1BD2A 1YEDB 3CLWA 3IVKB 4LLWA 4MAYB 2IAND 2JJWA 3MBXL 1UEMA 3CZFB 1QI5A 3D2UB 4PJIF 2QKIB 2PN5A 4H4NA 3KXFA 3F12A 4M93B 4M6AA 1MH5A 3MUZ1 2WLIA 3BAJA 3T2NL 2Y5TB 4OLYH 2FJHB 2EDDA 4EXKA 2VRQA 1AH1A 5GRZA 1MY5A 1LP9E 1D5RA 1T80A 1NMCB 2FTAA 3EFOA 1KSRA 1P7QD 4ZDHA 1ZA6A 4GOSA 4ZUSA 3IXTA 5DD5L 5E9DB 4M43H 4HUMB 4RZKA 1OGSA 4XVUD 4NNYA 2CPUA 1PCXA 4DQOH 5CSZA 4DFIA 2EC9U 1NM4A 4E5XG 4MA8L 2X7LB 2X4TB 3U0TB 3CFEB 3KBFA 4DTGH 2N1TE 1CTMA 2V37A 2RAMA 2ZP0T 3WKYA 5HYFA 2BZ7A 3L3GA 4YFEA 1A65A 3JYCA 3U36B 1BX2B 5I1KH 2Z4QB 3ETTA 1PKQA 3QS2A 4IEFA 1T83A 2AVGA 4Y9FA 3QXDB 4M1GH 5C09D 4H5SB 4NO0A 3X3GH 5KYYB 4LP5A 1N6VA 4UQEA 1BXVA 2NUTA 3V4PB 5E23A 5DHYA 4YSTA 4HP5A 4JKPL 4JK0D 4FXGC 3ZTJG 1KEGL 2WYZA 1T0NB 2EDKA 1EA9C 1PAMA 5EWIH 4WY7H 5T1MA 3RBSA 3HKFA 2JI1A 2WOBA 3LMJL 3C6LB 4AVHA 3GEFA 2YA0A 1DSFL 3CH1B 3GS0A 4WWKA 3SDDA 4AVIA 3DJTA 4HCRL 3LS5L 4ZYKA 1OGPA 2WLLB 2OSLB 2EUXA 1D6EA 2VLJB 5DGQA 5K9KA 3CVCA 4PCSA 1A6UH 1QKZL 5ADOH 1HL4A 1NANH 1HSBA 4G9DA 3CG8A 2AMGA 3CAFA 4LPUA 2H1XA 3D4ZA 3NCMA 3OMNB 4IGBA 2Q6WA 1Q4NX 3GTVA 3C60C 1XZ0A 2E76C 1JWMA 1LILA 4OD1L 4WCYH 3VFSB 2VR5A 3FQRB 1M1XA 1EEQA 1NCNA 5GS1B 4ODUB 3P4NA 3F00A 2NYYC 2VDOL 3D48R 3I9IA 3UOAB 5JHDA 4XAKE 2EVHA 4CJ1A 1YC8A 5A2AA 2MKWA 5HSFA 1JTPA 3OXRB 2WCPA 4M5ZH 1NINA 1WFJA 1JPFA 1KCRL 1R75A 2FRGP 3L1GA 4R97B 4ZSOE 4UTBA 1KJ2B 4UT7L 2VH5L 1V27A 3GZQA 4F57L 1CBVL 1OVZA 4JW3A 4RIRB 4NO0B 4QJ5B 1VEPA 1ND0A 2F15A 4C56B 2VLJD 1S9VA 4M9PA 3NJLA 5CGYD 5FA3B 1FZKA 1G9MH 5DUJA 3RZWA 5AW5B 3BHBB 3BZEA 1A1MA 4YN3A 3ZL1A 2QGBA 3U2IA 1DBBH 1F56A 2BP5M 3DJZA 3WFEL 3CK0H 4K94H 2Q86A 4H1LA 5LN8A 4IGBC 3N42F 1OP9A 3ZE1B 5IQ7H 4X4ZA 4JQVA 5DCCA 5JOEA 4UDTB 4EO5A 2N0KA 4PRBB 1GSKA 1G1OA 2VKXA 2WCSA 1RZJL 2XRAL 4S1SL 5EHFA 3N1GC 1PLGH 3NA9H 1GPOH 3QRLA 3V6OC 1FI8C 1BFVL 2LT9A 1FFRA 2R7EB 1EEZB 1THAA 3L3HA 2DV6A 3KPPA 4JDTL 4U1MB 4F15B 5C0IA 5IJCC 1RMFL 3GMRA 3LNDA 1ZHNB 3UYPA 1CDUA 2KPWA 5B21A 4EN3A 3PL6C 1JPTH 4HV8B 4JQIL 5TK2A 5A7BA 1AG6A 1IAOB 4MXWH 2ARJQ 4L1HA 3ZMNA 4UF7C 5GZNC 2RBLA 4NRYA 1EERB 2B8OT 4V1DD 4HHAA 1RUAL 2NY2D 2RGSA 5E95B 2R2EB 2AV1B 5C0ND 5F93C 3S4SA 4LEOB 5JHMA 4WI3A 1RJYA 3GTTA 2XG5A 2Z31B 3MZTA 1KTJA 1OF2B 5JW3L 1GC1C 1T7ZA 2NW2A 3IJEA 3P3SA 1OW0A 3HI6H 3FFDA 3E1ZA 2HJKB 4MZ3A 1JDDA 2I9LB 1W9XA 4LL1A 4UQCA 4O02B 2L0DA 4QRUB 5AL8A 3LQMA 2YLKA 5DJ6B 1UZ6E 3V0WL 4XN8A 3QJHA 4U1IA 1K5WA 1BG9A 3HG1B 1MIMH 2H4EA 1DBJH 4JDVA 3FS9A 2MQCA 3HTLX 4ZMPA 4P4KD 2O6CA 5BJTB 4L1SA 3FH8A 1QEWA 2OMBA 3C5ZD 3UP1A 3LKQB 1UHVA 1IQDA 3HCVB 4KX8A 4HKXB 4DP8X 5L4FA 2EQDA 4IK7A 1WJ3A 4X0NA 3GC3A 4W9DC 2A6KA 4MB5A 1I9IH 2YMXH 4I88A 4UMSA 4ZUWA 5JQHC 1UQSA 1N0LA 3FU7A 2UZPA 4J28A 1OARL 3G6AB 1JZJA 3AABA 1OPOA 1TETH 1EJFA 3QULA 4L4TD 4JMXA 3KPSE 1GA2A 3NJGA 5ICZB 4LE8A 1NGQH 1PS3A 1XGPA 3UJIL 3X17A 3NZ8B 3UZVA 1ZJAA 2DYRB 3IAGC 2O5ZH 3LDBB 4JANB 2K4AA 5I5IA 2CIIB 4YHOL 3WJLA 5BZDA 1YCSA 3QEQB 5CIPH 3RA7L 4R7NB 2CO2A 3TNMB 4MNQE 2GTWB 1BECA 1U91A 4ICXA 2IBZY 3E0GA 2EO7A 1T7VA 5JMOC 3BGMA 3W81A 2QPFA 1XGQA 4QJ3B 3AB0C 2JI2A 2XFXB 4HC1L 2V5SA 2HLAB 4YDVB 1S9YA 3LH8A 5EV7A 5HYJE 1BJ1H 2HRHA 4PJBF 3WY4A 1WIPA 2ZWYA 3MGTB 4ODSH 4PWIA 3G6JB 4TTDC 1SXSA 3MACH 3LKOA 4XP5H 4JKNA 2AFNA 2EDQA 3B1TA 3QE5A 4E9VA 3S88H 2OR9L 1WBXB 4LLYA 3HUJB 5FHBH 5E8DL 4QRAA 1Q9WB 3RHWF 3HPLB 2KLSA 2B4CH 5IWLA 3G6DH 4P4RB 4BELD 5M95B 2R2BA 3CXDH 4Q9QL 2YFNA 1ILUA 4DN4L 1KTDB 2J8UE 2AEIT 2NY2B 4XBGB 2MQ0A 3TYFB 1T1WA 2GJJA 3TA3D 1MCEA 4MJ4A 3BH9B 3DO7B 3B7SA 2MSPA 4GSDH 1D5XB 3O4LA 2HVKB 5EC2B 1F6FB 1ZSDA 3CFNA 2SODB 3JZYA 4KTYA 2FIRT 2IFFH 4TRPL 2PPDA 4U31A 4CKVX 4MNHA 3EHBB 1R33A 5HDRA 3S0PA 5I1EL 7PAZA 4N20A 2VL4A 4NQTA 1WIOA 1B0GA 1D2PA 4PGBB 4HJ0C 1P9MC 1HEZB 4HIIA 4N2MA 4P4KB 3PCYA 4JFFB 2AEPH 3BDYH 1N68A 3QORA 32C2A 3UP6A 3Q6FB 2ZX8A 3QUMB 1KJMB 1BJMA 1H3XA 2XQBH 4Y1AA 4GAGH 4H8QA 3SBPA 2UZYA 5C0DB 1CUOA 2HPOA 4JRWA 1QTPA 4OM1H 3NCCB 4DK3A 3MJ9H 1V7NH 3HB3C 4AQZA 3HA0A 1UD6A 1J0KA 1J9TA 3KWWA 5ESAB 3N41F 1JZEA 4PAZA 4P5KA 5GGRB 3GXIA 4P2RE 3BH8A 1DDHA 1LTXA 5IVZA 4H7VA 3KBPA 5CINL 4E9YA 1F4WL 1QSFD 5E1GA 3HE6A 1HI6B 2X2UA 3PXLA 4NQQA 4DQOL 4HALA 3V5HA 3POCA 3BAWA 1JS4A 4Z0BL 3LXBA 1T1WB 2WWMC 3INUL 2AF2A 5ILTL 4NX0A 4BQCA 4D0CA 2P7TA 4MD0B 1J1PL 3L7EB 2DOCA 3N44F 3OLIA 4RAHA 1V3MA 4GINA 2VC2H 2DWYA 3U1QA 1EFXD 1OQXA 3QQ4A 4Q0XL 3Q6GH 1AACA 3VMOA 1M2VB 1U91B 4UTBL 3TT1H 5L7XH 1J8HA 4E9TA 3GSUB 1FNEA 3RVXD 1R19A 3DK2A 4NKMA 4RX4A 1OO2A 5MHSD 5T1KA 1R9FA 1TTCA 3HE6C 1XR8B 2QSCL 3ARBA 4FQLL 4HJEA 5I8KL 5C92A 4YHPB 5BUPA 1KGXA 3MNMA 5HBBA 3BCDA 3BUBA 1FGNH 3FYIB 1YEKL 4W68A 1QRKA 4HWBA 1LGVA 5T5FH 2Z92A 4UWQB 3GXMA 2UZYB 3OG4B 5KVGH 5DJZA 4Y5VB 3VACA 2G75B 4PB0L 5AB2A 1YEIL 3ZDYE 5KSAA 2E7LA 4HCRA 1WLHA 1WTGT 1YNTF 2F8VA 4TS6A 3T0AA 3MBWA 4G1EB 2C1PB 4M7ZB 3CNKA 3REVB 2GCYA 2YAHA 3QEHB 3B9KC 5EFIA 2DQJH 3MXWH 5DUBB 3P0GB 4UQ3A 1RZKH 1SYVB 5DD0L 4BK5A 4KZEH 3UC0H 3UL4A 2GITB 3HRPA 3HS0C 1F42A 1ZHLB 2P5WA 4X4ME 4NRZB 1T03L 2XN9B 3PQYE 5DO2D 3P3UA 4D0CB 3GSXB 4NO2B 3D9AL 1M4KA 1DVUA 5DRXB 4O5LL 2E75C 1F58L 2ZOLA 3CTTA 2DEXX 4G7SB 2Q8BH 3RRQA 5BRZE 1TETL 4UINH 1H8LA 3IDJA 1EJOL 3RTQB 4L29B 3A0OA 2FK9A 1LL1A 4X6CB 2VLLB 4UILH 5FFGA 1KXHA 1INDH 3N42B 4BFBD 4D0BB 3ZRSA 2C9QA 1JZDC 1DQJA 1T5WA 3APCA 4PBDA 4ETQB 5I6XC 3QJHB 3AU0A 4FZ8H 4HZ1A 3VXUE 4KNTA 5HGAB 3Q2VA 1RKRA 2W0FA 1OM3L 4H8WL 5JQ6H 4U1GC 1QA9B 3VXTB 1OM9A 2F0CA 5HJDA 2EDEA 3F7KA 3G3LA 5LWYH 2VZVA 4HX1B 2YUXA 1BYPA 1KCSH 3BIBX 4MA3B 2CXKA 4WDIB 4M4RB 4JO1H 5C0GA 4X6DF 4KJPC 5HHMD 3TWCL 2R0LH 3L1EA 2RCSH 3F5WA 4N8VB 4AG4L 3H4FA 5D6CB 2HH0L 4LSTH 3B9DA 5F1OB 5HYEA 4NN6B 1U92B 3V4VB 2NXYB 3RI5K 4HPHA 1NIEA 2PO6D 3AXHA 4LSQL 4A2GA 1EMTL 2CDGB 2CAKA 3IFOA 5MENB 1F45A 2VNCA 2B0SL 4DN3L 5A2CA 1GY2A 2H0EA 1YUKB 1PJ9A 2I60L 4YDJB 5E8EA 4JM2F 2H9GB 3NPZB 4YVUA 5JPMC 1R5VA 4Z7OB 4KKBC 4JY6A 2YK1L 4LO9A 1J8SA 2WPGA 3MUGA 2QSCH 4FQLH 4HAGA 2JJVA 4MLIA 2JCCA 2LFGA 5HTSA 3NZUA 3P0VL 1TF4A 4RFOL 4U4BA 2NY3B 3HZVB 4YNYB 3B43A 5HYJB 2J8HA 1P2CB 1QTYT 1TQBB 3PWLB 4HFWB 1U58A 5EU6E 1KJ2H 4B9GA 1Z9SA 2V2WB 2AK1H 5AOZA 3L9EA 3IDNB 1O6SB 4ZOAA 2EXWD 3LEVH 5KG9A 2ALAA 2AJVL 3VQLA 3VW3H 7PCYA 4JPVH 4XAWL 2BFVH 4IBQA 4FYQA 4LSSL 1U8KB 3VGBA 3VRIA 1IBGH 1SLXA 3O11A 2FSEA 1SVZA 4YPJA 5I1JH 2CO4A 3LQAC 3G5VA 2MRYA 3RFRA 4AGMA 5B38A 1L9TA 1DVSA 2IPTL 2IDFA 3THML 1SJMA 4MKTA 4F7EA 5IMMB 3EH4B 3ME0B 3HR5A 2ZCLL 4LARL 1KB5L 3ULVH 3ELAT 1WFUA 3ATBA 3TZVA 1Z0NA 2D7MA 5FCUL 5HXMA 1HWHB 4B5ZA 4B9JA 2RJMA 3VGDA 5E6SB 4GAFB 3T4YB 3OKOA 3QI9D 1AQ8A 4H25A 5ISZA 1XSJA 2CXGA 2YSSA 5JHBA 2FEJA 3TBSB 5FDWA 1F86A 2VSDA 3E8UH 4YXLH 3LVEA 1JGVH 1M05B 2WN2A 4JGNA 4PGDB 1E4XH 1ECYA 4L4TA 2XY2A 4JRYA 4ZO9A 5IHBA 4HBQA 4KK8C 4ISVB 2P8LA 5D6DC 4QYOB 4HPOL 2XUWA 3X1FA 4BSWB 3IB4A 1VADB 2DLIA 2ESVE 4P2QB 4DSYA 5HVGB 5LKNA 4WO4A 5D1ZB 3AUWB 3SYAA 4MAUL 3APFA 3KH3A 4FABH 4YDLB 1JGIA 4M61B 2WYIA 4Z7OF 4LFHD 2OR9H 3JTSA 2NW3A 1J0HA 3S88L 2FNBA 4JM2B 3MLXL 3LKPA 4E9LA 5EULV 3QIWD 2B2XH 1X5HA 3VXME 1PD1A 4QJ4B 4A7QA 1MHHB 2P43B 3IGLA 1CB4A 4YIQA 3JVGA 1MF2L 2FLMA 3GHEH 1OTSC 4YE0A 3IKKA 2DM2A 1QNZL 1U8QB 3QIWB 4A66A 3MHZA 4E5XA 2C9PA 2FWOB 2MQ3A 4F7MB 1BXAA 1T1YB 4KTDH 4X6DB 3T8XB 5EIQA 3ZZQA 2VO8A 5D5ME 3HZYA 3BWAB 3MRNB 4RFOH 4TUKH 5ID1A 3NJKA 3NACL 2Y72A 1HTYA 4P2QD 4P2OB 3RVWD 3ZE1E 4ORGA 3D12B 4FYTA 3LH2H 2FHCA 1BYOA 5H94A 4BUQA 3WUWB 4HOMA 1BZOA 3WKPA 4XO3A 2EKJA 2GEQA 2XVLA 3LXAA 2FIKB 4AQ1B 1CFQA 1U8MB 3L6FA 4PWGA 3QNFA 3LKRA 5EDSA 2IAAC 4LB8A 4BHUA 1FFQA 2Y0SA 2PXYC 3R06A 3RJQB 2EE0A 2VXQA 5IV2B 1JWUB 4AEHL 2OXHB 3BRFA 1WO2A 3NDZE 4YQXH 1NH6A 3SDDC 3U9WA 2AJUL 4PG9B 1FGVH 5GS0L 5KJ7E 3LRSA 4W9JC 1NGYA 2LU5A 3UTSE 2FYVA 1TMCB 2WLJA 1AKPA 4G1MA 3DUSA 5JYMA 1CZ8H 1ACXA 5LBGA 4RIRA 1B9KA 1KEML 2X89D 2F2HA 2FZ3A 2HX7A 3VRJB 1DQMH 3GPEA 1SHSA 1I9EA 1T89C 5D8JH 1KN2L 4L5FE 1IC0A 2ERJC 4EIZC 1JDAA 3D69A 4KU1A 2NZIA 1GZQB 2R83A 2VXTH 1OAZL 5FW8A 3QUMH 1BA9A 4GFTB 1QI4A 3V0VB 3QJUB 4DWHA 3P9WB 4ZUUA 1KTLA 3MGOA 3QJRB 1NDGB 1XB3A 3S8FB 3RVWC 4QRSB 5EG6C 3JV0A 4P46A 1EEZA 3TVMC 5DYOB 4DGWC 4YC2B 4UMGA 1TPXC 4C59B 3ILDA 4CVUA 4AVJA 2GJ6E 3W5MA 3X12B 3X11B 2UV3A 2ADFL 1VIWA 4U6HA 1QLRB 5DD3L 5D5MA 4GEJA 4WSKA 3B2PA 2CALA 1ZIAA 2XN2A 1LO5B 5I19L 2K6ZA 1ZANH 1H5BA 1DQLL 1NFDF 4JPWL 5TDNA 2QL1A 4XI5C 1HZHH 4W9IC 3ABKB 5BNXD 2NY6B 1JWUA 3RGVC 5JW3H 5E56A 3DGGA 3EGDA 3FO2A 4JUSA 4PY7A 3TPUB 4Z7VA 1DJZA 3IFLH 1B2WL 2HB0A 3UAEA 2DKMA 1FZMB 2HVBA 5MEPA 3P4OA 3C9NA 1SM3L 2OCCB 2XWEA 5EWIL 5BO1L 1A6TA 1CD1A 2C9UA 2YAMA 3N41B 2ZUVA 4IU2A 1JXDA 4AYEC 2K1MA 4LLWB 1NUFA 4JFQB 4R4FH 2F5AH 3LZLA 1KIPA 4JY4A 2H6OA 1T0NA 5KSUB 3KPMA 3BE1L 5E5RB 4FLQA 2V3FA 1S7SA 1V5JA 3VFWB 3DI2B 3ZDXE 1D9KD 3VFMB 5IW6A 3EYQD 4BKLA 3NIFF 3WN5C 4FQ2H 4X7TA 4WFHE 5K9QI 3VRLF 5C0RH 4XNXH 5D5MB 2XZCH 3GBMH 2NY0C 4NM8L 4JJOA 3CFEA 2EEXA 4ONGL 3BKMH 3VXRB 4B0MM 3D39E 1QBLL 2WBWB 1RY7B 2J43A 2FLBT 1J5OL 2AJXH 5HVFB 3QZMA 1ZIBA 4PS3A 1KCUH 5I66A 1MCNA 2IGFL 2GK2A 3MLVL 5IKCB 2FGWL 1QVOA 3QNYB 1S7XA 1CDYA 1FIGL 3LTVA 4FQHA 1I4FB 5C0BD 3MRRB 5EO9A 1CZ8L 3MCKB 1G7IB 4AQ8A 3TV8A 4PRIE 2FATL 5D96B 2LTQB 4NKOB 4KXAA 3S35L 4LLVA 4ABUA 1I82A 4HCRH 5IQ9B 3RIAK 4Q9QH 2AJXL 1AXIB 4WDIA 2XBZA 1M9SA 3HJ0A 3O3DA 2ESVB 1Z9MA 1FZKB 2ZG3A 1TZAA 2EDTA 2OJEA 2NR6A 5FHBL 1F4XH 5EO1A 2PF6A 5FECA 1TTGA 1PVHA 1Z3RA 3QDGA 4JFXA 4NBXB 1GS8A 4ZAKC 4JFDB 3CC1A 1AOHA 4EIUA 1UWXH 2IFFL 4DIXA 3MFGB 4NBZB 1FZJA 3FKUS 2OL3A 1I1YA 1U0QA 3I85A 4LGSB 4ZFZB 3LZPA 5I1AA 3EHBC 1QZ1A 1RUKH 4GSDL 5A6IA 4XCFH 4XP6H 4XCYA 3AG3B 3WS3A 3BSZL 3O2DH 1M57B 3CSPA 3MCYA 1A7QL 2CRZA 4ZO6A 3GMMB 3ZUCA 2E9GA 2GSGA 1I8LA 1CE6B 1S7UA 1C1EL 2E8ZA 1K4CA 2BM3A 3DUHA 4J3OH 5B8CC 1SUHA 4JGJA 3S8GB 2A6IA 4MJ6B 4NQSA 1VLXA 1I85A 4GAJL 1UTDA 4KKBD 4YIQB 4OT1H 5HYSB 4FA7B 1VGKB 4N68A 3ULSA 5C2BH 1IILE 4JG0L 2GBTA 5I76B 1XV8A 4BZ2A 2CHWA 1IAIL 4FQHB 1UT2A 2H1PL 4X7CC 5IFJA 3BWAA 3MRNA 4IS6B 3ULUL 3FB8B 2X4OA 1H0DA 3GSXA 4NO2A 3EH1A 2Q3ZA 2KT6A 4POZD 1QI3A 3ZN6A 2QFRA 5IHUH 3GHPA 1KGUA 3VTTA 4F7PA 2R39A 1T1ZA 1JPGB 1E50A 1QFPA 3H56A 3CZEA 4HZLB 2IBGA 4KJPD 4AYFA 4P07A 5TE7L 3WV0A 5DRZA 1LYQA 5L0QB 4JG1L 1TSHA 1A7NH 4RESB 3VFVB 3L7FB 1HILB 3BP4A 1J11A 1KCRH 2OCFD 1CR9L 4R4BB 5DJCB 3UJTL 3HAEG 1NGQL 3UJIH 5I6LA 3T6QC 2J7LA 4OCRH 1EZUA 4BSVB 1DVZA 1BBJB 4ZMVA 2VR7A 1WZLA 1OPGL 3B9KD 3H0TB 4JM4H 4K3JH 1DVQA 4GRWF 4OZ4A 2WJ7A 4I9WD 4PRPE 5IB1A 3F7LA 4D0DB 1CL7L 3QDGE 2B1HH 4FTVD 3H9SB 1TFPA 2XJLA 3ZO9A 3RNQB 4N0UA 2E86A 4ODBD 5JHLL 4W6XB 4N28A 4WNQA 4PY8J 4NI3A 3MDJA 2N7AA 4WJKB 3R7QA 1IUZA 4YVNA 4MZRA 4YSUA 2A9NH 3B2UC 3L1OL 3TEWA 4GAYA 1NCAH 4D9RE 1J5IA 2XN9E 3PQYB 4N2IA 5JYLA 4LHUA 1LK2B 2KPNA 2DWSA 1SN0A 4FFYA 4JGMA 2HKHL 1V3JA 2ZOUA 1TQUA 5JDSB 4E0RA 3JVGC 4HJJL 5E8EB 1F4YH 3K4DA 4D9LH 5F7DA 1QSEB 3WNPA 1F90L 3WLBA 3BI9X 2EIBA 1NEUA 1T2JA 1T22B 1YPZB 3G5ZA 2NDGA 1W0VB 2XKSA 4U3CA 4Y2DD 5EFIB 3SE9L 1WT5C 3I50H 1A9VA 4NPKA 2AEPL 3MBWB 2CIIA 5DS2A 1BW8A 1L4IA 2R0ZL 1UD8A 5FUOL 2UYLB 4JRXE 3S3BB 4U6YB 4IKNA 1AC6A 2F7QA 2VLRD 2CJ3A 4TVSa 3U1PA 4QHUB 3WEAA 2NX5A 3R7RA 3KH4A 3L3OA 1HXYA 3VVWA 1UFGA 1CFNA 2G9HA 3QO1A 2ODHA 5FYKD 5T3ZD 4POYA 5J1SC 1AHMA 3BZ4B 2P5WB 3QJVB 4CSSA 2IPTH 4XCEA 2WWOA 4AGQA 4QOKA 1WZ1L 4LHQB 1RIHH 4WKZB 3LKNA 4D0DA 4F37F 1IZKA 4HUVA 5MEQA 5FGCB 3GI9L 2ZE0A 2HVKA 5EC2A 4AL8H 4Y2DC 5IVXB 4N2LA 3ZT7A 2O61B 15C8L 5JMRA 3HB3D 4UNTA 3GNMH 1AZUA 2A9AA 1JI2A 1OSYA 4Q97A 4WUUA 1NSNL 2UUDK 35C8H 2VUKA 3L5HA 2XDHA 4KROD 2JWYA 4PJXB 3S2CA 1DQQA 3WKML 3GS4A 4DZBB 4PGBA 1R3JB 3VMNA 5L8LB 3T0BA 1PFCA 2D31B 3GZOA 4J3VA 3OJDB 4P06A 4W6YB 1M6UA 4P5TD 2NXZC 2KLRA 4AXWB 3PWJB 5TE7H 3RZCC 4ANVA 1UZ6F 3DYOA 5BMFL 2FH8A 3WNOA 1AHWA 4K5MA 4ICWA 1JZ7A 4P2RA 5D9SB 4Y9BA 1RIUL 4FLHA 1WQVT 2AEOA 4GSQA 2DH3A 5MP6H 5GJSH 5JIQA 2FEEL 5GGRA 3INUH 4ATWA 4DN3H 5ILTH 1F90H 2KHAA 1OCCB 2WBJB 3NT0A 5FX3A 1AKJD 3X14A 3KCWA 4OFQA 3SDXB 3AREB 1H6FA 3E6FA 2DIAA 3OHXC 5L88H 4AYMC 1LD9A 3DIFB 4KUZH 2F5BH 2H32H 4DP2X 3GXPA 4HQQL 2EH8H 1IGYA 3DVFA 3STBA 1ED3B 5LLIC 3ILEA 4QXVA 1I1RA 4GRWE 3CHXA 3CZKA 1UVQB 3T3MF 1CGUA 1HEZA 3FUJA 1C9SA 2P24B 2GIYA 3FZUC 2IADA 2B5IB 4OJAA 1VEOA 1YEGL 1WCQA 4O51B 1JK9B 4G43A 1O75A 2MMXA 1LE9B 5F7DB 5KVGL 4JPVL 1OCWL 4GXFA 5DVPA 3S37X 3FK3A 1PSKH 3QZBA 4I1NB 1X9LA 1B2YA 3RTQD 3OZLA 4AKPA 2ICEA 2NR6D 4XBPA 5IVZB 2JB5H 1RZKL 5CZVL 4TSAH 3O6MH 2NNRA 1I31A 2FGZA 2K70A 2I5YL 3MRIB 3CIAA 3ET9F 5H2BA 5JIHA 4E2OA 3L3OB 4WWOA 2H0FA 2A4CA 4MDIA 5MI0B 1DO6A 1Y7VA 3O9WC 5J56B 5HDBE 1F3JB 2WZ6A 2H2SD 3NRQA 3H9YA 1E5AA 4WHDA 3ZDYB 1YNLH 5HHQB 1TU2B 3WS6C 3L3DA 4NZFA 7TAAA 1QSZA 4JREC 3LQZB 4KVNL 1NKRA 1S78D 1X5LA 4KROB 4F27A 3CVDA 4QHPA 1G9ML 3DECA 3AG4B 3HMXA 3M17B 1T7XA 4RGNB 2KZKA 1T6WA 4S1QL 1DLHA 3WLBB 4G8FB 1PZDA 1Y18B 4X98A 3V9EA 3W39A 2AERT 3M1BA 1BFVH 2ZX5A 1WC7B 4B50A 3K0WA 4ZMZA 3KWWB 3RDJA 1L5GA 1YEEH 4W9ZA 3A23A 4S1SH 1QYGH 4A67A 1EAPB 1OL0A 3OQRA 5L4MA 3KPOB 3GJFA 5DQ9B 2WO2B 4F1SA 2DQCL 4M4PA 4BGLA 3RPIB 4MD4A 5BS0D 1N3NB 1AC0A 5C0EB 3QFJA 2V4LA 1YPZF 4Y8AA 1M6OB 3ROLB 4H8UA 1VFMA 3FT9A 3LN5A 5E2UH 1G7IA 4LVNC 3A67L 3O3AA 4XNZB 4L2LA 2ZAHA 3JWDH 1RFDL 5CLWA 1KYDA 3GBEA 3QUYD 2OW7A 2WBJA 4JRXD 4JX0A 4Y4HB 3ZDZF 5HPMA 1ET8A 2CO6B 2GBAA 2VMJA 4MQ7A 2BOBB 3SDCA 3V55A 2FO4A 3MN8A 4G42B 1F58H 2Q8BL 4XX5A 1OY3B 4YO0A 3ZMRA 5AYTA 4JCLA 4HUWB 3VD1A 3ZE0F 3ESPA 1JJUA 3KLAB 5AW1B 3HW7A 4AEIL 1QHQA 1BF5A 4NJ9L 5I9QB 2DTSA 4O9HH 1KZQA 1IGYB 3S3PA 3CFDB 3CXFA 1SZNA 4P99A 1N10A 1U8JA 4HD5A 4YLBA 4CKQA 4KO7A 5GS0C 1A64A 4YDJA 2ZG1A 1HINH 3UTTE 2B20A 1RJZA 5IHZB 1J8HD 4QHKJ 2ZWNA 1WBYA 5DJAB 4PMFA 2MOGA 5F7EH 5GGVH 1KTCA 2GSGB 4JFDA 3IWVA 5C0BE 3FOMB 5EOQL 5ITBH 1EUTA 2J6WA 2X42A 3JV4B 2HUHA 4ZMAT 4B9YA 4LVEA 1T2QL 3E7JA 1J0YA 4LRNH 1FNSH 4Y2NA 1MCOL 1DUZB 1KELL 2RQEA 3FT4B 4F2MA 5IHUL 3LIZH 1RULH 5EZIL 3IMUA 1HNGA 3BH9A 1IM3D 2ZWLT 4JFTA 4HLJA 1I3GH 4F2EA 3MREB 3DIFA 4CL7A 1YG9A 4ODTH 4PJ5D 1UUNA 4M43L 5TGBB 4Z7NB 1ETJA 5JXAL 5KSBB 1DBKL 3BZFA 3MV01 4U1HB 5DHYB 1UWYA 4IGBD 1QQDB 1T89A 2VDMH 1F6AA 2IVFC 5L2JA 3NJIA 2XG4B 1PD0A 1S3RA 5IZ7A 2YPLE 2E6JA 4A2DA 2E7LC 4JFEE 4WI7A 5ICYB 2W0PA 3RWIA 1OPGH 2VLLA 2W80C 3LKOB 4JM4L 2EDBA 4JZJA 1CFVH 4K3JL 3MJ7B 4M8VA 4JDTH 4NRYB 4IYKA 2QPDB 3VB9A 4XP9L 2HPTA 3VD0A 5IJKC 4MS6A 4FQIL 2ADGA 4CMHB 1AP2B 5HDQH 4KDWA 3TVMD 1ACZA 4V1DE 1MFCL 1VRSA 2WTRA 1S5HA 1QLRA 1K2DB 1DVTA 5J1AB 4L8BB 4MQXC 1TDQA 4Z7WE 3VI3A 3CSGA 5DJAA 5IFHH 4LLVB 1NEPA 4PJ5B 4I13B 3CD4A 4TPRH 2RQ8A 5L4IA 3EYFB 2DQIL 1GHFH 2PUQT 4K71C 4NC0B 1C08B 4MWFB 1WEJL 1DDHB 2Y5QA 4W9FC 1TNMA 1VFUA 2W5PA 5EORL 4AQOA 4DPBX 3RVUD 4M8RA 4Z7QF 2BNQE 1QFWH 5SX4I 1N6QL 3IDXH 4LBEA 2ADIB 4A37A 1G7LB 1OSZA 3FJTA 3ARXA 2UZIL 5J12B 1DSYA 1FZMA 1TCMA 3P9LB 4Q6IA 4ZUWB 3DX6A 1KJ2A 2R1YB 3QB7C 2NZ1A 5JDSA 4XMUA 4E0RB 5AVZB 4PRHB 2BNRB 4QXUH 4YJZL 4XR8C 2YSSB 2YMXL 1UOVA 4XVUC 1TVBB 1N8OE 4IU3A 4WJG3 4YUEL 1TEFA 3WNMA 2BPBA 3I3BA 4MA1B 2L04A 3MCG1 5I73B 3DHUA 1KIPB 4JY4B 2BSCA 2R9HC 3VQMA 1FSKC 3DBSA 3EOAB 3T8XA 1VADA 4X6EA 1TJHH 4WWID 5F8QC 2WUCL 4BWWA 1IC5H 4W4OA 4WI2A 1OCOB 2EIMB 4AV4A 5C6TL 1AZRA 2CQVA 2JLPA 1G5AA 2VITB 3NQKA 5DC2A 4DP5X 3SOBH 4I48B 1QATA 4PP1D 3NGBB 4XCCL 3OSVA 5F6IC 2FLRT 1OT1A 3O3AB 3D0LA 4EN3B 4GQ9L 5I1CL 1DSWA 3F7RA 4CNIA 5I6PA 4KKAC 4NSKB 1NEZA 5ECGA 3WENA 2JCWA 4F58H 3HNSL 4Z7QB 3ESNA 2ED9A 3AT0A 1L6PA 4R9HA 2Y7QB 1G7PA 1YNTA 1RZ8A 2HRLA 2H7WA 2OS7A 3DVIA 4HZLA 5D7LD 1E2WA 1OD9A 5F7BA 2VDML 2R69H 4HUWA 4ODSL 5IIEA 2ENSA 4WO0A 3CZJA 1IJNA 1RERA 4O58H 3GK8L 3V7AE 3VYNA 4J3TA 4WWPA 5HHOA 3WE6B 5AG9A 1MWAB 4WU5A 2C9AA 2GKIA 3O9WA 4PJBE 2BVUA 3SGKC 3OLDA 4HAFA 1CICB 3LH9A 4TUKL 5E4EC 4AIXA 1KACB 4IRSA 1KIRB 4I2XE 5BO1H 2MQGA 3KGSA 5EZPA 1DVFB 4YXKH 3SYOA 4WHYG 1HH6B 3O6LH 3OKEA 4OCMC 4PJGA 4XP4L 4LPCA 5IOPA 5L2KD 1MW1A 3IFNH 1TZIB 4B60A 4Z8FH 1JP5A 1TJGL 3ZL4H 2JNZA 4DPCX 2VMEA 1BIHA 3VXPA 2WO4A 4XP6L 4AE0A 4JVPA 4QNPF 2EEDA 5KSBF 1TXKA 1ZANL 3ML8A 3LN9A 1AR1C 2V17L 5CEZL 3GRWH 1YN6A 4RAUA 1DJIA 2JELH 5FB8A 8PAZA 2FZ3B 2VE6B 3O3BB 1C5DB 3P73B 3GXTA 1CGVA 1OOAA 1CL7I 4G7VH 3RWDB 1KFAL 2GJ6B 3HZMB 4HK0A 3G5XA 2BP3A 2YO3A 3DIDA 2FDBP 4YWGL 5DFAA 2BK8A 1K5NB 2UWEA 3DDGA 1Q0YL 3OHXA 2ESVD 2SEBB 4PJ9B 5I1IL 2XPYA 5CP3A 1SY6A 2A1WL 2VQ1B 3J7HA 4YL4A 3FSZA 1Z32X 2HFFB 3Q1EA 4W6WB 3UTTB 3QR1A 3ZVVA 2PCFB 4F8TA 1XCTB 2K7QA 4IIQC 2IG2L 3IF1A 5L0QC 2FQDA 3IDJB 4LIQE 4Q8BA 2J4WH 1H5BC 3H8NA 2BRRL 3PGCB 1MZZA 4ZW8A 1FAIL 3OKKB 5DHXB 3QRFM 1A1OB 4YHKL 1YYML 3BOVA 4LFHG 3SDAC 1JBJA 3S4SB 3HFFA 2OP4L 1EHLL 2ZTBA 2CMRL 2DM3A 1QEXA 1BEYL 4ZX6A 2J6EL 1OB1A 4S1QH 5IQLA 4DZBA 1E6OH 1Q0XH 4R0LA 5DRWB 1ORSA 4Z1PA 5B3SB 1TTAA 3VTMA 1AD0A 4JRLA 4HWBL 4PJGE 5GJSL 2HN7B 2DQGH 1F0LA 4KUCD 1D7CA 3FT4A 4DO5A 1DFBL 4K73A 5CJXA 4Z8FL 4GRMA 3MNVA 1WBZB 1R5IB 4KRPB 4PJEE 5C08E 2ZG2A 2WLIB 3QRBA 4KJWC 3RAJL 3VI4B 1QASA 5E6YA 3QUYA 3MNWA 2ICEC 2MHAB 3RY5A 3FU9A 2D7QA 3SBWA 2VW4A 2CHNA 4AYGA 1IGTA 2XPGA 4KJYA 1WCBB 1PIFA 3CVHL 5ISZB 3WU1A 2M26A 4L4VB 3RVUC 1DR9A 4JUTA 5I23A 4M5YL 5C70A 4GS7C 4KZ0A 4PJ5E 4OAWA 2ZSWA 3VNYA 4WTZG 2CO7B 3HFMH 4JAMA 2DQEL 3IS1X 1ERNA 5LXGL 1UD3A 3QHZH 2WTRB 2R15A 5CR1A 2FEDC 4Y2OB 2VLRB 4AJYV 2V2TA 1NPUA 3GRWA 1TQSA 1KEMH 2DMGA 2C4FU 2EADA 4DCQA 1EEUA 1ZKAA 3LOWA 2XZQH 5GHWH 2R7EA 3L3HB 5C0IB 2KZ1B 1ZLVK 1WK0A 2LLLA 4J4PA 1T2QH 2XVKA 1XGRA 4LRNL 4NQEA 2GIMA 2CD0A 5KVFL 1ADQA 4DUXA 5F96L 3CXHJ 2WUCH 1UXMA 3RVVD 3K8MA 3KWVA 5GISH 15C8H 2F6AA 2Y23A 3FTUA 1AGBA 2DQUH 1S3KH 3BPCB 1JNLL 2GFBB 3NN8B 5DD1H 4K5NA 5IEKA 3SY0A 1EXUA 5DUML 1HXMA 2FUTA 2OL3L 4Y4KD 1CLYH 1MFAH 3F5WB 3OWEA 4N8VA 4NCC2 3UG3A 43C9B 3RU8H 3T3MB 1NGPH 4NKMB 3KJ4B 1OF0A 3C8KA 1ZV5A 2CDGA 2OP4H 2FHBA 5F6HI 3NCXA 3CGTA 4C55A 3H9SD 1S7RA 2IIJA 2W92A 2E9JA 1S8DA 3IBEA 4HCFA 4LAJH 4OCWL 2QJDA 5C0CB 5BS0E 2PYED 1BFOB 4IS6A 3ZKQD 4G6KH 3I75A 3RJDA 5EOTB 4CC0A 1IMHC 1ZK9A 2NSQA 3QNXA 3WEMA 2X7LA 1MXDA 3RWIB 4UV4H 4JVWA 3G7TA 3I9GH 1UFUA 5IFHL 4YDNA 5JORA 2YXVA 4RRPM 1GOGA 2WB7A 1Q0EA 3KW7A 2WWKO 1M42A 4R8WL 3A4FA 1FFNB 2NXYC 3F12B 5D1QE 2DI9A 4DKFH 4LF3A 1U6AL 3I6SA 3OF6D 1EAQA 1A02N 5FYKE 3TFKC 2NLJB 4L1TA 2QV4A 2ROYA 3GKWH 2GAZA 3RFZC 1L9OA 2IXQA 4X6CA 2BOBA 1KGIA 1SXZA 4MJ2A 4XNMB 1Q9LA 35C8L 1KN4L 1TENA 2OULB 3WUWA 4HX1A 1G9NC 4HXBH 4JJHA 5F7MC 3UGUA 3ECUA 3C5SB 2GJRA 2ITEA 1X6NA 4PHZA 1BQLL 3ZHNA 4OI9A 5CLYA 1BIIA 1KJVB 1HWGB 3JBG7 5IEHA 4CUCA 1ONQA 5DDHA 4PV1C 4XMTA 4GSRA 3KGTA 3TN0D 1IKOP 4HFUL 3K81A 5EF2A 1R3HA 3Q8CA 1WFIA 3QDMB 4DEPB 4NO5A 1BCIA 1DEDA 5EZLA 3VD3A 1M7UA 4U6XB 2YQBA 5LWYL 4G5ZH 4HH9A 4YAQB 4HYTB 2D3NA 3QIBD 1YEJL 5CJBA 5EBWA 1PG7H 2V7NB 3KLHD 4D94A 4I4WA 2NSMA 2J6EH 4Y4KA 3VCLB 1IQWH 4N2NA 1CFNB 1F4XL 1AO7D 3DTDA 2DIEA 3NJXA 2AV7B 2VXVH 3RDTC 4TUUA 2EDMA 2HG5A 1L9SA 1G6RH 1S7WA 4M48L 4WGKA 2X6MA 2WLYA 3PXJA 1Q9OB 5KYNA 2EH8L 2XXMB 1DJSA 5D93C 5E0FA 4TSBL 1A6ZB 1G94A 4TTDD 3KR3H 1FIEA 2WLKA 3WN5A 4QLWA 2K7PA 5AWNL 3VFWA 4P23C 3DUUA 3DWTA 4Q56A 5HHPB 1HT6A 3O6FC 4PB0H 4OGAC 2PP8A 2AMUA 3LN5B 3RKDD 4POUB 4M7KL 5C0EA 4GRWB 3ARZA 1J5CA 2B1HL 4OLEA 3MV11 2CNYA 3FB7B 4MCNA 5IEHB 4P05A 3WUZA 4UNVA 2VZTA 2D0HA 3BGMB 3BH8B 4XWOD 2F53B 1IBDA 4MLSA 5L6YH 2QGCA 2Z3FA 1CF8L 5CZVH 3T8MA 1NUGA 3RDTD 1BF2A 3DYMA 5I1DB 3V5HB 1JHLL 1RUQL 5K39B 4F37K 2QHRL 5F3HB 4I3RL 3QCUH 4GAYB 5KSUA 1LDSA 5E1QA 5GRUL 4AEEA 5C08B 2VXQL 4NYLB 1OB0A 5JW4M 1ZXQA 1QW9A 2ZYIA 1PZAA 2MPAH 1U8LB 3QUXA 1HNYA 2DMBA 3Q5OA 4BE6A 4JHAL 5C0CA 5KSAC 4KKLC 3NAAL 1OE3A 1REIA 3EDJA 4I7ZC 1C5BH 4OIFA 1Y6KR 4B5EA 2G3NA 5TDOA 5BW7A 2CJSA 1TJIL 3F7YB 5CZRA 5J13C 3G5WA 4FQ2L 3GM0A 3LB6D 1QUNA 4M5ZL 4PRBA 4X7DC 3NIGB 3HE7C 4PJAA 3NMEA 3TT3H 4QXTA 5D2NE 2BRRH 2NXZD 1WZMA 5CBEA 3TN0A 1OAXL 2Y7SA 2CDEA 3K6IA 2H6PA 4HXAL 4ZBJA 4ZW7A 3VGAC 2XKNB 1AI1H 3IRCA 2VT0A 4P2RB 4OM1L 4TNEA 2WZPA 2V33A 4U3SA 4I3SL 1MNUL 12E8H 4OD2A 4YHML 3MMEB 4Z7UE 5FA3A 3OLGA 1LD9B 3MLVH 1CFSA 3INOA 3NABL 3SKJH 4AENB 1KBGH 4OLXH 5BOZG 5I8OH 1Q9KB 4CW1A 4KH9A 3EJYD 4YAQA 2A77H 3O4OC 2ETWA 3EYOB 2AKRA 1P5VB 3FRUA 1XGTA 2XI9A 3CE1A 4GG8B 5DHDA 1I75A 3R0MA 2XQYK 1AP2A 5KBNC 1VZHA 3CC5A 1F18A 2CKNA 3HRZC 1MRCH 5E1AB 4GO8A 1GGIL 4G7QB 3WIFB 3NQIA 1E28A 1K8IA 4PW4A 1XAUA 3RZCA 2DDQL 3UYRH 2XA3A 4ODVL 2NY1B 2QMKA 4IOFD 3PWPB 2NY3C 1ZRUA 1A7PL 1UQSB 2MPVA 1Z5LB 1U8MA 3L6FB 3K8KA 1WUNT 3BE1H 1MFBH 4LNRA 2FE0A 4F9PC 1PJWA 3AG1B 3FXIC 3GWJA 3IFPB 4K2UL 3U7WH 2Q20A 3ARGC 2ID5A 3EJQA 3RVVC 1CS6A 4O9HL 3FAXA 5ISZE 4NC1C 4CA4A 2FH6A 3VX0A 3SOTA 2AJ3B 4QCIB 4HU8A 2JXMB 4HIJB 1H3UA 1AG0A 1XQ4A 1FVEA 5INCB 3ESVF 2A74A 5HVWA 4U7KA 5DZNA 2EVGA 3G6JF 3PPEA 3DURB 1H3GA 4U7SA 4ABWA 2J5LC 2PP7A 3IPEA 2CBPA 4PJBB 3CX5K 1MLCB 2CKBH 5EEVA 4M1DH 3KXFE 3RGBA 4HKXA 3SIKA 1BM3H 1E3FA 2W38A 1MH5B 4TNGA 3N85L 3WFCL 5L9DH 1CDIA 3DX4A 1F11B 3FU3A 4N0FB 1OWRM 3ISYA 3D4GA 5TQ0H 1RH8A 3EO0B 3O8XB 3DK0A 4U3XA 2E56A 3O2WL 3CDZB 2IF7A 3WJLC 4PCYA 4HPYH 4OUOA 1P5UB 3CFMA 2VLJE 4FI8A 5LAXA 3QUHA 2IWGA 4I0PB 1SF3A 3GK8H 2F58L 3DTXA 4F24A 3D87B 3VWJD 5AKRA 2IEPA 4L05A 4J6RH 3VFVA 2AXJA 2W65B 4FYSA 4X7SH 5KS9B 1XH0A 4MD4B 4G6AC 3CFQA 3PDGA 4YDKL 1JHTA 3D51A 4PCKA 2DIJA 3MA7B 3MOQA 3IMRA 3OSKA 1EO7A 3LPWA 4PWKA 5C7XH 1ZS8B 2Z93A 2ZKWA 4HOXA 3NTCL 4JFYA 3O45B 4JNXA 3LEXA 1D5XA 3O4LB 4L4TE 1NBQA 3MRGA 3OKDB 1DEEB 2E59A 2ZUQC 4U1LB 1BD2E 1FNLA 1GGCH 4IRSB 2PPAA 1A6TB 4H25B 4GRLC 4NQUA 4ELKB 1J7VR 5FF6B 3UTSA 5I82A 3OMZA 3U0TA 4M5TA 2ZAIA 1S7TA 2V17H 5C71A 2VTFA 4Z77B 4ZMWA 4OGZA 1S7SB 4WW2C 3SGEH 2VDNB 3HBGA 3I9AA 5CMAB 3W38A 4X7FC 1D5IH 3FHQA 3F58H 3EIFA 2C8NA 4N2EA 5F7KC 1X5ZA 4H88H 4LGPB 4FNQA 3ULVL 4OY9A 3H85A 1RPQA 4OTXL 4RNRB 1MAJA 3CJJA 1E42A 1X9UA 1VAHA 3E2HB 4L4VA 4ZODA 4TULL 1IFHH 5EC1A 3SZ6A 4YHNB 2EYSB 1P1VA 3GEWB 1WDAA 4DUWA 4K8RH 1NC4D 1JZ6A 2JH2A 3ZZ1A 3WTUA 2QVMA 3HI1A 4FNRA 4B7LA 1H15B 1P53A 4IKIA 5I0ZA 1WAAA 3AUVA 1EFQA 5FO7B 3EF4A 5EUKB 3NAAH 1C08A 2AGJH 1FVEB 1E4WH 3VA6A 4QRSA 3PWUB 3N1QC 1JHTB 3OAYK 5DC4B 1E28B 1K8IB 4MMZC 4CGTA 3D39B 3HZVA 4R2GD 2O5YL 2E3VA 2VAAA 4HUXB 4HMCA 3HKZA 4OGYH 5A2KH 2MCAA 3V4PH 1XCTA 4JHWL 4U0QB 3S35X 3MRRA 3DOSA 5EO9B 3VSTA 3EBIA 2B59B 4H40A 3LNHA 1YY8A 4IMKC 3B3BA 3BX7C 5HYQB 4MCYA 2FBOJ 1F41A 2D3LA 3EBGA 1FNSL 3V52H 4ZFFB 2KLTA 5DTFB 4J39A 1MIEH 1IL1B 2YRZA 1KGJA 5FECB 1TPXB 3AWGA 3BD3A 3BPOC 4Y4FA 4G8IB 5I0XA 4ZO8A 1G9HA 4BFRA 1AGCB 1SXNA 2APTA 1A3QA 5CJ8A 3MREA 4AV5A 1DN0B 3RTLA 4FERA 5J6SA 2ICEB 1CLOL 3ES6A 1I7ZA 3V0FA 4N2OA 2X4QB 5AZUA 1NIDA 5T33H 4Y88A 5KANG 3PLYA 2DBJA 1WWCA 5IJDC 3MMEA 2MWCA 4RLDA 1XXDC 3FT1A 3KXFD 3MLUL 3WIHL 2QDWA 5AYUL 3DO4A 3ZLQC 4U1IB 3U4AA 4DOHE 5GS3A 5KYUA 5GZOA 1F97A 2FT6A 4W1TA 3U9UA 1NFIA 1ANUA 3KNBA 3PWNB 4PP2A 4XNDA 4XVSH 1R3IH 3BO8A 4G6JH 5FKPB 2EXTA 4NCDA 3N55A 4QRTA 5F7AA 3OR7A 2XLLA 2CLVB 3KGRA 2EDNA 5CMAA 3MV7B 1KXTA 5IBTH 1RZFL 1A0QH 5JIPA 1FO0A 2R2CA 3MGOB 5DD6B 5DUBA 4FLSA 5FWQA 2QKIC 1QWNA 5ECJE 3LRLA 2BIMA 5F9OL 2Z35B 5KANI 3RPIA 1SBSL 4LEXL 4R7LA 5KAQF 2FECI 1LO2L 3FTXA 2JELL 3C6EA 3QJZA 1QBBA 1N59A 1QBML 3D0LB 3NIDB 5CGTA 4XMPH 2OL3H 3F7VB 5HI4D 4E5XB 3DIVA 3WEXA 4Z78A 4FNPA 4YDIL 3MRQB 2ZOLB 1YMMB 1YO4A 4X80L 5K9OB 3IRPX 1HJCA 3WMSA 1JPFB 2X4QA 1YEDA 4G11A 4FCHA 3K4AA 3BW9B 1ACYH 3VFNB 5JR1H 1NANI 2X2YA 3GSWB 3TPUA 4F7EB 5KUKA 1U9KA 1YJDH 4HLZG 2A83B 3VSQA 2MH4A 4OCSL 3QP3A 4X6BB 3KYNB 4QXTB 3CDYA 1F5WA 2ARJA 3C9NB 7FABH 3R06B 1J8HE 4WIQA 5EN2B 1DBAH 1F13A 4IOIA 5E5MA 3VXMD 4LSPH 4G70B 2WO3B 2XSKA 4NIYE 3K4ZA 5J06A 3JWNE 1S9WB 2Z64C 1SN5A 4H1LB 5EOCH 2LR4A 3P69A 2Q76A 4ZUTA 5D7SH 2XKNA 5T1MB 5AW8B 3CVHH 4OQTA 1G9MC 3MV8D 4U6YA 7FABL 1R5WB 4RRPA 5EUOE 5E6IA 1YUHB 2NTSP 1UACH 3GBLA 3BSHA 3AC0A 3ECWA 5GGTH 2FO1A 1NAMB 2FEEI 2QADB 3KVPA 1C16B 2FL5B 2CCWA 3OL2A 4JPIB 1RIVL 3M07A 2R0ZH 3CFBA 4CW1B 1G5GA 5KBMA 4EDWH 3EUDA 4BZ1A 3ERXA 4KV5F 5E2VH 5B8CB 3BD5A 5ES4B 3B2DC 2KS0A 1MOEA 5D7SL 1J9RA 3JT0A 2ZQKA 1C12B 1E65A 1QFUL 1DEEA 4KAQH 3V7AG 5C1MB 4GUOA 1EVUA 1A1NB 3P54A 1U8IA 3NESA 4DGVH 1N0XL 1MFUA 4K7FA 3RPKA 4NO3A 3FQYA 5BOPA 3QWRA 3A5VA 5AYUH 5BRZB 5IBLD 1UKQA 3ZKXC 3T2NH 4OCNC 2UX6A 4R0LC 5JHLA 4WU7A 1O6TA 3IXAB 5HHVL 1K3IA 4AYID 3H9SA 3A6BH 4UT6A 4JM2A 5D2NB 1U8LA 4DPRA 2ZSWB 1UXWB 3SDAA 3ZYZA 5B4MD 3VGEA 3QUYC 1VFOA 2FATH 3FTZA 4MA8H 1A6AB 1G7MA 1MI5B 3MCLL 2UX7A 4WI5A 4ZJ9A 3KPTA 4G5ZL 1SEQH 3Q2NA 4WI8A 3RB7A 1VFBA 1HEHC 1U8QA 1DZBA 1KIUB 3QIWA 4M8UA 5EBWB 2MHAA 5CN3A 2DQHL 3VD5A 3CSFA 3H55A 2AK4E 1HDMA 4LLQA 1NAMA 2QKSA 5EBLB 1TOXA 1MREL 4OZIE 3FMGL 4BKTC 1J18A 1PZ5B 5I15H 2NTFB 4A7UA 2CK0L 1U8CA 5MEOB 3H3PL 5ACZB 5SWQA 3OQ3B 3ABGA 2PWFA 4OFIA 4BDVA 5CD3B 2AITA 3BT2H 1YQVH 2X0UA 5I24A 1IGMH 1T1YA 3GO1H 1DBMH 4P2QA 5KSAD 3RY4A 3L54A 2N1KA 1XTLA 4OZHA 3K7UA 3ULSB 2FYYB 1A7RL 1OIOA 2CO6A 3KVQA 1WHPA 2YEVB 3JWOH 4LLYB 2IGTA 3U79A 3KPRB 3O3EA 4PPTA 4TLTA 4LU5L 4WUUE 3DO3A 5DC9B 5H37A 5FR3A 2D03H 5EEXA 2WLNA 4KZDL 3IDUA 3GO1L 4LLAA 3BSZA 3VD4A 4UCFA 4OLZL 4XE0A 1IVLA 4XWOC 1XBDA 2R4RH 4Y19E 3VJ6A 3X1NA 3ARDB 3QUKA 4G9FB 3LSOB 4WI4A 2MTPA 3RUGF 4I85A 4UV7L 3F7PC 3AMLA 2VN6A 1TTUA 1R3KB 1KIUA 2XKUA 3V0IA 4YXLL 1S78C 2YD7A 3E3QC 3CFTA 4KPHH 4Z3EA 4K8RC 5BRZD 4EDXB 3O6FD 2HAZA 3BAIA 2IAMB 1R4XA 4FQXB 2YGPA 3FQWB 3E9UA 1H9VA 2IWKA 3IU4H 1UXSA 1U8CB 5FYJU 3SZKC 5ACZA 2P1YA 2XQYA 1JZ8A 2Z7YA 3EYSL 5KSBA 4UV7H 3GBDA 3IMBA 3TJEH 3ARFD 2Q3AA 3VXOA 3RWCA 3WXWL 3FQ4A 1OP5K 3X14B 3BO8B 5FKPA 3AB0B 1TJMA 3TZVD 3PABA 2FT7A 2B15A 5BV7B 3BPNB 2FVNA 1U4FA 3TCLB 3TN0B 5CBEB 2R1WB 1ZLWK 1RK0A 3N04A 1B0IA 4RMUA 4OF0A 5D71L 1ZLWH 3WS6A 2OZ4H 4NHUB 3U46A 4A6YL 1BZQK 2YKLL 3TYGL 1HZLA 1HI6A 1T22A 5T3ZE 4OBRA 4G71B 1JPTL 4JQIH 1BBDH 2VN5A 3K91A 3MRCB 1PD6A 2GJZA 2AK1L 3QQ9D 4JKLA 4UIKH 4L9LA 1QYGL 1P1ZA 3PUUA 4DN4H 5JORB 5FYLH 4LCCB 4Z7WA 3WY1A 3WCYA 4JCMA 5F9AC 1JFQH 4NO3B 1QFHA 1IFGA 1YEFL 4NZRL 1MJ7H 4LEOA 5I8KH 1DVXA 5D1QB 3HI6L 1E27A 2BNUB 4Y7OC 3Q0HA 4WUUB 1EQWA 3SGEI 2YK1H 3NEXA 4WK4B 1NGWB 3UPCA 4JFZL 4FZEH 4DP6X 1KZYA 3FB6B 1MREH 4IBLT 4FD0A 1JPGA 1MJ8H 3FRPB 2J55A 2KBGA 5MEQB 4K23H 5IB5A 3LKSB 3TV3L 4KQ4H 3C5SA 4XB8A 2XA8H 2HWZL 1A14L 1S8DB 1VKXB 3IM1A 1ZSDB 1GZHA 5E00B 4PVMA 2XN9D 1JZ4A 1OAKL 3GMNB 5LNDA 1J86A 4FG6D 5E5MB 2MTAA 3AY4A 4CN1A 3L45A 1RL1A 2ZCZA 4BSVA 3NSYA 2NX5D 2NXYD 4PBXA 2EC9T 1OV8A 2Y07H 4MJIA 5A43C 5LG6A 3V79C 3NIGF 4HIIB 1FZJB 2G5UA 3PPSA 3UBXA 4XC1H 1CT8A 4BIKA 4M93C 1LEKB 3US0A 2DQFA 2JMRA 1KBVA 3BIKB 4OW6A 4QTHB 1OANA 3MV7E 2JKXA 2YRPA 1BZDA 4X9GA 2P80D 4C56A 1FVCA 2A1WH 2DMHA 2GITA 4JJ5A 5DK2A 5SWZA 2BVOB 4NKQB 2B1AL 1WGOA 3NZ8A 2GK0A 3G04A 1YLBB 2AV7A 3S5LA 3MJ6A 4HJIA 5DVNA 2VN4A 4HISA 4WW1A 1UM6L 1HHIA 4N1HB 3CPUA 4GKOA 2VXUL 3HS9A 3WAJA 1IEHA 1RVFH 4LVOC 4K94C 3RUGA 5I6KA 3V6OA 4TVUA 1OTUC 4JO3H 4Z7VF 2BVQB 1ZOXA 3TS8A 2XFXA 5EMYA 3IYLW 3MQIA 5AVUB 4PD4K 2V7HA 4H8VA 3ULUD 3VI3B 4CMMB 2CO1A 1FNHA 1GSMA 2CJTA 1KN2H 3QXVA 3CHOA 5IGXH 3VDBA 3QJFB 4X7SL 1Z9LA 5FYKH 4ZFQA 5T1LB 5HDBF 4OR1A 1I8UA 1ORSB 1MCWM 4XHJC 4AIEA 1R3KA 5E9NA 3MNWB 4HUVB 4BQ9A 3IVKA 4AE1A 5HPOA 2X4NA 3QQ4B 3QEQA 1ZS8A 2Z93B 3BVNB 4A55A 5F7WC 4EKXA 2DJ4A 4JM2D 4Y16D 2CJUH 3MNVB 3VH8A 3UZQA 4BFIB 5IHLB 1NCOA 1BXUA 1ZVNA 2ZNWA 2XWJA 3QNZA 5SX5H 1JDCA 4LU5H 1BVNP 4U1SB 5SX5K 1X5XA 3RAJH 3GYRA 3Q5YA 4DW2H 5E6UB 3LAFA 1G7JB 4FG4A 1YMME 4YFLI 4KJYB 4HSAC 1IO4C 1JCVA 3T0ED 3LH2L 5LNEA 2DAVA 4HA1A 3R1GH 3N85H 4E36A 1GIGL 2QHLA 3GGWA 4C56E 4C4UA 1TVHB 3IDYC 3WFEH 4UI2A 2CO7A 3MI6A 1GGYA 2J56A 4AM0A 5FIEA 5KYUB 3ARSA 4I0CC 3Q6FA 1JN6A 5D7IF 3PNWA 1IKFH 3BVVA 3GLZA 2OJ1A 1IC4L 1UA6H 2ED8A 3QO0A 5FOBB 4UQDA 4FP8H 1GRWA 2R29A 2WXKA 4JO3L 2PR9A 2XQ0A 4V1DA 4GXUN 2Q7AA 4POZC 5CEXB 5ESAA 1UB5A 4OGYL 1A7OL 4FQJH 2NQ3A 2PPCA 2H0JA 2ZX9A 3CDFA 1YNLL 3ZL2A 2J88H 3BIAX 3A4AA 4RZCA 1KYOK 3TA3A 4MAZA 1K2DA 2VLKE 3BMWA 1AJ7H 1CK0L 2BWQA 5DD3H 1YMHA 2TRYA 5FYKL 2RB8A 1NKGA 4QCIA 1B90A 4JFDE 1DJXA 2PXYB 1UYWL 4PWEA 2JB6B 3B7YA 1M7DA 2QSQA 2XHNA 2GFBA 3KEHA 1CDBA 3GJFK 1FLRH 8CGTA 1IM3A 3AM8C 3TX4A 3HZ3A 3OKOB 1IL1A 2OYMA 3UDWA 4WI0A 2BC4B 3VFUA 1JYWA 4DZ8B 3TEUA 1I9JH 3HUJA 4M7KH 2QQQA 3C8KB 3CX5J 1QRNE 2VLJA 2VAJA 2XBDA 2CK2A 5G4OA 3T65B 4OD3L 3FU6A 1YNKH 3JV6A 5EEWA 5H35A 3WNLA 2WINA 3EF7A 1HHGB 4I3SH 1T5XA 3T2QA 1CL7H 1JF5A 2B4CC 3QQ3A 3ATDA 4J6RL 4FMFA 4PVLA 3AMKA 1GXEA 1L7IL 4APQB 4J3SA 4BFEA 1QTSA 2WMPA 4MXWL 3VGGA 1YEEL 5LAXB 5LGJB 5C09B 3DETD 1KPVA 5LNGA 5CCHE 5DJ8A 2E47A 1JL8A 5DURD 4YS4A 3I9PA 3VWJB 5IREA 5JDJA 4TLSA 2Y1VA 3PS6A 1IGJA 4O02H 5B7FA 2Y6TE 1MCWW 3HZMA 4I0KA 5DJDB 3AQYA 4M1DL 2ZUUA 5I28A 3UPAA 2V2TB 2QT6A 3QI9A 4ATTA 4YLCA 1HH9A 1QLFA 3D0VB 5B39A 1W91A 3K6DA 4XCFL 3MXVL 5DU7A 2ZKMX 2V3EA 4HK3N 3QA3A 2ZP9A 1ID2A 3CK0L 3EFDH 4MFHA 2R2HA 1BQUA 3SPGA 4R2GB 3KPPB 5IESL 2QZQA 4AJWA 1NOFA 1C5CL 4BZ1L 2BY3A 3IJ9A 4RFNC 4HGWB 2NY0D 2G2PA 2C9SA 1E6JL 1IQDB 1TZ8A 3HCVA 3QHTC 1RULL 5EZIH 2EYRA 2JKLA 1PPIA 2DYPD 2GI7A 3IXTB 1HC1A 3PNWB 4NO0D 4L8DB 4JY5L 2J4WL 4G1EA 1MVYA 2OMTA 2YD8A 3F84A 1T0OA 3KAAA 1JGVL 3DTXB 2OTWA 5FK9B 2FO4B 4M8QB 3MCLH 1YEJH 1ND0B 5DZOA 1NA8A 1CFQB 4MA3A 2CKBL 2Q3XA 5E6ZA 5HHNA 5SWSD 2AXGB 2L7JA 4Q6IB 1KCUL 4XOAA 1JYXA 1T04B 3CBKB 3I74A 2XG5B 4HIEA 2X3BA 2ICES 3PWPE 4IJ3B 5D71H 1KELH 1MFVA 1JXGA 5KYYA 4ZSOB 1FL5B 2CUHA 2EDOA 3HC2A 1QEWB 2ZXDA 4Y1AE 4G59C 5C0JB 5HYSA 1OP3H 3GD1C 3FF8A 1FH5L 1F11A 3TTYA 3JWDL 3VI4F 1G43A 1UWXK 2BSTA 2NY6D 3HAEA 3ASNB 5FM5O 3LZQA 2XTJC 1ZLUK 5BOJA 5HGBA 1JYVA 1VGEH 1I1AB 4J3UA 1C5DA 3HNTL 3W39B 1IT9H 4R5VA 5IMOB 4NP9A 1EVTC 4I5BB 1D6EB 2Y4SA 4O00A 3JWOL 1G7HB 5DMJB 1F1DA 4AQEA 4F8PA 2R2EA 4EDWL 1BWWA 4CC1A 2H8PA 2DQDL 3Q2LA 1PDKB 1NCAL 1U3YA 1IU1A 5BUGA 1B4RA 2YAEA 3WD5L 1XXFC 1GH7A 3U4EA 5DGRA 5IW1B 1JV2B 4HFUH 3RVTD 4DVBA 2R4RL 4P3CH 5DJYB 3NJFA 2X12A 2WLHA 1TKWA 1QO3B 5CCKH 5HD8C 4LCUA 1IARB 3L4ZA 4B9CA 1DQIA 1C8QA 3HBQA 5F88B 4X99A 4Z7AA 1JK8A 1TITA 2X4SA 4IRZL 4FNLL 4FHJA 3S5YA 4NAJA 3NH7L 5DEGA 5GRUH 5KN5A 1J9CT 3KLAA 2X4TA 1YECH 1JNNL 2NQDA 4MS8D 3KPSA 4FQ1L 3NG5A 1AR2A 4PJAB 3RVTC 3PWPA 3KZ8A 2IH1B 3KYMB 4L1LA 1LEGB 2TRHA 4QDGA 3FOLA 3SDDD 1UG9A 1T1XB 2QQLL 2OI9C 3BUDA 3N91A 5HYQA 1NGPL 3QXDA 1AZNA 4KI5F 3SE8H 2JKNA 4KJQD 5E2TH 3FRPG 2ZOWA