1NPMA

Neuropsin, a serine protease expressed in the limbic system of mouse brain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
225
structure length
223
Chain Sequence
ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROPSIN
publication title Crystal structure of neuropsin, a hippocampal protease involved in kindling epileptogenesis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Serine proteinase
total genus 51
structure length 223
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.4.21.118: Kallikrein 8.
pdb deposition date 1998-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1npmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1npmA02
1DOJA 2ANWA 2C8WB 1O2XA 3SHAH 4AOQA 1AMHA 3PB1E 1KIGH 4UFEH 1TWXB 2PLXA 4XFQA 3UPEA 3VXEH 4FUIA 3O8BA 2ZFRH 1QBVH 3P70B 5GDSH 5HM2A 3LC3A 3RC4A 2HOBA 3AW1A 2SGPE 3A81A 1O2SA 4Z0KA 4KTUA 1ANCA 1QJ7B 1WBGB 3TH2H 3A8CA 2VIVA 2P8OC 1EAUA 2H9TH 3HK3B 1JOUB 5TCCA 2FWWA 5C5NA 2PGBB 3U9AH 1AGJA 4Q7ZA 1C1MA 4CBOA 2Y7XA 1C1QA 1KXBA 1Z6EA 3F9HA 4FUJA 1NRQH 1O3EA 3MH7A 3ODDA 4DIIH 1B0EA 1BITA 2R3YA 5FPYA 4YOIA 5ESTE 3GCNA 3T5FH 5GWZA 1HCGA 2WPKS 3DA9B 4INKA 4A6LA 4OS5A 2A31A 1HRTH 3R0FA 1D3QB 4F49A 3GY4A 1P04A 1LO6A 2UUFB 2JH5D 4FU7A 1P0SH 4FUBA 1CHOF 3GY5A 2AMQA 4XOJA 1IAUA 4K1SA 1YPKH 2FI5E 1MZAA 4JZIA 3UUZA 3VB6A 1F5LA 2AGIX 1PPBH 1DWBH 4BTIB 1YKTA 2NWNA 5A09A 4ZKSU 2ZGXH 1TRYA 5FCRA 3BF6H 4O3TA 1SOZA 4Y0YE 1G32B 1G30B 4JZ1A 4WH6A 2NU0E 1GBDA 8KME2 5E2PA 4CREA 3DUXH 1F0UA 3K6YA 3GDSA 1BTUA 1TOMH 2D2DA 5DGJA 3ZZDA 3SU1A 1TNGA 4K2YA 2RDLA 2GTBA 1ZPZA 1C1VH 1MKXH 2A0QB 2BQ7B 3VB3A 1VGCC 1TNKA 1P2KA 2Z9KA 2Y6TA 4E05H 4NFFA 1GMHF 4WJG2 3E0PB 5JBCS 2J2UA 1OP0A 1FN8A 1TNHA 3RXDA 1P9SA 1ETRH 1QBOA 3GY2A 2BTCE 4ISLA 3EGKH 5E8EH 2M5TA 1GHYH 1MUEB 3SU0A 4D76A 1TRMA 1PYTC 1QCPA 1C1RA 4U32A 3TVJB 1C9TA 4OS2A 2F91A 3BTGE 1HAGE 1S84A 3STIA 1F0RA 4VGCB 1ARCA 1FLEE 3M35A 3MNBA 2FS9A 1MTVA 1O2QA 2FX4A 1KXDA 3BTQE 1VZQH 3TJVA 1VJAU 1G3CA 1YLCA 1EJMA 3GDVA 3EYDA 1PPZA 4GSOA 2OQ5A 1P2NA 1C2GA 1TBQH 1EPTC 2BXTH 2JETB 3MH6A 1SGTA 2FOHA 4J1YA 1LHDH 3GY3A 2GD4B 5HMAA 1V6DA 4JYVH 3PTBA 2J94A 4H4FA 1GVZA 1Y5AT 2THFB 1HJAB 1IQFA 2EA3A 1EZQA 2J4IA 1HAZB 1U6QA 4WXIA 3SJOA 1BHXF 5JYIA 1NTPA 1OPHB 3KNXA 1O2UA 3BG4C 4SGAE 2FOEA 1FPHH 4ABHA 2HALA 2F9UA 5GIBA 3RXMA 2PKSB 3KHVA 1PQAA 1K28D 2ZHFH 1ANBA 5EU8A 2GX4A 2WYGA 1BBRH 4IN1A 1SL3A 2XC4A 1ELDE 2BDAA 3GY6A 1P8VC 2A4GA 2ANKH 1TABE 1C5NH 3KF2A 1XXFA 3HGNA 2H9HA 4MPXA 4QT8C 3UY9A 1EOJA 1V2UT 7KMEH 4LZ4B 2ZI2H 2A2QH 2D1JA 5I46H 1Z8GA 1IQJA 5GPIB 2AGGX 2BLVA 1UK2A 1XVMA 2QY0B 3B23B 4A92A 1SGCA 1EP5A 1G3EA 4FUFA 1TX7A 5G4BA 4ABBA 1HJ8A 1UK4A 2SGQE 5EGMA 1E37B 5I25A 1NRRH 2ZCHP 1ELFA 3PWCA 2VH6A 2W7SA 4ISIH 1FAKH 1SBWA 2W7UA 3QUMP 3BIUH 3UQVA 1S0RA 3BEFB 1K22H 1HIAA 2J38A 4U2WA 5FHTA 4ZKNU 3QGJA 4K8BA 1TMUH 1V2NT 1FPCH 1P05A 1O2HA 3VGCB 2GT8A 1GJBB 4Q80A 2WV5A 2ANYA 1GBBA 1FN6A 1ZHMA 1F2SE 5IDKA 2F9VA 2VU8E 1EZUC 3E0NB 4I8JA 1P11E 1O33A 3TNSA 4MNVA 1MKXK 3B9FH 3DFLA 2OLGA 2STAE 4I7YH 1KLJH 3NK8A 4X0WU 2VNTA 3LJJA 4CRCA 3F6UH 4ABFA 4X6OA 3LGYA 3PMJA 3ZVDA 1BHXB 2J95A 3HATH 3RXBA 2BZ6H 2V3HH 1NZQH 3LONA 2ZDNA 1O2OA 4NWKA 4OS7A 1QB9A 3MTYA 4LZ1H 2ZCLP 1OS8A 4ZUHA 2C90B 1G2LA 1D3PB 1SGNE 1O3HA 3DFJA 3ZZ7A 2ZFTA 3ZVBA 1XXDA 2CJIA 3GY8A 1C4V2 1SGYE 5DP7A 2FZZA 3ATLA 3AASA 2FOMB 1UTPA 1O2VA 2YOLA 2C8ZB 2GDEH 2ZFPH 2F3CE 2Y5HA 1AFEH 1UVUH 1Z8IB 3UREA 4GCHF 2LNCA 1AUJA 3KEEA 4O3UA 3PM3A 1O2LA 4NA7A 2SNVA 1L1JA 3LC5A 2FDAA 6ESTA 2Z6BD 1CA0B 5C5OA 2BY5X 3SU3A 4D9RA 1BTPA 3PMHB 4ESTE 2BX4A 4I8LA 2HWLB 1C5LH 4NGAH 3SW2B 3K65B 1THRH 3AAVA 3ZZAA 1GI2A 3U8OH 1PPEE 1V2TT 4X8UH 5EG4A 4CRFA 5FCKA 1BBRK 1O5AB 4RN6A 1O3BA 2FOAA 2RA0A 2GCTB 1JIRA 4FU9A 1ESTA 4AGKA 3M5OA 4NSYA 5FBIA 4TY6A 6CHAB 2IN2A 1BRCE 1JMOH 1A0LA 1O34A 4K60A 3O8DA 1A3BH 1Y3YA 4H6TA 1WYKA 1MCVA 1O2GH 3S7KB 2C4FH 3SNDA 1BMNH 2GT7A 4YOJA 1YCPH 5PTPA 2C3SA 1SFIA 1EUFA 3A7ZA 5LPFA 2VVVA 1ZSJA 2Z9JA 5DO4H 1SQTA 1PQ7A 1VR1H 1BMAA 1C4Y2 4KGAA 4ZMAH 1SLVB 2R9PA 1S5SA 1O3AA 2PR3A 4YTAA 1DWEH 4MDSA 1GL1A 1HLTH 2ZP0H 3TNTA 2WPJS 1DX5M 1TBZH 2PFEA 2ZFFH 2YNBA 1CGHA 1E35B 1LDTT 2QV1A 3GISB 1P03A 2P16A 1GI5A 4DOQA 4D7GA 1DUAA 3P8FA 4CRGA 2WYJA 1FIWA 4UFGH 4I33A 1GBIA 2FLRH 1V2ST 1EKBB 1J15A 3MH5A 1DSTA 1SGPE 1MU6B 2Z7FE 1ZLRA 1V2MT 1ESAA 1VCWA 1Y5BT 2G55A 2VWLA 4NFEA 1AVXA 1T4UH 1A5IA 3P95A 2OC8A 1TONA 1GI6A 1HAPH 8GCHG 1XKBC 5GCHG 1SI5H 1LVYA 3BTME 3QZQA 2FP7B 1YP9A 1ORFA 3LH3A 3M3VA 4AX9H 2XW9A 1MCTA 1DVAH 1MD8A 1A0JA 1Y59T 1HYLA 2AYWA 2J9NA 1GHBF 1AQ7A 2VWMA 1QJ6B 2PTNA 1GJ6A 1TX8A 2Y7ZA 4ZHAA 1C5ZB 1LKBA 2BD9A 3L3TA 5BPEA 1TGNA 4FUGA 2BQWB 5A0CA 3TPIZ 3KGPA 1ZSLA 1D9IA 4VGCC 1ZMNA 3TK9A 2TIOA 4U01A 2OTVA 1ELGA 3MWIU 4HGCA 3P8NA 1C5YB 1HAYB 1FJSA 5AFZH 5HYOA 2Z9GA 1A5HA 1B0FA 2A7HA 1YPHC 3I29A 2OBQA 3UTUH 5T6DA 4GUXA 1O3NA 1QGFA 2JETC 2BVRH 1HPGA 3TITA 1TGTA 1P09A 1EZXC 1TBRH 1O39A 5SGAE 1C1TA 1HJAC 1K21H 2BMGB 2G4UA 2XBWA 3TLOA 5JDUB 1TGSZ 1LQEA 2A1DB 3FVFB 5EQSA 2VVUA 1P2OA 1V2KT 2BXUH 4BXSA 2DUCA 3RM0H 1AWFH 3TGKE 5E0GA 3EE0B 4DY7B 5HGGA 3V7TA 1NPMA 3A82A 2PKSC 1IHTH 2XBYA 2ZU4A 1T4VH 4AFZA 3PO1B 3M5MA 3PLPA 4XBDA 1V3XA 4O9VA 4K1EA 1FONA 3H5CB 3UOUA 1WQSA 1GBTA 1EQ9A 2ZU1A 3NUMA 1BZXE 2OC1A 3D23A 1MH0A 2ZDAH 3GCOA 3KQEA 4UFFH 2TGTA 4OGXA 2XYAA 3SUEA 3ENSB 1P3EA 4X1PU 1C5PA 4D8NA 3E8LA 1IHSH 3OY5U 1YCPK 5C1UA 1O31A 3SUDA 1GPZA 2F83A 1DE7H 3HK6B 1MBQA 3RXCA 3GCTG 1LHCH 3OYPA 1GHAF 2GCHG 1GHZA 1O2YA 3C27B 1LCYA 5DP5A 5JBAS 5HXFA 4AORA 2QIQA 1CHGA 4HFPB 2FOFA 2ZFQH 1J17T 1O5BB 2BDGA 3O8CA 2BD3A 3BTTE 1LHEH 2B9LA 4ISOA 3VB4A 1CT0E 4K8YA 2UUJB 1SGRE 1C5VA 4DW2U 2BZAA 7GCHG 1LVOA 1BTHH 3F9GA 5DP3A 1FIZA 1O38A 1O3OA 3VGCC 1GHXH 4X1RU 1GGDB 1P2JA 1ZGIA 1WOFA 4ABAA 3M5LA 1GMCG 3T26A 1AI8H 1UK3A 1FI8A 2Q6DA 4YLQH 3EA9A 1ABIH 3BTEE 1IQIA 2FEQH 3FAOA 1NU9A 3QN7A 1TX6A 4X8SH 1BA8B 1DS2E 1ELBA 3TU7H 1IQEA 4YESB 1GMDG 5EPNA 3UFAA 1HIAB 2A7JA 2CF9H 1ZHPA 1HJ9A 3PMAB 1O3PB 3ATIA 2RG3A 4GHTA 2ZCKP 5AHGH 2H5DA 4OS4A 2LPRA 1GJ7B 1KLIH 1F0TA 2ZKSA 3NPSA 3SGBE 3SI4H 1MQ6A 4XDEA 1QIXB 2PW8H 3RXHA 3P8GA 2F9OA 1OWIA 1QRZA 2ZTYA 4ABJA 2VINA 3LIWA 2V35A 4R0IA 2BD4A 1RIWB 1TYNA 2R2MB 1C5QA 1D6WA 1QNJA 1GI0A 2G5VA 1C5WB 4IMZA 4XBCA 2QXHA 5B6OA 1ZOMA 2CGAA 1PPFE 2A5KA 3A7YA 1C5SA 4Y11E 1AB9B 1AE8H 1E38B 2JH0D 3SU4A 2H5CA 3MNSA 2R0LA 1F7ZA 4ASHA 4DURA 1CA0C 1UTQA 2XBVA 1ZZZA 2BDYA 1XUHA 3S9BA 1NRPH 3S7HB 2ZWLH 1OYTH 4TY7A 4ZXYH 2Y82A 1JXPA 2G5NA 4BTTB 3UNSA 2ZPRA 3GDUA 3OY6U 4WMEA 4HZHA 1WTGH 2Y5FA 3MMGA 2GCTC 1RXPA 2YNAA 2VH0A 3ZVAA 1C5MD 3BSQA 3NKKA 3OX7U 2B5TB 1MMJN 4XE4A 3ZZ4A 1L4DA 1GBMA 6CHAC 1FAXA 1SOTA 1GMDF 3A7WA 4JMYA 2FO9A 4NG9H 4A5TS 2ZGHA 3NZIA 3WY8A 1INCA 1IQGA 4F4OC 3BEUA 1IOEA 3ELAH 1A61H 3MO9A 2H2ZA 2OC0A 5E2OA 1GI7B 2ZGBH 1C2JA 2PTCE 1AHTH 1MAYA 1A7SA 1S81A 5BRRE 4Q7YA 3Q00A 4ABEA 3KIDU 1N8OB 5L30H 1O3KA 1O2WA 2BDIA 2WINI 1Y3WA 2Z9LA 1O3DA 2BX3A 3T27A 5AFYH 3SBKA 1BRBE 3F9FA 3STJA 1EJAA 2A5IA 4SGBE 3V0XA 2FLBH 1EX3A 2ZPQA 5C2ZA 3UNRA 1QJ1B 1DFPA 1YCPM 1H9HE 2QCYA 4Q7XA 3E90B 2XXLA 1S6HA 1V2LT 2XC5A 1T8LA 2VWOA 4FU8A 1UVSH 1TAWA 1ZR0A 3MU4A 1F5RA 2BHGA 3RMOH 2XC0A 3P92A 1K1JA 1P01A 3MI4A 1C5OH 1MTWA 1UTJA 3QTOH 1P02A 1G36A 5DK1A 4A1TA 4DT7B 3ZVGA 1GI4A 3TK6A 1A46H 3SU6A 4DVAU 5DP4A 1QRWA 4B2AA 1BOQA 1C1WH 3TJNA 3RU4D 4B2CA 2BD2A 1P06A 3EA8A 5EXMA 2QAAA 1AKSA 1O5CB 3UR9A 3SJKA 1OP2A 2Z3EA 2FYQA 2TGPZ 1O2IA 5CHAB 2VIWA 1MTSA 1XUGA 4IGDA 1S85A 5EW2H 1ZSKA 1UTNA 2O9QA 1XMNB 3NCLA 1GJCB 3HGPA 2R2WU 1CBWB 2NU2E 4FUDA 1W3CA 5TCAA 2PUXB 2XRCA 9LPRA 5LGOA 1RTLA 3A89A 2AIQA 1QURH 4B76A 1GBFA 5DP6A 2W3KA 1OKXA 4H6SB 3S9CA 1C2EA 2FPZA 1DDJA 1V2JT 4X6PA 1Y3VA 1CQQA 1VITH 2TGDA 4XBBA 3AAUA 1O35A 1PQ5A 4IC6A 1WCZA 1AVGH 1Z8JB 2I6QA 2QXGA 4WMFA 2PUQH 1BTZA 1OOKB 2UUKB 1RTKA 5CMXH 1HUTH 2QN5T 2Y80A 1FV9A 4IBLH 5LPEA 4A1XA 2ZDLA 1YM0A 2IOTA 2PHBA 2UWLA 1P2MA 3A87A 3BTDE 1TMTH 1N6XA 3M3TA 3MHWU 3CP7A 3TH4H 4MVNA 3ZVCA 1VJ9U 2H9EH 1D3TB 3PO1C 1GBEA 4AGJA 3SGAE 2BD7A 2CHAB 2P95A 1UMAH 3MFJA 4PROA 3A7TA 2ZHQH 1F5KU 1FY3A 4BAQB 3QGNB 1UVPA 3A7XA 2QYIA 3FZDA 3E1XB 3URDA 1GDUA 1UHBA 2ZG0H 1OSSA 3RXQA 2OC7A 1XKAC 4IS5A 5LPRA 1SFQB 3NWUA 1FY1A 4BTUB 4MTBA 2OUAA 2HPPH 2AMPA 3Q77A 4CH8B 2ZGCA 2D26C 1BJVA 4TPIZ 2BVSH 2VWNA 3U98H 3VB7A 1AZZA 2VIQA 1YF4A 3T62A 4UE7H 3T28A 1CE5A 3HKJB 2ZGJA 2BOKA 3QTVH 6GCHG 2XWAA 3QZRA 1OWJA 1C5TA 3ATKA 3GYLB 3P17H 4FUHA 3D65E 4YO9A 2V3OH 1SLUB 9ESTA 1NM6A 1SPJA 4MPWA 3BTKE 4UDWH 1ID5H 1BBRE 1SLWB 4RKJB 1YPMH 3SV9A 2O8TA 4FVBA 3RC6A 5F6MA 1SGEE 3PROA 2O8UA 5T6GA 1F0SA 1W7GH 5FPTA 1AIXH 1A1RA 1S83A 1IQNA 4ZH8A 4UD9H 4UEHH 1GGDC 1GJ8B 1D6RA 3EA7A 4K69A 4ZHLU 1UTKA 1T8OA 2WPLS 3U1JB 3M36A 5EQQA 3SV7A 3KQBA 2WPMS 5F8XA 1DLEA 4INHA 4IC5A 1NFYA 3MU1A 1QR3E 2FI3E 3FANA 2QGRA 3CENA 1BCUH 1TRNA 3RXTA 1HAXB 3RU4E 1AD8H 1TNIA 3RM2H 2NU4E 1L0ZA 1LKAA 1BRAA 3SQHE 1HBTH 4JK6A 3U8TH 3SJIA 1FUJA 1KLTA 1PPHE 1NROH 3QK1A 1MKWH 3RLYH 2BM2A 2JH6D 1O2TA 1C1OA 1ZTJA 1AVWA 3TIUA 6LPRA 1ELEE 5A8YA 1QL8A 1Z71A 4I8GA 2FI4E 1UTMA 4WXVA 4WF8A 3TJOA 4DG4A 1NY22 3PLBA 2GZ9A 5T6FA 1O37A 3K9XB 1W7XH 1TMBH 1Z7KA 4IW4E 1GCTB 1V2PT 4BAOB 1LTOA 4CRDA 3MU8A 4KTSA 1DXPA 1FNIA 1C5UA 1BDAA 1O5FH 2DE8A 1SLXB 1SHHB 1VGCB 1ELCA 4NIWA 3SHCH 1DLKB 1AB9C 1CVWH 4H42U 1BTWA 4DJZB 1G37A 1O2ZA 4XSKU 4JYTA 1NT1A 2VGCB 3JZ1B 1V2RT 1CO7E 4WVPE 2GV7A 3BN9A 1MTNB 2JKHA 5ESBA 3ZZBA 1CSOE 1UCYH 1GCDA 1P10A 4D9QA 1DM4B 4WY3A 4ISHH 3HPTB 4YT7H 1VITG 2A2XH 1NO9H 4I31A 3M7QA 1THPB 3EQ0H 3BTHE 1KXEA 2ALVA 1Q2WA 2GKVE 1BJUA 3GICB 3RXJA 2WUCA 1OP8A 1SGQE 1P9UA 1T8NA 1J16A 1LPKB 3GCHB 4OS6A 2ZA5A 1TB6H 3M7TA 3RXAA 3FP6E 1H9LB 2GZ8A 4HTCH 1N6YA 4GVUA 1MTUA 1GWAA 3F1SB 1ACBE 1FQ3A 2EI6A 5JB9S 1T7CA 4CBNA 3EAJA 1V2WT 5EXLA 2FMJA 3V13A 5DKMA 1TIOA 1TPPA 2DE9A 2WPIS 3MO6A 3LPRA 4CRBA 4ABIA 3A84A 3LGIA 1W8BH 3F9EA 1GI3A 2BD5A 1ZJKA 2G4TA 3A80A 4JK5A 1ETSH 5JBBS 2B0FA 1JIMA 2AMDA 2GVFA 2B8OH 2VJ1A 2Q6FA 3OU0A 2B7DH 2A5AA 1ANDA 2OD3B 1C2MA 1A3EH 1YPHE 1UTLM 3KCGH 2EI7A 2ZTXA 1AFQB 1GVKB 1O3CA 1QQUA 3BIVH 4GHQA 3ZZ6A 3FP8E 1SG8B 1ZPBA 1NN6A 1P3CA 1Y3UA 3RMMH 3SOSA 1KTTB 1OYQA 2QF0A 1UO6A 1DWCH 2HNTE 2NU1E 2SNWA 1EJNA 1FZZA 2BYAX 2Z9IA 4Y6DA 5AF9H 4AYYB 2ALPA 1GBJA 4LXBH 1K1PA 1GBHA 1P2IA 1Y5UT 4JZDH 3K2UA 1A0HB 2BDBA 4ZKOU 3Q3YA 4M7GA 2ZHDA 3RDZA 1GJ5H 2ILNA 1W12U 1W0YH 5TJXA 2FTMA 1J8AA 3E91A 2PGQB 1TPAE 2FOBA 3TGIE 3MOCA 8GCHF 2OINA 4JZFH 3OSYA 5GCHF 1C2KA 1MKWK 1FY8E 2Y81A 1MU8B 1TOCB 3MNCA 4UFDH 1VCQA 4LOYH 1CBWC 1FY4A 1SMFE 3RXUA 3KL6A 2J92A 3KQDA 2BLOA 4I8HA 2FOCA 1A5GH 2UUYA 5DJ7A 4HI3A 1T31A 4Y76A 1UVOA 1AKSB 1W0ZU 2KAIB 2ZECA 3PTNA 1BQYA 4LK4A 1JRSA 3MU5A 4Y7BA 1GJAB 1AWHB 2GZ7A 5FXLA 1RTFB 1L2EA 1GJDB 1NFWA 3ZZ3A 1PYTD 4NA8A 3H7TA 1EAWA 1OWDA 1XX9A 3U8RH 1ZMJA 1AO5A 3H7OA 5DPAA 3L6PA 4NIVA 4CR5A 5CE1A 3BTWE 4AG2A 2FODA 1RGQA 2ZU3A 1TQ7B 1G9IE 1UCYK 1KXFA 5IYTA 2A4QA 2OQUA 1BMLA 1V2OT 3Q3KA 2QXIA 1QL7A 1EASA 1VCPA 2ZHEH 3SNBA 2CHAC 1IQLA 1XVOA 1O3JA 3RXLA 4CRAA 1BMMH 5EW1H 4GPGA 5FPSA 2FIRH 3R3GB 1O2NA 1SQOA 1Z1IA 3KQCA 4GAWA 4B75A 3SJ8A 3QX5H 1PPCE 2A45B 3KN2A 2BY7X 2W3IA 3K6ZA 2EC9H 4JZEH 3SU5A 1C9PA 1YPJH 4DCDA 4TYDA 1MAXA 2AIPA 4AFUA 3Q76A 1CT2E 4KTCA 1FMGA 1YPLH 2W26A 1O3IA 2AEIH 1KXCA 2F9PA 3LJOA 1UHBB 5L6NH 1N1LA 5C1XA 1HFDA 2Z3DA 1DXWA 1GMHG 3GCTF 3QDZB 2P93A 1P2QA 3RMNH 2GCHF 1EP6A 1O3FA 1ZYOA 3SV6A 1ZTKA 4NIYA 3MNXA 1K1LA 2ZZUH 2BB4A 1DPOA 4O03A 2ASUB 1QRXA 1ZRBA 2WUBA 1KTSB 3SNCA 1TLDA 1C5RA 3QO6A 2C93B 1TQ0B 3BG8A 3RP2A 1C1PA 2ZNKH 2OBOA 3S69A 1BRUP 2C8YB 3S9AA 4B71A 2GMTB 7GCHF 1EPTA 1HAHH 2CF8H 5HM9A 3LGVA 1EOLA 5L2YH 1O2JA 2HNTF 4B73A 1O5GH 1T8MA 2VIOA 1YYY1 2CXVA 3SZNA 1MQ5A 1MBMA 2NU3E 1GMCF 1S6FA 2Z3CA 2H1UA 1J14A 4B2BA 3SO3A 3A8AA 4R8TB 3HKIB 5DP8A 1Q3XA 2HVXA 2R0KA 2ODYB 1IQMA 3JZ2B 3E6PH 4Y79A 5F8ZA 3W95A 3LU9B 3G01A 5J4SA 5C67A 4Y71A 5EOKA 1QFKH 3MH4A 3U1IB 1AN1E 1AY6H 1BT7A 1XUIA 2TRMA 4Y8YA 1EB1H 1K2I1 1SGFG 2ESTE 4ZROA 1NRSH 2CV3A 1W10U 1K9OE 3RLWH 1KY9A 4NWLA 3ODFA 1GI8B 2PSXA 2UWOA 2O8MA 4MG3A 2PKAA 1DT2A 2R3UA 1GCTC 1Z1JA 4X1QU 5ABWA 1H8DH 2W5EA 1W2KH 1SQAA 2G8TA 3ZZCA 4B1TA 3LOXA 1XM1A 5EODA 1JWTA 1IQHA 5E0JA 3P8OA 1GG6B 1KYNA 1HDTH 2VGCC 1ZHRA 2D8WA 2QA9E 2AS9A 2XNIA 4YOGA 2ZDVH 4NZQA 3TH3H 1GBKA 4AFQA 1MTNC 2CMYA 4JYUH 1GBCA 1HGTH 4TPYA 3U69H 4CR9A 2QXJA 3ZVEA 1L4ZA 3IG6B 1TALA 3A88A 1WSSH 1PFXC 3O8RA 1DANH 2ZHWH 4JCNA 1TNJA 2GGVB 3QLPH 3UQOA 3FZZA 3S0NA 4WH8A 1AUTC 1CA8B 1BUIA 2P3TB 1ZMLA 3GCHC 3VFEA 1ETTH 4MPVA 4BNRA 3Q3XA 3RC5A 3SJ9A 2KAIA 1E36B 1XUJA 1YLDA 1Z6JH 1O3LA 3QWCH 4WMDA 4ISNA 4CHAB 1MZDA 2BVXH 4MPUA 3SQEE 1DUEA 4NSVA 1EAIA 1KDQA 1RD3B 3VB5A 4MNXA 3M7UA 5K7RA 1YGCH 3OTJE 1PJPA 2ULLA 2VIDA 2ZEBA 1LMWB 1TGBA 1HAVA 3ZZ9A 1P12E 4YLUA 3W94A 3DD2H 3ATWA 3C1KA 1RRKA 1HAOH 2XCFA 1GJ9B 1EXFA 2ODQA 3DHKH 1E0FD 4ABGA 3L33A 3M5NA 1QB1A 2O8WA 2HGTH 3A86A 1G3BA 1GI9B 1AFQC 3ZV8A 3AW0A 2F9BH 1THSH 2O8LA 1OWHA 1K1NA 1CGJE 4Y10E 2Y5GA 1GDQA 3M61U 1LHFH 1SR5C 2FTLE 1DY8A 1LQDB 4MLFB 3E3TA 3VPKA 1UJ1A 1OWEA 2OCVB 4E7NA 1WUNH 1YPGH 4NZLA 1SGDE 2BDCA 2G52A 2P59A 1P57B 1HXEH 3A8DA 1C1SA 2EEKA 1F92A 1GBAA 3AVZA 1NFUA 4E06H 1ELAA 1X7AC 5JB8S 3SUGA 4AN7A 1GDNA 3BV9B 2Q1JA 1OWKA 1ZJDA 1O2MA 1D4PB 3SNAA 3LT3A 4BANB 2ZTZA 4GCHG 1HV7A 1S82A 2G51A 2ZIQH 4RSPA 2OP9A 2STBE 2ANMH 3A8BA 1C5XB 4AZ2B 1H1BA 1SC8U 1QB6A 2BLQA 4U30A 2BOHB 1LPGB 1C2DA 2V0BA 3UWJH 1JBUH 1C1UH 2XTTB 3T29A 1C2HA 4Y8ZA 4Y0ZE 1FDPA 4NCYA 2BQ6B 1L1GA 4DIHH 2ZQ2A 1K1IA 5C1YA 3LGUA 3PMBB 3UR6A 5GXPA 3TGJE 3GY7A 1HAIH 1PQ8A 2FX6A 3UOPA 4AG1A 5GJ4B 2TBSA 1O2RA 4ZHMU 3RU4T 1A2CH 3FFGA 2IJOB 1TA6A 3RXRA 4KP0A 2XBXA 4YM9A 2I6SA 2ZDMA 2P8OB 1V2QT 4ZKRU 1KSNA 1W11U 2PWXA 2Q6GA 5A8ZA 2ZPSA 1UVTH 5A0AE 3DT0H 2ODPA 3RXOA 3RXIA 3A85A 3LGTA 3SI3H 2XWBI 1O36A 4O97A 1WQVH 3I78A 2XCNA 4IN2A 2VIPA 1TE0A 1ESBA 1DSUA 3ZVFA 1O5DH 4AB8A 4X1NU 4X2XA 1ELVA 2BD8A 3B8JA 1J9CH 1DY9A 2ZO3H 2G00A 3A7VA 4BXWA 2ZU2A 1DITH 5F03A 5J4QA 1TGCA 1Y8TA 1WTHD 2P3UB 3ESTA 1NESE 5ETXA 1O5EH 1YBWA 4FUEA 3ZYDA 3E16B 2AERH 3RXVA 2FESH 3P6ZB 4BAMB 1AU8A 3GYMA 5DP9A 1OXGA 3MYWA 2F9NA 5EPYA 1ZRKA 4Z6AH 8LPRA 2BLWA 3V12A 4ABDA 4ZAEA 1O30A 1TA2A 1RIWC 1C2FA 3ATMA 4X6NA 2IPHA 3NXPA 3RXKA 1TPOA 2P94A 1V2VT 4MQAA 1H9IE 3TJUA 1LVMA 1GHBG 1LPZB 1ANEA 2HRVA 2OXSA 3D62A 6GCHF 2A4RA 4X8VH 1EB2A 3PYHA 1QY6A 4TWYA 4RKOB 1ELTA 1BTXA 1SB1H 4INLA 1SGIB 4TWWA 8ESTE 3N7OA 1QBNA 1GL0E 1K1MA 3BEIB 3BTFE 2GMTC 1AZ8A 2HPQH 3RXEA 1TFXA 1ABJH 1O3MA 5A2MH 5EXNA 4X1SU 2BY9X 5FBEA 4AYVB 2BY8X 3LKWA 1MD7A 2G81E 4A1VA 2A32A 3CS0A 5JPMH 3V3MA 5EQRA 3LGWA 3SN8A 4Y7AA 5F8TA 1GJ4H 1NFXA 1CU1A 1NU7B 4THNH 3ZV9A 1KXAA 2BDHA 2QC2A 4Y8XA 3RXGA 3RMLH 4WWYA 2RCEA 4YZUA 1ZTLA 2SFAA 2TPIZ 4ZXXH 4K1TA 1QL9A 1XUKA 1IQKA 2FOGA 3I77A 5E0HA 3VXFH 1EPTB 2GV6A 2C8XB 1GHVH 1A4WH 3ITIA 1C1NA 3PLKA 2SGAA 5FAHA 1NS3A 2ZF0H 4Q2KA 2FXRA 3IWMA 1TPSA 5T3HA 1NRNH 1BIOA 1EZSC 1QQ4A 1Q31A 5C3NA 4D7FA 2A7CA 4NIXA 4BOHA 1O32A 4KKDA 1LVBA 1ARBA 3RXFA 1O2PA 2RA3A 3BG4B 4B74A 3PV4A 1N8OC 5H4IB 4A7IB 1S0QA 5DG6A 1Y3XA 5K0HA 2WV4A 3T25A 1GG6C 1GI1A 3T2NA 4K5ZA 2BY6X 3URCA 4MNYA 1H4WA 3ZZ8A 4CH2B 1XUFA 4K3JA 1PPGE 1SHYA 1GHAG 3TK5A 4DGJA 2FYRA 2ZFSA 4J2YB 5C20A 5AVDA 2ZQ1A 2PKAB 2WPHS 4GLYA 3SV2H 3D49H 1EATA 2EI8A 3RXSA 1WV7H 3MU0A 4X2VA 1OX1A 1SSXA 1Z8RA 2GP9B 4FXGH 1BTYA 1GBLA 2FS8A 2P3FH 3UNQA 5A0BA 5FX5A 1NC6A 2SGEE 3SUFA 3RUOA 4KELA 1WU1A 1O0DH 3UIRA 4BAKB 1VITF 1BB0B 1QHRB 5L2ZH 1QA0A 5CHAC 1GVLA 4OGYA 1JRTA 1FXYA 2HNTC 4CHAC 1C2LA 2TGAA 1GHWH 1K1OA 4YT6H 2PV9B 3RXPA 4OS1A 4X8TH 4NA9H 4AFSA 1EAXA 5A8XA 2AH4X 1L1NA 2PSYA 1UCYE 2QF3A 1QTFA 1O2KA 1G3DA 1YC0A 1QA7A 1W13U 1SGFA 5FX6A 3LDXH 3SNEA 1M9UA 1RJXB 1LHGH 3MO3A 3F68H 1B5GH 2GDDA 3VEQB 2A4OA 1DWDH 1RFNA 1KDQB 1TNLA 3PWBA 4IMQA 1FY5A 1T32A 3SORA 2VVCA 1HAVB 3LH1A 4I8KA 4E7RG 1E34B 7ESTE 3M37A 1WAYB 2H6MA 1HXFH 2J34A 3UWIA 1SVPA 1UTOA 4I32A 4UONA 2AFQB 3A83A 4MNWA 1C2IA 2UWPA 3EDXB 4AB9A 2Z94A 3ZYEA 1CT4E 1H8IH 4BAHB 1AE5A 3ZZ5A 1O3GA 4FUCA 4X2YA 1G2MA 2SGDE 3M3SA 1CHOG 1DICA 2SGFE 2ZDKA 1CGIE 1ZPCA 4X2WA 2FM2A 3SGQE 3FP7E 3GOVB 2VB0A 5LH8A 7LPRA 2HLCA 5JBTA 1B7XB 1C4U2 2K1QA 4FVDA 2ZC9H 1ZGVA 2AGEX 1HNEE 2ZU5A 1W14U 2V6NA 4X6MA 1D3DB 3SU2A 1HB0B 3CS7A 2CN0H 3SV8A 3IITA 1YPEH 1RS0A
chains in the Genus database with same CATH superfamily
1DOJA 2ANWA 2C8WB 1O2XA 3DSGA 3SHAH 4AOQA 1AMHA 3PB1E 1KIGH 4UFEH 1TWXB 2PLXA 4XFQA 3UPEA 3VXEH 3GS9A 4FUIA 3O8BA 2ZFRH 1QBVH 3P70B 5GDSH 5HM2A 3LC3A 3RC4A 3F0OA 2W6ID 2HOBA 3AW1A 2SGPE 3A81A 1O2SA 4Z0KA 4KTUA 1ANCA 1QJ7B 1WBGB 3TH2H 3A8CA 2VIVA 2P8OC 1EAUA 2H9TH 3HK3B 1JOUB 5TCCA 3OTPA 2FWWA 5C5NA 2PGBB 3U9AH 1AGJA 4Q7ZA 1C1MA 4Z1MD 4CBOA 2Y7XA 1C1QA 1KXBA 1Z6EA 3F9HA 4FUJA 1NRQH 1O3EA 3MH7A 3ODDA 4DIIH 1B0EA 1BITA 2R3YA 5FPYA 4YOIA 5ESTE 3GCNA 3T5FH 2VBCA 1HCGA 2WPKS 3DA9B 4INKA 4A6LA 4OS5A 5GWZA 2A31A 1HRTH 3R0FA 1D3QB 4F49A 3GY4A 1P04A 1LO6A 2UUFB 1SKYE 2V7QD 2JH5D 4FU7A 1P0SH 4FUBA 1CHOF 3GY5A 2AMQA 4XOJA 1IAUA 4K1SA 1YPKH 2FI5E 1MZAA 4JZIA 3UUZA 3VB6A 1F5LA 2AGIX 1PPBH 1DWBH 4BTIB 1YKTA 2NWNA 5A09A 4ZKSU 4RI0A 2ZGXH 1TRYA 5FCRA 3BF6H 4O3TA 1SOZA 4Y0YE 1G32B 1G30B 4JZ1A 4WH6A 2NU0E 1GBDA 8KME2 5E2PA 4CREA 3DUXH 1F0UA 3K6YA 3GDSA 1BTUA 1TOMH 2D2DA 5DGJA 3ZZDA 3SU1A 1TNGA 4K2YA 2RDLA 2GTBA 1ZPZA 1C1VH 1MKXH 2A0QB 2XNDD 2BQ7B 3VB3A 1VGCC 1TNKA 1P2KA 2KX4A 2Y6TA 2Z9KA 4E05H 4NFFA 1GMHF 4WJG2 3E0PB 3OE7D 5JBCS 2J2UA 1OP0A 1FN8A 1TNHA 3KQ5A 4ZCNA 3RXDA 2IPQX 1P9SA 1ETRH 1QBOA 3GY2A 2BTCE 4ISLA 3EGKH 2PP6A 5E8EH 2M5TA 1GHYH 1MUEB 3SU0A 4D76A 1TRMA 1PYTC 1QCPA 1C1RA 4U32A 3TVJB 4RT1A 1C9TA 4OS2A 2F91A 3BTGE 1HAGE 1S84A 3STIA 1F0RA 4VGCB 1ARCA 1FLEE 3M35A 3MNBA 2FS9A 1MTVA 1O2QA 2FX4A 1KXDA 3BTQE 1VZQH 3TJVA 1VJAU 1G3CA 1YLCA 1EJMA 3GDVA 3EYDA 1PPZA 4GSOA 2OQ5A 1P2NA 1C2GA 1TBQH 1EPTC 2BXTH 2JETB 1NBME 1SGTA 2FOHA 4J1YA 1LHDH 3GY3A 2GD4B 5HMAA 1V6DA 4JYVH 3PTBA 2J94A 4H4FA 1GVZA 1Y5AT 2THFB 1HJAB 1IQFA 2EA3A 1EZQA 2J4IA 1HAZB 1U6QA 4WXIA 3SJOA 1BHXF 5JYIA 1NTPA 1OPHB 3KNXA 1O2UA 3BG4C 4SGAE 2FOEA 1FPHH 4ABHA 2RFKC 2HALA 2F9UA 5GIBA 3RXMA 2PKSB 3KHVA 1H8HD 1PQAA 1K28D 2ZHFH 1ANBA 5EU8A 2GX4A 2WYGA 1BBRH 4IN1A 1SL3A 2XC4A 1ELDE 2BDAA 3GY6A 1P8VC 2A4GA 2ANKH 1TABE 1C5NH 3KF2A 1XXFA 3HGNA 2H9HA 4MPXA 4QT8C 3UY9A 1EOJA 1V2UT 7KMEH 4LZ4B 2ZI2H 2A2QH 2D1JA 3MH6A 5I46H 2HLDD 1Z8GA 1IQJA 5GPIB 2AGGX 2BLVA 1UK2A 1XVMA 2QY0B 3B23B 4A92A 3FOAA 1SGCA 1EP5A 1G3EA 4FUFA 1TX7A 5G4BA 4ABBA 1BMFD 1HJ8A 1UK4A 2SGQE 5EGMA 1E37B 5I25A 1NRRH 2ZCHP 1ELFA 3PWCA 2VH6A 2W7SA 4ISIH 1FAKH 1SBWA 2W7UA 3QUMP 3BIUH 3UQVA 1S0RA 2WSSD 2J97A 3BEFB 1K22H 1HIAA 2J38A 4U2WA 5FHTA 3WWBA 4ZKNU 3QGJA 4K8BA 1TMUH 1V2NT 1FPCH 1P05A 1O2HA 3VGCB 2GT8A 1GJBB 4Q80A 2WV5A 2ANYA 1GBBA 1FN6A 1ZHMA 1F2SE 5IDKA 2F9VA 2VU8E 1EZUC 3E0NB 4I8JA 5CHBA 1P11E 1O33A 3TNSA 4MNVA 1MKXK 3B9FH 3DFLA 2OLGA 2STAE 4I7YH 1KLJH 3NK8A 4X0WU 2VNTA 3LJJA 4CRCA 4DT4A 3F6UH 4ABFA 4X6OA 3LGYA 3PMJA 3ZVDA 1BHXB 2J95A 3HATH 3RXBA 2BZ6H 2V3HH 1NZQH 3LONA 2ZDNA 1O2OA 4NWKA 4OS7A 1QB9A 3MTYA 4LZ1H 2ZCLP 1OS8A 4ZUHA 2C90B 1G2LA 1D3PB 1SGNE 1O3HA 3DFJA 3ZZ7A 2ZFTA 3ZVBA 3N99A 1XXDA 2CJIA 3GY8A 1C4V2 1SGYE 5DP7A 2FZZA 4TSFD 3ATLA 3AASA 2FOMB 1UTPA 1O2VA 2YOLA 2C8ZB 2GDEH 2ZFPH 2F3CE 2Y5HA 1AFEH 1UVUH 1Z8IB 3UREA 2IJD1 4GCHF 2LNCA 1AUJA 3KEEA 4O3UA 3PM3A 1O2LA 4NA7A 2SNVA 1L1JA 3LC5A 2FDAA 6ESTA 2Z6BD 1CA0B 5C5OA 2BY5X 3SU3A 4D9RA 1BTPA 3PMHB 4ESTE 2BX4A 4I8LA 2HWLB 1C5LH 4NGAH 3SW2B 3K65B 1THRH 3AAVA 3ZZAA 1GI2A 3U8OH 1PPEE 1V2TT 4X8UH 5EG4A 4CRFA 5FCKA 1BBRK 1O5AB 2WZQA 4RN6A 1O3BA 2FOAA 2RA0A 2GCTB 1JIRA 4FU9A 1ESTA 4AGKA 3M5OA 3PRDA 4NSYA 5FBIA 5C17A 4TY6A 6CHAB 2IN2A 1BRCE 1JMOH 1A0LA 1O34A 4K60A 3O8DA 1WXRA 1A3BH 1Y3YA 4H6TA 1WYKA 1MCVA 1O2GH 3S7KB 2C4FH 5CDFE 3SNDA 1BMNH 2GT7A 4YOJA 1YCPH 5PTPA 2C3SA 1SFIA 1EUFA 3A7ZA 5LPFA 2VVVA 1ZSJA 2Z9JA 5DO4H 1SQTA 1PQ7A 1VR1H 1BMAA 1C4Y2 4KGAA 4ZMAH 1SLVB 2R9PA 1S5SA 1O3AA 2PR3A 4YTAA 1DWEH 4MDSA 1GL1A 1HLTH 2ZP0H 3TNTA 2WPJS 1DX5M 1TBZH 2PFEA 2ZFFH 2YNBA 1CGHA 1E35B 1LDTT 2QV1A 3GISB 1P03A 2P16A 1GI5A 4I86A 4D7GA 4DOQA 1DUAA 3P8FA 4CRGA 2WYJA 1FIWA 2JDID 4UFGH 4I33A 1GBIA 2KM0A 2FLRH 1V2ST 1EKBB 1J15A 3MH5A 1DSTA 1SGPE 1MU6B 2Z7FE 1ZLRA 1V2MT 1ESAA 1VCWA 1Y5BT 2G55A 2VWLA 4NFEA 2HVYB 1AVXA 1T4UH 1A5IA 3P95A 2OC8A 1TONA 1GI6A 1HAPH 8GCHG 1XKBC 5GCHG 1SI5H 1LVYA 3BTME 3QZQA 2FP7B 1YP9A 3F2FA 1ORFA 3LH3A 3M3VA 4AX9H 4B6FA 2XW9A 1MCTA 1DVAH 1MD8A 1A0JA 1Y59T 1HYLA 2AYWA 2J9NA 1GHBF 1AQ7A 2VWMA 1QJ6B 2PTNA 1GJ6A 1TX8A 2Y7ZA 1KMHB 4ZHAA 3N7DA 1C5ZB 1LKBA 2BD9A 3L3TA 5BPEA 5HKKD 1TGNA 4FUGA 1EFRD 1SQRA 2BQWB 5A0CA 3TPIZ 3KGPA 1ZSLA 1D9IA 4VGCC 1ZMNA 3TK9A 5EJ1A 2TIOA 4U01A 2OTVA 1ELGA 3MWIU 4HGCA 3P8NA 2CK3D 1C5YB 1HAYB 1FJSA 5AFZH 5HYOA 2Z9GA 1A5HA 1B0FA 2A7HA 1YPHC 3I29A 2OBQA 3UTUH 5T6DA 4GUXA 1O3NA 1QGFA 4ACAA 2JETC 2BVRH 1HPGA 3TITA 2KCYA 1TGTA 1P09A 1EZXC 1TBRH 1O39A 5SGAE 1C1TA 1HJAC 1K21H 2BMGB 2G4UA 2XBWA 3TLOA 5JDUB 2GJGA 1TGSZ 1LQEA 2A1DB 3FVFB 5EQSA 2VVUA 1P2OA 1V2KT 2BXUH 4BXSA 2DUCA 3RM0H 1AWFH 3TGKE 5E0GA 3EE0B 4DY7B 5HGGA 3V7TA 1NPMA 3A82A 2PKSC 1IHTH 2XBYA 5HIYA 2ZU4A 1T4VH 4AFZA 3PO1B 3M5MA 3PLPA 4XBDA 1V3XA 4O9VA 4K1EA 1FONA 3H5CB 3UOUA 1WQSA 1GBTA 1EQ9A 2ZU1A 3NUMA 1BZXE 2OC1A 1QZ8A 3D23A 1MH0A 2ZDAH 3GCOA 3KQEA 4UFFH 2TGTA 4OGXA 2XYAA 4FETA 3SUEA 3ENSB 1P3EA 4X1PU 1C5PA 3SYJA 4D8NA 2YMSC 3E8LA 1IHSH 3OY5U 1YCPK 5C1UA 1O31A 3SUDA 1GPZA 2F83A 1DE7H 3HK6B 1MBQA 3RXCA 3GCTG 1LHCH 3OYPA 4HG6A 1GHAF 2KCOA 2GCHG 1GHZA 1O2YA 3C27B 1LCYA 5DP5A 5JBAS 5HXFA 4AORA 2QIQA 3MQKC 1CHGA 4HFPB 2FOFA 2ZFQH 1J17T 1O5BB 2BDGA 3O8CA 2BD3A 3BTTE 1LHEH 2B9LA 4ISOA 3VB4A 1CT0E 4K8YA 2UUJB 1SGRE 1C5VA 4DW2U 2BZAA 4YXWD 7GCHG 1LVOA 1BTHH 3F9GA 5DP3A 1FIZA 1O38A 1O3OA 3VGCC 1GHXH 4X1RU 1GGDB 1P2JA 1ZGIA 1WOFA 4ABAA 3M5LA 1GMCG 3T26A 1AI8H 1UK3A 1FI8A 2Q6DA 4YLQH 3EA9A 1ABIH 3BTEE 1IQIA 2FEQH 3FAOA 1NU9A 3QN7A 1TX6A 4X8SH 1BA8B 1DS2E 1ELBA 3TU7H 1IQEA 5C94A 4YESB 1GMDG 5EPNA 3UFAA 1HIAB 2A7JA 2CF9H 1ZHPA 1HJ9A 3PMAB 3N7EA 1O3PB 3ATIA 2RG3A 4GHTA 2ZCKP 5AHGH 2H5DA 2JIZD 4OS4A 2LPRA 1GJ7B 1KLIH 1F0TA 2ZKSA 3NPSA 3SGBE 3SI4H 1MQ6A 4XDEA 1FX0B 5EIYA 1QIXB 2PW8H 3RXHA 3P8GA 3NRLA 2F9OA 2JJ2D 1OWIA 1QRZA 2ZTYA 4ABJA 2VINA 3LIWA 2V35A 4R0IA 2BD4A 1RIWB 1TYNA 2R2MB 1C5QA 1D6WA 1QNJA 1GI0A 1UW7A 2G5VA 1C5WB 3PV2A 4IMZA 4XBCA 2QXHA 5B6OA 1ZOMA 4ACBA 2CGAA 1PPFE 1MABB 2A5KA 3A7YA 1C5SA 4Y11E 1AB9B 1AE8H 1E38B 2JH0D 3SU4A 2H5CA 3MNSA 2R0LA 1F7ZA 4ASHA 4DURA 1CA0C 1UTQA 2XBVA 1ZZZA 2BDYA 1XUHA 3S9BA 1NRPH 3S7HB 2ZWLH 1OYTH 4TY7A 4ZXYH 2Y82A 1JXPA 2G5NA 4BTTB 3UNSA 2ZPRA 3GDUA 3OY6U 4WMEA 4HZHA 1WTGH 2Y5FA 3MMGA 2GCTC 1RXPA 2YNAA 2VH0A 3ZVAA 1C5MD 3BSQA 3NKKA 3OX7U 2B5TB 1MMJN 4XE4A 3ZZ4A 1L4DA 1GBMA 6CHAC 1FAXA 1SOTA 1GMDF 3A7WA 4JMYA 2FO9A 4NG9H 4A5TS 2ZGHA 3NZIA 3WY8A 1INCA 1IQGA 4F4OC 3BEUA 1IOEA 3ELAH 1A61H 3MO9A 2H2ZA 2OC0A 5E2OA 1GI7B 2ZGBH 1C2JA 2PTCE 1AHTH 1MAYA 1A7SA 1S81A 5BRRE 4Q7YA 3Q00A 4ABEA 3KIDU 1N8OB 5L30H 1O3KA 1O2WA 2BDIA 2WINI 1Y3WA 2Z9LA 1O3DA 2BX3A 3T27A 5AFYH 3SBKA 1BRBE 3F9FA 3STJA 5DSFA 1EJAA 2A5IA 4SGBE 3V0XA 2FLBH 1EX3A 2ZPQA 5C2ZA 3UNRA 1QJ1B 1DFPA 1YCPM 1H9HE 2QCYA 4Q7XA 3E90B 2XXLA 1S6HA 1V2LT 5FL7D 2XC5A 1T8LA 2VWOA 4FU8A 4XRNA 1UVSH 1TAWA 1ZR0A 3MU4A 1F5RA 2BHGA 3RMOH 2XC0A 3P92A 1K1JA 1P01A 3MI4A 1C5OH 1MTWA 1UTJA 3QTOH 4OM9A 1P02A 1G36A 5DK1A 4A1TA 5B6LA 4DT7B 3ZVGA 1GI4A 3TK6A 5F53A 1A46H 3SU6A 4DVAU 5DP4A 1QRWA 4B2AA 1BOQA 1C1WH 3TJNA 3RU4D 4B2CA 2BD2A 1P06A 3EA8A 5EXMA 2QAAA 1AKSA 1O5CB 3UR9A 3SJKA 1OP2A 2Z3EA 2FYQA 2TGPZ 1O2IA 5CHAB 2VIWA 1MTSA 1XUGA 4IGDA 1S85A 5EW2H 1ZSKA 1UTNA 2O9QA 1XMNB 3NCLA 1GJCB 3HGPA 2R2WU 1CBWB 2NU2E 4FUDA 1W3CA 5TCAA 2PUXB 2XRCA 9LPRA 5LGOA 1RTLA 3A89A 2AIQA 1QURH 4B76A 1GBFA 5DP6A 2W3KA 1OKXA 4H6SB 3S9CA 1C2EA 2FPZA 1DDJA 1V2JT 4X6PA 1Y3VA 1CQQA 1VITH 2TGDA 4XBBA 3AAUA 1O35A 1PQ5A 4IC6A 4P02A 1WCZA 1AVGH 1Z8JB 2I6QA 2QXGA 4WMFA 2PUQH 1BTZA 1OOKB 2UUKB 1RTKA 5CMXH 1HUTH 2QN5T 2Y80A 1FV9A 4IBLH 5LPEA 4A1XA 2ZDLA 1YM0A 2IOTA 2PHBA 2UWLA 1P2MA 3A87A 3BTDE 1TMTH 1N6XA 3M3TA 3FN8A 3MHWU 3CP7A 3TH4H 4MVNA 3ZVCA 1VJ9U 2H9EH 2KFWA 1D3TB 3PO1C 2EY4C 1GBEA 4AGJA 3SGAE 2BD7A 2JJ1D 2CHAB 2P95A 1UMAH 3MFJA 4PROA 3A7TA 2ZHQH 1F5KU 1FY3A 4BAQB 3QGNB 1UVPA 3A7XA 2QYIA 3FZDA 3E1XB 3URDA 1GDUA 1UHBA 2ZG0H 1OSSA 2EQNA 3RXQA 2OC7A 4AC9A 1XKAC 5C0TA 4IS5A 5LPRA 1SFQB 3NWUA 1FY1A 4BTUB 3F3BA 4MTBA 2OUAA 2HPPH 2AMPA 3Q77A 4CH8B 2ZGCA 2D26C 1BJVA 4TPIZ 2BVSH 2VWNA 3U98H 3VB7A 1AZZA 2VIQA 2V3MA 1YF4A 3T62A 4UE7H 3T28A 1CE5A 3FO8D 3HKJB 2ZGJA 2BOKA 3QTVH 6GCHG 2XWAA 3QZRA 1OWJA 1C5TA 3ATKA 3GYLB 2W6JD 3P17H 4FUHA 3D65E 4YO9A 1E1RD 2V3OH 3PV5A 1SLUB 9ESTA 1NM6A 1SPJA 4MPWA 3BTKE 2F4LA 4UDWH 1ID5H 1BBRE 1SLWB 4XD7D 4Q4LA 4RKJB 1YPMH 3SV9A 2O8TA 5KEDA 4FVBA 3RC6A 5F6MA 1SGEE 3PROA 2O8UA 5T6GA 1F0SA 1W7GH 5FPTA 1AIXH 1A1RA 3CNRA 1S83A 1IQNA 4ZH8A 4UD9H 4UEHH 1GGDC 1GJ8B 1D6RA 3EA7A 3DSPA 4K69A 1UTKA 4ZHLU 1T8OA 2WPLS 3U1JB 3M36A 1E79D 5EQQA 3SV7A 3KQBA 2WPMS 5F8XA 1DLEA 4INHA 2K8IA 4IC5A 1NFYA 3MU1A 1QR3E 2FI3E 3FANA 2QGRA 3CENA 1BCUH 1TRNA 3RXTA 1HAXB 3RU4E 1AD8H 1TNIA 3RM2H 2NU4E 1L0ZA 1LKAA 1BRAA 3SQHE 1HBTH 4JK6A 3U8TH 3SJIA 1FUJA 1KLTA 2OK5A 1PPHE 1NROH 3QK1A 1MKWH 3RLYH 2BM2A 2JH6D 1O2TA 1C1OA 1ZTJA 1AVWA 3TIUA 6LPRA 1ELEE 5A8YA 1QL8A 2YMSD 1Z71A 4I8GA 2FI4E 1UTMA 4WXVA 4WF8A 3TJOA 4DG4A 1NY22 3PLBA 2GZ9A 5T6FA 1O37A 3K9XB 1W7XH 1TMBH 1Z7KA 4IW4E 1VKYA 1GCTB 1V2PT 4BAOB 1LTOA 4CRDA 3MU8A 4KTSA 1DXPA 1FNIA 1C5UA 1BDAA 1O5FH 2DE8A 1SLXB 2LELA 1SHHB 1VGCB 1ELCA 4NIWA 3SHCH 1DLKB 1AB9C 1CVWH 4H42U 1BTWA 4DJZB 1G37A 1O2ZA 4XSKU 4JYTA 1NT1A 2VGCB 3JZ1B 1V2RT 1CO7E 4WVPE 2GV7A 3BN9A 1MTNB 2JKHA 3KYFA 5ESBA 3ZZBA 1CSOE 1UCYH 1GCDA 1P10A 4D9QA 1DM4B 4WY3A 4ISHH 3HPTB 4YT7H 1VITG 2A2XH 1NO9H 4I31A 2AHME 3M7QA 1THPB 3EQ0H 3BTHE 1KXEA 2ALVA 1Q2WA 2GKVE 1BJUA 3GICB 3RXJA 2WUCA 1OP8A 1SGQE 1P9UA 1T8NA 1J16A 1LPKB 3GCHB 4OS6A 2ZA5A 1TB6H 3M7TA 3RXAA 2KZ4A 3FP6E 1H9LB 2GZ8A 4HTCH 1N6YA 4GVUA 1MTUA 1GWAA 3F1SB 1ACBE 1FQ3A 2EI6A 1W0JD 5JB9S 1T7CA 4CBNA 3EAJA 1V2WT 5EJLA 5EXLA 2FMJA 3V13A 2XOKD 5DKMA 1TIOA 1TPPA 2DE9A 2WPIS 3MO6A 3LPRA 4CRBA 4ABIA 3A84A 3LGIA 1W8BH 3F9EA 2M2AA 1GI3A 2BD5A 1ZJKA 2G4TA 3A80A 4JK5A 1ETSH 5JBBS 2B0FA 1JIMA 2AMDA 2GVFA 2B8OH 2VJ1A 2Q6FA 3OU0A 2B7DH 2A5AA 1ANDA 2OD3B 1C2MA 1A3EH 1YPHE 1UTLM 3KCGH 4B6EA 2EI7A 2ZTXA 1AFQB 1GVKB 1O3CA 1QQUA 3BIVH 2QF4A 4GHQA 3ZZ6A 3FP8E 1SG8B 1ZPBA 1NN6A 1P3CA 1Y3UA 3RMMH 3SOSA 1KTTB 1OYQA 2QF0A 1UO6A 1DWCH 2HNTE 2NU1E 2SNWA 1EJNA 1FZZA 2BYAX 2Z9IA 4Y6DA 1YLNA 4AYYB 5AF9H 2ALPA 1GBJA 4LXBH 1K1PA 1GBHA 1P2IA 1Y5UT 4JZDH 3K2UA 1A0HB 2BDBA 3F2GA 4ZKOU 3Q3YA 4M7GA 2ZHDA 3RDZA 1GJ5H 2ILNA 1W12U 1W0YH 5TJXA 2FTMA 1J8AA 3E91A 2PGQB 1TPAE 2FOBA 3TGIE 3MOCA 8GCHF 2OINA 4JZFH 3OSYA 5GCHF 1C2KA 1MKWK 1FY8E 2Y81A 1MU8B 1TOCB 3MNCA 4UFDH 1VCQA 4LOYH 1CBWC 3PRBA 1FY4A 1SMFE 3RXUA 3KL6A 2J92A 3KQDA 2BLOA 3SZEA 4I8HA 2FOCA 1A5GH 2UUYA 5DJ7A 4HI3A 1T31A 4Y76A 1UVOA 1AKSB 1W0ZU 2KAIB 2ZECA 3PTNA 1BQYA 4LK4A 1JRSA 3MU5A 4Y7BA 1GJAB 1AWHB 2GZ7A 5FXLA 1RTFB 1L2EA 1GJDB 1NFWA 3ZZ3A 1PYTD 4NA8A 3H7TA 1EAWA 1OWDA 5DN6D 1XX9A 3U8RH 1ZMJA 1AO5A 4FOUC 3H7OA 5DPAA 3L6PA 4NIVA 4CR5A 5CE1A 3BTWE 4AG2A 2FODA 1RGQA 2ZU3A 1TQ7B 1G9IE 1UCYK 1KXFA 5IYTA 2A4QA 2OQUA 1BMLA 1V2OT 3Q3KA 2QXIA 1QL7A 1EASA 1VCPA 2ZHEH 3SNBA 2CHAC 3OAAD 1IQLA 1XVOA 1O3JA 3RXLA 4CRAA 1BMMH 5EW1H 4GPGA 5FPSA 2FIRH 3R3GB 1O2NA 1SQOA 1Z1IA 3KQCA 4GAWA 4B75A 3SJ8A 3QX5H 1PPCE 2A45B 3KN2A 2BY7X 3F0PA 2W3IA 3K6ZA 2EC9H 4JZEH 3SU5A 1C9PA 1YPJH 4DCDA 4TYDA 2QE7D 1MAXA 2AIPA 4AFUA 3Q76A 1CT2E 2J5UA 4KTCA 1FMGA 1YPLH 2W26A 1O3IA 2AEIH 1KXCA 2F9PA 3ZIAD 3EE7A 3LJOA 1UHBB 5L6NH 1N1LA 5C1XA 1HFDA 2Z3DA 1DXWA 1GMHG 3GCTF 3QDZB 2P93A 1P2QA 3RMNH 3OFND 2GCHF 1EP6A 1O3FA 1ZYOA 3SV6A 1ZTKA 4NIYA 3MNXA 1K1LA 2ZZUH 2BB4A 1DPOA 4O03A 2ASUB 1QRXA 1ZRBA 2WUBA 1KTSB 3SNCA 1TLDA 1C5RA 3QO6A 2C93B 1TQ0B 3BG8A 3RP2A 1C1PA 2ZNKH 2OBOA 5EJZA 3S69A 1BRUP 2C8YB 3S9AA 4B71A 2GMTB 7GCHF 1EPTA 1HAHH 2CF8H 5HM9A 3LGVA 1EOLA 5L2YH 1O2JA 2HNTF 4B73A 1O5GH 1T8MA 4F55A 2VIOA 1YYY1 2CXVA 3SZNA 1MQ5A 1MBMA 2NU3E 1GMCF 1S6FA 2Z3CA 2H1UA 1J14A 5GNDA 4B2BA 3SO3A 3A8AA 1E1QD 4R8TB 3HKIB 5DP8A 1Q3XA 2HVXA 2R0KA 2ODYB 1IQMA 3JZ2B 3E6PH 4Y79A 5F8ZA 3W95A 3LU9B 3G01A 5J4SA 5C67A 4Y71A 5EOKA 1QFKH 3MH4A 3U1IB 1AN1E 1AY6H 1BT7A 1XUIA 2TRMA 4Y8YA 1EB1H 1K2I1 1SGFG 2ESTE 4ZROA 1NRSH 2CV3A 1W10U 1K9OE 3RLWH 1KY9A 4NWLA 3ODFA 1GI8B 2PSXA 2UWOA 2O8MA 3AK5A 3DSOA 2PKAA 4MG3A 1DT2A 2R3UA 2QF5A 1GCTC 1Z1JA 4X1QU 5HIZA 1H8DH 5ABWA 2W5EA 1W2KH 1SQAA 2G8TA 3UAIC 3ZZCA 4B1TA 3LOXA 1XM1A 5EODA 1JWTA 1IQHA 5E0JA 3P8OA 1GG6B 1KYNA 1S6LA 1HDTH 2VGCC 1ZHRA 2D8WA 2QA9E 2AS9A 2XNIA 4YOGA 2ZDVH 4NZQA 3TH3H 1GBKA 4AFQA 1MTNC 2CMYA 4JYUH 1GBCA 1HGTH 4TPYA 3U69H 4CR9A 2QXJA 3ZVEA 1L4ZA 3IG6B 1TALA 3A88A 1WSSH 1PFXC 3O8RA 3WWFA 1DANH 2ZHWH 4JCNA 1TNJA 2GGVB 3QLPH 3UQOA 3FZZA 3S0NA 4Q63A 4WH8A 1AUTC 1CA8B 1BUIA 2P3TB 1ZMLA 3GCHC 3VFEA 1ETTH 4MPVA 4BNRA 3Q3XA 3RC5A 3SJ9A 2KAIA 1E36B 1XUJA 1YLDA 1Z6JH 1O3LA 3QWCH 4WMDA 4ISNA 4CHAB 1MZDA 2BVXH 4MPUA 3SQEE 1DUEA 4NSVA 1EAIA 1KDQA 1RD3B 3VB5A 4MNXA 3M7UA 5K7RA 1YGCH 3OTJE 1PJPA 2ULLA 2VIDA 2ZEBA 1LMWB 1TGBA 1HAVA 3ZZ9A 1P12E 4YLUA 3W94A 3DD2H 3ATWA 3C1KA 1RRKA 1HAOH 5C0UA 2XCFA 1GJ9B 1EXFA 2ODQA 3DHKH 1E0FD 4ABGA 3L33A 3M5NA 1QB1A 2O8WA 2HGTH 3A86A 1G3BA 1GI9B 1AFQC 3ZV8A 3AW0A 2F9BH 1THSH 2J98A 2O8LA 1OWHA 1K1NA 1CGJE 4Y10E 2Y5GA 1GDQA 2YMSB 3M61U 1LHFH 1SR5C 3KYGA 2FTLE 1DY8A 1LQDB 4MLFB 3E3TA 3VPKA 1UJ1A 1OWEA 2OCVB 4E7NA 1WUNH 1YPGH 2RDEA 4NZLA 1SGDE 5T1VA 2BDCA 2G52A 2P59A 1P57B 1HXEH 3A8DA 1C1SA 2EEKA 1F92A 1GBAA 3AVZA 1NFUA 4E06H 1ELAA 1COWD 1X7AC 5JB8S 3SUGA 4AN7A 1GDNA 5KGOA 3BV9B 2Q1JA 1OWKA 1ZJDA 1O2MA 1D4PB 3SNAA 3LT3A 4BANB 2ZTZA 4GCHG 1HV7A 1S82A 2G51A 2ZIQH 4RSPA 2OP9A 2STBE 2ANMH 3A8BA 1C5XB 4AZ2B 1H1BA 1SC8U 1QB6A 2BLQA 4U30A 2BOHB 1LPGB 1C2DA 2V0BA 3UWJH 1JBUH 1C1UH 2XTTB 3T29A 1C2HA 4Y8ZA 4Y0ZE 1FDPA 4NCYA 2BQ6B 1L1GA 4DIHH 2ZQ2A 2KR7A 1K1IA 4P00A 5C1YA 3LGUA 3PMBB 3UR6A 5GXPA 3TGJE 3GY7A 1HAIH 1PQ8A 2FX6A 3UOPA 4AG1A 5GJ4B 2TBSA 1O2RA 4ZHMU 3RU4T 1A2CH 3FFGA 2IJOB 1TA6A 3RXRA 4F48B 4KP0A 2XBXA 4YM9A 2I6SA 2ZDMA 2P8OB 1V2QT 4ZKRU 1KSNA 1W11U 2PWXA 2Q6GA 5A8ZA 2ZPSA 1UVTH 5A0AE 3DT0H 2ODPA 3RXOA 3RXIA 3A85A 3LGTA 3SI3H 2XWBI 1O36A 4O97A 1WQVH 3I78A 2XCNA 4IN2A 2VIPA 1TE0A 1ESBA 1DSUA 3ZVFA 1K0HA 1O5DH 4AB8A 4X1NU 4X2XA 1ELVA 2BD8A 3VG8A 3B8JA 1J9CH 1DY9A 2ZO3H 2G00A 3A7VA 4BXWA 2ZU2A 1DITH 3W1EA 5F03A 5J4QA 1TGCA 1Y8TA 1WTHD 2LP6A 2KCAA 2P3UB 3ESTA 1NESE 5ETXA 1O5EH 1YBWA 4FUEA 3ZYDA 3E16B 2AERH 3RXVA 2FESH 3P6ZB 4BAMB 1AU8A 3GYMA 5DP9A 2KCPA 3FKSD 1OXGA 3MYWA 2F9NA 5EPYA 1ZRKA 4Z6AH 8LPRA 2BLWA 1YY3A 3V12A 4ABDA 4ZAEA 1O30A 1TA2A 1RIWC 1C2FA 3ATMA 4X6NA 2IPHA 3NXPA 3RXKA 1TPOA 2P94A 2L6OA 1V2VT 4MQAA 1H9IE 3TJUA 1LVMA 1GHBG 1LPZB 1ANEA 2HRVA 2OXSA 3D62A 6GCHF 2A4RA 4X8VH 1EB2A 3PYHA 1QY6A 4TWYA 4RKOB 1ELTA 1BTXA 1SB1H 4INLA 1SGIB 4TWWA 3F2HA 8ESTE 3N7OA 1QBNA 1GL0E 1K1MA 2K0QA 3UB0A 3BEIB 3BTFE 4M9FA 2GMTC 1AZ8A 2HPQH 3RXEA 1TFXA 1ABJH 1O3MA 5A2MH 5EXNA 4X1SU 2BY9X 5FBEA 4AYVB 2BY8X 3LKWA 1MD7A 2G81E 4A1VA 2A32A 3CS0A 5JPMH 3V3MA 5EQRA 3LGWA 3SN8A 4Y7AA 5F8TA 1GJ4H 1NFXA 1CU1A 1NU7B 4THNH 3ZV9A 1H8ED 1KXAA 1YWUA 2BDHA 2QC2A 4Y8XA 3RXGA 5IK2D 3RMLH 4WWYA 2RCEA 1OHHD 4YZUA 3U28C 1ZTLA 2SFAA 2TPIZ 4ZXXH 4K1TA 1QL9A 1XUKA 1IQKA 4RT0A 2FOGA 3I77A 5E0HA 3VXFH 1EPTB 2GV6A 2C8XB 1GHVH 1A4WH 3ITIA 1C1NA 3PLKA 2SGAA 5FAHA 1NS3A 5KECA 2ZF0H 4Q2KA 2FXRA 3IWMA 1TPSA 5T3HA 1NRNH 1BIOA 1EZSC 1QQ4A 1Q31A 5C3NA 4D7FA 2A7CA 4NIXA 4BOHA 1O32A 4KKDA 1LVBA 1ARBA 3RXFA 1O2PA 2RA3A 3BG4B 4B74A 3PV4A 1N8OC 5H4IB 4A7IB 1S0QA 5DG6A 1Y3XA 5K0HA 2WV4A 3T25A 1GG6C 1GI1A 3T2NA 2WPDD 4K5ZA 2BY6X 3URCA 4MNYA 1H4WA 3ZZ8A 4CH2B 1XUFA 4K3JA 1PPGE 1SHYA 1GHAG 3TK5A 4DGJA 2FYRA 2ZFSA 4J2YB 5C20A 5AVDA 2ZQ1A 2PKAB 2WPHS 4GLYA 3SV2H 3D49H 1EATA 2WHXA 2EI8A 3RXSA 1WV7H 3MU0A 4X2VA 1OX1A 1SSXA 1Z8RA 2GP9B 4FXGH 1BTYA 1GBLA 2FS8A 2P3FH 3H09A 3UNQA 5A0BA 5FX5A 1NC6A 2SGEE 3SUFA 3RUOA 4KELA 1WU1A 1O0DH 3UIRA 4BAKB 1VITF 1BB0B 1QHRB 5L2ZH 1QA0A 5CHAC 1GVLA 4OGYA 1JRTA 1FXYA 2HNTC 4CHAC 1C2LA 2TGAA 1GHWH 4TT3D 1K1OA 4YT6H 2PV9B 3RXPA 4OS1A 4X8TH 4NA9H 4AFSA 1EAXA 5A8XA 2AH4X 1L1NA 2WV9A 2PSYA 1UCYE 2L74A 2QF3A 1QTFA 4ASUD 1O2KA 1G3DA 1YC0A 3OEHD 1QA7A 1W13U 1SGFA 5FX6A 3LDXH 3SNEA 1M9UA 1RJXB 1LHGH 3MO3A 3DCLA 3F68H 1B5GH 2GDDA 3VEQB 2A4OA 1DWDH 1RFNA 1KDQB 1TNLA 3PWBA 4IMQA 2F43B 1FY5A 1T32A 3SORA 2VVCA 1HAVB 3LH1A 4I8KA 4E7RG 1E34B 3WW7A 7ESTE 3M37A 1WAYB 2H6MA 1HXFH 2J34A 3UWIA 1SVPA 1UTOA 4I32A 4UONA 2AFQB 3A83A 4MNWA 1C2IA 2UWPA 3EDXB 4AB9A 2Z94A 3ZYEA 1CT4E 1H8IH 4BAHB 1AE5A 3ZZ5A 1O3GA 4FUCA 4X2YA 1G2MA 2SGDE 2J98B 3M3SA 1CHOG 1DICA 2SGFE 2ZDKA 1CGIE 1ZPCA 4X2WA 2FM2A 3SGQE 3FP7E 3GOVB 2VB0A 5LH8A 7LPRA 1W0KD 2HLCA 5JBTA 1B7XB 1C4U2 2K1QA 4FVDA 2ZC9H 1NBMD 1ZGVA 2AGEX 1HNEE 2ZU5A 1W14U 3OEED 2V6NA 4X6MA 1D3DB 3SU2A 1HB0B 3CS7A 2CN0H 1WDIA 3SV8A 3IITA 1YPEH 1RS0A
chains in the Genus database with same CATH topology
1DOJA 2ANWA 2C8WB 1O2XA 3SHAH 4AOQA 1AMHA 3PB1E 1KIGH 4UFEH 1TWXB 2PLXA 4XFQA 3UPEA 3VXEH 4FUIA 3O8BA 2ZFRH 1QBVH 3P70B 5GDSH 5HM2A 3LC3A 3RC4A 2HOBA 3AW1A 2SGPE 3A81A 1O2SA 4Z0KA 4KTUA 1ANCA 1QJ7B 1WBGB 3TH2H 3A8CA 2VIVA 2P8OC 1EAUA 2H9TH 3HK3B 1JOUB 5TCCA 2FWWA 5C5NA 2PGBB 3U9AH 1AGJA 4Q7ZA 1C1MA 4CBOA 2Y7XA 1C1QA 1KXBA 1Z6EA 3F9HA 4FUJA 1NRQH 1O3EA 3MH7A 3ODDA 4DIIH 1B0EA 1BITA 2R3YA 5FPYA 4YOIA 5ESTE 3GCNA 3T5FH 5GWZA 1HCGA 2WPKS 3DA9B 4INKA 4A6LA 4OS5A 2A31A 1HRTH 3R0FA 1D3QB 4F49A 3GY4A 1P04A 1LO6A 2UUFB 2JH5D 4FU7A 1P0SH 4FUBA 1CHOF 3GY5A 2AMQA 4XOJA 1IAUA 4K1SA 1YPKH 2FI5E 1MZAA 4JZIA 3UUZA 3VB6A 1F5LA 2AGIX 1PPBH 1DWBH 4BTIB 1YKTA 2NWNA 5A09A 4ZKSU 2ZGXH 1TRYA 5FCRA 3BF6H 4O3TA 1SOZA 4Y0YE 1G32B 1G30B 4JZ1A 4WH6A 2NU0E 1GBDA 8KME2 5E2PA 4CREA 3DUXH 1F0UA 3K6YA 3GDSA 1BTUA 1TOMH 2D2DA 5DGJA 3ZZDA 3SU1A 1TNGA 4K2YA 2RDLA 2GTBA 1ZPZA 1C1VH 1MKXH 2A0QB 2BQ7B 3VB3A 1VGCC 1TNKA 1P2KA 2Z9KA 2Y6TA 4E05H 4NFFA 1GMHF 4WJG2 3E0PB 5JBCS 2J2UA 1OP0A 1FN8A 1TNHA 3RXDA 1P9SA 1ETRH 1QBOA 3GY2A 2BTCE 4ISLA 3EGKH 5E8EH 2M5TA 1GHYH 1MUEB 3SU0A 4D76A 1TRMA 1PYTC 1QCPA 1C1RA 4U32A 3TVJB 1C9TA 4OS2A 2F91A 3BTGE 1HAGE 1S84A 3STIA 1F0RA 4VGCB 1ARCA 1FLEE 3M35A 3MNBA 2FS9A 1MTVA 1O2QA 2FX4A 1KXDA 3BTQE 1VZQH 3TJVA 1VJAU 1G3CA 1YLCA 1EJMA 3GDVA 3EYDA 1PPZA 4GSOA 2OQ5A 1P2NA 1C2GA 1TBQH 1EPTC 2BXTH 2JETB 3MH6A 1SGTA 2FOHA 4J1YA 1LHDH 3GY3A 2GD4B 5HMAA 1V6DA 4JYVH 3PTBA 2J94A 4H4FA 1GVZA 1Y5AT 2THFB 1HJAB 1IQFA 2EA3A 1EZQA 2J4IA 1HAZB 1U6QA 4WXIA 3SJOA 1BHXF 5JYIA 1NTPA 1OPHB 3KNXA 1O2UA 3BG4C 4SGAE 2FOEA 1FPHH 4ABHA 2HALA 2F9UA 5GIBA 3RXMA 2PKSB 3KHVA 1PQAA 1K28D 2ZHFH 1ANBA 5EU8A 2GX4A 2WYGA 1BBRH 4IN1A 1SL3A 2XC4A 1ELDE 2BDAA 3GY6A 1P8VC 2A4GA 2ANKH 1TABE 1C5NH 3KF2A 1XXFA 3HGNA 2H9HA 4MPXA 4QT8C 3UY9A 1EOJA 1V2UT 7KMEH 4LZ4B 2ZI2H 2A2QH 2D1JA 5I46H 1Z8GA 1IQJA 5GPIB 2AGGX 2BLVA 1UK2A 1XVMA 2QY0B 3B23B 4A92A 1SGCA 1EP5A 1G3EA 4FUFA 1TX7A 5G4BA 4ABBA 1HJ8A 1UK4A 2SGQE 5EGMA 1E37B 5I25A 1NRRH 2ZCHP 1ELFA 3PWCA 2VH6A 2W7SA 4ISIH 1FAKH 1SBWA 2W7UA 3QUMP 3BIUH 3UQVA 1S0RA 3BEFB 1K22H 1HIAA 2J38A 4U2WA 5FHTA 4ZKNU 3QGJA 4K8BA 1TMUH 1V2NT 1FPCH 1P05A 1O2HA 3VGCB 2GT8A 1GJBB 4Q80A 2WV5A 2ANYA 1GBBA 1FN6A 1ZHMA 1F2SE 5IDKA 2F9VA 2VU8E 1EZUC 3E0NB 4I8JA 1P11E 1O33A 3TNSA 4MNVA 1MKXK 3B9FH 3DFLA 2OLGA 2STAE 4I7YH 1KLJH 3NK8A 4X0WU 2VNTA 3LJJA 4CRCA 3F6UH 4ABFA 4X6OA 3LGYA 3PMJA 3ZVDA 1BHXB 2J95A 3HATH 3RXBA 2BZ6H 2V3HH 1NZQH 3LONA 2ZDNA 1O2OA 4NWKA 4OS7A 1QB9A 3MTYA 4LZ1H 2ZCLP 1OS8A 4ZUHA 2C90B 1G2LA 1D3PB 1SGNE 1O3HA 3DFJA 3ZZ7A 2ZFTA 3ZVBA 1XXDA 2CJIA 3GY8A 1C4V2 1SGYE 5DP7A 2FZZA 3ATLA 3AASA 2FOMB 1UTPA 1O2VA 2YOLA 2C8ZB 2GDEH 2ZFPH 2F3CE 2Y5HA 1AFEH 1UVUH 1Z8IB 3UREA 4GCHF 2LNCA 1AUJA 3KEEA 4O3UA 3PM3A 1O2LA 4NA7A 2SNVA 1L1JA 3LC5A 2FDAA 6ESTA 2Z6BD 1CA0B 5C5OA 2BY5X 3SU3A 4D9RA 1BTPA 3PMHB 4ESTE 2BX4A 4I8LA 2HWLB 1C5LH 4NGAH 3SW2B 3K65B 1THRH 3AAVA 3ZZAA 1GI2A 3U8OH 1PPEE 1V2TT 4X8UH 5EG4A 4CRFA 5FCKA 1BBRK 1O5AB 4RN6A 1O3BA 2FOAA 2RA0A 2GCTB 1JIRA 4FU9A 1ESTA 4AGKA 3M5OA 4NSYA 5FBIA 4TY6A 6CHAB 2IN2A 1BRCE 1JMOH 1A0LA 1O34A 4K60A 3O8DA 1A3BH 1Y3YA 4H6TA 1WYKA 1MCVA 1O2GH 3S7KB 2C4FH 3SNDA 1BMNH 2GT7A 4YOJA 1YCPH 5PTPA 2C3SA 1SFIA 1EUFA 3A7ZA 5LPFA 2VVVA 1ZSJA 2Z9JA 5DO4H 1SQTA 1PQ7A 1VR1H 1BMAA 1C4Y2 4KGAA 4ZMAH 1SLVB 2R9PA 1S5SA 1O3AA 2PR3A 4YTAA 1DWEH 4MDSA 1GL1A 1HLTH 2ZP0H 3TNTA 2WPJS 1DX5M 1TBZH 2PFEA 2ZFFH 2YNBA 1CGHA 1E35B 1LDTT 2QV1A 3GISB 1P03A 2P16A 1GI5A 4DOQA 4D7GA 1DUAA 3P8FA 4CRGA 2WYJA 1FIWA 4UFGH 4I33A 1GBIA 2FLRH 1V2ST 1EKBB 1J15A 3MH5A 1DSTA 1SGPE 1MU6B 2Z7FE 1ZLRA 1V2MT 1ESAA 1VCWA 1Y5BT 2G55A 2VWLA 4NFEA 1AVXA 1T4UH 1A5IA 3P95A 2OC8A 1TONA 1GI6A 1HAPH 8GCHG 1XKBC 5GCHG 1SI5H 1LVYA 3BTME 3QZQA 2FP7B 1YP9A 1ORFA 3LH3A 3M3VA 4AX9H 2XW9A 1MCTA 1DVAH 1MD8A 1A0JA 1Y59T 1HYLA 2AYWA 2J9NA 1GHBF 1AQ7A 2VWMA 1QJ6B 2PTNA 1GJ6A 1TX8A 2Y7ZA 4ZHAA 1C5ZB 1LKBA 2BD9A 3L3TA 5BPEA 1TGNA 4FUGA 2BQWB 5A0CA 3TPIZ 3KGPA 1ZSLA 1D9IA 4VGCC 1ZMNA 3TK9A 2TIOA 4U01A 2OTVA 1ELGA 3MWIU 4HGCA 3P8NA 1C5YB 1HAYB 1FJSA 5AFZH 5HYOA 2Z9GA 1A5HA 1B0FA 2A7HA 1YPHC 3I29A 2OBQA 3UTUH 5T6DA 4GUXA 1O3NA 1QGFA 2JETC 2BVRH 1HPGA 3TITA 1TGTA 1P09A 1EZXC 1TBRH 1O39A 5SGAE 1C1TA 1HJAC 1K21H 2BMGB 2G4UA 2XBWA 3TLOA 5JDUB 1TGSZ 1LQEA 2A1DB 3FVFB 5EQSA 2VVUA 1P2OA 1V2KT 2BXUH 4BXSA 2DUCA 3RM0H 1AWFH 3TGKE 5E0GA 3EE0B 4DY7B 5HGGA 3V7TA 1NPMA 3A82A 2PKSC 1IHTH 2XBYA 2ZU4A 1T4VH 4AFZA 3PO1B 3M5MA 3PLPA 4XBDA 1V3XA 4O9VA 4K1EA 1FONA 3H5CB 3UOUA 1WQSA 1GBTA 1EQ9A 2ZU1A 3NUMA 1BZXE 2OC1A 3D23A 1MH0A 2ZDAH 3GCOA 3KQEA 4UFFH 2TGTA 4OGXA 2XYAA 3SUEA 3ENSB 1P3EA 4X1PU 1C5PA 4D8NA 3E8LA 1IHSH 3OY5U 1YCPK 5C1UA 1O31A 3SUDA 1GPZA 2F83A 1DE7H 3HK6B 1MBQA 3RXCA 3GCTG 1LHCH 3OYPA 1GHAF 2GCHG 1GHZA 1O2YA 3C27B 1LCYA 5DP5A 5JBAS 5HXFA 4AORA 2QIQA 1CHGA 4HFPB 2FOFA 2ZFQH 1J17T 1O5BB 2BDGA 3O8CA 2BD3A 3BTTE 1LHEH 2B9LA 4ISOA 3VB4A 1CT0E 4K8YA 2UUJB 1SGRE 1C5VA 4DW2U 2BZAA 7GCHG 1LVOA 1BTHH 3F9GA 5DP3A 1FIZA 1O38A 1O3OA 3VGCC 1GHXH 4X1RU 1GGDB 1P2JA 1ZGIA 1WOFA 4ABAA 3M5LA 1GMCG 3T26A 1AI8H 1UK3A 1FI8A 2Q6DA 4YLQH 3EA9A 1ABIH 3BTEE 1IQIA 2FEQH 3FAOA 1NU9A 3QN7A 1TX6A 4X8SH 1BA8B 1DS2E 1ELBA 3TU7H 1IQEA 4YESB 1GMDG 5EPNA 3UFAA 1HIAB 2A7JA 2CF9H 1ZHPA 1HJ9A 3PMAB 1O3PB 3ATIA 2RG3A 4GHTA 2ZCKP 5AHGH 2H5DA 4OS4A 2LPRA 1GJ7B 1KLIH 1F0TA 2ZKSA 3NPSA 3SGBE 3SI4H 1MQ6A 4XDEA 1QIXB 2PW8H 3RXHA 3P8GA 2F9OA 1OWIA 1QRZA 2ZTYA 4ABJA 2VINA 3LIWA 2V35A 4R0IA 2BD4A 1RIWB 1TYNA 2R2MB 1C5QA 1D6WA 1QNJA 1GI0A 2G5VA 1C5WB 4IMZA 4XBCA 2QXHA 5B6OA 1ZOMA 2CGAA 1PPFE 2A5KA 3A7YA 1C5SA 4Y11E 1AB9B 1AE8H 1E38B 2JH0D 3SU4A 2H5CA 3MNSA 2R0LA 1F7ZA 4ASHA 4DURA 1CA0C 1UTQA 2XBVA 1ZZZA 2BDYA 1XUHA 3S9BA 1NRPH 3S7HB 2ZWLH 1OYTH 4TY7A 4ZXYH 2Y82A 1JXPA 2G5NA 4BTTB 3UNSA 2ZPRA 3GDUA 3OY6U 4WMEA 4HZHA 1WTGH 2Y5FA 3MMGA 2GCTC 1RXPA 2YNAA 2VH0A 3ZVAA 1C5MD 3BSQA 3NKKA 3OX7U 2B5TB 1MMJN 4XE4A 3ZZ4A 1L4DA 1GBMA 6CHAC 1FAXA 1SOTA 1GMDF 3A7WA 4JMYA 2FO9A 4NG9H 4A5TS 2ZGHA 3NZIA 3WY8A 1INCA 1IQGA 4F4OC 3BEUA 1IOEA 3ELAH 1A61H 3MO9A 2H2ZA 2OC0A 5E2OA 1GI7B 2ZGBH 1C2JA 2PTCE 1AHTH 1MAYA 1A7SA 1S81A 5BRRE 4Q7YA 3Q00A 4ABEA 3KIDU 1N8OB 5L30H 1O3KA 1O2WA 2BDIA 2WINI 1Y3WA 2Z9LA 1O3DA 2BX3A 3T27A 5AFYH 3SBKA 1BRBE 3F9FA 3STJA 1EJAA 2A5IA 4SGBE 3V0XA 2FLBH 1EX3A 2ZPQA 5C2ZA 3UNRA 1QJ1B 1DFPA 1YCPM 1H9HE 2QCYA 4Q7XA 3E90B 2XXLA 1S6HA 1V2LT 2XC5A 1T8LA 2VWOA 4FU8A 1UVSH 1TAWA 1ZR0A 3MU4A 1F5RA 2BHGA 3RMOH 2XC0A 3P92A 1K1JA 1P01A 3MI4A 1C5OH 1MTWA 1UTJA 3QTOH 1P02A 1G36A 5DK1A 4A1TA 4DT7B 3ZVGA 1GI4A 3TK6A 1A46H 3SU6A 4DVAU 5DP4A 1QRWA 4B2AA 1BOQA 1C1WH 3TJNA 3RU4D 4B2CA 2BD2A 1P06A 3EA8A 5EXMA 2QAAA 1AKSA 1O5CB 3UR9A 3SJKA 1OP2A 2Z3EA 2FYQA 2TGPZ 1O2IA 5CHAB 2VIWA 1MTSA 1XUGA 4IGDA 1S85A 5EW2H 1ZSKA 1UTNA 2O9QA 1XMNB 3NCLA 1GJCB 3HGPA 2R2WU 1CBWB 2NU2E 4FUDA 1W3CA 5TCAA 2PUXB 2XRCA 9LPRA 5LGOA 1RTLA 3A89A 2AIQA 1QURH 4B76A 1GBFA 5DP6A 2W3KA 1OKXA 4H6SB 3S9CA 1C2EA 2FPZA 1DDJA 1V2JT 4X6PA 1Y3VA 1CQQA 1VITH 2TGDA 4XBBA 3AAUA 1O35A 1PQ5A 4IC6A 1WCZA 1AVGH 1Z8JB 2I6QA 2QXGA 4WMFA 2PUQH 1BTZA 1OOKB 2UUKB 1RTKA 5CMXH 1HUTH 2QN5T 2Y80A 1FV9A 4IBLH 5LPEA 4A1XA 2ZDLA 1YM0A 2IOTA 2PHBA 2UWLA 1P2MA 3A87A 3BTDE 1TMTH 1N6XA 3M3TA 3MHWU 3CP7A 3TH4H 4MVNA 3ZVCA 1VJ9U 2H9EH 1D3TB 3PO1C 1GBEA 4AGJA 3SGAE 2BD7A 2CHAB 2P95A 1UMAH 3MFJA 4PROA 3A7TA 2ZHQH 1F5KU 1FY3A 4BAQB 3QGNB 1UVPA 3A7XA 2QYIA 3FZDA 3E1XB 3URDA 1GDUA 1UHBA 2ZG0H 1OSSA 3RXQA 2OC7A 1XKAC 4IS5A 5LPRA 1SFQB 3NWUA 1FY1A 4BTUB 4MTBA 2OUAA 2HPPH 2AMPA 3Q77A 4CH8B 2ZGCA 2D26C 1BJVA 4TPIZ 2BVSH 2VWNA 3U98H 3VB7A 1AZZA 2VIQA 1YF4A 3T62A 4UE7H 3T28A 1CE5A 3HKJB 2ZGJA 2BOKA 3QTVH 6GCHG 2XWAA 3QZRA 1OWJA 1C5TA 3ATKA 3GYLB 3P17H 4FUHA 3D65E 4YO9A 2V3OH 1SLUB 9ESTA 1NM6A 1SPJA 4MPWA 3BTKE 4UDWH 1ID5H 1BBRE 1SLWB 4RKJB 1YPMH 3SV9A 2O8TA 4FVBA 3RC6A 5F6MA 1SGEE 3PROA 2O8UA 5T6GA 1F0SA 1W7GH 5FPTA 1AIXH 1A1RA 1S83A 1IQNA</