1NPMA

Neuropsin, a serine protease expressed in the limbic system of mouse brain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
225
structure length
223
Chain Sequence
ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of neuropsin, a hippocampal protease involved in kindling epileptogenesis.
pubmed doi rcsb
molecule keywords NEUROPSIN
source organism Mus musculus
molecule tags Serine proteinase
total genus 51
structure length 223
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.4.21.118: Kallikrein 8.
pdb deposition date 1998-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1npmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1npmA02
1O2YA 1O5EH 2B9LA 2ALPA 4FU9A 2TGAA 1IHTH 1OXGA 2VWMA 4CRBA 4ISHH 1MAYA 3RXEA 2C8XB 2FXRA 1YKTA 2P3TB 4INLA 1XMNB 3GY3A 1FZZA 1O2ZA 5J4SA 1AKSA 4AOQA 5AFYH 6GCHG 1AGJA 5K7RA 2C8WB 1EAIA 1SGFG 4CHAC 3IG6B 2HNTF 1EASA 1UVUH 5FCRA 1S83A 1C4U2 1ELVA 2W7SA 1O39A 2D8WA 1V2UT 4Y8YA 4B1TA 4LZ1H 1OKXA 4ABAA 2SGPE 5DK1A 4AX9H 5A09A 1GBDA 4O03A 4X2XA 2GCTB 4LZ4B 1E0FD 4YT6H 4MDSA 3TGKE 1GHVH 4ZKSU 3ZV8A 1O2JA 2TBSA 3ENSB 1THPB 2FS8A 4NG9H 4GCHF 1V2ST 1GJCB 2UWLA 1HBTH 3P70B 1OPHB 1S84A 1YPMH 3ZVAA 1HIAA 4KKDA 5C5NA 4UFFH 4LK4A 5ETXA 3ITIA 3SUEA 3M7UA 3A81A 1O32A 3SQHE 1YPGH 1QHRB 2Y5FA 1GJBB 1O2WA 1MKXH 3QK1A 1GWAA 5B6OA 3NWUA 2ASUB 1EP6A 2BDAA 4YTAA 1A2CH 2GZ7A 1LVMA 3IITA 6CHAC 2OUAA 1LDTT 3UIRA 3BSQA 1YGCH 3MU1A 2A31A 3M5LA 2FLRH 1TNHA 1AIXH 3E91A 1HDTH 2BQ7B 1BBRE 2ZNKH 2FYRA 2OC1A 4YM9A 1BTPA 2FS9A 4CHAB 1SVPA 1GMCF 2BVSH 1GI1A 3A87A 2OTVA 4X6NA 3KF2A 4FUGA 3MO6A 1CT4E 2ZHWH 1DWEH 1O2NA 1O5AB 1GCTC 3UQVA 3T29A 2R3YA 2UUYA 1L4ZA 2C90B 2UUFB 1W11U 3LH3A 3A7YA 5AF9H 1LPZB 5GCHG 1SC8U 3RXLA 4ESTE 3RC4A 1O3EA 4RKJB 4WH8A 2B7DH 1W8BH 1WTGH 3G01A 3CP7A 3RMMH 1J8AA 1MD7A 4X1QU 3P95A 4JK6A 1LVOA 2HWLB 2AH4X 1AHTH 1AUJA 1ELGA 2W7UA 4NGAH 1ACBE 3QLPH 2JETC 2SGAA 2Z3DA 1SSXA 3ZZDA 2J9NA 2BX4A 4NA8A 1P2IA 1GPZA 2FX6A 3MYWA 2STBE 4KP0A 5JBCS 3RU4E 1H9LB 1ZZZA 1W12U 4ZKOU 2Y7XA 4WXVA 2ZZUH 3DUXH 3SZNA 1UK2A 2J95A 1SLUB 3GCHB 3PMBB 3UNSA 3OY6U 1QL7A 5L2ZH 1NRSH 5FX5A 1H4WA 2BLOA 1W3CA 3GDUA 1UTMA 1C1RA 1L4DA 4WVPE 3KNXA 3HKJB 2XXLA 3SJKA 4BXSA 1SFIA 3SU6A 1F0UA 2FYQA 1AVWA 5FBEA 1TBZH 3EA9A 1SHHB 1YYY1 2ZWLH 1SGFA 1GHAG 2ZPQA 2H9TH 3EE0B 4X0WU 5AVDA 1O2KA 1GCTB 1SPJA 3D49H 1ELCA 1UTKA 4Y6DA 1A0JA 8LPRA 1NTPA 1W7GH 1HNEE 1CE5A 5JPMH 3LT3A 3Q76A 5FXLA 1K1PA 4YZUA 1SGNE 1HAXB 3RXQA 4YO9A 1O3HA 1ZLRA 1TYNA 2ZKSA 4I8KA 3ATLA 1QA0A 2W3IA 1S81A 5E0GA 2HPPH 4E7NA 2VIDA 2DUCA 2HLCA 2JETB 3QGJA 4PROA 1A3BH 2IJOB 1C9PA 1TBQH 1GJ6A 8GCHF 2CGAA 1YPLH 1C5LH 1YLCA 1TIOA 1JBUH 2XYAA 3MNSA 2C8YB 1TNJA 2BOHB 1CQQA 3LGTA 1PPBH 3S0NA 1NC6A 1CT2E 2Q6FA 2G8TA 4DGJA 2ZCLP 1C5WB 5JBTA 2ZIQH 4Y0ZE 2VVUA 1DWCH 2FMJA 3MH7A 5ABWA 1P2KA 2WPLS 4XBBA 4ZXYH 2SFAA 1O38A 3PLKA 4MPUA 2ZDNA 2ZECA 4BTTB 1HJ8A 2BY9X 2Q6GA 1AY6H 4JZFH 4HZHA 1AN1E 1G36A 3LGYA 3KL6A 3GY4A 3RUOA 1GBEA 1TPSA 3A80A 3M37A 9LPRA 3LPRA 3B9FH 1NZQH 2F3CE 4NCYA 1HAVA 1KTSB 3KCGH 3E0NB 4Q2KA 4AB9A 1NPMA 4DIIH 4IC6A 1TNGA 1GI7B 1P09A 3RC5A 1BTXA 2ODYB 5EQQA 3F9EA 1VZQH 1GI0A 4Y8ZA 3QUMP 4WF8A 4CRCA 3TJNA 1F0RA 3UTUH 3SBKA 1EAUA 4ISIH 1CA8B 4VGCC 5CHAC 3P8OA 2XC4A 3ZYDA 1DWDH 1ZMJA 3HGPA 3LDXH 2R2MB 2GVFA 3M5MA 4ZXXH 1TRNA 2PKSC 3RXHA 3ZZ3A 1C1SA 4XBDA 2D26C 3U8RH 3K9XB 3LONA 4HFPB 1VJ9U 2C8ZB 3LGVA 2Q1JA 1CHOG 4ABIA 1QNJA 2ODPA 4FUJA 5FHTA 3TNTA 3OY5U 4FU8A 4AFUA 2Y6TA 1WV7H 1C2DA 1ETSH 2ZU1A 1UCYK 1EOJA 2G4TA 1G3CA 1E35B 1IQHA 2BDIA 2VGCB 1K21H 1EAXA 2G55A 4WH6A 3M7QA 6LPRA 2FOBA 1VITG 1C1TA 2CHAB 1AFQB 1DE7H 5PTPA 3ZZBA 1XX9A 2OBOA 1UK4A 1P05A 2OQUA 4OS5A 3RXCA 1BITA 2ZHFH 1T8LA 1WUNH 5E2OA 3RM0H 2C3SA 4Z0KA 1FPHH 2GD4B 1RTKA 3JZ1B 1GBFA 1PPHE 1NFWA 4MNVA 1A5IA 4YT7H 5F03A 4M7GA 3SI4H 5TCAA 1VGCC 1RTLA 4D8NA 1ZGIA 3CENA 4VGCB 1Z8RA 3DT0H 2Q6DA 3HK3B 1NT1A 3OTJE 1Y3UA 2VIOA 3ZYEA 1GI5A 2AGIX 3DD2H 2DE9A 3RLYH 4K1SA 3LGUA 2XC5A 2BDYA 3PYHA 1PQ7A 2G4UA 2ZHDA 1N6XA 1GG6C 1OWEA 2R9PA 1C1QA 1AMHA 5F8ZA 1EB1H 4ABEA 3QO6A 4ABDA 5T6FA 3PMHB 2SGQE 2FOCA 1LO6A 4AN7A 3K6ZA 3RXTA 1SOZA 4FU7A 4MNWA 1DANH 3A82A 1YBWA 1EPTB 1TGCA 3F9GA 1A7SA 3A8AA 1GVKB 1GDNA 1TALA 1BTZA 2VIWA 1LQEA 2Z3EA 3SO3A 1TX8A 4K2YA 5A8XA 2H2ZA 3ESTA 4BAOB 3RXSA 1F7ZA 3AVZA 4SGBE 1V6DA 1T8MA 3UUZA 1GBTA 4MPWA 3BTKE 3SW2B 2F9BH 1JRTA 1ELFA 1CA0C 1TPPA 2ZFPH 1P06A 4BAHB 3B23B 1AB9B 2QGRA 2VINA 1DLKB 1W0ZU 4ZKRU 4IC5A 1ORFA 1UVSH 2QV1A 3DFLA 1HAOH 4TYDA 1T4VH 1TX6A 1NFUA 3PWBA 1GJAB 1DY9A 1WOFA 1WQVH 4XFQA 3C27B 4RKOB 1WYKA 1TMUH 1FIZA 4GUXA 3GOVB 3EQ0H 1H9HE 1GG6B 4X1PU 2H9HA 5L2YH 4NSVA 1WBGB 2YOLA 5AFZH 1ZJDA 3DA9B 1GHBF 4A1XA 1K22H 3F68H 4UDWH 1AQ7A 4YESB 1N8OC 3K65B 4JZ1A 3M3VA 2ANYA 3EGKH 2AERH 1RIWB 4CH8B 2GZ9A 2HALA 1QBVH 3NPSA 4TPIZ 1FV9A 2Y81A 2Z7FE 4XOJA 3MU5A 2ZI2H 1LQDB 4INHA 2FOEA 1SG8B 1AE8H 2PR3A 1SFQB 2QN5T 4CBOA 1PPZA 3AW0A 2A7CA 3E0PB 2LNCA 3P17H 1MH0A 3PMAB 5EPNA 1KXDA 4DOQA 3U8OH 4X2WA 1KYNA 1G3DA 2AEIH 3GCNA 5JDUB 4NIYA 1ABIH 1XUGA 2QIQA 2TIOA 5EXMA 1V2PT 1E37B 1HLTH 1HB0B 2IN2A 4ZKNU 3RXMA 3MMGA 4X6PA 3F6UH 4X8TH 1SLWB 2GGVB 2ANWA 2V35A 4NWKA 1O5BB 1Z8JB 4I8LA 1NRNH 5FPSA 1NU7B 1FY4A 3M35A 4I31A 3E6PH 1F0SA 3M36A 5IYTA 1Z8IB 1FY5A 1TQ7B 4ZUHA 4KELA 4BTUB 1TPOA 2GCHF 1O3GA 1TA6A 3SNEA 3SJ8A 1UTQA 2RDLA 1P11E 1KLJH 1UVPA 4U2WA 2OXSA 1FY8E 4Q7YA 2ANMH 1MZDA 2J34A 4IMQA 1C5QA 2PUQH 4AFZA 2FOGA 1P9UA 3NZIA 4E05H 1GJ4H 4KTSA 2H9EH 3T2NA 4KGAA 3NUMA 2BD4A 3MH6A 4ZAEA 1MTNC 1SQTA 1INCA 1YCPH 4ZHAA 1MTSA 3NCLA 1C1PA 5DJ7A 1NRPH 1LHFH 2UUJB 1BBRK 2FPZA 3E90B 1G2MA 1EB2A 3RXKA 4FUEA 3MH4A 1GI4A 1OWKA 2A32A 1XUIA 1YPHC 1F5LA 4Y76A 3A7XA 4WJG2 1QL8A 1MKWH 5FX6A 4ZHMU 1W2KH 2J94A 2BYAX 2GP9B 1HAHH 2Z9GA 3O8RA 2RCEA 3SU5A 5A0BA 1O34A 1C5XB 1J15A 2ZFFH 1A4WH 1TPAE 1E34B 1IQEA 2BD7A 1C1VH 2P3FH 2PV9B 1L1NA 2HVXA 1MUEB 3GY7A 4XSKU 1GHYH 4D9RA 3ODFA 4J1YA 4O97A 2BDCA 1ZMNA 4XBCA 1QY6A 2PKAB 2HRVA 2ZU3A 2NWNA 1SQOA 1SGDE 3B8JA 1GL0E 2W3KA 1F2SE 2VIQA 1MU6B 3PB1E 4MNXA 4D76A 1YM0A 1IHSH 3QZRA 2FI3E 5G4BA 1LMWB 3GDSA 1O0DH 2ZDMA 1LCYA 1OOKB 3SU0A 5GCHF 3T25A 3A83A 3RP2A 2FX4A 4CR5A 1MKXK 1EP5A 1ZPBA 3SHAH 1TAWA 2F9NA 5DP7A 2A45B 1O3FA 1WCZA 3ELAH 3SU3A 3KN2A 1OX1A 1QQ4A 4ISLA 3CS0A 2VWOA 1Z6EA 4MNYA 1S0RA 1T8OA 1DSTA 1TRMA 2PFEA 4OGYA 2NU3E 2BHGA 2C93B 3TGJE 2BY7X 1LKBA 4D7GA 2ZFTA 3ATIA 4FXGH 2P59A 1EPTA 1OWDA 1V2QT 3MU4A 4ZH8A 1BJUA 3BTQE 4B75A 3T27A 1B0EA 1OWIA 4D7FA 4BAMB 1GBLA 2STAE 3VFEA 1BRAA 3L6PA 2AS9A 3RDZA 1HAIH 2P93A 3QX5H 1NN6A 4NZLA 1C2IA 4OS4A 3RU4D 1SOTA 1GBCA 1CT0E 3BEFB 4AG2A 1GBAA 3O8BA 2PUXB 3W94A 5BPEA 1ZPCA 2WUBA 4XE4A 3VXFH 1NRQH 1GJ8B 1GHAF 3KGPA 2ZGJA 1DFPA 3BIVH 2BD2A 1EUFA 1IQMA 1NY22 2BLQA 2J2UA 2K1QA 5EXNA 4ABGA 1OWHA 2QY0B 1MAXA 1TMTH 2BLVA 4FUBA 2B0FA 1FXYA 4HI3A 4F49A 5FCKA 2BZ6H 4K8YA 4GCHG 1AI8H 4K1EA 4CRGA 1SHYA 2P16A 3A84A 3M7TA 2ZC9H 3ZZCA 3I78A 1P8VC 1RJXB 4UD9H 1DOJA 4B73A 1S5SA 1ZGVA 3TJVA 4Y8XA 1OP2A 2OQ5A 2PSXA 4A1TA 3BTTE 6CHAB 1P02A 2VH0A 2Y82A 2QCYA 1G9IE 4CRAA 3MOCA 3GICB 2AMQA 3C1KA 1ZR0A 4WWYA 1OWJA 1ANEA 5EXLA 3M5OA 3SU1A 3SU2A 3RXBA 3P92A 1O37A 5JB8S 1SGYE 3FZZA 3SNAA 1YPJH 3A7TA 1D6WA 1U6QA 4JK5A 4I8GA 1AUTC 5E0HA 3K6YA 3MNCA 2XC0A 1KDQB 2WYJA 1E36B 3H7OA 4WMEA 5EG4A 1UVTH 4U30A 1E38B 1N1LA 1QRZA 3LOXA 1IQKA 2A2QH 1UTPA 2A0QB 1FDPA 2BOKA 2R0KA 1AFEH 1DVAH 3AAUA 3VB6A 1ARBA 4JZIA 4X8SH 3MI4A 2TPIZ 5EQRA 1LPKB 4CRDA 1QBOA 1OP0A 3UOUA 1A5GH 4I33A 4TWWA 1C2GA 1V2LT 3STIA 1GMHG 1QBNA 1THSH 1L1JA 5ESTE 1QJ1B 2CF8H 3MU8A 5C20A 5C1YA 1HCGA 4ABBA 3OU0A 1ZHMA 1BUIA 1NESE 2XNIA 3E3TA 1FN6A 1PYTD 1O31A 2NU2E 3A7VA 1YF4A 2FWWA 1V2JT 3MO9A 1C5MD 1JWTA 2OBQA 1UMAH 3UPEA 1S6HA 4FVDA 3ZVEA 3TLOA 3F1SB 2OD3B 1G2LA 3MU0A 3BTHE 2NU4E 1F5KU 1EATA 3S9AA 2J38A 2QF3A 3F9FA 1C4Y2 1G3BA 1HXFH 4B2AA 4NWLA 4WXIA 3VXEH 1C1MA 1TA2A 5EGMA 1MMJN 1GBMA 1V2KT 3U98H 1VITF 1KIGH 1ZJKA 4JYVH 4BAQB 1TB6H 3A85A 1EJMA 2QXHA 1LTOA 1HAGE 1HRTH 2BX3A 1Y5UT 3TH2H 3RXRA 2AFQB 1AU8A 1DM4B 4BAKB 4AFSA 4MPVA 2G81E 1OYTH 1Z1IA 3A7WA 4UONA 3OX7U 4FUFA 2VWNA 5JBBS 3BTME 2DE8A 1C5RA 1X7AC 1UJ1A 2WPHS 2BVRH 1AWHB 4U01A 3F9HA 1BMLA 2A4GA 1W10U 3EA8A 2BD8A 2BMGB 4GLYA 1CVWH 2SGDE 2XBVA 1O2SA 3RXOA 2WINI 3I29A 3ZVBA 5CE1A 1YPEH 3SUGA 3UOPA 4YOGA 1JRSA 5L30H 3BG8A 3QWCH 2ZFRH 1UTJA 1HFDA 2EEKA 4IW4E 1VCPA 4AORA 1ZRKA 3RXGA 1BTYA 2XWAA 2ZGBH 3VGCC 1F5RA 2PW8H 1FNIA 2XCNA 1D3PB 3GISB 1A0HB 1O5CB 3M3SA 1K28D 5LGOA 2OP9A 1O3JA 4NA9H 3MNXA 2FOAA 2PKAA 3MTYA 1O3DA 4LXBH 4X6OA 3OSYA 3SV8A 5GDSH 1TGSZ 3GY8A 1EZSC 3SHCH 2BDHA 3QTVH 4H42U 4MVNA 1FAXA 1O3BA 1T7CA 4I8HA 1DXPA 1C2JA 2BD5A 5E0JA 3V7TA 8ESTE 5J4QA 2ANKH 1JXPA 2Z3CA 4DY7B 4TPYA 1LHDH 2P94A 2BB4A 5A2MH 5CHAB 4CREA 1FLEE 1O5DH 1O5FH 4DG4A 1W13U 3ZVCA 1SLVB 1DITH 5E2PA 2PKSB 2FP7B 1IAUA 2EC9H 4H6TA 4FUDA 2O8TA 5T6DA 3UNQA 1G37A 5DKMA 1DSUA 4X1NU 1Y8TA 3SV7A 1P2QA 3E16B 1FQ3A 4ISNA 5HMAA 5GWZA 4GHTA 1O3IA 2JKHA 3FFGA 3IWMA 1SBWA 2FLBH 1GJ5H 1V2MT 5F8XA 1ETRH 2HPQH 5LPEA 2F9PA 2PSYA 2RA3A 2A1DB 2GKVE 3SUFA 1OS8A 1V2RT 2FESH 3FP8E 4K1TA 1CBWC 1TQ0B 2BZAA 4ZMAH 1PJPA 1IQGA 3I77A 4AG1A 3V0XA 2UUKB 3MO3A 1C2EA 1D3DB 1C5VA 1GJDB 1EZXC 4JYUH 2VH6A 2VIVA 3BF6H 3ZZ7A 3Q00A 2GT8A 2OCVB 3FANA 3QN7A 4AYVB 3TH4H 4YLQH 3V12A 1G30B 2ZGXH 1MD8A 2FO9A 1L2EA 1Y3XA 1TWXB 2NU1E 1C2FA 3SI3H 2FTMA 1EKBB 1XXDA 1O3CA 3AW1A 3GCOA 5FAHA 2XRCA 1TGNA 3Q77A 1P3CA 1Y3YA 4Y79A 1YP9A 4ABFA 1XVOA 3RM2H 1ELTA 2WV5A 1C5SA 1GMDF 1XVMA 1VGCB 1S0QA 1LHEH 1YPKH 3M61U 1SB1H 2QA9E 1BHXB 1B5GH 5A8YA 3SQEE 4NFFA 3RXVA 3HATH 3STJA 1MTVA 3FVFB 1GBBA 4YLUA 2EA3A 1T31A 2YNAA 1EXFA 2BDGA 1DUEA 1Y5AT 1SGIB 3GCTF 3GY5A 3VB7A 1FUJA 2H5DA 3Q3XA 1VCWA 1H8DH 4IBLH 4JZEH 3VB5A 3W95A 3M3TA 1T4UH 1HJAC 4X1SU 2FOMB 1S6FA 2PLXA 2AMDA 4Y7BA 3U1JB 2SGEE 3U1IB 2ZQ2A 3BN9A 1SMFE 1S85A 5LH8A 1IQNA 1OP8A 3BTEE 4ABJA 2QXGA 1CBWB 2ZF0H 4DIHH 1BMAA 2I6QA 1AVGH 2ULLA 1QFKH 3D65E 2VVVA 1KDQA 3SJIA 3N7OA 1V3XA 1NRRH 2A4QA 3UY9A 1G32B 3LJJA 4F4OC 1HJ9A 1BTHH 1K2I1 2IOTA 1H9IE 5DP6A 2THFB 1J16A 4IN1A 1CGHA 4H4FA 1Z7KA 1CA0B 4GPGA 4D9QA 5EU8A 3RXJA 3OYPA 4Q7ZA 1QL9A 2TGPZ 2H5CA 3PWCA 1NS3A 2BDBA 3T62A 1AO5A 1ABJH 2R0LA 1Q31A 1WSSH 4K60A 3U9AH 2AMPA 1QR3E 3VPKA 2FIRH 1GHZA 3S69A 5C1XA 2G52A 2BY6X 2LPRA 2WV4A 3TVJB 1S82A 2Y5HA 3QTOH 1ELDE 1QQUA 3SGQE 2BM2A 1GI9B 3LGWA 4IN2A 3KIDU 3R3GB 1PQ5A 4NIVA 1QRXA 2A5KA 2WPJS 2QC2A 2I6SA 3RXIA 5DP8A 3LU9B 3PTBA 4MPXA 1O30A 4MG3A 2PTNA 3TITA 1N8OB 4CRFA 3UQOA 1O2XA 1P9SA 1JIMA 1O2HA 1Q3XA 1GDUA 3ZV9A 1GHXH 3DFJA 6GCHF 1C2MA 1GHBG 4MLFB 2BQ6B 3EA7A 1Y59T 2XBXA 2CF9H 3P6ZB 3P8FA 1DX5M 1GVLA 2FI5E 3TIUA 3NKKA 4UFEH 1JOUB 3NK8A 1YCPK 4NIWA 2F9OA 1Q2WA 1CSOE 3SN8A 4FUCA 1GI3A 1TX7A 1QB1A 1TGTA 1ARCA 1KXFA 2GX4A 5JBAS 3SGBE 1TBRH 2GCTC 3A8CA 4O9VA 4DVAU 1MQ5A 2BY5X 4RSPA 1ELAA 1EJNA 2FOHA 2ZG0H 3RXAA 2H1UA 5EPYA 1N6YA 2XW9A 1O2GH 3LJOA 2P95A 5EW1H 1RFNA 1A1RA 1C1OA 3R0FA 1FONA 3ZVDA 1LHCH 5F8TA 1QTFA 1MKWK 3BG4C 4BOHA 1HAVB 2FTLE 4R0IA 4BNRA 1BOQA 2GMTC 1SL3A 1G3EA 3L33A 4Y0YE 1BJVA 1QIXB 2WPMS 1O2TA 2NU0E 4B2BA 2Y80A 3A86A 1D9IA 2JH5D 3BIUH 3EYDA 4O3TA 1CGJE 4JYTA 1AZZA 2ODQA 3NXPA 1QRWA 3FP7E 1MTUA 3KQBA 2EI8A 5F6MA 8KME2 2ZO3H 1P2OA 1K1NA 2G00A 3BTGE 2OC0A 1RGQA 2ALVA 1UK3A 2QXJA 1J17T 3VB4A 1J9CH 4DURA 2VVCA 4B71A 1O3NA 2FI4E 2ZGCA 2FODA 5CMXH 2ZHQH 4OS7A 3ZZ9A 1BMNH 2GCHG 2W26A 3A88A 3LC3A 1ESAA 4Y7AA 1TOMH 2V0BA 2CV3A 1K9OE 2D1JA 4OS1A 2ZFQH 3D62A 1QURH 4IMZA 5GPIB 2QAAA 1MTNB 1FY1A 1W14U 2BLWA 3SV9A 2ZDKA 3EDXB 1PQAA 2A7JA 1BTWA 3FP6E 3PLBA 3GDVA 3PMJA 4DJZB 1KTTB 2XWBI 1FI8A 1GL1A 1ELBA 2XCFA 4KTUA 4X8UH 1DICA 3LGIA 1BQYA 2BVXH 1UTLM 3T28A 1A0LA 4NA7A 3TPIZ 2YNBA 3BG4B 2J92A 1GHWH 4WY3A 1NFXA 4KTCA 2GMTB 1GJ7B 1PFXC 5DP5A 5ESBA 2R2WU 3TK5A 2F83A 3PROA 5FPTA 1SI5H 2Y5GA 3SNDA 7GCHG 1BT7A 1XUFA 3RMLH 3V13A 4WMFA 1O33A 1KLTA 2GDEH 1P01A 3V3MA 1L1GA 1XUJA 7LPRA 1Y3WA 2TGDA 2F9UA 1O3PB 5AHGH 1MZAA 1SR5C 1TLDA 4HGCA 2ILNA 3UWIA 1PYTC 2HNTE 3GYMA 3VEQB 1DLEA 3GCHC 4A92A 1JIRA 1RRKA 3KHVA 2GT7A 1HXEH 4Q80A 1EOLA 1K1LA 2ZTYA 1ZSLA 1O36A 3BEUA 1OSSA 2CXVA 2G5VA 5HGGA 2EI6A 2KAIB 5EQSA 1FJSA 5FPYA 4HTCH 2V3OH 2JH6D 2BTCE 2VU8E 4DT7B 5T3HA 1MCVA 1C5YB 5TJXA 4AZ2B 1O2UA 1C1NA 5C2ZA 2FDAA 4DCDA 2V3HH 1GMHF 1W7XH 2FM2A 3E8LA 2RG3A 1TNLA 2BY8X 1QGFA 1RTFB 5DP4A 4R8TB 5A0AE 1GVZA 2A2XH 4QT8C 1O3LA 1ZRBA 3P8NA 4K69A 1WU1A 1QB6A 2CMYA 3UFAA 1BCUH 3ZZ5A 2ZEBA 5BRRE 1DUAA 1C1WH 1T32A 1ZHRA 4E06H 1O3MA 4GVUA 2WUCA 1HGTH 4SGAE 2ZHEH 5LPFA 2ZPSA 2GZ8A 1DPOA 1EQ9A 1C5ZB 2A4RA 1YPHE 5E8EH 1O2MA 1GBHA 1TFXA 1VR1H 1WTHD 2ZQ1A 4TY7A 4Y71A 1BZXE 3TJOA 1FPCH 1NO9H 2HGTH 1GMCG 3S7HB 1GBKA 1EAWA 2GTBA 2ZDVH 2Y7ZA 4AGKA 1O35A 1A46H 2ZP0H 3BTDE 4GAWA 5L6NH 1LHGH 3L3TA 1C5UA 1ESBA 3KQEA 4K3JA 1GBIA 4OS2A 2XTTB 1O2PA 4A5TS 3D23A 1EZUC 3HKIB 4H6SB 1IQJA 1O2IA 1TABE 1BTUA 1P04A 1BRUP 2IPHA 1VJAU 1ZTJA 3TK6A 1UO6A 4B74A 1CHOF 1BMMH 5T6GA 3URCA 4CBNA 1VITH 3LC5A 3PO1C 5SGAE 1QCPA 1GGDC 1F0TA 3ZZ6A 4B2CA 2XBYA 1C5PA 1C5OH 1Z8GA 3VB3A 2CJIA 5HM2A 2ZU5A 4Z6AH 4FUIA 1PPGE 3TNSA 1P12E 4UFGH 1M9UA 4MTBA 1D3QB 5C5OA 1SGRE 1SGQE 1Z71A 2VWLA 4UFDH 3GYLB 2Z94A 2HOBA 1FMGA 6ESTA 2VGCC 3RXDA 5DPAA 2ZDLA 5GXPA 4ASHA 1DT2A 2Z6BD 2CHAC 4Q7XA 1AFQC 4MQAA 3QZQA 1C4V2 4K8BA 1SLXB 2A5IA 1KXBA 1K1MA 2AYWA 2QYIA 4BTIB 3UR6A 4X1RU 4ZHLU 3RU4T 2Z9JA 7KMEH 2TRMA 3SNCA 2G51A 4ISOA 3PM3A 1UHBB 3GY6A 1ZSJA 4CH2B 1C5NH 4BXWA 1C2LA 1NFYA 2O8LA 1P57B 1IOEA 1SQAA 3SJOA 3UREA 5C3NA 2ZDAH 4DW2U 1H8IH 1B7XB 1XM1A 1HYLA 1Z1JA 4I7YH 3TK9A 3SV6A 1RS0A 1XXFA 2ZGHA 4AYYB 1SGPE 1O2LA 3FAOA 1P10A 3PO1B 3T5FH 2ZPRA 1DXWA 1GGDB 3PLPA 2ZU4A 1HV7A 2WPKS 3O8DA 2O8WA 2Z9IA 3TJUA 4GHQA 8GCHG 3RC6A 1ZTKA 2PGBB 1TOCB 3FZDA 2J4IA 4E7RG 3WY8A 1ID5H 1MQ6A 2P8OC 2GDDA 4K5ZA 5GIBA 1KXEA 4WMDA 2BD3A 4IGDA 1KXCA 3S9BA 1NU9A 1PQ8A 1UCYH 4A1VA 3TU7H 4OS6A 1EPTC 4TY6A 3URDA 1AKSB 1MTWA 2EI7A 1MU8B 1BRBE 2TGTA 3SU4A 4UE7H 5JB9S 2QF0A 1PPCE 1KY9A 1QA7A 2PWXA 5DP9A 2WYGA 2BQWB 4UEHH 4BANB 1ZOMA 1L0ZA 3MHWU 5FBIA 5C67A 1P2NA 1BB0B 1GBJA 1O2RA 1CU1A 1JMOH 3ZVGA 1O3AA 1SGEE 3SNBA 2GV7A 1AB9C 3PV4A 1PPEE 1BA8B 3QGNB 1K1JA 2FZZA 1A61H 1HIAB 3ZVFA 9ESTA 2AIQA 4AGJA 3TH3H 3P8GA 1HPGA 3S7KB 1O2VA 3UR9A 1AWFH 5HYOA 1QB9A 5IDKA 1O5GH 1THRH 5JYIA 2CN0H 4TWYA 3VGCB 1TNIA 1P2MA 1MCTA 1P0SH 1AD8H 1VCQA 2B5TB 1HAZB 3MWIU 5HXFA 3SOSA 3UNRA 4YOJA 4OGXA 1XUHA 3BTFE 1AE5A 2P8OB 2PTCE 1ETTH 1GCDA 2ZCHP 4U32A 1ZYOA 2ZCKP 4XDEA 3K2UA 1MBMA 2Z9LA 1F92A 3ATMA 1RIWC 1O2QA 4JZDH 3RMOH 4FVBA 1ANBA 1TGBA 2KAIA 1C5TA 3U69H 1HUTH 1GDQA 3ATWA 1LPGB 2P3UB 2ZTXA 3ZZ8A 1KLIH 1DS2E 1O3OA 1TMBH 4NFEA 5DP3A 4A7IB 1UVOA 7ESTE 5GJ4B 3RXPA 3MNBA 3RMNH 2AGEX 1TRYA 4FUHA 3KQDA 1UCYE 3LH1A 1BRCE 1V2NT 2B8OH 1GI2A 1NM6A 2G5NA 3GY2A 2AGGX 1C1UH 4NSYA 2VB0A 2UWOA 2A7HA 3RXFA 1P3EA 2ESTE 1Y3VA 4Y11E 1DDJA 5EW2H 4Y10E 5EOKA 1TE0A 1HAPH 3HPTB 1GJ9B 1D6RA 2AIPA 3CS7A 2SNVA 1ZPZA 1GI6A 2OINA 4B76A 2OC7A 4X2VA 1V2OT 1XKBC 1KXAA 3MH5A 4INKA 1J14A 1KSNA 3AASA 2ZU2A 1ANCA 2UWPA 3KQCA 2D2DA 2OC8A 2JH0D 1DWBH 2VIPA 1BHXF 4YOIA 4AFQA 4CR9A 1ELEE 3ZZAA 4ABHA 1EX3A 1IQIA 3SORA 1IQFA 2OLGA 3DHKH 3KEEA 1UTOA 2BXTH 2O9QA 1MBQA 4ZROA 3A8BA 3A89A 2Z9KA 1FY3A 3U8TH 5I46H 5C1UA 4GSOA 1DY8A 4I32A 1YCPM 1SGCA 1ZTLA 4I8JA 3ODDA 2C4FH 1FN8A 2ZTZA 5LPRA 2ZFSA 1CGIE 1BIOA 1GMDG 3BTWE 3H7TA 5A8ZA 3O8CA 1AZ8A 1EZQA 1CO7E 3RXUA 1NROH 2SGFE 3HK6B 1C2KA 2GV6A 3T26A 1HJAB 2FOFA 5DGJA 1YC0A 1O2OA 1K1OA 1D3TB 2HNTC 4LOYH 5HM9A 3GCTG 1AVXA 1C2HA 3SJ9A 3EAJA 1W0YH 1ESTA 3BV9B 2O8UA 2M5TA 1A5HA 3SGAE 1V2WT 1LVBA 1LKAA 3RLWH 2RA0A 1QJ6B 3Q3YA 5DO4H 1EJAA 2ZA5A 1LVYA 3TGIE 1FAKH 1O3KA 1WAYB 4X6MA 1FIWA 2SNWA 3SUDA 3A7ZA 2F9VA 1TONA 3E1XB 2BD9A 2W5EA 1SGTA 1WQSA 1V2VT 2PGQB 3HGNA 3LKWA 1YLDA 1T8NA 2R3UA 1ZMLA 5H4IB 1Y5BT 3ZZ4A 5K0HA 1XUKA 2PHBA 4J2YB 1IQLA 3PTNA 5I25A 2BXUH 3M5NA 1BDAA 5TCCA 1GI8B 1XKAC 5DG6A 1H1BA 1K1IA 1V2TT 4JCNA 2XBWA 1UHBA 3UWJH 3SV2H 4X8VH 1QJ7B 1ZHPA 3Q3KA 4X2YA 2FEQH 1RXPA 1TNKA 1D4PB 3S9CA 2A4OA 3AAVA 1Z6JH 1OYQA 4JMYA 4AB8A 1ANDA 3BEIB 1P03A 1P2JA 2V6NA 2F91A 4A6LA 4RN6A 1CHGA 1ZSKA 1RD3B 3JZ2B 4O3UA 2H6MA 3ATKA 4THNH 1B0FA 2VNTA 1C9TA 3LIWA 3H5CB 5EODA 3A8DA 3QDZB 2VJ1A 1A3EH 1HAYB 3MFJA 4IS5A 7GCHF 5A0CA 2QXIA 2WPIS 1BBRH 2A5AA 4NZQA 1PPFE 4NIXA 1UTNA 2O8MA
chains in the Genus database with same CATH superfamily
1O2YA 1O5EH 2B9LA 2ALPA 4FU9A 5KGOA 2TGAA 1IHTH 1OXGA 2VWMA 4CRBA 4ISHH 1MAYA 3RXEA 2C8XB 2FXRA 1YKTA 2P3TB 4INLA 1XMNB 3GY3A 1FZZA 1O2ZA 5J4SA 1AKSA 4AOQA 5AFYH 6GCHG 1AGJA 5K7RA 2C8WB 1EAIA 1SGFG 4CHAC 3IG6B 2HNTF 1EASA 1UVUH 5FCRA 1S83A 1C4U2 1ELVA 2W7SA 1O39A 2D8WA 1V2UT 4Y8YA 4B1TA 4LZ1H 1OKXA 4ABAA 2J98A 2SGPE 5DK1A 4AX9H 5A09A 1GBDA 4O03A 4X2XA 2GCTB 4LZ4B 1E0FD 4YT6H 4MDSA 3TGKE 1GHVH 2VBCA 4ZKSU 3ZV8A 1O2JA 2TBSA 3ENSB 1THPB 2FS8A 4NG9H 4GCHF 1V2ST 1GJCB 2UWLA 1HBTH 3P70B 1OPHB 1S84A 1YPMH 3ZVAA 1HIAA 4KKDA 5C5NA 4UFFH 4LK4A 5ETXA 3ITIA 3SUEA 3M7UA 3A81A 1O32A 3SQHE 1YPGH 1QHRB 2Y5FA 1GJBB 1O2WA 1MKXH 3QK1A 1GWAA 5B6OA 3NWUA 2ASUB 3OAAD 1EP6A 2BDAA 2CK3D 4YTAA 1A2CH 2GZ7A 2L74A 1LVMA 3IITA 6CHAC 2OUAA 1LDTT 3UIRA 3BSQA 1YGCH 3MU1A 2A31A 3M5LA 2FLRH 1TNHA 1AIXH 3E91A 1HDTH 2BQ7B 1H8HD 1BBRE 2ZNKH 2FYRA 2OC1A 4YM9A 1BTPA 2FS9A 2JIZD 4CHAB 1SVPA 1GMCF 2BVSH 1GI1A 3A87A 2OTVA 4X6NA 5CHBA 3KF2A 4FUGA 3MO6A 1CT4E 2ZHWH 1DWEH 1O2NA 1O5AB 1GCTC 3UQVA 3T29A 2R3YA 3OE7D 2UUYA 1L4ZA 2C90B 2UUFB 1W11U 3LH3A 3A7YA 2WV9A 5AF9H 1LPZB 5GCHG 2M2AA 1SC8U 3RXLA 4ESTE 3RC4A 1O3EA 4RKJB 4WH8A 2B7DH 1W8BH 1WTGH 3G01A 3CP7A 3RMMH 1J8AA 1MD7A 4X1QU 2F43B 3P95A 4JK6A 1LVOA 2HWLB 2AH4X 1AHTH 1AUJA 2WZQA 1ELGA 2W7UA 4NGAH 1ACBE 3QLPH 2JETC 2SGAA 2Z3DA 1SSXA 3ZZDA 2J9NA 2BX4A 4NA8A 1P2IA 1GPZA 2FX6A 3MYWA 2STBE 4KP0A 1SQRA 5JBCS 3RU4E 1H9LB 1ZZZA 1W12U 4ZKOU 2Y7XA 4WXVA 2ZZUH 3DUXH 3SZNA 1UK2A 2J95A 1SLUB 3GCHB 3PMBB 3UNSA 3OY6U 1QL7A 5L2ZH 1NRSH 5FX5A 1H4WA 2BLOA 1W3CA 3GDUA 1UTMA 1C1RA 1L4DA 4WVPE 3KNXA 3HKJB 2XXLA 1W0JD 3SJKA 4BXSA 1SFIA 3FN8A 3SU6A 1F0UA 2FYQA 1AVWA 5FBEA 1TBZH 3EA9A 1SHHB 1YYY1 2ZWLH 1SGFA 1GHAG 2ZPQA 2H9TH 3EE0B 4X0WU 5DSFA 5AVDA 1O2KA 2QE7D 1GCTB 1SPJA 3D49H 1ELCA 2AHME 1UTKA 4Y6DA 1A0JA 8LPRA 1NTPA 1W7GH 1HNEE 1CE5A 5JPMH 3LT3A 3Q76A 5FXLA 5B6LA 1K1PA 4YZUA 1SGNE 1HAXB 3RXQA 4YO9A 1O3HA 1ZLRA 1TYNA 2ZKSA 4I8KA 3ATLA 1QA0A 2F4LA 2W3IA 1S81A 5E0GA 2HPPH 4E7NA 2VIDA 2DUCA 2HLCA 3DSGA 2JETB 3QGJA 4PROA 1A3BH 2IJOB 1C9PA 1TBQH 1GJ6A 8GCHF 2CGAA 1YPLH 1C5LH 1YLCA 1TIOA 1JBUH 2XYAA 3MNSA 2C8YB 1TNJA 2BOHB 1CQQA 3LGTA 1PPBH 3S0NA 1NC6A 1CT2E 2Q6FA 2G8TA 4DGJA 2ZCLP 1C5WB 5JBTA 2ZIQH 4Y0ZE 2VVUA 1DWCH 2FMJA 3MH7A 5ABWA 1P2KA 2WPLS 4XBBA 4ZXYH 2SFAA 1O38A 3PLKA 4MPUA 2ZDNA 2ZECA 4BTTB 1HJ8A 2BY9X 2Q6GA 1AY6H 4JZFH 4HZHA 1AN1E 1G36A 4TT3D 3LGYA 3KL6A 3GY4A 3RUOA 1GBEA 1TPSA 3A80A 3M37A 9LPRA 3LPRA 3B9FH 1NZQH 2F3CE 4NCYA 1HAVA 1KTSB 3KCGH 3E0NB 4Q2KA 4AB9A 1NPMA 4DIIH 4IC6A 1TNGA 1GI7B 1P09A 3RC5A 1BTXA 2ODYB 5EQQA 3F9EA 1VZQH 1GI0A 4Y8ZA 3QUMP 4WF8A 4CRCA 3TJNA 1F0RA 3UTUH 3SBKA 1EAUA 4ISIH 1CA8B 4VGCC 5CHAC 3P8OA 2XC4A 3ZYDA 1DWDH 1ZMJA 3HGPA 3LDXH 2R2MB 2GVFA 3M5MA 4ZXXH 1TRNA 2PKSC 3RXHA 4I86A 3ZZ3A 1C1SA 4XBDA 2D26C 3U8RH 3KYFA 3K9XB 3LONA 4HFPB 1VJ9U 2C8ZB 3LGVA 2Q1JA 1CHOG 4ABIA 1QNJA 2ODPA 4FUJA 5FHTA 3TNTA 3OY5U 4FU8A 4AFUA 2Y6TA 1WV7H 1C2DA 1ETSH 2ZU1A 1UCYK 4B6EA 1EOJA 2G4TA 1G3CA 1E35B 1IQHA 2BDIA 2VGCB 1K21H 1EAXA 2G55A 4WH6A 3M7QA 6LPRA 2FOBA 1VITG 1C1TA 2CHAB 1AFQB 1DE7H 5PTPA 3ZZBA 1UW7A 1XX9A 2OBOA 1UK4A 1P05A 2OQUA 4OS5A 3RXCA 1BITA 2ZHFH 1T8LA 1WUNH 5E2OA 3RM0H 2C3SA 4Z0KA 1FPHH 2GD4B 5F53A 1RTKA 3JZ1B 5HIZA 1GBFA 1PPHE 1NFWA 4MNVA 1A5IA 4YT7H 5F03A 4M7GA 3SI4H 5TCAA 1VGCC 1RTLA 4D8NA 1ZGIA 3KYGA 3CENA 4VGCB 1Z8RA 3DT0H 5EJ1A 2Q6DA 3HK3B 1NT1A 3OTJE 1Y3UA 2VIOA 2XOKD 3ZYEA 3F0OA 1GI5A 2AGIX 3DD2H 2DE9A 5CDFE 3RLYH 4K1SA 3LGUA 2XC5A 2BDYA 1QZ8A 3PYHA 1PQ7A 2G4UA 3F2GA 2ZHDA 1N6XA 1GG6C 1OWEA 2R9PA 1C1QA 1AMHA 3F3BA 5F8ZA 1EB1H 4ABEA 3QO6A 4ABDA 5T6FA 3PMHB 2SGQE 2FOCA 1LO6A 4AN7A 3K6ZA 3RXTA 2RFKC 1SOZA 4FU7A 4MNWA 1DANH 1S6LA 3A82A 1YBWA 1EPTB 1TGCA 3F9GA 1A7SA 3A8AA 1GVKB 1GDNA 1TALA 1BTZA 2WSSD 2VIWA 1LQEA 5KEDA 2Z3EA 3SO3A 1TX8A 4K2YA 5A8XA 2H2ZA 3ESTA 4BAOB 3RXSA 1F7ZA 3AVZA 4SGBE 1V6DA 1T8MA 3UUZA 1GBTA 4MPWA 3BTKE 3SW2B 2F9BH 1JRTA 1ELFA 1CA0C 1TPPA 2JJ2D 3AK5A 2ZFPH 1P06A 4BAHB 3B23B 1AB9B 2QGRA 2VINA 1DLKB 1W0ZU 4ZKRU 4IC5A 1ORFA 1UVSH 2QV1A 3DFLA 1HAOH 4TYDA 1T4VH 1TX6A 1NFUA 3PWBA 1GJAB 1DY9A 1WOFA 1WQVH 4XFQA 3C27B 4RKOB 1WYKA 1TMUH 1FIZA 4GUXA 3GOVB 5C0TA 3EQ0H 1H9HE 1GG6B 4X1PU 2H9HA 4ACAA 5L2YH 4NSVA 1WBGB 2YOLA 5AFZH 1ZJDA 3DA9B 5DN6D 1GHBF 4A1XA 1K22H 3F68H 4UDWH 1AQ7A 4YESB 1N8OC 3K65B 4JZ1A 3M3VA 2ANYA 3EGKH 2AERH 1RIWB 4CH8B 2GZ9A 2HALA 4Q63A 1QBVH 3NPSA 4TPIZ 1FV9A 2Y81A 2Z7FE 4XOJA 3MU5A 2ZI2H 1LQDB 4INHA 2FOEA 1SG8B 1AE8H 2PR3A 1SFQB 2QN5T 4CBOA 3PRBA 1PPZA 3AW0A 2A7CA 3E0PB 2LNCA 3P17H 1MH0A 3PMAB 5EPNA 1KXDA 4DOQA 3U8OH 4X2WA 1KYNA 1G3DA 2AEIH 3GCNA 5JDUB 4NIYA 1ABIH 1XUGA 2QIQA 2TIOA 5EXMA 1V2PT 1E37B 1HLTH 1EFRD 1HB0B 2IN2A 4ZKNU 3RXMA 3MMGA 4X6PA 3F6UH 4X8TH 1SLWB 2GGVB 2ANWA 2KM0A 2V35A 4NWKA 1O5BB 1Z8JB 4I8LA 1NRNH 5FPSA 2HVYB 1NU7B 1FY4A 3M35A 4I31A 3E6PH 1F0SA 3M36A 5IYTA 1Z8IB 1FY5A 1TQ7B 4ZUHA 4KELA 3MQKC 4BTUB 1TPOA 2GCHF 1O3GA 4FOUC 1TA6A 3SNEA 3SZEA 3SJ8A 1UTQA 2RDLA 1P11E 1KLJH 3UB0A 1UVPA 4U2WA 2OXSA 1FY8E 4Q7YA 2ANMH 1MZDA 2J34A 4IMQA 1C5QA 2PUQH 4AFZA 2FOGA 1P9UA 3NZIA 4E05H 1GJ4H 4KTSA 2H9EH 3T2NA 4KGAA 3NUMA 2BD4A 3MH6A 4ZAEA 1MTNC 1SQTA 1INCA 1YCPH 4ZHAA 1MTSA 3NCLA 1C1PA 3U28C 5DJ7A 1VKYA 1NRPH 1LHFH 2UUJB 1BBRK 2FPZA 3E90B 1G2MA 1EB2A 3RXKA 4FUEA 3MH4A 1GI4A 1OWKA 2A32A 1XUIA 1YPHC 1F5LA 4Y76A 3A7XA 4WJG2 1QL8A 1MKWH 5FX6A 4ZHMU 1W2KH 2J94A 2BYAX 2GP9B 1HAHH 2Z9GA 3O8RA 2RCEA 3SU5A 5A0BA 1O34A 1C5XB 1J15A 2ZFFH 1A4WH 1TPAE 1E34B 2XNDD 1IQEA 2BD7A 1C1VH 2P3FH 2PV9B 1L1NA 2HVXA 1MUEB 2W6ID 3GY7A 4XSKU 1GHYH 4D9RA 3ODFA 4J1YA 4O97A 2BDCA 1ZMNA 4XBCA 1QY6A 2PKAB 2HRVA 2ZU3A 2NWNA 1SQOA 1SGDE 3B8JA 1GL0E 2W3KA 4Z1MD 1F2SE 2VIQA 1MU6B 3PB1E 4MNXA 4D76A 1YM0A 1IHSH 3QZRA 2FI3E 5G4BA 1LMWB 3GDSA 1O0DH 2ZDMA 1LCYA 1OOKB 3SU0A 5GCHF 3T25A 3A83A 3RP2A 2FX4A 4CR5A 1MKXK 1EP5A 1ZPBA 3SHAH 1TAWA 2F9NA 5DP7A 2A45B 1O3FA 1WCZA 2WHXA 3ELAH 3SU3A 3KN2A 1OX1A 1QQ4A 4ISLA 3CS0A 2VWOA 2QF4A 2HLDD 1Z6EA 4MNYA 1S0RA 1T8OA 1DSTA 1TRMA 2PFEA 4OGYA 2NU3E 2BHGA 2C93B 3TGJE 2BY7X 1LKBA 4D7GA 2ZFTA 3ATIA 4FXGH 2P59A 1EPTA 1OWDA 1V2QT 3MU4A 4ZH8A 1BJUA 3BTQE 4B75A 3T27A 1B0EA 1OWIA 4D7FA 4BAMB 1GBLA 1YWUA 2STAE 3VFEA 1BRAA 3L6PA 2AS9A 3RDZA 1HAIH 2P93A 3QX5H 1NN6A 4NZLA 1C2IA 2YMSD 4OS4A 3RU4D 1SOTA 1GBCA 1CT0E 3BEFB 4AG2A 1GBAA 3O8BA 2PUXB 3W94A 5BPEA 1ZPCA 5IK2D 2WUBA 4XE4A 3VXFH 1NRQH 1GJ8B 1GHAF 3KGPA 2ZGJA 1DFPA 1MABB 3BIVH 2BD2A 1EUFA 1IQMA 1NY22 2BLQA 2J2UA 2K1QA 5EXNA 4ABGA 1OWHA 2QY0B 1MAXA 1TMTH 2BLVA 4FUBA 2B0FA 1FXYA 4HI3A 4F49A 5FCKA 2BZ6H 4K8YA 4GCHG 1AI8H 4K1EA 4CRGA 1SHYA 2P16A 3A84A 3M7TA 2L6OA 2ZC9H 3ZZCA 3I78A 1P8VC 1RJXB 4UD9H 1DOJA 4B73A 1S5SA 1ZGVA 3TJVA 4Y8XA 1OP2A 2OQ5A 2PSXA 4A1TA 3BTTE 6CHAB 1P02A 2VH0A 2Y82A 2QCYA 1G9IE 4CRAA 3MOCA 3GICB 2AMQA 3C1KA 1ZR0A 4WWYA 1OWJA 1ANEA 5EXLA 3M5OA 3SU1A 3SU2A 4M9FA 3RXBA 3P92A 1O37A 5JB8S 1SGYE 3FZZA 3SNAA 5C0UA 1YPJH 5EJZA 3A7TA 1D6WA 1U6QA 4XRNA 4JK5A 4I8GA 1E1QD 1AUTC 5E0HA 3K6YA 3MNCA 2XC0A 1KDQB 2WYJA 1E36B 3H7OA 4WMEA 5EG4A 1UVTH 4U30A 1E38B 1N1LA 1QRZA 3LOXA 1IQKA 2A2QH 1UTPA 2A0QB 1FDPA 2BOKA 2R0KA 1AFEH 1DVAH 3AAUA 3VB6A 1ARBA 4JZIA 4X8SH 3MI4A 2TPIZ 5EQRA 1LPKB 3OTPA 4CRDA 1QBOA 1OP0A 3UOUA 1A5GH 4I33A 4TWWA 1C2GA 1V2LT 2J97A 3STIA 1GMHG 1QBNA 1THSH 1L1JA 5ESTE 1QJ1B 2CF8H 3MU8A 5C20A 5C1YA 1HCGA 4ABBA 3OU0A 1ZHMA 1BUIA 1NESE 2XNIA 3E3TA 1FN6A 1PYTD 1O31A 2NU2E 3A7VA 2KX4A 1YF4A 2FWWA 1V2JT 3MO9A 1C5MD 1JWTA 2OBQA 1UMAH 3UPEA 4P00A 1S6HA 4FVDA 3ZVEA 3TLOA 3F1SB 4ACBA 2OD3B 1G2LA 3MU0A 3BTHE 2NU4E 1F5KU 1EATA 3S9AA 2J38A 2QF3A 3F9FA 1C4Y2 1G3BA 1HXFH 4B2AA 4NWLA 3PRDA 4WXIA 3VXEH 1C1MA 1TA2A 1WDIA 5EGMA 1MMJN 1GBMA 1V2KT 3U98H 1VITF 1KIGH 1ZJKA 4JYVH 4BAQB 1TB6H 3A85A 1EJMA 2QXHA 1LTOA 1HAGE 1HRTH 3OFND 2BX3A 1Y5UT 3TH2H 3RXRA 2AFQB 1AU8A 1DM4B 4BAKB 4AFSA 4MPVA 2G81E 1OYTH 1Z1IA 3A7WA 4UONA 3OX7U 4FUFA 2VWNA 5JBBS 3BTME 2DE8A 1C5RA 1X7AC 1UJ1A 2WPHS 2BVRH 1AWHB 4U01A 3F9HA 1BMLA 2A4GA 1W10U 3EA8A 2BD8A 2BMGB 4GLYA 1CVWH 2SGDE 2XBVA 5EJLA 1O2SA 3RXOA 2WINI 3I29A 3ZVBA 5CE1A 1YPEH 3SUGA 3UOPA 4YOGA 1JRSA 5L30H 3BG8A 3QWCH 2ZFRH 1UTJA 1HFDA 2EEKA 4IW4E 2W6JD 1VCPA 4AORA 1ZRKA 3RXGA 1BTYA 2XWAA 2ZGBH 3VGCC 1F5RA 2PW8H 1FNIA 2XCNA 1D3PB 3GISB 1A0HB 1O5CB 3M3SA 1K28D 5LGOA 2OP9A 1O3JA 4NA9H 3MNXA 2FOAA 2PKAA 3MTYA 1O3DA 4LXBH 4X6OA 3OSYA 3SV8A 2KR7A 5GDSH 1TGSZ 3GY8A 1EZSC 3SHCH 2BDHA 3QTVH 4H42U 4MVNA 1FAXA 1O3BA 1T7CA 4I8HA 1DXPA 1C2JA 2BD5A 5E0JA 3V7TA 8ESTE 5J4QA 2ANKH 1JXPA 2Z3CA 4DY7B 4TPYA 1LHDH 2P94A 2BB4A 5A2MH 3WW7A 5CHAB 4CREA 2J98B 1FLEE 1O5DH 3KQ5A 1O5FH 4DG4A 1W13U 3ZVCA 5GNDA 1SLVB 1DITH 5E2PA 2PKSB 2FP7B 1IAUA 2EC9H 3WWBA 4H6TA 4FUDA 2O8TA 5T6DA 3UNQA 1G37A 5DKMA 1DSUA 4X1NU 1Y8TA 3SV7A 1P2QA 3E16B 1FQ3A 4ISNA 5HMAA 5GWZA 4GHTA 1O3IA 4XD7D 2JKHA 3FFGA 3IWMA 1SBWA 2FLBH 1GJ5H 1V2MT 5F8XA 1ETRH 2HPQH 5LPEA 2F9PA 2PSYA 2RA3A 2A1DB 2GKVE 3SUFA 1OS8A 1V2RT 2FESH 3FP8E 4K1TA 1CBWC 1TQ0B 2BZAA 4ZMAH 1PJPA 1IQGA 3I77A 1COWD 4ASUD 4AG1A 3V0XA 2UUKB 3MO3A 1C2EA 1D3DB 1C5VA 1GJDB 1EZXC 2KZ4A 2VH6A 2VIVA 3BF6H 4JYUH 3ZZ7A 3Q00A 2GT8A 2OCVB 3FANA 3QN7A 4AYVB 3TH4H 4YLQH 3V12A 1G30B 2ZGXH 1MD8A 2FO9A 1L2EA 1Y3XA 1TWXB 2NU1E 1C2FA 3SI3H 2FTMA 1EKBB 1XXDA 1O3CA 2IJD1 3AW1A 3GCOA 5FAHA 2XRCA 1TGNA 3N7DA 3Q77A 1P3CA 1Y3YA 4Y79A 1YP9A 4ABFA 1XVOA 3RM2H 1ELTA 2WV5A 1C5SA 1GMDF 1XVMA 1VGCB 3F2HA 1S0QA 1LHEH 1YPKH 3M61U 1SB1H 2KFWA 2QA9E 1BHXB 1B5GH 5A8YA 3SQEE 4NFFA 3RXVA 3HATH 3STJA 1MTVA 3FVFB 1GBBA 4YLUA 2EA3A 1T31A 2YNAA 1EXFA 2BDGA 1DUEA 1Y5AT 1SGIB 3GCTF 3GY5A 3VB7A 1FUJA 2H5DA 3Q3XA 1VCWA 1H8DH 3DSOA 4IBLH 4JZEH 3VB5A 3W95A 3M3TA 1T4UH 1HJAC 4X1SU 2FOMB 1S6FA 4F48B 2PLXA 3F0PA 3UAIC 2AMDA 4Y7BA 3U1JB 2SGEE 3U1IB 2ZQ2A 3BN9A 1SMFE 1S85A 5LH8A 1IQNA 1OP8A 3BTEE 4ABJA 2QXGA 1CBWB 2ZF0H 4DIHH 1BMAA 2I6QA 1AVGH 2ULLA 1QFKH 3D65E 2VVVA 3DCLA 1KDQA 3SJIA 3N7OA 1V3XA 1NRRH 2A4QA 3UY9A 1G32B 3LJJA 4F4OC 1HJ9A 1BTHH 1K2I1 2IOTA 1H9IE 5DP6A 2THFB 1J16A 4IN1A 1YLNA 1CGHA 4H4FA 1Z7KA 1CA0B 4GPGA 4D9QA 5EU8A 3DSPA 3RXJA 3OYPA 4Q7ZA 1QL9A 2TGPZ 2H5CA 3PWCA 1NS3A 2BDBA 3T62A 1AO5A 1ABJH 2R0LA 1Q31A 1WSSH 4K60A 3U9AH 2AMPA 1QR3E 3VPKA 2FIRH 1GHZA 3S69A 5C1XA 2G52A 2BY6X 2LPRA 2WV4A 3TVJB 1S82A 2Y5HA 3QTOH 1ELDE 1QQUA 3SGQE 2BM2A 1GI9B 3LGWA 4IN2A 3KIDU 3R3GB 1PQ5A 4NIVA 1QRXA 2A5KA 2WPJS 2QC2A 2I6SA 3RXIA 1KMHB 5DP8A 3LU9B 3PTBA 4MPXA 2RDEA 1O30A 4MG3A 2PTNA 3TITA 1N8OB 4CRFA 3UQOA 1O2XA 1P9SA 1JIMA 1O2HA 1Q3XA 1GDUA 3ZV9A 1GHXH 3DFJA 6GCHF 1C2MA 2LP6A 1GHBG 4MLFB 2BQ6B 3W1EA 3EA7A 1Y59T 2XBXA 2CF9H 3P6ZB 3P8FA 1DX5M 1GVLA 2FI5E 3TIUA 3NKKA 4UFEH 1JOUB 3NK8A 1YCPK 4NIWA 2F9OA 1Q2WA 2LELA 1CSOE 3SN8A 4FUCA 1GI3A 1TX7A 1QB1A 1TGTA 3OEED 1ARCA 1KXFA 2GX4A 5JBAS 3FO8D 1TBRH 2GCTC 3A8CA 4O9VA 3SGBE 4DVAU 1MQ5A 2BY5X 4RSPA 1ELAA 1EJNA 2FOHA 2ZG0H 3RXAA 2H1UA 2EQNA 5EPYA 1N6YA 2WPDD 1O2GH 2XW9A 2YMSC 3LJOA 2P95A 5EW1H 1RFNA 1A1RA 1C1OA 3R0FA 1FONA 3ZVDA 1LHCH 5F8TA 4DT4A 1QTFA 1MKWK 3BG4C 4BOHA 1HAVB 2FTLE 4R0IA 4BNRA 1BOQA 2GMTC 1SL3A 1G3EA 2J5UA 3L33A 4Y0YE 1BJVA 1QIXB 2WPMS 1O2TA 2NU0E 4B2BA 2Y80A 3A86A 1D9IA 2JH5D 3BIUH 3EYDA 4O3TA 1CGJE 4RT1A 4JYTA 1AZZA 2ODQA 3NXPA 2QF5A 1QRWA 3FP7E 1MTUA 3KQBA 2EI8A 5F6MA 8KME2 2ZO3H 1P2OA 1K1NA 2G00A 3BTGE 2OC0A 1RGQA 2ALVA 1UK3A 3SYJA 2QXJA 1J17T 3VB4A 1J9CH 4DURA 2VVCA 4B71A 1O3NA 2FI4E 2ZGCA 2FODA 5CMXH 3FKSD 2ZHQH 4OS7A 1NBME 3ZZ9A 1BMNH 2GCHG 2W26A 3A88A 3LC3A 1ESAA 4Y7AA 1TOMH 2V0BA 2CV3A 1K9OE 2D1JA 4OS1A 3PV5A 2JJ1D 2ZFQH 3D62A 1QURH 4IMZA 5GPIB 2QAAA 1MTNB 1FY1A 1W14U 2BLWA 3SV9A 2ZDKA 3EDXB 1PQAA 2A7JA 1BTWA 3FP6E 3PLBA 3GDVA 3PMJA 4DJZB 1KTTB 2XWBI 1FI8A 5FL7D 4RI0A 5KECA 1GL1A 1ELBA 2XCFA 4KTUA 4X8UH 1DICA 3LGIA 2YMSB 1BQYA 2BVXH 1UTLM 3T28A 1A0LA 4NA7A 3TPIZ 2YNBA 3BG4B 2J92A 1GHWH 4WY3A 1NFXA 4KTCA 2GMTB 1GJ7B 1PFXC 5DP5A 5ESBA 2R2WU 3TK5A 2F83A 3PROA 5FPTA 3GS9A 1SI5H 2V3MA 2Y5GA 3SNDA 7GCHG 1BT7A 1XUFA 3RMLH 3V13A 4WMFA 1O33A 1KLTA 2GDEH 3FOAA 1P01A 3V3MA 1L1GA 1XUJA 7LPRA 1Y3WA 2TGDA 2F9UA 1O3PB 5AHGH 1MZAA 1SR5C 1TLDA 4HGCA 2ILNA 3UWIA 1PYTC 2HNTE 3GYMA 3VEQB 1DLEA 3GCHC 4A92A 1JIRA 1RRKA 3KHVA 2GT7A 1HXEH 1E79D 4Q80A 1EOLA 1K1LA 2ZTYA 1ZSLA 1O36A 3BEUA 1OSSA 2CXVA 2G5VA 5HGGA 2OK5A 2EI6A 2KAIB 4F55A 5EQSA 3EE7A 1FJSA 5FPYA 4HTCH 1H8ED 2V3OH 2JH6D 2BTCE 2VU8E 4DT7B 5T3HA 1MCVA 1C5YB 5TJXA 4AZ2B 1O2UA 1C1NA 5C2ZA 4YXWD 2FDAA 4DCDA 4FETA 2V3HH 1GMHF 1W7XH 2FM2A 3E8LA 2RG3A 2PP6A 1TNLA 2BY8X 1QGFA 1RTFB 5DP4A 4R8TB 5A0AE 1GVZA 1WXRA 2A2XH 4QT8C 1O3LA 1ZRBA 3P8NA 4K69A 1WU1A 1QB6A 3N99A 2CMYA 3UFAA 1BCUH 3ZZ5A 2ZEBA 5BRRE 1DUAA 1C1WH 1T32A 1ZHRA 4E06H 1O3MA 4GVUA 2WUCA 1HGTH 4SGAE 2ZHEH 5LPFA 2ZPSA 2GZ8A 1DPOA 1EQ9A 1C5ZB 2A4RA 1YPHE 5E8EH 1O2MA 1GBHA 1TFXA 1VR1H 1WTHD 2ZQ1A 4TY7A 4Y71A 1BZXE 3TJOA 1FPCH 1NO9H 2HGTH 1GMCG 3S7HB 1GBKA 1EAWA 2GTBA 2ZDVH 2Y7ZA 4AGKA 1O35A 1A46H 2ZP0H 3BTDE 4GAWA 5L6NH 1LHGH 3L3TA 1C5UA 5T1VA 1ESBA 2KCOA 3KQEA 4K3JA 1GBIA 4OS2A 2XTTB 1O2PA 4A5TS 3D23A 3F2FA 1EZUC 3HKIB 4H6SB 4OM9A 1IQJA 1O2IA 4RT0A 1TABE 1BTUA 1P04A 1BRUP 2IPHA 1VJAU 1ZTJA 2JDID 3TK6A 1UO6A 4B74A 1CHOF 1BMMH 5T6GA 3URCA 4CBNA 1VITH 3LC5A 3H09A 3PO1C 5SGAE 1QCPA 1FX0B 1F0TA 1GGDC 3ZZ6A 4B2CA 2XBYA 1C5PA 1C5OH 1Z8GA 3VB3A 2CJIA 5HM2A 2ZU5A 4Z6AH 4FUIA 1PPGE 5HIYA 3TNSA 1P12E 4UFGH 1M9UA 4MTBA 1D3QB 5C5OA 1SGRE 1SGQE 1Z71A 2VWLA 4UFDH 3GYLB 2Z94A 2HOBA 1FMGA 6ESTA 2VGCC 3RXDA 5DPAA 2ZDLA 5GXPA 4ASHA 1DT2A 2Z6BD 2CHAC 4Q7XA 1AFQC 4MQAA 3QZQA 1C4V2 1W0KD 4K8BA 1SLXB 2A5IA 1KXBA 1K1MA 2AYWA 2QYIA 4BTIB 3UR6A 4X1RU 4ZHLU 3RU4T 2Z9JA 2KCYA 7KMEH 2TRMA 3SNCA 2G51A 4ISOA 3PM3A 4P02A 4TSFD 1UHBB 3GY6A 1ZSJA 4CH2B 1C5NH 4BXWA 1C2LA 1NFYA 2O8LA 1P57B 1IOEA 1SQAA 3SJOA 3UREA 5C3NA 2ZDAH 4DW2U 1H8IH 1B7XB 1XM1A 5C94A 1HYLA 1Z1JA 4I7YH 3TK9A 3SV6A 1RS0A 1XXFA 2ZGHA 3NRLA 4AYYB 1SGPE 1O2LA 3FAOA 1P10A 3PO1B 3T5FH 2ZPRA 1DXWA 1GGDB 3PLPA 2ZU4A 1HV7A 2WPKS 3O8DA 2O8WA 2Z9IA 3TJUA 4GHQA 8GCHG 3RC6A 1ZTKA 2PGBB 1TOCB 3FZDA 2J4IA 4E7RG 3WY8A 1ID5H 1MQ6A 2P8OC 2GDDA 4K5ZA 5GIBA 1KXEA 4WMDA 2BD3A 4IGDA 1KXCA 3S9BA 1NU9A 1PQ8A 1UCYH 4A1VA 3TU7H 4OS6A 1EPTC 4TY6A 3URDA 1AKSB 1MTWA 2EI7A 1MU8B 1BRBE 2TGTA 3SU4A 4UE7H 5JB9S 2QF0A 1PPCE 1KY9A 1QA7A 2PWXA 5DP9A 2WYGA 2BQWB 4UEHH 4BANB 3N7EA 1ZOMA 1L0ZA 3MHWU 5FBIA 5C67A 1P2NA 1BB0B 1GBJA 1O2RA 3VG8A 1CU1A 2KCPA 1JMOH 3ZVGA 1O3AA 1SGEE 3SNBA 2GV7A 1AB9C 3PV4A 1PPEE 1BA8B 3QGNB 1K1JA 2FZZA 1A61H 1HIAB 3ZVFA 9ESTA 2AIQA 4AGJA 3TH3H 3P8GA 1HPGA 3S7KB 1O2VA 3UR9A 1AWFH 5HYOA 1QB9A 5IDKA 2IPQX 1O5GH 1THRH 5JYIA 2CN0H 4TWYA 3VGCB 1TNIA 2KCAA 1P2MA 1MCTA 1OHHD 1P0SH 1AD8H 1VCQA 2B5TB 1HAZB 5HKKD 3MWIU 5HXFA 3SOSA 3UNRA 4YOJA 4OGXA 1XUHA 3BTFE 1AE5A 2P8OB 2PTCE 1ETTH 1GCDA 2ZCHP 4U32A 1ZYOA 2ZCKP 4XDEA 3K2UA 1MBMA 2Z9LA 1F92A 3ATMA 1RIWC 1O2QA 4JZDH 3RMOH 4FVBA 1ANBA 1TGBA 2KAIA 1C5TA 3U69H 1HUTH 1GDQA 3ATWA 1LPGB 2P3UB 2ZTXA 3ZZ8A 1KLIH 1DS2E 1O3OA 1SKYE 1TMBH 4NFEA 5DP3A 1UVOA 4A7IB 7ESTE 5GJ4B 3RXPA 3MNBA 3RMNH 2AGEX 1TRYA 4FUHA 3KQDA 1UCYE 3LH1A 1BRCE 1V2NT 2B8OH 1GI2A 1NM6A 2G5NA 3GY2A 2AGGX 1C1UH 4NSYA 2VB0A 2UWOA 2A7HA 3RXFA 1P3EA 2ESTE 1Y3VA 4Y11E 1DDJA 5EW2H 4Y10E 1K0HA 5EOKA 1TE0A 1HAPH 3HPTB 1GJ9B 1D6RA 2AIPA 3CS7A 2SNVA 1ZPZA 1GI6A 2OINA 4B76A 2OC7A 5EIYA 4X2VA 1V2OT 1XKBC 1KXAA 3MH5A 4INKA 1J14A 1KSNA 3AASA 2ZU2A 1ANCA 2UWPA 3KQCA 2D2DA 2OC8A 2JH0D 1DWBH 2VIPA 1BHXF 4YOIA 4AC9A 4AFQA 4CR9A 1ELEE 3ZZAA 4ABHA 1EX3A 1IQIA 3SORA 1IQFA 2OLGA 3DHKH 3KEEA 1UTOA 2BXTH 2O9QA 1MBQA 4ZROA 3A8BA 1YY3A 3A89A 2Z9KA 1FY3A 3U8TH 5I46H 5C1UA 4GSOA 4Q4LA 1DY8A 2K8IA 4I32A 1YCPM 3PV2A 1SGCA 1ZTLA 4I8JA 3ODDA 2C4FH 1FN8A 2ZTZA 5LPRA 2ZFSA 2V7QD 3ZIAD 1CGIE 1BIOA 1GMDG 3BTWE 3H7TA 5A8ZA 3O8CA 1AZ8A 1EZQA 1CO7E 3RXUA 1NROH 2SGFE 3HK6B 1C2KA 2GV6A 3T26A 4B6FA 1HJAB 2FOFA 5DGJA 1YC0A 1O2OA 1K1OA 1D3TB 2HNTC 4LOYH 5HM9A 3GCTG 1AVXA 1C2HA 3SJ9A 3EAJA 1W0YH 1ESTA 3BV9B 2O8UA 2M5TA 1A5HA 3SGAE 1V2WT 1LVBA 1LKAA 3RLWH 2RA0A 1QJ6B 3Q3YA 5DO4H 1EJAA 2ZA5A 1LVYA 3TGIE 1FAKH 1O3KA 1WAYB 4X6MA 1FIWA 2SNWA 3SUDA 4HG6A 3A7ZA 2F9VA 1TONA 3E1XB 2BD9A 2W5EA 1SGTA 1WQSA 1V2VT 2PGQB 3HGNA 3LKWA 4ZCNA 1YLDA 1T8NA 2R3UA 1BMFD 1ZMLA 5H4IB 1Y5BT 3ZZ4A 5K0HA 1XUKA 2PHBA 4J2YB 1IQLA 3PTNA 5I25A 2BXUH 3M5NA 1BDAA 5TCCA 1GI8B 1XKAC 5DG6A 3OEHD 1H1BA 1K1IA 1V2TT 4JCNA 2XBWA 1UHBA 3UWJH 3SV2H 1E1RD 1NBMD 4X8VH 1QJ7B 1ZHPA 3Q3KA 4X2YA 2FEQH 1RXPA 1TNKA 1D4PB 3S9CA 2A4OA 5C17A 3AAVA 1Z6JH 1OYQA 4JMYA 4AB8A 1ANDA 3BEIB 1P03A 1P2JA 2V6NA 2F91A 4A6LA 2GJGA 4RN6A 1CHGA 1ZSKA 3WWFA 1RD3B 3JZ2B 3CNRA 4O3UA 2H6MA 3ATKA 4THNH 1B0FA 2VNTA 1C9TA 3LIWA 3H5CB 2K0QA 5EODA 3A8DA 3QDZB 2VJ1A 1A3EH 1HAYB 3MFJA 4IS5A 7GCHF 5A0CA 2QXIA 2EY4C 1BBRH 2WPIS 2A5AA 4NZQA 1PPFE 4NIXA 1UTNA 2O8MA
chains in the Genus database with same CATH topology
1O2YA 1O5EH 2B9LA 2ALPA 4FU9A 2TGAA 1IHTH 1OXGA 2VWMA 4CRBA 4ISHH 1MAYA 3RXEA 2C8XB 2FXRA 1YKTA 2P3TB 4INLA 1XMNB 3GY3A 1FZZA 1O2ZA 5J4SA 1AKSA 4AOQA 5AFYH 6GCHG 1AGJA 5K7RA 2C8WB 1EAIA 1SGFG 4CHAC 3IG6B 2HNTF 1EASA 1UVUH 5FCRA 1S83A 1C4U2 1ELVA 2W7SA 1O39A 2D8WA 1V2UT 4Y8YA 4B1TA 4LZ1H 1OKXA 4ABAA 2SGPE 5DK1A 4AX9H 5A09A 1GBDA 4O03A 4X2XA 2GCTB 4LZ4B 1E0FD 4YT6H 4MDSA 3TGKE 1GHVH 4ZKSU 3ZV8A 1O2JA 2TBSA 3ENSB 1THPB 2FS8A 4NG9H 4GCHF 1V2ST 1GJCB 2UWLA 1HBTH 3P70B 1OPHB 1S84A 1YPMH 3ZVAA 1HIAA 4KKDA 5C5NA 4UFFH 4LK4A 5ETXA 3ITIA 3SUEA 3M7UA 3A81A 1O32A 3SQHE 1YPGH 1QHRB 2Y5FA 1GJBB 1O2WA 1MKXH 3QK1A 1GWAA 5B6OA 3NWUA 2ASUB 1EP6A 2BDAA 4YTAA 1A2CH 2GZ7A 1LVMA 3IITA 6CHAC 2OUAA 1LDTT 3UIRA 3BSQA 1YGCH 3MU1A 2A31A 3M5LA 2FLRH 1TNHA 1AIXH 3E91A 1HDTH 2BQ7B 1BBRE 2ZNKH 2FYRA 2OC1A 4YM9A 1BTPA 2FS9A 4CHAB 1SVPA 1GMCF 2BVSH 1GI1A 3A87A 2OTVA 4X6NA 3KF2A 4FUGA 3MO6A 1CT4E 2ZHWH 1DWEH 1O2NA 1O5AB 1GCTC 3UQVA 3T29A 2R3YA 2UUYA 1L4ZA 2C90B 2UUFB 1W11U 3LH3A 3A7YA 5AF9H 1LPZB 5GCHG 1SC8U 3RXLA 4ESTE 3RC4A 1O3EA 4RKJB 4WH8A 2B7DH 1W8BH 1WTGH 3G01A 3CP7A 3RMMH 1J8AA 1MD7A 4X1QU 3P95A 4JK6A 1LVOA 2HWLB 2AH4X 1AHTH 1AUJA 1ELGA 2W7UA 4NGAH 1ACBE 3QLPH 2JETC 2SGAA 2Z3DA 1SSXA 3ZZDA 2J9NA 2BX4A 4NA8A 1P2IA 1GPZA 2FX6A 3MYWA 2STBE 4KP0A 5JBCS 3RU4E 1H9LB 1ZZZA 1W12U 4ZKOU 2Y7XA 4WXVA 2ZZUH 3DUXH 3SZNA 1UK2A 2J95A 1SLUB 3GCHB 3PMBB 3UNSA 3OY6U 1QL7A 5L2ZH 1NRSH 5FX5A 1H4WA 2BLOA 1W3CA 3GDUA 1UTMA 1C1RA 1L4DA 4WVPE 3KNXA 3HKJB 2XXLA 3SJKA 4BXSA 1SFIA 3SU6A 1F0UA 2FYQA 1AVWA 5FBEA 1TBZH 3EA9A 1SHHB 1YYY1 2ZWLH 1SGFA 1GHAG 2ZPQA 2H9TH 3EE0B 4X0WU 5AVDA 1O2KA 1GCTB 1SPJA 3D49H 1ELCA 1UTKA 4Y6DA 1A0JA 8LPRA 1NTPA 1W7GH 1HNEE 1CE5A 5JPMH 3LT3A 3Q76A 5FXLA 1K1PA 4YZUA 1SGNE 1HAXB 3RXQA 4YO9A 1O3HA 1ZLRA 1TYNA 2ZKSA 4I8KA 3ATLA 1QA0A 2W3IA 1S81A 5E0GA 2HPPH 4E7NA 2VIDA 2DUCA 2HLCA 2JETB 3QGJA 4PROA 1A3BH 2IJOB 1C9PA 1TBQH 1GJ6A 8GCHF 2CGAA 1YPLH 1C5LH 1YLCA 1TIOA 1JBUH 2XYAA 3MNSA 2C8YB 1TNJA 2BOHB 1CQQA 3LGTA 1PPBH 3S0NA 1NC6A 1CT2E 2Q6FA 2G8TA 4DGJA 2ZCLP 1C5WB 5JBTA 2ZIQH 4Y0ZE 2VVUA 1DWCH 2FMJA 3MH7A 5ABWA 1P2KA 2WPLS 4XBBA 4ZXYH 2SFAA 1O38A 3PLKA 4MPUA 2ZDNA 2ZECA 4BTTB 1HJ8A 2BY9X 2Q6GA 1AY6H 4JZFH 4HZHA 1AN1E 1G36A 3LGYA 3KL6A 3GY4A 3RUOA 1GBEA 1TPSA 3A80A 3M37A 9LPRA 3LPRA 3B9FH 1NZQH 2F3CE 4NCYA 1HAVA 1KTSB 3KCGH 3E0NB 4Q2KA 4AB9A 1NPMA 4DIIH 4IC6A 1TNGA 1GI7B 1P09A 3RC5A 1BTXA 2ODYB 5EQQA 3F9EA 1VZQH 1GI0A 4Y8ZA 3QUMP 4WF8A 4CRCA 3TJNA 1F0RA 3UTUH 3SBKA 1EAUA 4ISIH 1CA8B 4VGCC 5CHAC 3P8OA 2XC4A 3ZYDA 1DWDH 1ZMJA 3HGPA 3LDXH 2R2MB 2GVFA 3M5MA 4ZXXH 1TRNA 2PKSC 3RXHA 3ZZ3A 1C1SA 4XBDA 2D26C 3U8RH 3K9XB 3LONA 4HFPB 1VJ9U 2C8ZB 3LGVA 2Q1JA 1CHOG 4ABIA 1QNJA 2ODPA 4FUJA 5FHTA 3TNTA 3OY5U 4FU8A 4AFUA 2Y6TA 1WV7H 1C2DA 1ETSH 2ZU1A 1UCYK 1EOJA 2G4TA 1G3CA 1E35B 1IQHA 2BDIA 2VGCB 1K21H 1EAXA 2G55A 4WH6A 3M7QA 6LPRA 2FOBA 1VITG 1C1TA 2CHAB 1AFQB 1DE7H 5PTPA 3ZZBA 1XX9A 2OBOA 1UK4A 1P05A 2OQUA 4OS5A 3RXCA 1BITA 2ZHFH 1T8LA 1WUNH 5E2OA 3RM0H 2C3SA 4Z0KA 1FPHH 2GD4B 1RTKA 3JZ1B 1GBFA 1PPHE 1NFWA 4MNVA 1A5IA 4YT7H 5F03A 4M7GA 3SI4H 5TCAA 1VGCC 1RTLA 4D8NA 1ZGIA 3CENA 4VGCB 1Z8RA 3DT0H 2Q6DA 3HK3B 1NT1A 3OTJE 1Y3UA 2VIOA 3ZYEA 1GI5A 2AGIX 3DD2H 2DE9A 3RLYH 4K1SA 3LGUA 2XC5A 2BDYA 3PYHA 1PQ7A 2G4UA 2ZHDA 1N6XA 1GG6C 1OWEA 2R9PA 1C1QA 1AMHA 5F8ZA 1EB1H 4ABEA 3QO6A 4ABDA 5T6FA 3PMHB 2SGQE 2FOCA 1LO6A 4AN7A 3K6ZA 3RXTA 1SOZA 4FU7A 4MNWA 1DANH 3A82A 1YBWA 1EPTB 1TGCA 3F9GA 1A7SA 3A8AA 1GVKB 1GDNA 1TALA 1BTZA 2VIWA 1LQEA 2Z3EA 3SO3A 1TX8A 4K2YA 5A8XA 2H2ZA 3ESTA 4BAOB 3RXSA 1F7ZA 3AVZA 4SGBE 1V6DA 1T8MA 3UUZA 1GBTA 4MPWA 3BTKE 3SW2B 2F9BH 1JRTA 1ELFA 1CA0C 1TPPA 2ZFPH 1P06A 4BAHB 3B23B 1AB9B 2QGRA 2VINA 1DLKB 1W0ZU 4ZKRU 4IC5A 1ORFA 1UVSH 2QV1A 3DFLA 1HAOH 4TYDA 1T4VH 1TX6A 1NFUA 3PWBA 1GJAB 1DY9A 1WOFA 1WQVH 4XFQA 3C27B 4RKOB 1WYKA 1TMUH 1FIZA 4GUXA 3GOVB 3EQ0H 1H9HE 1GG6B 4X1PU 2H9HA 5L2YH 4NSVA 1WBGB 2YOLA 5AFZH 1ZJDA 3DA9B 1GHBF 4A1XA 1K22H 3F68H 4UDWH 1AQ7A 4YESB 1N8OC 3K65B 4JZ1A 3M3VA 2ANYA 3EGKH 2AERH 1RIWB 4CH8B 2GZ9A 2HALA 1QBVH 3NPSA 4TPIZ 1FV9A 2Y81A 2Z7FE 4XOJA 3MU5A 2ZI2H 1LQDB 4INHA 2FOEA 1SG8B 1AE8H 2PR3A 1SFQB 2QN5T 4CBOA 1PPZA 3AW0A 2A7CA 3E0PB 2LNCA 3P17H 1MH0A 3PMAB 5EPNA 1KXDA 4DOQA 3U8OH 4X2WA 1KYNA 1G3DA 2AEIH 3GCNA 5JDUB 4NIYA 1ABIH 1XUGA 2QIQA 2TIOA 5EXMA 1V2PT 1E37B 1HLTH 1HB0B 2IN2A 4ZKNU 3RXMA 3MMGA 4X6PA 3F6UH 4X8TH 1SLWB 2GGVB 2ANWA 2V35A 4NWKA 1O5BB 1Z8JB 4I8LA 1NRNH 5FPSA 1NU7B 1FY4A 3M35A 4I31A 3E6PH 1F0SA 3M36A 5IYTA 1Z8IB 1FY5A 1TQ7B 4ZUHA 4KELA 4BTUB 1TPOA 2GCHF 1O3GA 1TA6A 3SNEA 3SJ8A 1UTQA 2RDLA 1P11E 1KLJH 1UVPA 4U2WA 2OXSA 1FY8E 4Q7YA 2ANMH 1MZDA 2J34A 4IMQA 1C5QA 2PUQH 4AFZA 2FOGA 1P9UA 3NZIA 4E05H 1GJ4H 4KTSA 2H9EH 3T2NA 4KGAA 3NUMA 2BD4A 3MH6A 4ZAEA 1MTNC 1SQTA 1INCA 1YCPH 4ZHAA 1MTSA 3NCLA 1C1PA 5DJ7A 1NRPH 1LHFH 2UUJB 1BBRK 2FPZA 3E90B 1G2MA 1EB2A 3RXKA 4FUEA 3MH4A 1GI4A 1OWKA 2A32A 1XUIA 1YPHC 1F5LA 4Y76A 3A7XA 4WJG2 1QL8A 1MKWH 5FX6A 4ZHMU 1W2KH 2J94A 2BYAX 2GP9B 1HAHH 2Z9GA 3O8RA 2RCEA 3SU5A 5A0BA 1O34A 1C5XB 1J15A 2ZFFH 1A4WH 1TPAE 1E34B 1IQEA 2BD7A 1C1VH 2P3FH 2PV9B 1L1NA 2HVXA 1MUEB 3GY7A 4XSKU 1GHYH 4D9RA 3ODFA 4J1YA 4O97A 2BDCA 1ZMNA 4XBCA 1QY6A 2PKAB 2HRVA 2ZU3A 2NWNA 1SQOA 1SGDE 3B8JA 1GL0E 2W3KA 1F2SE 2VIQA 1MU6B 3PB1E 4MNXA 4D76A 1YM0A 1IHSH 3QZRA 2FI3E 5G4BA 1LMWB 3GDSA 1O0DH 2ZDMA 1LCYA 1OOKB 3SU0A 5GCHF 3T25A 3A83A 3RP2A 2FX4A 4CR5A 1MKXK 1EP5A 1ZPBA 3SHAH 1TAWA 2F9NA 5DP7A 2A45B 1O3FA 1WCZA 3ELAH 3SU3A 3KN2A 1OX1A 1QQ4A 4ISLA 3CS0A 2VWOA 1Z6EA 4MNYA 1S0RA 1T8OA 1DSTA 1TRMA 2PFEA 4OGYA 2NU3E 2BHGA 2C93B 3TGJE 2BY7X 1LKBA 4D7GA 2ZFTA 3ATIA 4FXGH 2P59A 1EPTA 1OWDA 1V2QT 3MU4A 4ZH8A 1BJUA 3BTQE 4B75A 3T27A 1B0EA 1OWIA 4D7FA 4BAMB 1GBLA 2STAE 3VFEA 1BRAA 3L6PA 2AS9A 3RDZA 1HAIH 2P93A 3QX5H 1NN6A 4NZLA 1C2IA 4OS4A 3RU4D 1SOTA 1GBCA 1CT0E 3BEFB 4AG2A 1GBAA 3O8BA 2PUXB 3W94A 5BPEA 1ZPCA 2WUBA 4XE4A 3VXFH 1NRQH 1GJ8B 1GHAF 3KGPA 2ZGJA 1DFPA 3BIVH 2BD2A 1EUFA 1IQMA 1NY22 2BLQA 2J2UA 2K1QA 5EXNA 4ABGA 1OWHA 2QY0B 1MAXA 1TMTH 2BLVA 4FUBA 2B0FA 1FXYA 4HI3A 4F49A 5FCKA 2BZ6H 4K8YA 4GCHG 1AI8H 4K1EA 4CRGA 1SHYA 2P16A 3A84A 3M7TA 2ZC9H 3ZZCA 3I78A 1P8VC 1RJXB 4UD9H 1DOJA 4B73A 1S5SA 1ZGVA 3TJVA 4Y8XA 1OP2A 2OQ5A 2PSXA 4A1TA 3BTTE 6CHAB 1P02A 2VH0A 2Y82A 2QCYA 1G9IE 4CRAA 3MOCA 3GICB 2AMQA 3C1KA 1ZR0A 4WWYA 1OWJA 1ANEA 5EXLA 3M5OA 3SU1A 3SU2A 3RXBA 3P92A 1O37A 5JB8S 1SGYE 3FZZA 3SNAA 1YPJH 3A7TA 1D6WA 1U6QA 4JK5A 4I8GA 1AUTC 5E0HA 3K6YA 3MNCA 2XC0A 1KDQB 2WYJA 1E36B 3H7OA 4WMEA 5EG4A 1UVTH 4U30A 1E38B 1N1LA 1QRZA 3LOXA 1IQKA 2A2QH 1UTPA 2A0QB 1FDPA 2BOKA 2R0KA 1AFEH 1DVAH 3AAUA 3VB6A 1ARBA 4JZIA 4X8SH 3MI4A 2TPIZ 5EQRA 1LPKB 4CRDA 1QBOA 1OP0A 3UOUA 1A5GH 4I33A 4TWWA 1C2GA 1V2LT 3STIA 1GMHG 1QBNA 1THSH 1L1JA 5ESTE 1QJ1B 2CF8H 3MU8A 5C20A 5C1YA 1HCGA 4ABBA 3OU0A 1ZHMA 1BUIA 1NESE 2XNIA 3E3TA 1FN6A 1PYTD 1O31A 2NU2E 3A7VA 1YF4A 2FWWA 1V2JT 3MO9A 1C5MD 1JWTA 2OBQA 1UMAH 3UPEA 1S6HA 4FVDA 3ZVEA 3TLOA 3F1SB 2OD3B 1G2LA 3MU0A 3BTHE 2NU4E 1F5KU 1EATA 3S9AA 2J38A 2QF3A 3F9FA 1C4Y2 1G3BA 1HXFH 4B2AA 4NWLA 4WXIA 3VXEH 1C1MA 1TA2A 5EGMA 1MMJN 1GBMA 1V2KT 3U98H 1VITF 1KIGH 1ZJKA 4JYVH 4BAQB 1TB6H 3A85A 1EJMA 2QXHA 1LTOA 1HAGE 1HRTH 2BX3A 1Y5UT 3TH2H 3RXRA 2AFQB 1AU8A 1DM4B 4BAKB 4AFSA 4MPVA 2G81E 1OYTH 1Z1IA 3A7WA 4UONA 3OX7U 4FUFA 2VWNA 5JBBS 3BTME 2DE8A 1C5RA 1X7AC 1UJ1A 2WPHS 2BVRH 1AWHB 4U01A 3F9HA 1BMLA 2A4GA 1W10U 3EA8A 2BD8A 2BMGB 4GLYA 1CVWH 2SGDE 2XBVA 1O2SA 3RXOA 2WINI 3I29A 3ZVBA 5CE1A 1YPEH 3SUGA 3UOPA 4YOGA 1JRSA 5L30H 3BG8A 3QWCH 2ZFRH 1UTJA 1HFDA 2EEKA 4IW4E 1VCPA 4AORA 1ZRKA 3RXGA 1BTYA 2XWAA 2ZGBH 3VGCC 1F5RA 2PW8H 1FNIA 2XCNA 1D3PB 3GISB 1A0HB 1O5CB 3M3SA 1K28D 5LGOA 2OP9A 1O3JA 4NA9H 3MNXA 2FOAA 2PKAA 3MTYA 1O3DA 4LXBH 4X6OA 3OSYA 3SV8A 5GDSH 1TGSZ 3GY8A 1EZSC 3SHCH 2BDHA 3QTVH 4H42U 4MVNA 1FAXA 1O3BA 1T7CA 4I8HA 1DXPA 1C2J