1NPMA

Neuropsin, a serine protease expressed in the limbic system of mouse brain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
225
structure length
223
Chain Sequence
ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROPSIN
publication title Crystal structure of neuropsin, a hippocampal protease involved in kindling epileptogenesis.
pubmed doi rcsb
source organism Mus musculus
molecule tags Serine proteinase
total genus 51
structure length 223
sequence length 225
chains with identical sequence B
ec nomenclature ec 3.4.21.118: Kallikrein 8.
pdb deposition date 1998-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1npmA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1npmA02
1DDJA 3NUMA 5DO4H 4ZXYH 1C2MA 1A61H 1J16A 3RXQA 1Z6JH 1NTPA 3EYDA 2J2UA 1UK2A 1FJSA 2Z9JA 2GVFA 5EOKA 1CA0C 4Y8XA 4IN1A 4FUJA 1O2KA 1MTVA 1C1VH 1V2WT 5HM2A 2ZEBA 1TFXA 3TJVA 4UDWH 3M5NA 1K1MA 4JZEH 3D65E 1BMAA 1HIAA 2ZDKA 1AB9B 1O2VA 1P8VC 2FWWA 1GWAA 5C1UA 2UWOA 5DK1A 2B9LA 4NSVA 1HXFH 1SGQE 1YCPK 2XC0A 6GCHF 1C4V2 2F9NA 4BAQB 2JETB 4KELA 3SOSA 2OLGA 4X6OA 3LDXH 3HK3B 2BDHA 1PFXC 1BT7A 1HJ8A 3DT0H 2Q6FA 4SGBE 2W3IA 5DPAA 4K2YA 1MTNC 3MNBA 1O2RA 4I32A 2FLRH 1HAIH 1IAUA 4TPIZ 4X1SU 3LGYA 1S0QA 3OYPA 2BD9A 2UWLA 2WPKS 1OWEA 1P2KA 1UVUH 1KLTA 1ZTKA 4OS4A 1TRMA 1TYNA 2B0FA 3RXUA 2V3HH 2VIDA 1XUHA 3GY5A 4BNRA 2G5NA 1MH0A 1QCPA 3G01A 1FAXA 3Q3XA 3MU5A 5F8ZA 3FP6E 4NA9H 3ZZCA 1E37B 3FANA 3U9AH 1TONA 1OS8A 2UUKB 1F5LA 2OXSA 4ABJA 1GBHA 1EAUA 5LPRA 3LGVA 2W7UA 1YKTA 3PMAB 5HYOA 1GPZA 3E1XB 1NN6A 1ELCA 3OSYA 1LHCH 3HGNA 1GDUA 2QIQA 2QN5T 1C5WB 1G2MA 1L1JA 1CGIE 2ZFFH 2BDIA 3EA7A 1H4WA 1MTNB 2PTNA 2H2ZA 1IQLA 3AAVA 4NWKA 3SGAE 3M7TA 1S6FA 1MAYA 1DS2E 3PLKA 1INCA 4K8YA 1GCTC 1O2JA 3Q3YA 1BHXB 4HGCA 1KSNA 1HDTH 1NROH 1TQ7B 3TGIE 1IQHA 1EZSC 1NU9A 2A4QA 2QXJA 2FYQA 2Z9IA 1ZMLA 5A0CA 3LGWA 1GBTA 2RG3A 1KXAA 3K65B 3T62A 1MU8B 2Z9LA 1BZXE 1S81A 1Z71A 2ULLA 4X1NU 2QF0A 2ZTZA 2P8OB 5G4BA 2A2XH 1RIWC 2ZDVH 3PYHA 2EEKA 5LPEA 3SU6A 1ACBE 1TNLA 2D26C 4ABHA 2Y7XA 1BUIA 2Z94A 5DP9A 2HALA 3ITIA 4ISLA 4BAKB 2P16A 1Z8JB 2ZHFH 4B2AA 4SGAE 3RXSA 2IN2A 1C5NH 1GHAF 3A87A 4FUIA 2PUQH 3OTJE 3RXMA 2ANYA 3MMGA 4JZDH 5EGMA 3U98H 1AFEH 1OSSA 1ELBA 3P70B 2O9QA 4IC5A 4Q2KA 3TH4H 1F5KU 3BTWE 2ZGBH 3O8BA 2A7HA 1Y3WA 1PQAA 3SJ9A 1ZGIA 1T4VH 1BRCE 2A31A 4A5TS 5FPSA 3EE0B 3UNQA 4RN6A 3PV4A 4ABEA 1BHXF 1WTHD 1EZXC 3QGJA 1SMFE 3A86A 4X0WU 4Y8YA 1P3CA 1UVOA 5DP5A 1EJNA 1FY3A 4AGKA 3UREA 2ODPA 1AD8H 1WQSA 2XW9A 2XC5A 2BX3A 4Y76A 3SQHE 4CHAC 1G3EA 2J94A 5ETXA 1P9SA 4I31A 1GI8B 4AYVB 1JRTA 1GVZA 2ZPQA 2PUXB 5ESBA 2ZZUH 5A0BA 1C2EA 3GY6A 1LHDH 3R0FA 3RM2H 1T7CA 3MNCA 3RU4D 1H8DH 1LVOA 4J1YA 2FEQH 1AWHB 1GBEA 1ABJH 3P6ZB 2FX6A 2PSXA 1V2LT 2IPHA 1O36A 1TE0A 4LZ1H 2O8TA 2NU4E 2G51A 6LPRA 1THPB 1TBZH 1IQIA 1LDTT 1YPHC 4CRBA 1DVAH 2Y80A 5GIBA 2FS8A 1O3KA 1FDPA 1TOCB 3M35A 1O37A 1HYLA 3KQDA 3DUXH 2BD4A 1BTHH 3TNTA 1TA6A 4DOQA 3LPRA 1GJDB 2BDYA 5F6MA 2AMQA 1C9TA 1EX3A 1DUAA 3A88A 1GBIA 1HJ9A 1GI2A 1OPHB 4X2XA 2ZWLH 5E8EH 2A7JA 2WUBA 2XNIA 3ZVAA 1ZPZA 3UWIA 2GV7A 1HAGE 2BD8A 3T27A 1YLDA 4WMDA 3ZVCA 1A4WH 1U6QA 1UTLM 4JZFH 1E35B 2Q6DA 2HVXA 1O2YA 1V2NT 1CU1A 1ZYOA 1SGNE 1SG8B 3OX7U 1TAWA 4KGAA 1W7GH 2ZU4A 5TJXA 2G4TA 1C5SA 3SJIA 1HIAB 1D3PB 3MU0A 2LPRA 1O2SA 3A8CA 3L33A 1VJAU 4BAOB 1TMBH 3U8OH 3TK9A 2BD7A 1AVGH 3OU0A 2ODYB 2A4RA 3UQOA 1ANCA 1O3GA 3RXOA 1Q3XA 2W3KA 3KNXA 4E06H 1XUKA 1IHSH 1ESAA 3Q3KA 1NRPH 1G36A 1GI1A 4GHTA 1BB0B 1K9OE 1L4ZA 1NRSH 1V2QT 3PO1C 2I6QA 1K1IA 2AMDA 3A7VA 1TX7A 2D8WA 3SU2A 1SGFG 1TOMH 4H4FA 1WUNH 3VXFH 2BQWB 1SGDE 3E90B 3NWUA 4M7GA 1O3BA 1QRWA 1YPHE 3P92A 5HXFA 1K1OA 3LGTA 1EPTC 1JBUH 1QNJA 3LC5A 1T8OA 1TRYA 5AVDA 4ISNA 2YOLA 1UK4A 5J4SA 2R0LA 1O33A 1BBRH 3RXRA 5CE1A 2FXRA 2GT7A 1TRNA 2K1QA 4XE4A 3JZ1B 3ZZDA 1K1NA 3GYMA 3F6UH 1D3QB 1FMGA 1P06A 1QGFA 1C1WH 2O8WA 2AIQA 3PTNA 2VWOA 4KKDA 6CHAB 3KCGH 2W5EA 1QL8A 1KDQA 1TMUH 2J4IA 3V13A 1AU8A 1EUFA 2Z3DA 3SV6A 3ODDA 1O32A 1QTFA 1ZSJA 1GBCA 1SFQB 1TLDA 2ZFQH 1ESTA 4MG3A 2H9HA 1TNGA 1SGCA 1NPMA 1PQ5A 1S85A 2ZDAH 1C2KA 1SLUB 1RRKA 5JBTA 4BAMB 3QZQA 1SQAA 4CBOA 3NPSA 4OS2A 2VVUA 1J8AA 1LVBA 1ZJDA 1FN6A 2Y82A 2FO9A 3BEFB 2Y81A 1C5UA 4IBLH 3Q76A 1SSXA 3MU4A 3EAJA 4A7IB 2Y7ZA 4B2BA 2WUCA 1P04A 3MO3A 1GBFA 2C8XB 1XXDA 2YNAA 2ZGJA 1S84A 1VCQA 1MTSA 5DP3A 1ESBA 3M3TA 1QB9A 4MNWA 1GMCF 1YLCA 1C9PA 3F9FA 5JDUB 1QURH 4NA7A 5K7RA 3ZZ7A 2C93B 3W95A 1CT4E 1NESE 3SV8A 2P93A 2SFAA 1V2RT 2H5DA 3TPIZ 4RKOB 3PLPA 1EASA 3BEIB 3ZZ6A 4ZHLU 1KIGH 3TU7H 1A5HA 2P95A 3K2UA 3LKWA 4JYUH 1GHXH 1TQ0B 5ABWA 3SHAH 1VITH 3P8FA 2SGEE 1THRH 1ZHPA 4FU9A 4X8UH 1GJ5H 1O2OA 4BTTB 2BB4A 4RSPA 3ZZ8A 1LHGH 2BLOA 1MZDA 1DICA 1O3HA 1TNJA 1XMNB 3M37A 3GY7A 2OC1A 2FOHA 4D9QA 1C5VA 1SHYA 3DFLA 1C5LH 1G3CA 1D3TB 1O5GH 4FUFA 3SO3A 3SJ8A 1GG6C 1P01A 2BY8X 1MTWA 3MH4A 4WWYA 4B71A 1SGPE 3A81A 1P57B 1WQVH 2FI5E 3MFJA 4Y8ZA 1FY5A 2QCYA 3SUFA 3S0NA 1B7XB 1EP5A 1VCWA 2VWMA 3UR6A 1Z1JA 1Y5AT 2ZHWH 2LNCA 4YLQH 2FOGA 5ESTE 3SU0A 4Y71A 1ZR0A 1C2JA 3UPEA 1ZTJA 3TJNA 1H9LB 3LIWA 3SUEA 2EI8A 2ZG0H 3SGQE 4UONA 4CH2B 3CENA 2R9PA 3QLPH 1C2LA 1IQKA 2PR3A 4Y0ZE 2KAIA 1J15A 1ID5H 3SV2H 2OD3B 4R8TB 1TPPA 1WV7H 4ZKOU 1LQEA 5T6GA 4A1XA 1ZPBA 1GL0E 1EATA 2R2MB 2NU0E 5F03A 1L0ZA 1O2TA 4LK4A 3SW2B 3UTUH 7GCHG 1O35A 1Q31A 4ABGA 3I29A 2PFEA 1P2NA 2NWNA 4UD9H 2BHGA 3SU4A 1V2PT 3A82A 1PPZA 3MHWU 3RC5A 2XBWA 4AYYB 3SV9A 1DANH 2YNBA 3L6PA 4ZXXH 1GVKB 5CHAC 3CS0A 1QHRB 3KN2A 3MO9A 4FVDA 4AN7A 3TNSA 1KXBA 1O31A 1NS3A 1TB6H 1FXYA 1O5DH 1EOLA 1Y3UA 3KQBA 2JH5D 1G3DA 1HAPH 3U1JB 1NRRH 5TCAA 3TH3H 1HAVA 1O3OA 1P12E 1FZZA 1MCVA 2XWAA 1GBJA 1CGHA 1AI8H 3DFJA 1OWJA 3A89A 1O5CB 1AN1E 5JB8S 3SBKA 1H1BA 1TPAE 5L2YH 4K1TA 1C4U2 3K6YA 5E0JA 3TK6A 1BTXA 3I78A 3E91A 2RA0A 3MNSA 3TH2H 4Y0YE 5DKMA 4BXWA 2ZF0H 2TGAA 1IOEA 2V3OH 3SNBA 3CP7A 4XDEA 5EU8A 1T8NA 2R3YA 1V2UT 3T26A 4AORA 1UVSH 1EP6A 1CHOG 3BTEE 2AGEX 3ZVEA 1MBQA 1W10U 2J34A 3ZYDA 2P94A 1QQUA 5T6FA 1AKSA 4DGJA 1QA7A 2GDDA 2QC2A 3M3SA 4WMEA 1B0EA 2OC7A 4JZIA 3MYWA 1TPOA 1KDQB 4DJZB 2C8YB 4YOIA 1CA0B 1PPCE 3B8JA 4GSOA 1EB2A 1LQDB 5GJ4B 3HKIB 5JPMH 4Y6DA 4AFZA 4BXSA 1LHFH 1AFQC 1TBQH 3LH3A 3F9HA 1EXFA 1FIWA 4B2CA 3SI3H 3V12A 1AQ7A 1V2JT 2BDBA 2ZP0H 4ZMAH 2BTCE 1HAXB 5DGJA 3P95A 1UVTH 3S7KB 1DM4B 1SLVB 1TGBA 1HJAC 1O2MA 1BBRK 1RXPA 2BM2A 3KGPA 1LHEH 5CMXH 2ZFSA 2C4FH 2ASUB 3GDSA 2Q6GA 2IOTA 2TGTA 4Z0KA 1NFXA 1Y3VA 2NU1E 2BOKA 2BYAX 1UJ1A 2SGAA 2WYGA 2WPJS 3LT3A 5BRRE 4OGXA 2XCFA 4OS7A 2OUAA 2ZTXA 3MI4A 3UOPA 1GL1A 1C2FA 2A5AA 3K9XB 1MMJN 2XBXA 5DJ7A 1O2GH 1ORFA 3SU3A 2D2DA 1GMHG 4WH6A 2GT8A 4GCHG 1Y5BT 4YO9A 1C1UH 3TGKE 3RMOH 4Q7XA 3UNRA 1YPEH 3KQCA 2A1DB 3BTTE 3ZVFA 1BMNH 4BTIB 1GI7B 2H6MA 3MU1A 3RXEA 2A7CA 4ZUHA 2BDAA 1DWEH 2W26A 4X1QU 1EPTA 3E3TA 4CRFA 1NRNH 2CGAA 1SI5H 1CBWC 2W7SA 1GGDC 5C1XA 1O3NA 1V6DA 3SUGA 2ZHEH 2BZAA 1A0LA 1BRUP 1QFKH 4DW2U 1D4PB 3E0NB 1P09A 4IMQA 2HWLB 3SI4H 2O8MA 1C1PA 2G8TA 4YTAA 5E0HA 4NA8A 4GHQA 3FP7E 8GCHG 1SR5C 2ZCHP 4ZKSU 1JWTA 1GJCB 1ZHRA 3CS7A 1KYNA 1QBNA 1P2OA 4O3TA 4E7RG 5GDSH 2ZFTA 4YT6H 2CJIA 1GBBA 1TIOA 1LPGB 3STJA 2RA3A 1HAZB 3A80A 5A8YA 3UIRA 1GJ7B 1Y5UT 1GCTB 3IG6B 2C8ZB 1GJAB 5GCHF 2XC4A 2XYAA 1YPMH 3FVFB 3RXPA 2TIOA 2ESTE 1O2IA 1FY8E 4B74A 1XKBC 1PJPA 2ZGCA 1CBWB 3MH6A 4FUCA 1O3MA 2R3UA 3H5CB 1O3EA 2Z9KA 3RXVA 1NRQH 1O5EH 2Z7FE 1O2PA 2VU8E 3PWCA 1NU7B 4B73A 1C5MD 5HMAA 5L6NH 3E6PH 1QB1A 5L30H 1RIWB 1BQYA 1QBOA 4H42U 2UUJB 2VIOA 1FY4A 1HCGA 3KF2A 1ETSH 3UOUA 1W0YH 2FOEA 1GDNA 1LKBA 1QBVH 1X7AC 1MKXH 1T31A 4UFGH 1V2ST 4JZ1A 2CHAC 4NIWA 2GZ8A 1EAIA 1DLKB 4CRGA 2DE9A 3PLBA 2BXUH 2BLWA 3FAOA 3M7UA 2KAIB 1GHBF 1NFUA 5C5NA 1UK3A 2VJ1A 3RM0H 1K2I1 1A0HB 5AHGH 4E7NA 1N8OC 2FESH 1AZ8A 1HAOH 1O3IA 1UCYE 1SL3A 1P05A 1IHTH 1N1LA 2ZCKP 3U8RH 3B23B 4CRCA 4AX9H 1PQ7A 4ABBA 4XBBA 2BLVA 2G4UA 4VGCC 4TWWA 1LVYA 3URCA 2CHAB 3ZZ3A 2F91A 3RMNH 3KL6A 4CHAB 1CHGA 1C2DA 1K21H 2ZDNA 1A1RA 3VPKA 3PMHB 1G3BA 3U8TH 4XSKU 3VGCC 2OQ5A 3URDA 1W2KH 1LPKB 2FOMB 2HPPH 1O34A 4OS5A 5EQRA 2F9OA 1A46H 2FI4E 1ANEA 3MU8A 4U01A 1HAVB 2O8UA 5EXMA 4D7FA 1EQ9A 4NGAH 3E8LA 1PYTD 5A09A 1TX6A 3AAUA 1WU1A 1YF4A 3EDXB 1PPEE 3TJUA 2GX4A 3SN8A 3UY9A 2F83A 2GCTC 1MU6B 3SU1A 3ELAH 4LXBH 2AGIX 1ARCA 1C1RA 3ATWA 4K8BA 2GMTC 3RXLA 1JMOH 1DITH 4BANB 3JZ2B 3UQVA 3W94A 4QT8C 6GCHG 1OWDA 5A8ZA 2BOHB 4NWLA 4X6NA 3GY4A 1QR3E 3VGCB 1C2GA 3RXHA 1TGTA 1SQOA 3A8DA 1S82A 1BJVA 4ZAEA 4K5ZA 1CGJE 2QGRA 1AKSB 4NZLA 3VB7A 5LH8A 1OWHA 3O8CA 3K6ZA 2FYRA 1ZLRA 2C3SA 1RS0A 3BIUH 1A3BH 3RU4E 2CXVA 4X2WA 1C4Y2 2PGBB 1UTKA 3A7YA 5AF9H 4CRAA 1C5QA 1C5PA 4Y79A 3DHKH 3M36A 3PTBA 1GCDA 4LZ4B 1BTZA 3SORA 1FV9A 1ELTA 1PQ8A 4HTCH 2HGTH 4X8SH 4TYDA 5FAHA 5EQSA 1SGFA 2QY0B 5TCCA 5DG6A 1TPSA 4NFEA 1DSTA 1L2EA 1QB6A 3GCTF 3I77A 5EXLA 2HRVA 2G52A 5I25A 4WF8A 2XRCA 2BDCA 1F7ZA 3GYLB 2TRMA 3GY3A 3UFAA 3ATMA 4I8KA 1N6XA 1DXPA 1ANDA 2PW8H 5IYTA 1O2XA 1DE7H 4UE7H 1OX1A 3QDZB 3UUZA 1AHTH 2P3FH 2BY7X 2VVCA 5EQQA 1OYQA 3U69H 1OWIA 1DWBH 2A4OA 3PO1B 3OY5U 3KHVA 1NC6A 1GJ4H 1AUJA 1FN8A 1XXFA 4JYTA 1V2TT 1OP2A 1AUTC 2A5KA 3M5MA 1BTWA 5EODA 1S0RA 1MKWH 4BOHA 1DOJA 4CR9A 1P02A 3PROA 1GHWH 2F9BH 1EPTB 1BJUA 1TNIA 3SGBE 3LOXA 2CMYA 2QF3A 3PM3A 2BXTH 4X6MA 1UTNA 3C1KA 5FBEA 3ZVGA 4CREA 2HLCA 3P8GA 4MPWA 1C5ZB 2HPQH 3GY2A 5I46H 1GJ8B 2PKAA 4D9RA 1TNHA 2GD4B 2WPLS 4D76A 1AWFH 1D6RA 2FOCA 5JYIA 3GCHC 3LC3A 1FUJA 2ZFPH 3LONA 5J4QA 1TNKA 2J92A 3AW0A 2GP9B 5FPYA 1GHAG 2A32A 2C90B 2A5IA 2VIVA 1CT2E 2PWXA 1TBRH 4FU8A 1QJ7B 2WV4A 1XUIA 5PTPA 1HB0B 3GCOA 1VGCC 1KXFA 2P59A 3QUMP 4X1RU 1K1PA 4ABIA 3PB1E 3GCNA 4Q7YA 5IDKA 1C2HA 2QA9E 4NSYA 4NG9H 1BTPA 2P3TB 3RMLH 4KTUA 2A45B 3T25A 1FAKH 4IW4E 1ETTH 2FS9A 3F9GA 2AIPA 4ZROA 1Y8TA 2FTMA 1ELFA 1GVLA 1L1NA 4X8TH 4PROA 1S6HA 1NM6A 2ZU5A 1LTOA 2GCHF 4MPXA 3FFGA 1BRAA 2GZ7A 1AVXA 3C27B 1MAXA 2PKSC 3GCHB 3NKKA 1J9CH 1ZRBA 1C2IA 3GY8A 1XX9A 1E36B 4YT7H 1Y59T 7LPRA 1MD7A 2AEIH 1J17T 1Z1IA 3SZNA 4F4OC 2ALPA 5FX6A 3T5FH 3GISB 1CVWH 2XXLA 4U2WA 3BG4C 3LGUA 1ZSKA 1CQQA 3PWBA 1A7SA 1F92A 1UMAH 1FY1A 2VB0A 1QRZA 3BIVH 3BTDE 4OS6A 1IQGA 5EPYA 3RXGA 4CR5A 1EZUC 4WJG2 3MOCA 3V7TA 2QXIA 4FUEA 1ELDE 2HNTE 3ZVDA 2WPMS 1HAYB 1FPHH 1LVMA 1O2HA 2V0BA 1BDAA 1HBTH 1UTJA 1P2IA 1OXGA 1VITF 2ZPRA 4JK6A 3UR9A 1ZPCA 1ZGVA 1O39A 1WSSH 5H4IB 5C67A 2Z9GA 2FPZA 2FLBH 1C1QA 3N7OA 1EZQA 9ESTA 2VNTA 1MKXK 2C8WB 1ELVA 1RTFB 1HAHH 1P2QA 1SGYE 2ZHDA 4A6LA 4AB9A 3QK1A 4KP0A 3D49H 4MVNA 1SOTA 1TABE 1CO7E 4HFPB 1GBLA 4NZQA 5HM9A 4B1TA 2F9UA 2TBSA 2WPHS 2RDLA 1ZHMA 2BQ6B 2XBYA 5BPEA 3TK5A 1JIRA 1OYTH 2FM2A 1YPGH 4WXIA 1DWCH 1GI5A 1UCYK 3SJKA 5GPIB 1UTMA 2ZCLP 4ABFA 2WYJA 3RXKA 1C5XB 3QX5H 1DWDH 1MBMA 4WMFA 1GG6B 1AIXH 1HPGA 2R0KA 1C1OA 1NFWA 1O5AB 3MO6A 2GDEH 2VGCC 1XUFA 4YOJA 2ZPSA 1TA2A 4GAWA 2GZ9A 1BRBE 3S69A 1ELEE 4YZUA 2Z3CA 9LPRA 1YCPM 2JH6D 2QYIA 1T8MA 5E2PA 1Z7KA 3RLYH 1OOKB 1G37A 1SHHB 1ZMNA 1M9UA 2AYWA 1GMDF 3P17H 2BD2A 2RCEA 3ENSB 3QWCH 4GVUA 3MNXA 2UWPA 1O2ZA 1GI9B 2ZC9H 1PPHE 3ZVBA 5FXLA 1NO9H 1P03A 1O38A 1CSOE 3FZZA 5C5OA 3STIA 1BOQA 1O2UA 5GXPA 1A2CH 1GBDA 5DP7A 2ZIQH 4ABDA 3UNSA 1SFIA 1P0SH 1AB9C 2Y5HA 1FI8A 2VVVA 4GLYA 3E16B 4U30A 1GI4A 3GCTG 2Q1JA 3F9EA 1IQEA 2FI3E 1GJ6A 1A0JA 2JETC 1C1NA 3HATH 4Y7BA 4IMZA 1C5OH 1SVPA 2VIQA 3VEQB 2OINA 4F49A 1WYKA 2FOAA 5F8TA 2ZQ2A 3TVJB 1JXPA 5CHAB 5T6DA 1UTPA 1C1SA 3RXAA 1BMLA 2F9PA 2SGDE 1LCYA 5JBCS 2TGPZ 3ZZ5A 1WAYB 3TLOA 8ESTE 4A92A 4THNH 1UTQA 1Z8IB 2DUCA 3ZV9A 2ZU1A 1YP9A 2NU2E 5DP8A 1ZSLA 3ATLA 1ELGA 4NIXA 1QQ4A 3PMBB 1EJMA 5LPFA 5SGAE 3M5LA 5GWZA 4I8HA 1G30B 1JRSA 1V2KT 1O2QA 5EW1H 4K1EA 1VJ9U 1SGEE 4RKJB 1AMHA 3WY8A 3O8RA 4TY7A 2H5CA 3GOVB 2BVRH 2ZGXH 2V6NA 1DX5M 4XBDA 4HZHA 3RXJA 1IQMA 1RTLA 1C1TA 1O3JA 3VB4A 3BN9A 1GBKA 4MQAA 3SV7A 1F5RA 1GBAA 2PKAB 4FUDA 1WCZA 5LGOA 2Y5GA 2STBE 4K60A 1VCPA 2WINI 2OC0A 2G81E 2P3UB 4A1VA 4B75A 2BZ6H 5FPTA 1B5GH 1W0ZU 3BTKE 1SB1H 2XWBI 1MKWK 5E2OA 1B0FA 1AFQB 7ESTE 3TIUA 1E38B 1DPOA 4H6SB 3RP2A 2CF9H 2FIRH 4KTSA 1UVPA 2PV9B 4YM9A 1WTGH 3GDVA 3SUDA 1PPGE 4I8GA 3E0PB 3TITA 4MTBA 1GMCG 1Q2WA 4TY6A 2ZI2H 4BAHB 2P8OC 1YBWA 1L1GA 1KLIH 2Z3EA 1HJAB 5JBBS 3VB6A 2GCHG 1FONA 2PGQB 3OY6U 4E05H 2GV6A 1SBWA 2TPIZ 4CH8B 1DLEA 4WH8A 1DUEA 1TX8A 4INLA 1NFYA 3VB5A 1LMWB 4AFUA 3KIDU 1GI6A 3RC6A 2J38A 1Z6EA 1PPBH 1W11U 2UUFB 4Q80A 4UFDH 4CBNA 2STAE 2ZDMA 1G9IE 4D7GA 2ANKH 3D23A 3SNAA 1K28D 2FDAA 1C5TA 3BG8A 3SNEA 1UHBA 3F1SB 2ZKSA 2OCVB 4FUGA 4O3UA 1XUJA 2FTLE 2CF8H 4B76A 1OKXA 4CRDA 2B7DH 1YYY1 1AZZA 3TGJE 5A2MH 2VWLA 2ODQA 2GTBA 3ODFA 1HUTH 1T4UH 1VITG 4NIYA 5C20A 1GBMA 3A84A 3BEUA 4IN2A 4O03A 1JOUB 1D9IA 1GGDB 3L3TA 3FZDA 3NXPA 1XUGA 1Y3YA 1O5FH 3V3MA 4ESTE 4AZ2B 4OS1A 1O3AA 2BX4A 3LH1A 1SLXB 2Y6TA 1DY9A 1T8LA 4DCDA 1SOZA 4XFQA 1ETRH 4DURA 2ILNA 3IWMA 3RMMH 1KXCA 4JK5A 1OWKA 4JCNA 1H8IH 1ZOMA 1H9HE 1IQJA 1CA8B 5C2ZA 3VB3A 4AG1A 2PTCE 1IQNA 1HGTH 5B6OA 2AH4X 2GGVB 2BD3A 3ZZBA 4ASHA 3P8OA 3VFEA 3O8DA 4DG4A 4JYVH 3A83A 1O30A 5EPNA 1V2VT 5K0HA 2OQUA 1E34B 2ZDLA 3RUOA 3R3GB 5DP6A 2FX4A 1UCYH 2A0QB 3SJOA 2PHBA 4AGJA 3P8NA 4R0IA 2WPIS 1HV7A 1SQTA 5A8XA 1SGTA 5AFZH 1WOFA 1ZTLA 1BTUA 1W7XH 4ZH8A 2H1UA 1O3DA 3QN7A 3QTVH 2BQ7B 3AW1A 1GMDG 3NZIA 3RXFA 1V2MT 4K69A 7KMEH 4D8NA 4INKA 3H7TA 2G5VA 4Y7AA 4MNYA 4INHA 1FPCH 1GHVH 1GHYH 3LGIA 3T28A 2GKVE 1SPJA 1PYTC 2EC9H 3AVZA 3RDZA 3SNDA 3RC4A 1N8OB 8LPRA 1W13U 4X2YA 2D1JA 4X6PA 3MWIU 2SNVA 1P2JA 2XCNA 4ZHMU 1HXEH 3VXEH 1ZMJA 2AERH 3D62A 4GUXA 1DFPA 3DA9B 1D3DB 4NCYA 3A8BA 1RD3B 4FUBA 4DIIH 2ZQ1A 3A7WA 3BF6H 1G2LA 3F68H 1TWXB 3EA9A 1MTUA 2CV3A 4VGCB 3ESTA 1BMMH 1QA0A 1UTOA 3EQ0H 4MDSA 1LPZB 1GJBB 3TJOA 2EA3A 1O3LA 2I6SA 1RTKA 1VZQH 3MH7A 4GPGA 3T2NA 3BV9B 3V0XA 1BTYA 1W3CA 3GDUA 1C1MA 1QIXB 1XM1A 2UUYA 3QZRA 1GHZA 1K22H 1A3EH 3HPTB 1DY8A 1FLEE 8KME2 2SGFE 2BVSH 3PMJA 5DP4A 3SU5A 2H9EH 3ZZ9A 1QY6A 4FUHA 7GCHF 1FQ3A 2GCTB 3A7TA 2THFB 1W12U 3M3VA 1O3CA 5EXNA 4FXGH 5F8XA 1QL9A 1KXDA 2GMTB 1ELAA 1YCPH 4KTCA 4WY3A 2QXGA 5AFYH 1KTSB 3SQEE 1F0RA 1O2NA 1IQFA 3HGPA 2PSYA 2TGDA 4YESB 1W14U 1ZJKA 1O2LA 6CHAC 2FMJA 1F0SA 1XKAC 1CT0E 4AB8A 2ZGHA 2B5TB 2CN0H 2VH0A 5A0AE 3A85A 1A5IA 1QJ1B 1P3EA 2VH6A 4DVAU 2VIWA 4U32A 1OP8A 4UEHH 4UFFH 3LJOA 2FOBA 1AE8H 1P11E 3A7ZA 2BLQA 4ISOA 4IS5A 1HNEE 4I8JA 1YPJH 3RLWH 3HK6B 4ZKRU 2BY6X 3B9FH 4I33A 1FIZA 2ZECA 4NIVA 1BBRE 4MLFB 1V2OT 2QXHA 3U1IB 4X8VH 1O5BB 5C1YA 4Y10E 2ANMH 4UFEH 3SNCA 2HNTC 2EI6A 3T29A 2ZFRH 1K1JA 1CHOF 2VIPA 4ISHH 4ISIH 1J14A 1ARBA 2ZO3H 3KQEA 3A7XA 4NFFA 2JKHA 2BY9X 2SGQE 2V35A 1MCTA 1EAXA 1W8BH 1N6YA 2G55A 3ZZ4A 1Z8RA 2G00A 1LO6A 1YC0A 1QL7A 2A2QH 2BY5X 2Z6BD 3S9BA 1RFNA 4O9VA 4Z6AH 1KLJH 5FHTA 2OBQA 2OTVA 4JMYA 1UHBB 3ZZAA 2BD5A 2XTTB 4MNVA 5EW2H 3BSQA 3GICB 3BTME 3FP8E 3QGNB 5GCHG 1F2SE 3ATKA 4ZKNU 3NK8A 3RXTA 3MTYA 4Q7ZA 1O0DH 3M61U 1ABIH 2BDGA 1AE5A 1KY9A 2M5TA 4IGDA 2AMPA 3M7QA 1GDQA 4XBCA 5JBAS 3UWJH 2SGPE 1CE5A 3LJJA 2ZA5A 2OP9A 3Q00A 5E0GA 1HLTH 2OC8A 1F0UA 1AGJA 1MD8A 3ZYEA 1TGCA 4IC6A 1MZAA 5FCKA 3HKJB 1EB1H 1G32B 1THSH 4ZHAA 1TGNA 1YPKH 4FU7A 1RJXB 2H9TH 1ANBA 3RXIA 3Q77A 1KXEA 2BVXH 1BCUH 4Y11E 3ATIA 1EAWA 2B8OH 4YOGA 1GMHF 4WVPE 4GCHF 4MNXA 1PPFE 1P10A 1DT2A 1LKAA 2ANWA 1TGSZ 3EA8A 4DY7B 3BTHE 3EGKH 1Y3XA 1ZRKA 4YLUA 1VGCB 1GHBG 1Z8GA 4XOJA 2F9VA 2HOBA 1P2MA 3AASA 1HFDA 1A5GH 1SLWB 1EKBB 1FNIA 3ZV8A 2VWNA 1XVOA 4WXVA 2FOFA 1GJ9B 2VINA 4I8LA 1DXWA 5FX5A 3S9CA 1V3XA 4FVBA 8GCHF 1UO6A 3KEEA 3NCLA 2PKSB 2R2WU 6ESTA 2ZHQH 1BA8B 2EI7A 2DE8A 5FCRA 3A8AA 2HNTF 1EJAA 1TMTH 3M5OA 1O3PB 3BG4B 4HI3A 4A1TA 4DT7B 1QRXA 3BTFE 5L2ZH 5C3NA 2BMGB 2ALVA 5HGGA 1L4DA 4J2YB 2J9NA 3QO6A 1RGQA 3QTOH 1DSUA 4X1PU 1P9UA 1VR1H 3LU9B 2WV5A 2J95A 1NT1A 4K1SA 1D6WA 3DD2H 3RXBA 2AFQB 1NY22 1BIOA 4X2VA 3RXDA 3MH5A 2ZU2A 1XVMA 4TWYA 2QAAA 1AVWA 4AOQA 2PLXA 4ABAA 4MPVA 2AS9A 2ZNKH 1O2WA 5T3HA 1EOJA 1C5YB 3SHCH 2ZU3A 4K3JA 1O3FA 2SNWA 3H7OA 2IJOB 1WBGB 4MPUA 1AY6H 1E0FD 1TALA 1KTTB 1HRTH 4TPYA 1GI0A 1OP0A 2AGGX 3RXCA 4H6TA 1QJ6B 2F3CE 2OBOA 1NZQH 4AG2A 1JIMA 1MQ6A 1YM0A 3IITA 4LOYH 1H9IE 2FODA 3RU4T 2FZZA 3S9AA 5EG4A 4O97A 2QV1A 5FBIA 4BTUB 1S5SA 1ZZZA 1AO5A 1MUEB 1T32A 2FP7B 5JB9S 1F0TA 1YPLH 3BTQE 2O8LA 1YGCH 1SGIB 4AFSA 1MQ5A 3BTGE 1S83A 1SC8U 2ZTYA 2JH0D 1GI3A 2A4GA 4OGYA 4AFQA 1K1LA 2NU3E 2VGCB 3S7HB 4I7YH 2Y5FA 1BITA 1SGRE 2XBVA 1C5RA 4DIHH
chains in the Genus database with same CATH superfamily
1DDJA 3NUMA 5DO4H 4ZXYH 1C2MA 1A61H 1J16A 3RXQA 1Z6JH 1NTPA 3EYDA 2J2UA 1UK2A 1FJSA 2Z9JA 2GVFA 5EOKA 1CA0C 4Y8XA 4IN1A 4FUJA 1O2KA 1MTVA 4ACAA 1C1VH 2CK3D 5CDFE 1V2WT 5HM2A 2ZEBA 1TFXA 3TJVA 4UDWH 3M5NA 1K1MA 4JZEH 3D65E 1BMAA 1HIAA 2ZDKA 2J5UA 1AB9B 1O2VA 1P8VC 2FWWA 1GWAA 5C1UA 2UWOA 4Q63A 5DK1A 2B9LA 4NSVA 4FOUC 1HXFH 1SGQE 1YCPK 2XC0A 4I86A 6GCHF 1C4V2 2F9NA 4BAQB 2JETB 4KELA 3SOSA 2JJ1D 2OLGA 4X6OA 3LDXH 3HK3B 2BDHA 1PFXC 2HVYB 1BT7A 1HJ8A 3DT0H 2Q6FA 4SGBE 2W3IA 5DPAA 4K2YA 2F4LA 1MTNC 3MNBA 1O2RA 4I32A 2FLRH 1HAIH 1IAUA 4TPIZ 4X1SU 3LGYA 1S0QA 3OYPA 2BD9A 2UWLA 3PRBA 2WPKS 1OWEA 1P2KA 1UVUH 1KLTA 1ZTKA 4OS4A 1TRMA 1TYNA 2B0FA 3RXUA 2V3HH 2VIDA 1XUHA 3GY5A 4BNRA 2G5NA 1MH0A 1QCPA 3G01A 1FAXA 3Q3XA 3MU5A 5F8ZA 3FP6E 4NA9H 3ZZCA 1E37B 3FANA 3U9AH 1TONA 1OS8A 2UUKB 1F5LA 2OXSA 4ABJA 1GBHA 1EAUA 5LPRA 3LGVA 4B6FA 2W7UA 1YKTA 3PMAB 5HYOA 1GPZA 3E1XB 1NN6A 1ELCA 3OSYA 1LHCH 3HGNA 1GDUA 2J97A 2QIQA 2QN5T 1C5WB 1G2MA 1L1JA 1CGIE 2ZFFH 3DSOA 2BDIA 3EA7A 1H4WA 1MTNB 2PTNA 2H2ZA 1IQLA 3AAVA 4NWKA 3SGAE 3M7TA 1S6FA 1MAYA 1DS2E 3PLKA 1INCA 4K8YA 1GCTC 1O2JA 3Q3YA 1BHXB 4HGCA 1KSNA 1HDTH 1NROH 1TQ7B 3TGIE 5C94A 3OTPA 1IQHA 1YWUA 5KGOA 1EZSC 1NU9A 2A4QA 2QXJA 2FYQA 2Z9IA 2JIZD 1ZMLA 5A0CA 3LGWA 1GBTA 2RG3A 1KXAA 3K65B 3T62A 1MU8B 2Z9LA 3PV2A 1BZXE 1S81A 1Z71A 2ULLA 4X1NU 2QF0A 2ZTZA 2P8OB 5G4BA 2A2XH 1RIWC 2ZDVH 3PYHA 2EEKA 5T1VA 5LPEA 3SU6A 1ACBE 1TNLA 2D26C 4ABHA 2Y7XA 1BUIA 2Z94A 5DP9A 2HALA 3ITIA 4ISLA 4BAKB 2P16A 1Z8JB 2ZHFH 4B2AA 4SGAE 3RXSA 2IN2A 1C5NH 1GHAF 3A87A 4FUIA 2PUQH 3OTJE 3RXMA 2ANYA 3MMGA 4JZDH 5EGMA 3U98H 1AFEH 1OSSA 1ELBA 3P70B 2O9QA 4IC5A 4Q2KA 3TH4H 1F5KU 3BTWE 2RFKC 2ZGBH 3O8BA 2A7HA 1Y3WA 1PQAA 2V7QD 3OEHD 3SJ9A 1ZGIA 1T4VH 1BRCE 2A31A 4A5TS 5FPSA 3EE0B 3UNQA 3WWFA 4RN6A 3PV4A 4ABEA 1BHXF 3UAIC 1WTHD 1EZXC 3QGJA 1SMFE 3A86A 4X0WU 4Y8YA 1P3CA 1UVOA 5DP5A 1EJNA 1FY3A 4AGKA 3UREA 2ODPA 1AD8H 1WQSA 2XW9A 2XC5A 2BX3A 4Y76A 3SQHE 4CHAC 1G3EA 2J94A 5ETXA 1P9SA 4I31A 1GI8B 4AYVB 1JRTA 1GVZA 2ZPQA 2PUXB 5ESBA 2ZZUH 5A0BA 1C2EA 3GY6A 1LHDH 4F55A 3R0FA 3RM2H 1T7CA 3MNCA 3RU4D 1H8DH 1LVOA 4J1YA 2FEQH 1AWHB 1GBEA 1ABJH 3P6ZB 2FX6A 2PSXA 1V2LT 1SKYE 2IPHA 1O36A 1TE0A 4LZ1H 2O8TA 2NU4E 2G51A 6LPRA 1THPB 1TBZH 1IQIA 1LDTT 1YPHC 4CRBA 3FN8A 1DVAH 2Y80A 5GIBA 2FS8A 1O3KA 1FDPA 1TOCB 3M35A 1O37A 1HYLA 3KQDA 3DUXH 2BD4A 1BTHH 3TNTA 1TA6A 4DOQA 3LPRA 1GJDB 2BDYA 5F6MA 2AMQA 1C9TA 1EX3A 1DUAA 3A88A 1GBIA 1HJ9A 1GI2A 3WW7A 1OPHB 4X2XA 2ZWLH 5E8EH 2A7JA 2WUBA 2XNIA 3ZVAA 1ZPZA 3UWIA 2GV7A 1HAGE 2BD8A 3T27A 1YLDA 4WMDA 3ZVCA 1A4WH 1U6QA 1UTLM 2WV9A 4JZFH 1E35B 2Q6DA 2HVXA 1O2YA 1V2NT 1CU1A 1ZYOA 1SGNE 1SG8B 3OX7U 1TAWA 4KGAA 1W7GH 4ZCNA 2ZU4A 5TJXA 2G4TA 1C5SA 3SJIA 1HIAB 1D3PB 3MU0A 1K0HA 2LPRA 1O2SA 3A8CA 3L33A 1VJAU 4BAOB 1TMBH 3U8OH 3TK9A 2BD7A 1AVGH 3OU0A 2ODYB 2IJD1 2M2AA 2A4RA 3UQOA 1ANCA 1O3GA 3RXOA 1Q3XA 2W3KA 3KNXA 4E06H 1XUKA 1IHSH 1ESAA 3Q3KA 1NRPH 5C17A 1G36A 1GI1A 4GHTA 1BB0B 1K9OE 1L4ZA 3N99A 1NRSH 1V2QT 3PO1C 2I6QA 1K1IA 2AMDA 3A7VA 1TX7A 2D8WA 3SU2A 1SGFG 1TOMH 4H4FA 1WUNH 3VXFH 2BQWB 1SGDE 3E90B 3DSPA 3NWUA 4M7GA 3CNRA 1YPHE 1O3BA 1QRWA 3H09A 4Q4LA 3P92A 5HXFA 1K1OA 3LGTA 1EPTC 1JBUH 1QNJA 3LC5A 1T8OA 1TRYA 5AVDA 4ISNA 2YOLA 1UK4A 5J4SA 2R0LA 1O33A 1BBRH 3RXRA 5CE1A 2FXRA 2GT7A 1TRNA 2K1QA 4XE4A 3JZ1B 3ZZDA 1K1NA 3GYMA 3F6UH 1D3QB 1FMGA 1P06A 1QGFA 1C1WH 2O8WA 3OAAD 2AIQA 3PTNA 2VWOA 4KKDA 6CHAB 3KCGH 2W5EA 2YMSD 1QL8A 1KDQA 1TMUH 2J4IA 3V13A 1AU8A 1EUFA 2Z3DA 3SV6A 3ODDA 1O32A 1QTFA 1ZSJA 1GBCA 3F2FA 1SFQB 1TLDA 2ZFQH 1ESTA 4MG3A 2H9HA 1TNGA 4ACBA 1SGCA 1NPMA 2KCAA 1PQ5A 1S85A 2ZDAH 1C2KA 1SLUB 1RRKA 5JBTA 4BAMB 3QZQA 1SQAA 4CBOA 3NPSA 4OS2A 2VVUA 1J8AA 1LVBA 1ZJDA 1FN6A 2Y82A 2FO9A 3BEFB 2Y81A 1C5UA 3N7DA 4IBLH 3Q76A 2KM0A 1SSXA 3MU4A 3EAJA 4A7IB 5EJLA 2Y7ZA 4P02A 4B2BA 2HLDD 2WUCA 1P04A 3MO3A 3N7EA 1GBFA 2C8XB 1XXDA 2YNAA 2ZGJA 1S84A 2W6JD 1VCQA 1MTSA 5DP3A 4B6EA 1ESBA 3M3TA 1QB9A 4MNWA 1GMCF 1YLCA 1C9PA 3F9FA 5JDUB 4XD7D 1QURH 2LELA 4NA7A 5K7RA 3ZZ7A 2C93B 3W95A 1CT4E 1NESE 3SV8A 2P93A 2SFAA 1V2RT 2H5DA 3TPIZ 4RKOB 3PLPA 1EASA 3BEIB 3ZZ6A 4ZHLU 1KIGH 3TU7H 1A5HA 2P95A 3K2UA 3LKWA 4JYUH 1GHXH 1TQ0B 5ABWA 3SHAH 1VITH 3P8FA 2SGEE 1THRH 1ZHPA 4FU9A 4X8UH 1GJ5H 5FL7D 1O2OA 4BTTB 2BB4A 4RSPA 3ZZ8A 1LHGH 2BLOA 1MZDA 1DICA 1O3HA 1TNJA 1XMNB 3M37A 3GY7A 2OC1A 2FOHA 4D9QA 1C5VA 1SHYA 3DFLA 1C5LH 2KCYA 2JJ2D 1G3CA 1D3TB 1O5GH 4FUFA 3SO3A 3SJ8A 1GG6C 1P01A 1VKYA 2BY8X 1MTWA 3MH4A 4WWYA 4M9FA 4B71A 1SGPE 3A81A 1P57B 1WQVH 2FI5E 2WPDD 3MFJA 1FY5A 2QCYA 4Y8ZA 3SUFA 3S0NA 1B7XB 1EP5A 1VCWA 2VWMA 3UR6A 1Z1JA 1Y5AT 2ZHWH 2LNCA 4YLQH 2FOGA 5ESTE 3SU0A 4Y71A 1ZR0A 1C2JA 3UPEA 1ZTJA 3TJNA 1H9LB 3LIWA 2WZQA 3SUEA 2EI8A 2ZG0H 3SGQE 4UONA 4CH2B 3CENA 2R9PA 3QLPH 1C2LA 1IQKA 2PR3A 4Y0ZE 2KAIA 1J15A 1ID5H 3SV2H 2OD3B 4R8TB 1TPPA 1WV7H 4ZKOU 1LQEA 5T6GA 4A1XA 1ZPBA 3DCLA 1GL0E 1EATA 2R2MB 3DSGA 2NU0E 5F03A 1L0ZA 1O2TA 4LK4A 3SW2B 3UTUH 7GCHG 1SQRA 1O35A 1Q31A 4ABGA 3I29A 2PFEA 1P2NA 2NWNA 4UD9H 2BHGA 3SU4A 1V2PT 3A82A 1PPZA 3MHWU 3RC5A 2XBWA 4AYYB 3SV9A 1DANH 2YNBA 3L6PA 4ZXXH 1GVKB 5CHAC 3CS0A 1QHRB 3KN2A 3MO9A 4FVDA 4AN7A 3TNSA 1KXBA 1O31A 1NS3A 1TB6H 1FXYA 1O5DH 1Y3UA 1EOLA 1H8HD 5B6LA 3KQBA 2JH5D 1G3DA 2KX4A 1HAPH 3U1JB 1NRRH 5TCAA 3TH3H 1HAVA 1O3OA 1P12E 1FZZA 1MCVA 2XWAA 1GBJA 5EIYA 1CGHA 1AI8H 3DFJA 1OWJA 3A89A 1O5CB 2KCPA 1AN1E 5JB8S 2PP6A 3SBKA 1H1BA 1TPAE 5L2YH 4K1TA 1C4U2 3K6YA 5E0JA 3TK6A 1BTXA 3I78A 3E91A 2RA0A 3MNSA 3TH2H 4Y0YE 5DKMA 4BXWA 2ZF0H 2TGAA 1IOEA 2V3OH 3SNBA 3CP7A 2KR7A 4XDEA 1T8NA 2R3YA 5EU8A 1V2UT 3T26A 4AORA 1UVSH 1EP6A 1CHOG 3BTEE 2AGEX 3ZVEA 1MBQA 1W10U 2J34A 3ZYDA 2P94A 1QQUA 5T6FA 1AKSA 2K8IA 3F2HA 4DGJA 1QA7A 2GDDA 2QC2A 3M3SA 4WMEA 1OHHD 1B0EA 2OC7A 4JZIA 3MYWA 1TPOA 1KDQB 4DJZB 2C8YB 4YOIA 1CA0B 1PPCE 3B8JA 3FO8D 4GSOA 1EB2A 1FX0B 1LQDB 5GJ4B 3HKIB 5JPMH 4Y6DA 4AFZA 4BXSA 1LHFH 1AFQC 1TBQH 3LH3A 3F9HA 1EXFA 1FIWA 4B2CA 3SI3H 3V12A 1AQ7A 1V2JT 2BDBA 2ZP0H 4ZMAH 2BTCE 1HAXB 5DGJA 3P95A 3OEED 1UVTH 3S7KB 1DM4B 1SLVB 1TGBA 1HJAC 1O2MA 1BBRK 1RXPA 2BM2A 3KGPA 1LHEH 5CMXH 2ZFSA 2C4FH 2ASUB 3GDSA 1UW7A 2Q6GA 2IOTA 2TGTA 4Z0KA 1NFXA 1Y3VA 4TT3D 2NU1E 2BOKA 2BYAX 1UJ1A 2SGAA 2WYGA 2WPJS 3LT3A 5BRRE 4OGXA 2XCFA 4OS7A 2OUAA 2ZTXA 3MI4A 3UOPA 1GL1A 1C2FA 2A5AA 3K9XB 3U28C 1MMJN 2XBXA 3NRLA 5DJ7A 1O2GH 1ORFA 3SU3A 2D2DA 1GMHG 4WH6A 2GT8A 4GCHG 1Y5BT 4YO9A 1C1UH 3TGKE 3RMOH 4Q7XA 3UNRA 1YPEH 3KQCA 2A1DB 3BTTE 3ZVFA 1BMNH 4BTIB 1GI7B 2H6MA 3MU1A 3RXEA 2A7CA 4ZUHA 2BDAA 1DWEH 2W26A 4X1QU 1EPTA 3E3TA 4CRFA 1NRNH 4F48B 2CGAA 1SI5H 2XOKD 1CBWC 2W7SA 1GGDC 5C1XA 1O3NA 1V6DA 3SUGA 2ZHEH 2BZAA 1A0LA 1BRUP 1QFKH 4DW2U 1D4PB 3E0NB 1P09A 4IMQA 2HWLB 3SI4H 2O8MA 1C1PA 2G8TA 4P00A 4YTAA 5E0HA 4NA8A 4GHQA 3FP7E 8GCHG 2XNDD 1SR5C 2ZCHP 4ZKSU 1JWTA 1GJCB 1ZHRA 3CS7A 1KYNA 1QBNA 1P2OA 4O3TA 4E7RG 5GDSH 2ZFTA 4YT6H 2CJIA 1GBBA 1TIOA 1LPGB 3STJA 2RA3A 1HAZB 3A80A 5A8YA 3UIRA 1GJ7B 1Y5UT 1GCTB 3IG6B 2C8ZB 1GJAB 4XRNA 5GCHF 2XC4A 2XYAA 1YPMH 3SYJA 3FVFB 3RXPA 2TIOA 2ESTE 1O2IA 1FY8E 4B74A 1XKBC 1PJPA 2ZGCA 1CBWB 5C0TA 3MH6A 4FUCA 1O3MA 2R3UA 3H5CB 1O3EA 2Z9KA 3RXVA 1NRQH 1O5EH 2Z7FE 1O2PA 2VU8E 3PWCA 1NU7B 4B73A 1C5MD 5HMAA 5L6NH 3E6PH 1QB1A 5L30H 1RIWB 1BQYA 1QBOA 4H42U 2UUJB 2VIOA 1FY4A 1HCGA 3KF2A 1ETSH 4FETA 3UOUA 1W0YH 2FOEA 1GDNA 1LKBA 1QBVH 1X7AC 1MKXH 1T31A 4UFGH 1V2ST 4JZ1A 2CHAC 4NIWA 2GZ8A 1EAIA 1DLKB 4CRGA 2DE9A 4YXWD 3PLBA 2BXUH 2BLWA 3FAOA 3M7UA 2KAIB 1GHBF 1NFUA 5C5NA 2AHME 1UK3A 2VJ1A 3RM0H 1K2I1 1A0HB 5AHGH 4E7NA 1N8OC 2FESH 1AZ8A 1HAOH 1O3IA 1UCYE 1SL3A 1P05A 2L74A 1IHTH 1N1LA 2ZCKP 3U8RH 3B23B 4CRCA 4AX9H 1PQ7A 4ABBA 4XBBA 2BLVA 2G4UA 4VGCC 4TWWA 1LVYA 3URCA 2CHAB 3ZZ3A 2F91A 3RMNH 3KL6A 4CHAB 1CHGA 1C2DA 1K21H 2ZDNA 1A1RA 3VPKA 3PMHB 4HG6A 1G3BA 3U8TH 4XSKU 3VGCC 2OQ5A 3URDA 1W2KH 1LPKB 2FOMB 2HPPH 1O34A 4OS5A 5EQRA 2F9OA 1A46H 2FI4E 1ANEA 3MU8A 4AC9A 4U01A 1HAVB 1NBMD 2O8UA 5EXMA 4D7FA 1EQ9A 4NGAH 3E8LA 1PYTD 5A09A 1TX6A 3AAUA 1WU1A 1YF4A 5DSFA 3EDXB 1PPEE 3TJUA 2GX4A 3SN8A 3UY9A 2F83A 2GCTC 1MU6B 2OK5A 3ELAH 3SU1A 4LXBH 2AGIX 1ARCA 1C1RA 3ATWA 4K8BA 1QZ8A 2GMTC 3RXLA 1JMOH 1DITH 4BANB 3JZ2B 2RDEA 3W94A 3UQVA 4QT8C 6GCHG 1OWDA 5A8ZA 2BOHB 4NWLA 4X6NA 3GY4A 1QR3E 5F53A 3VGCB 1C2GA 3RXHA 1TGTA 1SQOA 3A8DA 1S82A 1BJVA 4ZAEA 4K5ZA 1CGJE 2QGRA 1AKSB 4NZLA 3VB7A 5LH8A 1OWHA 3O8CA 3K6ZA 2FYRA 1ZLRA 2C3SA 1RS0A 3BIUH 1A3BH 3RU4E 2CXVA 4X2WA 1C4Y2 2PGBB 1UTKA 3A7YA 5AF9H 4DT4A 3WWBA 4CRAA 1C5QA 1C5PA 1KMHB 4Y79A 3DHKH 3M36A 3PTBA 1GCDA 4LZ4B 1BTZA 4ASUD 3SORA 1FV9A 1ELTA 1PQ8A 4HTCH 2HGTH 4X8SH 4TYDA 5FAHA 5EQSA 1SGFA 2QY0B 5TCCA 5DG6A 1TPSA 4NFEA 1DSTA 1L2EA 1QB6A 3GCTF 3I77A 5EXLA 2HRVA 2G52A 5I25A 4WF8A 2XRCA 2BDCA 1F7ZA 3GYLB 2TRMA 3GY3A 3UFAA 3ATMA 4I8KA 1N6XA 1DXPA 1ANDA 2PW8H 5IYTA 1O2XA 1DE7H 4UE7H 1OX1A 3QDZB 3UUZA 2JDID 5CHBA 1AHTH 2P3FH 2BY7X 2VVCA 5EQQA 1OYQA 3U69H 1OWIA 1DWBH 2A4OA 1NBME 3PO1B 3OY5U 3KHVA 1NC6A 2YMSC 1GJ4H 1AUJA 1FN8A 1XXFA 4JYTA 1V2TT 5KEDA 1OP2A 1AUTC 2A5KA 3M5MA 1BTWA 5EODA 1S0RA 1MKWH 4BOHA 1DOJA 5IK2D 4CR9A 1P02A 3PROA 2VBCA 1GHWH 2F9BH 1EPTB 1BJUA 3KYFA 1TNIA 3SGBE 3LOXA 2CMYA 2QF3A 3PM3A 2BXTH 4X6MA 1UTNA 3C1KA 5FBEA 3ZVGA 4CREA 2HLCA 3P8GA 4MPWA 1C5ZB 5KECA 2HPQH 3GY2A 5I46H 1GJ8B 3OFND 2PKAA 4D9RA 1TNHA 2GD4B 2W6ID 2WPLS 4D76A 1AWFH 1D6RA 2FOCA 5JYIA 3GCHC 3LC3A 3MQKC 1FUJA 2ZFPH 3LONA 5J4QA 1TNKA 2J92A 3AW0A 2GP9B 5FPYA 1GHAG 2A32A 2C90B 2A5IA 2VIVA 1CT2E 2PWXA 1TBRH 4FU8A 1QJ7B 2WV4A 1XUIA 2GJGA 5PTPA 1HB0B 3GCOA 1VGCC 1KXFA 2P59A 3QUMP 4X1RU 1K1PA 4ABIA 3PB1E 3GCNA 4Q7YA 5IDKA 1C2HA 2QA9E 4NSYA 4NG9H 1BTPA 2P3TB 3RMLH 4KTUA 2A45B 3T25A 1FAKH 4IW4E 1ETTH 2FS9A 3F9GA 2AIPA 4ZROA 1Y8TA 2FTMA 1ELFA 1GVLA 1L1NA 4X8TH 4PROA 1S6HA 1NM6A 2ZU5A 3FKSD 1LTOA 2GCHF 4MPXA 3FFGA 1BRAA 2QF4A 1WXRA 2GZ7A 1AVXA 3C27B 1MAXA 2PKSC 3GCHB 3NKKA 1J9CH 1ZRBA 1C2IA 3GY8A 1XX9A 1E36B 4YT7H 1Y59T 7LPRA 1MD7A 2AEIH 1J17T 1Z1IA 3SZNA 4F4OC 2ALPA 5FX6A 3T5FH 3GISB 1CVWH 2XXLA 4U2WA 3BG4C 3F3BA 3LGUA 1ZSKA 1CQQA 3PWBA 1A7SA 5EJZA 1F92A 1UMAH 1FY1A 2VB0A 1QRZA 3BIVH 3BTDE 4OS6A 1IQGA 5EPYA 3RXGA 4CR5A 1EZUC 4WJG2 3MOCA 3V7TA 2QXIA 4FUEA 1ELDE 2HNTE 3FOAA 3ZVDA 2WPMS 1HAYB 1FPHH 1LVMA 1E1RD 1O2HA 2V0BA 1BDAA 1HBTH 1UTJA 1P2IA 1OXGA 1VITF 2ZPRA 4JK6A 3UR9A 1ZPCA 1ZGVA 1O39A 1WSSH 5H4IB 5C67A 2Z9GA 2FPZA 2FLBH 1C1QA 3N7OA 1EZQA 9ESTA 2VNTA 1MKXK 2C8WB 1ELVA 1RTFB 1HAHH 1P2QA 1SGYE 2KZ4A 2ZHDA 2L6OA 4A6LA 4AB9A 3QK1A 4KP0A 3D49H 4MVNA 1SOTA 1TABE 1CO7E 4HFPB 1GBLA 4NZQA 5HM9A 4B1TA 2F9UA 2TBSA 1YY3A 2WPHS 2RDLA 1ZHMA 2BQ6B 2XBYA 5BPEA 3TK5A 1JIRA 1OYTH 2FM2A 1YPGH 4WXIA 1DWCH 1GI5A 1UCYK 3SJKA 5GPIB 1UTMA 2ZCLP 4ABFA 2WYJA 3RXKA 1C5XB 3QX5H 3PRDA 1DWDH 1MBMA 4WMFA 1GG6B 1AIXH 1HPGA 2R0KA 1C1OA 1NFWA 1O5AB 3MO6A 2GDEH 2VGCC 1XUFA 4YOJA 2ZPSA 1TA2A 4GAWA 2GZ9A 1BRBE 3S69A 1ELEE 4YZUA 2Z3CA 9LPRA 1YCPM 2QE7D 2JH6D 2QYIA 2EQNA 1T8MA 5E2PA 1Z7KA 3RLYH 1OOKB 1G37A 1SHHB 1ZMNA 1M9UA 2AYWA 1GMDF 3P17H 2BD2A 2RCEA 3ENSB 3QWCH 4GVUA 3MNXA 2UWPA 1O2ZA 1GI9B 2ZC9H 1PPHE 2V3MA 5FXLA 1NO9H 3ZVBA 1P03A 1O38A 3F2GA 1CSOE 3FZZA 5C5OA 3STIA 1BOQA 1O2UA 5GXPA 1A2CH 1GBDA 5DP7A 2ZIQH 4ABDA 3UNSA 1SFIA 1P0SH 1AB9C 2Y5HA 1FI8A 2VVVA 4GLYA 3E16B 4U30A 1GI4A 3GCTG 2Q1JA 3F9EA 1IQEA 2FI3E 1GJ6A 1A0JA 2JETC 1C1NA 3HATH 4Y7BA 4IMZA 1C5OH 1SVPA 2VIQA 3VEQB 2OINA 1W0JD 1WYKA 4F49A 2FOAA 5F8TA 2ZQ2A 3TVJB 1JXPA 5CHAB 5T6DA 4Z1MD 1UTPA 1C1SA 3RXAA 1BMLA 4RI0A 2F9PA 2SGDE 1LCYA 5JBCS 2TGPZ 3ZZ5A 1WAYB 3TLOA 8ESTE 4A92A 4THNH 1UTQA 1Z8IB 2DUCA 3ZV9A 2ZU1A 5C0UA 1YP9A 2NU2E 5DP8A 1ZSLA 3ATLA 1ELGA 4NIXA 2WSSD 1QQ4A 3PMBB 1EJMA 5LPFA 5SGAE 3M5LA 5GWZA 4I8HA 1G30B 1E79D 1JRSA 1V2KT 1O2QA 5EW1H 1EFRD 4K1EA 1VJ9U 1SGEE 4RKJB 1AMHA 3WY8A 3O8RA 4TY7A 2H5CA 3GOVB 2BVRH 2ZGXH 2V6NA 1DX5M 4XBDA 4HZHA 5GNDA 3RXJA 1IQMA 1RTLA 1C1TA 1O3JA 3VB4A 3BN9A 1GBKA 4MQAA 3SV7A 1F5RA 1GBAA 2PKAB 4FUDA 1WCZA 5LGOA 2Y5GA 2STBE 4K60A 1VCPA 2WINI 2OC0A 2G81E 4RT0A 2P3UB 4A1VA 4B75A 2BZ6H 5FPTA 1B5GH 1W0ZU 3BTKE 1SB1H 2XWBI 1MKWK 5E2OA 1B0FA 1AFQB 7ESTE 3TIUA 1E38B 1DPOA 4H6SB 3RP2A 2CF9H 2FIRH 4KTSA 1UVPA 2PV9B 4YM9A 1WTGH 3GDVA 3SUDA 1PPGE 4I8GA 3E0PB 3TITA 4MTBA 1GMCG 1Q2WA 4TY6A 2ZI2H 4BAHB 1YBWA 2P8OC 1L1GA 1KLIH 2Z3EA 1HJAB 5JBBS 3VB6A 2GCHG 1FONA 2PGQB 3OY6U 4E05H 2GV6A 1SBWA 2TPIZ 4CH8B 1DLEA 4WH8A 1DUEA 1TX8A 4INLA 1NFYA 3VB5A 1LMWB 4AFUA 3KIDU 1GI6A 3RC6A 2J38A 1Z6EA 1PPBH 1W11U 2UUFB 4Q80A 4UFDH 4CBNA 2STAE 2ZDMA 1G9IE 4D7GA 2ANKH 3D23A 2KCOA 3SNAA 1K28D 2FDAA 1C5TA 3BG8A 3SNEA 1UHBA 3F1SB 2ZKSA 2OCVB 4FUGA 4O3UA 1XUJA 2FTLE 2CF8H 4B76A 1OKXA 4CRDA 2B7DH 1YYY1 3VG8A 1AZZA 3TGJE 5A2MH 2VWLA 2ODQA 2GTBA 3ODFA 1HUTH 1T4UH 1VITG 4NIYA 5C20A 1GBMA 3A84A 3BEUA 4IN2A 4O03A 1JOUB 1D9IA 1GGDB 3L3TA 3FZDA 3NXPA 1XUGA 1Y3YA 3UB0A 1O5FH 3V3MA 4ESTE 4AZ2B 4OS1A 1O3AA 2BX4A 3LH1A 1SLXB 2Y6TA 1DY9A 1T8LA 4DCDA 1SOZA 4XFQA 1ETRH 4DURA 2ILNA 3IWMA 3OE7D 3RMMH 1KXCA 4JK5A 1OWKA 4JCNA 1H8IH 1ZOMA 1H9HE 1IQJA 2EY4C 1CA8B 5C2ZA 3VB3A 4AG1A 2PTCE 1IQNA 1HGTH 3F0PA 5B6OA 2AH4X 2GGVB 2BD3A 3ZZBA 1S6LA 4ASHA 3P8OA 5EJ1A 3VFEA 3O8DA 4DG4A 4JYVH 3A83A 1O30A 5EPNA 1V2VT 5K0HA 2OQUA 1E34B 2ZDLA 3RUOA 3R3GB 5DP6A 2FX4A 1UCYH 2A0QB 3SJOA 2PHBA 4AGJA 2QF5A 3P8NA 4R0IA 2WPIS 1HV7A 1SQTA 5A8XA 1SGTA 4TSFD 5AFZH 1WOFA 1ZTLA 1BTUA 1W7XH 4ZH8A 1W0KD 2H1UA 1O3DA 3QN7A 3QTVH 2BQ7B 3AW1A 1GMDG 3NZIA 3RXFA 1V2MT 4K69A 7KMEH 4D8NA 4INKA 3H7TA 2G5VA 4Y7AA 1WDIA 4MNYA 4INHA 1FPCH 3W1EA 1GHVH 1GHYH 3LGIA 3T28A 2GKVE 1SPJA 1PYTC 2EC9H 3AVZA 3PV5A 3RDZA 3SNDA 3RC4A 1N8OB 8LPRA 1W13U 4X2YA 2D1JA 4X6PA 3MWIU 2SNVA 1P2JA 2XCNA 4ZHMU 1HXEH 3VXEH 1ZMJA 2AERH 3D62A 4GUXA 1DFPA 3DA9B 1D3DB 4NCYA 3EE7A 3A8BA 1RD3B 4FUBA 4DIIH 2ZQ1A 3A7WA 3BF6H 1G2LA 3F68H 1TWXB 3EA9A 1MTUA 2CV3A 4VGCB 3ESTA 1BMMH 1QA0A 1UTOA 3EQ0H 4MDSA 1LPZB 1GJBB 3TJOA 5HKKD 2EA3A 1O3LA 2I6SA 1RTKA 1VZQH 3MH7A 4GPGA 3T2NA 3BV9B 3V0XA 1BTYA 3KYGA 1W3CA 3GDUA 1C1MA 1QIXB 1XM1A 2UUYA 3QZRA 1GHZA 1K22H 1A3EH 3HPTB 1DY8A 1FLEE 8KME2 2SGFE 2BVSH 2J98A 3PMJA 5DP4A 3SU5A 2H9EH 3ZZ9A 1QY6A 4FUHA 7GCHF 1FQ3A 2GCTB 3A7TA 2THFB 1W12U 3M3VA 1O3CA 5EXNA 4FXGH 5F8XA 1QL9A 1KXDA 2GMTB 1ELAA 1YCPH 4KTCA 4WY3A 5HIYA 2QXGA 5AFYH 1KTSB 3SQEE 1F0RA 1O2NA 4OM9A 1IQFA 3HGPA 2PSYA 2TGDA 4YESB 1W14U 1ZJKA 1O2LA 6CHAC 2FMJA 1F0SA 1XKAC 1CT0E 4AB8A 2ZGHA 2B5TB 2CN0H 3SZEA 2VH0A 5A0AE 3A85A 1A5IA 1QJ1B 1P3EA 2VH6A 4DVAU 2VIWA 4U32A 1OP8A 4UEHH 4UFFH 3LJOA 2FOBA 1AE8H 1P11E 3A7ZA 2BLQA 4ISOA 4IS5A 1HNEE 4I8JA 1YPJH 3RLWH 3HK6B 4ZKRU 2BY6X 3B9FH 4I33A 1FIZA 2ZECA 1E1QD 4NIVA 1BBRE 4MLFB 1V2OT 2QXHA 3U1IB 4X8VH 1O5BB 5C1YA 4Y10E 3AK5A 1H8ED 2ANMH 4UFEH 3SNCA 2HNTC 2EI6A 3T29A 2ZFRH 1K1JA 1CHOF 2VIPA 4ISHH 4ISIH 1J14A 1ARBA 2ZO3H 3KQEA 3A7XA 4NFFA 2JKHA 2BY9X 2SGQE 2V35A 1MCTA 1EAXA 1W8BH 1N6YA 2G55A 3ZZ4A 1Z8RA 2G00A 1LO6A 1YC0A 1QL7A 2A2QH 2BY5X 2Z6BD 3S9BA 2KFWA 1RFNA 4O9VA 4Z6AH 1KLJH 5FHTA 2OBQA 2OTVA 2YMSB 3ZIAD 4JMYA 1UHBB 3ZZAA 2BD5A 2XTTB 4MNVA 5EW2H 3BSQA 3GICB 2WHXA 3BTME 3FP8E 3QGNB 5GCHG 1F2SE 3ATKA 4ZKNU 3NK8A 3RXTA 3MTYA 4Q7ZA 1O0DH 3M61U 1ABIH 2BDGA 1AE5A 1KY9A 2M5TA 4IGDA 2AMPA 3M7QA 1GDQA 4XBCA 5JBAS 1MABB 3UWJH 2SGPE 1CE5A 3LJJA 2ZA5A 2OP9A 3Q00A 5E0GA 1HLTH 2OC8A 1F0UA 1AGJA 1MD8A 3ZYEA 1TGCA 4IC6A 1MZAA 3KQ5A 5FCKA 3HKJB 1EB1H 1G32B 1THSH 4ZHAA 5DN6D 1TGNA 1YPKH 4FU7A 1RJXB 4RT1A 2H9TH 1ANBA 3RXIA 3Q77A 1KXEA 2BVXH 1BCUH 4Y11E 3ATIA 1EAWA 2B8OH 4YOGA 1GMHF 4WVPE 4GCHF 4MNXA 1PPFE 1P10A 1DT2A 1LKAA 2ANWA 1TGSZ 3EA8A 4DY7B 3BTHE 3EGKH 1Y3XA 1ZRKA 4YLUA 1VGCB 1GHBG 2K0QA 1Z8GA 4XOJA 2F9VA 2HOBA 1P2MA 3AASA 1HFDA 1A5GH 1SLWB 1EKBB 1COWD 1FNIA 3ZV8A 2VWNA 1XVOA 4WXVA 2FOFA 1GJ9B 2VINA 4I8LA 1DXWA 5FX5A 3S9CA 1V3XA 4FVBA 8GCHF 1UO6A 3KEEA 3NCLA 2PKSB 2R2WU 6ESTA 2ZHQH 5HIZA 1BA8B 2EI7A 2DE8A 5FCRA 3A8AA 2HNTF 1EJAA 1TMTH 3M5OA 1O3PB 3BG4B 1YLNA 4HI3A 4A1TA 4DT7B 1QRXA 3BTFE 5L2ZH 5C3NA 2BMGB 2ALVA 5HGGA 1L4DA 4J2YB 2J9NA 3QO6A 1RGQA 3QTOH 1DSUA 4X1PU 1P9UA 1VR1H 3LU9B 2WV5A 2J95A 1NT1A 4K1SA 1D6WA 3DD2H 3RXBA 2AFQB 1NY22 2LP6A 1BIOA 4X2VA 3RXDA 3MH5A 2ZU2A 1XVMA 4TWYA 2QAAA 1AVWA 4AOQA 2PLXA 4ABAA 4MPVA 2AS9A 2ZNKH 1O2WA 5T3HA 1EOJA 1C5YB 3SHCH 2ZU3A 4K3JA 1O3FA 2SNWA 3H7OA 2IJOB 1WBGB 4MPUA 1AY6H 1E0FD 1TALA 1KTTB 1HRTH 4TPYA 1GI0A 1OP0A 2AGGX 3RXCA 4H6TA 1QJ6B 2F3CE 3GS9A 2OBOA 1NZQH 4AG2A 1JIMA 1MQ6A 1YM0A 3IITA 4LOYH 1H9IE 2FODA 3RU4T 2FZZA 3S9AA 5EG4A 4O97A 2QV1A 5FBIA 4BTUB 1S5SA 1ZZZA 1AO5A 1MUEB 1T32A 2FP7B 2J98B 5JB9S 1F0TA 1YPLH 2F43B 3BTQE 3F0OA 2O8LA 1YGCH 1SGIB 4AFSA 2IPQX 1MQ5A 3BTGE 1S83A 1SC8U 2ZTYA 2JH0D 1GI3A 2A4GA 4OGYA 4AFQA 1K1LA 2NU3E 1BMFD 2VGCB 3S7HB 4I7YH 2Y5FA 1BITA 1SGRE 2XBVA 1C5RA 4DIHH
chains in the Genus database with same CATH topology
1DDJA 3NUMA 5DO4H 4ZXYH 1C2MA 1A61H 1J16A 3RXQA 1Z6JH 1NTPA 3EYDA 2J2UA 1UK2A 1FJSA 2Z9JA 2GVFA 5EOKA 1CA0C 4Y8XA 4IN1A 4FUJA 1O2KA 1MTVA 1C1VH 1V2WT 5HM2A 2ZEBA 1TFXA 3TJVA 4UDWH 3M5NA 1K1MA 4JZEH 3D65E 1BMAA 1HIAA 2ZDKA 1AB9B 1O2VA 1P8VC 2FWWA 1GWAA 5C1UA 2UWOA 5DK1A 2B9LA 4NSVA 1HXFH 1SGQE 1YCPK 2XC0A 6GCHF 1C4V2 2F9NA 4BAQB 2JETB 4KELA 3SOSA 2OLGA 4X6OA 3LDXH 3HK3B 2BDHA 1PFXC 1BT7A 1HJ8A 3DT0H 2Q6FA 4SGBE 2W3IA 5DPAA 4K2YA 1MTNC 3MNBA 1O2RA 4I32A 2FLRH 1HAIH 1IAUA 4TPIZ 4X1SU 3LGYA 1S0QA 3OYPA 2BD9A 2UWLA 2WPKS 1OWEA 1P2KA 1UVUH 1KLTA 1ZTKA 4OS4A 1TRMA 1TYNA 2B0FA 3RXUA 2V3HH 2VIDA 1XUHA 3GY5A 4BNRA 2G5NA 1MH0A 1QCPA 3G01A 1FAXA 3Q3XA 3MU5A 5F8ZA 3FP6E 4NA9H 3ZZCA 1E37B 3FANA 3U9AH 1TONA 1OS8A 2UUKB 1F5LA 2OXSA 4ABJA 1GBHA 1EAUA 5LPRA 3LGVA 2W7UA 1YKTA 3PMAB 5HYOA 1GPZA 3E1XB 1NN6A 1ELCA 3OSYA 1LHCH 3HGNA 1GDUA 2QIQA 2QN5T 1C5WB 1G2MA 1L1JA 1CGIE 2ZFFH 2BDIA 3EA7A 1H4WA 1MTNB 2PTNA 2H2ZA 1IQLA 3AAVA 4NWKA 3SGAE 3M7TA 1S6FA 1MAYA 1DS2E 3PLKA 1INCA 4K8YA 1GCTC 1O2JA 3Q3YA 1BHXB 4HGCA 1KSNA 1HDTH 1NROH 1TQ7B 3TGIE 1IQHA 1EZSC 1NU9A 2A4QA 2QXJA 2FYQA 2Z9IA 1ZMLA 5A0CA 3LGWA 1GBTA 2RG3A 1KXAA 3K65B 3T62A 1MU8B 2Z9LA 1BZXE 1S81A 1Z71A 2ULLA 4X1NU 2QF0A 2ZTZA 2P8OB 5G4BA 2A2XH 1RIWC 2ZDVH 3PYHA 2EEKA 5LPEA 3SU6A 1ACBE 1TNLA 2D26C 4ABHA 2Y7XA 1BUIA 2Z94A 5DP9A 2HALA 3ITIA 4ISLA 4BAKB 2P16A 1Z8JB 2ZHFH 4B2AA 4SGAE 3RXSA 2IN2A 1C5NH 1GHAF 3A87A 4FUIA 2PUQH 3OTJE 3RXMA 2ANYA 3MMGA 4JZDH 5EGMA 3U98H 1AFEH 1OSSA 1ELBA 3P70B 2O9QA 4IC5A 4Q2KA 3TH4H 1F5KU 3BTWE 2ZGBH 3O8BA 2A7HA 1Y3WA 1PQAA 3SJ9A 1ZGIA 1T4VH 1BRCE 2A31A 4A5TS 5FPSA 3EE0B 3UNQA 4RN6A 3PV4A 4ABEA 1BHXF 1WTHD 1EZXC 3QGJA 1SMFE 3A86A 4X0WU 4Y8YA 1P3CA 1UVOA 5DP5A 1EJNA 1FY3A 4AGKA 3UREA 2ODPA 1AD8H 1WQSA 2XW9A 2XC5A 2BX3A 4Y76A 3SQHE 4CHAC 1G3EA 2J94A 5ETXA 1P9SA 4I31A 1GI8B 4AYVB 1JRTA 1GVZA 2ZPQA 2PUXB 5ESBA 2ZZUH 5A0BA 1C2EA 3GY6A 1LHDH 3R0FA 3RM2H 1T7CA 3MNCA 3RU4D 1H8DH 1LVOA 4J1YA 2FEQH 1AWHB 1GBEA 1ABJH 3P6ZB 2FX6A 2PSXA 1V2LT 2IPHA 1O36A 1TE0A 4LZ1H 2O8TA 2NU4E 2G51A 6LPRA 1THPB 1TBZH 1IQIA 1LDTT 1YPHC 4CRBA 1DVAH 2Y80A 5GIBA 2FS8A 1O3KA 1FDPA 1TOCB 3M35A 1O37A 1HYLA 3KQDA 3DUXH 2BD4A 1BTHH 3TNTA 1TA6A 4DOQA 3LPRA 1GJDB 2BDYA 5F6MA 2AMQA 1C9TA 1EX3A 1DUAA 3A88A 1GBIA 1HJ9A 1GI2A 1OPHB 4X2XA 2ZWLH 5E8EH 2A7JA 2WUBA 2XNIA 3ZVAA 1ZPZA 3UWIA 2GV7A 1HAGE 2BD8A 3T27A 1YLDA 4WMDA 3ZVCA 1A4WH 1U6QA 1UTLM 4JZFH 1E35B 2Q6DA 2HVXA 1O2YA 1V2NT 1CU1A 1ZYOA 1SGNE 1SG8B 3OX7U 1TAWA 4KGAA 1W7GH 2ZU4A 5TJXA 2G4TA 1C5SA 3SJIA 1HIAB 1D3PB 3MU0A 2LPRA 1O2SA 3A8CA 3L33A 1VJAU 4BAOB 1TMBH 3U8OH 3TK9A 2BD7A 1AVGH 3OU0A 2ODYB 2A4RA 3UQOA 1ANCA 1O3GA 3RXOA 1Q3XA 2W3KA 3KNXA 4E06H 1XUKA 1IHSH 1ESAA 3Q3KA 1NRPH 1G36A 1GI1A 4GHTA 1BB0B 1K9OE 1L4ZA 1NRSH 1V2QT 3PO1C 2I6QA 1K1IA 2AMDA 3A7VA 1TX7A 2D8WA 3SU2A 1SGFG 1TOMH 4H4FA 1WUNH 3VXFH 2BQWB 1SGDE 3E90B 3NWUA 4M7GA 1O3BA 1QRWA 1YPHE 3P92A 5HXFA 1K1OA 3LGTA 1EPTC 1JBUH 1QNJA 3LC5A 1T8OA 1TRYA 5AVDA 4ISNA 2YOLA 1UK4A 5J4SA 2R0LA 1O33A 1BBRH 3RXRA 5CE1A 2FXRA 2GT7A 1TRNA 2K1QA 4XE4A 3JZ1B 3ZZDA 1K1NA 3GYMA 3F6UH 1D3QB 1FMGA 1P06A 1QGFA 1C1WH 2O8WA 2AIQA 3PTNA 2VWOA 4KKDA 6CHAB 3KCGH 2W5EA 1QL8A 1KDQA 1TMUH 2J4IA 3V13A 1AU8A 1EUFA 2Z3DA 3SV6A 3ODDA 1O32A 1QTFA 1ZSJA 1GBCA 1SFQB 1TLDA 2ZFQH 1ESTA 4MG3A 2H9HA 1TNGA 1SGCA 1NPMA 1PQ5A 1S85A 2ZDAH 1C2KA 1SLUB 1RRKA 5JBTA 4BAMB 3QZQA 1SQAA 4CBOA 3NPSA 4OS2A 2VVUA 1J8AA 1LVBA 1ZJDA 1FN6A 2Y82A 2FO9A 3BEFB 2Y81A 1C5UA 4IBLH 3Q76A 1SSXA 3MU4A 3EAJA 4A7IB 2Y7ZA 4B2BA 2WUCA 1P04A 3MO3A 1GBFA 2C8XB 1XXDA 2YNAA 2ZGJA 1S84A 1VCQA 1MTSA 5DP3A 1ESBA 3M3TA 1QB9A 4MNWA 1GMCF 1YLCA 1C9PA 3F9FA 5JDUB 1QURH 4NA7A 5K7RA 3ZZ7A 2C93B 3W95A 1CT4E 1NESE 3SV8A 2P93A 2SFAA 1V2RT 2H5DA 3TPIZ 4RKOB 3PLPA 1EASA 3BEIB 3ZZ6A 4ZHLU 1KIGH 3TU7H 1A5HA 2P95A 3K2UA 3LKWA 4JYUH 1GHXH 1TQ0B 5ABWA 3SHAH 1VITH 3P8FA 2SGEE 1THRH 1ZHPA 4FU9A 4X8UH 1GJ5H 1O2OA 4BTTB 2BB4A 4RSPA 3ZZ8A 1LHGH 2BLOA 1MZDA 1DICA 1O3HA 1TNJA 1XMNB 3M37A 3GY7A 2OC1A 2FOHA 4D9QA 1C5VA 1SHYA 3DFLA 1C5LH 1G3CA 1D3TB 1O5GH 4FUFA 3SO3A 3SJ8A 1GG6C 1P01A 2BY8X 1MTWA 3MH4A 4WWYA 4B71A 1SGPE 3A81A 1P57B 1WQVH 2FI5E 3MFJA 4Y8ZA 1FY5A 2QCYA 3SUFA 3S0NA 1B7XB 1EP5A 1VCWA 2VWMA 3UR6A 1Z1JA 1Y5AT 2ZHWH 2LNCA 4YLQH 2FOGA 5ESTE 3SU0A 4Y71A 1ZR0A 1C2JA 3UPEA 1ZTJA 3TJNA 1H9LB 3LIWA 3SUEA 2EI8A 2ZG0H 3SGQE 4UONA 4CH2B 3CENA 2R9PA 3QLPH 1C2LA 1IQKA 2PR3A 4Y0ZE 2KAIA 1J15A 1ID5H 3SV2H 2OD3B 4R8TB 1TPPA 1WV7H 4ZKOU 1LQEA 5T6GA 4A1XA 1ZPBA 1GL0E 1EATA 2R2MB 2NU0E 5F03A 1L0ZA 1O2TA 4LK4A 3SW2B 3UTUH 7GCHG 1O35A 1Q31A 4ABGA 3I29A 2PFEA 1P2NA 2NWNA 4UD9H 2BHGA 3SU4A 1V2PT 3A82A 1PPZA 3MHWU 3RC5A 2XBWA 4AYYB 3SV9A 1DANH 2YNBA 3L6PA 4ZXXH 1GVKB 5CHAC 3CS0A 1QHRB 3KN2A 3MO9A 4FVDA 4AN7A 3TNSA 1KXBA 1O31A 1NS3A 1TB6H 1FXYA 1O5DH 1EOLA 1Y3UA 3KQBA 2JH5D 1G3DA 1HAPH 3U1JB 1NRRH 5TCAA 3TH3H 1HAVA 1O3OA 1P12E 1FZZA 1MCVA 2XWAA 1GBJA 1CGHA 1AI8H 3DFJA 1OWJA 3A89A 1O5CB 1AN1E 5JB8S 3SBKA 1H1BA 1TPAE 5L2YH 4K1TA 1C4U2 3K6YA 5E0JA 3TK6A 1BTXA 3I78A 3E91A 2RA0A 3MNSA 3TH2H 4Y0YE 5DKMA 4BXWA 2ZF0H 2TGAA 1IOEA 2V3OH 3SNBA 3CP7A 4XDEA 5EU8A 1T8NA 2R3YA 1V2UT 3T26A 4AORA 1UVSH 1EP6A 1CHOG 3BTEE 2AGEX 3ZVEA 1MBQA 1W10U 2J34A 3ZYDA 2P94A 1QQUA 5T6FA 1AKSA 4DGJA 1QA7A 2GDDA 2QC2A 3M3SA 4WMEA 1B0EA 2OC7A 4JZIA 3MYWA 1TPOA 1KDQB 4DJZB 2C8YB 4YOIA 1CA0B 1PPCE 3B8JA 4GSOA 1EB2A 1LQDB 5GJ4B 3HKIB 5JPMH 4Y6DA 4AFZA 4BXSA 1LHFH 1AFQC 1TBQH 3LH3A 3F9HA 1EXFA 1FIWA 4B2CA 3SI3H 3V12A 1AQ7A 1V2JT 2BDBA 2ZP0H 4ZMAH 2BTCE 1HAXB 5DGJA 3P95A 1UVTH 3S7KB 1DM4B 1SLVB 1TGBA 1HJAC 1O2MA 1BBRK 1RXPA 2BM2A 3KGPA 1LHEH 5CMXH 2ZFSA 2C4FH 2ASUB 3GDSA 2Q6GA 2IOTA 2TGTA 4Z0KA 1NFXA 1Y3VA 2NU1E 2BOKA 2BYAX 1UJ1A 2SGAA 2WYGA 2WPJS 3LT3A 5BRRE 4OGXA 2XCFA 4OS7A 2OUAA 2ZTXA 3MI4A 3UOPA 1GL1A 1C2FA 2A5AA 3K9XB 1MMJN 2XBXA 5DJ7A 1O2GH 1ORFA 3SU3A 2D2DA 1GMHG 4WH6A 2GT8A 4GCHG 1Y5BT 4YO9A 1C1UH 3TGKE 3RMOH 4Q7XA 3UNRA 1YPEH 3KQCA 2A1DB 3BTTE 3ZVFA 1BMNH 4BTIB 1GI7B 2H6MA 3MU1A 3RXEA 2A7CA 4ZUHA 2BDAA 1DWEH 2W26A 4X1QU 1EPTA 3E3TA 4CRFA 1NRNH 2CGAA 1SI5H 1CBWC 2W7SA 1GGDC 5C1XA 1O3NA 1V6DA 3SUGA 2ZHEH 2BZAA 1A0LA 1BRUP 1QFKH 4DW2U 1D4PB 3E0NB 1P09A 4IMQA 2HWLB 3SI4H 2O8MA 1C1PA 2G8TA 4YTAA 5E0HA 4NA8A 4GHQA 3FP7E 8GCHG 1SR5C 2ZCHP 4ZKSU 1JWTA 1GJCB 1ZHRA 3CS7A 1KYNA 1QBNA 1P2OA 4O3TA 4E7RG 5GDSH 2ZFTA 4YT6H 2CJIA 1GBBA 1TIOA 1LPGB 3STJA 2RA3A 1HAZB 3A80A 5A8YA 3UIRA 1GJ7B 1Y5UT 1GCTB 3IG6B 2C8ZB 1GJAB 5GCHF 2XC4A 2XYAA 1YPMH 3FVFB 3RXPA 2TIOA 2ESTE 1O2IA 1FY8E 4B74A 1XKBC 1PJPA 2ZGCA 1CBWB 3MH6A 4FUCA 1O3MA 2R3UA 3H5CB 1O3EA 2Z9KA 3RXVA 1NRQH 1O5EH 2Z7FE 1O2PA 2VU8E 3PWCA 1NU7B 4B73A 1C5MD 5HMAA 5L6NH 3E6PH 1QB1A 5L30H 1RIWB 1BQYA 1QBOA 4H42U 2UUJB 2VIOA 1FY4A 1HCGA 3KF2A 1ETSH 3UOUA 1W0YH 2FOEA 1GDNA 1LKBA 1QBVH 1X7AC 1MKXH 1T31A 4UFGH 1V2ST 4JZ1A 2CHAC 4NIWA 2GZ8A 1EAIA 1DLKB 4CRGA 2DE9A 3PLBA 2BXUH 2BLWA 3FAOA 3M7UA 2KAIB 1GHBF 1NFUA 5C5NA 1UK3A 2VJ1A 3RM0H 1K2I1 1A0HB 5AHGH 4E7NA 1N8OC 2FESH 1AZ8A 1HAOH 1O3IA 1UCYE 1SL3A 1P05A 1IHTH 1N1LA 2ZCKP 3U8RH 3B23B 4CRCA 4AX9H 1PQ7A 4ABBA 4XBBA 2BLVA 2G4UA 4VGCC 4TWWA 1LVYA 3URCA 2CHAB 3ZZ3A 2F91A 3RMNH 3KL6A 4CHAB 1CHGA 1C2DA 1K21H 2ZDNA 1A1RA 3VPKA 3PMHB 1G3BA 3U8TH 4XSKU 3VGCC 2OQ5A 3URDA 1W2KH 1LPKB 2FOMB 2HPPH 1O34A 4OS5A 5EQRA 2F9OA 1A46H 2FI4E 1ANEA 3MU8A 4U01A 1HAVB 2O8UA 5EXMA 4D7FA 1EQ9A 4NGAH 3E8LA 1PYTD 5A09A 1TX6A 3AAUA 1WU1A 1YF4A 3EDXB 1PPEE 3TJUA 2GX4A 3SN8A 3UY9A 2F83A 2GCTC 1MU6B 3SU1A 3ELAH 4LXBH 2AGIX 1ARCA 1C1RA 3ATWA 4K8BA 2GMTC 3RXLA 1JMOH 1DITH 4BANB 3JZ2B 3UQVA 3W94A 4QT8C 6GCHG 1OWDA 5A8ZA 2BOHB 4NWLA 4X6NA 3GY4A 1QR3E 3VGCB 1C2GA 3RXHA 1TGTA 1SQOA 3A8DA 1S82A 1BJVA 4ZAEA 4K5ZA 1CGJE 2QGRA 1AKSB 4NZLA 3VB7A 5LH8A 1OWHA 3O8CA 3K6ZA 2FYRA 1ZLRA 2C3SA 1RS0A 3BIUH 1A3BH 3RU4E 2CXVA 4X2WA 1C4Y2 2PGBB 1UTKA 3A7YA 5AF9H 4CRAA 1C5QA 1C5PA 4Y79A 3DHKH 3M36A 3PTBA 1GCDA 4LZ4B 1BTZA 3SORA</