1NPUA

Crystal structure of the extracellular domain of murine pd-1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
SLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFSNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the costimulatory receptor programmed death-1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Programmed cell death protein 1
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2003-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1npuA00
4NN6B 4JG0H 4LGSB 1FYTE 3MRMA 3UJJH 3VRJB 5JHDD 4NZJA 3OAZH 3V4PH 4PRNA 3SO5A 4YHNB 4Y4KC 4P3CL 3RDTC 1O7VA 4X6EA 4GJTB 1TPXC 1G7HB 2PO6A 3O3DA 3VFPA 2R15A 4G9FA 3P30H 1JGEB 1HEZB 4OCSH 4Z7VE 4Y88A 4LARL 5BJTB 4JM2F 3QJHA 4EI5A 5IHZB 3MR9B 3NZHH 2GK0A 2K7PA 3MJ9H 3VI3E 1A7RH 3MOBH 2VR9A 5F9AC 2A83A 2IANE 4U6HA 4P57A 4I0PA 5T3ZD 4W70A 3H2WA 3MRQB 2CXKA 4H0IA 5AYUL 2IAMA 2XPGB 3W9DA 5EU6D 1ZHBA 1KB9J 3A6CL 2A6DB 5ADOL 1I8MA 3CFJB 5TDPB 5DVKA 4XNYH 2I07A 4Y2OA 1OQOA 1HOCB 5F1IA 3IS0X 5KG9A 1FZOA 5LXGH 2XQYK 4HV8A 4HKBB 3CCHB 4FFYL 3V6OE 3UO1L 3N1MC 2AJUH 1A2YB 1R24B 3QG7H 5IVNA 4YDKL 1T0NA 5IMMA 4P3DA 2R0LH 3T3PF 4OM0L 2ORBH 3LPGA 4OZGE 3QDME 5KN5A 4W4OC 3V79C 4P4KB 3ARQA 2IADA 1MFAH 4TTDC 4DGIL 5DMIL 3HZYB 4YO0A 5FGBC 1J0HA 3Q1SL 2DRUA 4C4KT 3LN5A 4PJEF 3KPPB 3V6FB 1QPXA 2OX5A 2EYSB 5BS0A 5HVHB 1P69B 2H6PB 3FMGL 1B0GA 3C60B 4PJDE 1F4XH 1U8JA 3QEGL 1JF5A 2HN7A 3IFNL 5DVOA 1H0DA 1BVLA 1A7QL 4FZEL 4HUMB 2Q20A 1AJ7H 1QLRB 3BO8B 4JZJC 3JV5A 4KJYB 2ZCKH 5GS0L 1NLDL 3O2DH 4NQCE 4LFHD 5DFVC 4J12A 3GSOB 5CJQL 2IPTH 4ZQKB 5EUOF 3I50L 4ZAKC 1UEMA 3MLYL 3K8LA 3WJLC 3EIFA 5GISL 3MXVL 4WTWA 5E6IA 5MHSD 3ULVH 1F11B 3ULUH 5CZKA 3GSNH 3ZYJA 3TIDB 3PL6D 3RHWK 1WQVT 3HE7B 4JVWA 1KB5H 2VZOA 1RUQL 3ELAT 4N5EC 2VQUA 4MWFB 2OTWB 4MQTB 1KEML 4QRRE 2EEDA 3FN9A 2YSSB 3GKWH 3CH1A 5HGGS 4APQD 5GZNC 1Y6KR 4GSDL 5LJYH 5AEAA 3H9ZA 2A74B 4OLEA 3SE3A 5E4EB 4XMPL 4ALAL 5ID0B 1A1MA 4CVWA 4G43B 1OD7A 2YHGA 4WHTB 4V2BA 1U3JA 3CNKA 1I9RL 4OLYL 4GOSA 1E27A 4UT7L 1F6LL 1BHGA 2AK4E 4CBPA 3MYZA 1H15B 4I18A 4M9OA 4R97B 1HXYA 3DO7A 1BVKA 1T89A 1IBGL 3LPFA 1HCFX 1WWBX 1F4XL 3C8KB 3TWCL 1IGJB 2EDOA 4JVPA 2KL6A 3HPJB 3QFDB 1XZ0A 2YN5A 3QI9C 4HQQL 3UXFA 1W8OA 5CLTA 3UTSD 5I8OL 3U4BL 1DN2A 1MHPL 2NXZB 4YE4L 5IGXL 2I27N 1NAMH 3BEVA 3QDMB 1KJVB 1IGIL 1XF4A 4LDLB 1MNUH 4XMLH 1NEUA 3VGBA 2B1AH 3GBLA 3LY6A 5FYLL 2MCPL 3FO2B 5CEZL 5T1LD 3CJJA 3RRQA 4OF5A 3MRFA 1BOGB 3QWOB 4UT7H 2DWDA 4G6ML 3MRLA 2JELL 4KXZH 4F15C 1KXVC 1DUYA 1KT2B 4PJAE 1KB5L 4PY8J 3BEWB 4R2GD 4DZ8A 5J3HD 5EOQH 1T1XA 1CDIA 4PJDB 5L9DH 3HAEG 5D7LE 3K3QA 4KDTA 1MCEA 1JZ7A 4M4PA 4GSDH 1F5WA 4C55A 1MCSA 3GMRB 1W8NA 3N1PC 4XMPH 4GW5A 2DLFH 4X98B 1CR9L 1EHLH 2ITDB 3MBED 3U36B 1X6LA 5CEXA 4MMZC 4ZFOA 3FFDA 1CICD 2BOBA 3HC3H 4HKZA 4OFIA 3BPCB 2DQIH 1CFTB 3X13B 3SBWA 2Z0BA 3NABL 5CZVL 2IJ0C 5DDHB 4PB0H 3DV6B 2ZKHL 4H20L 5J1TC 3VFOB 1H5BC 2F53E 2G9HA 3ORJA 4GS7B 5ETUA 1KJ2A 1JNHA 4NO5B 4Z0XB 5I71C 2O93L 1WFOA 4ZXBA 1EFXD 4MB3A 3X11B 2HTKC 4U7KA 2OQJA 4YFLF 3VCLB 3W81A 3DYPA 3FCTB 4WWKC 3AU1B 4NO0A 2Z31A 3G04B 3TN0B 5J06A 4ZS6D 3F6IA 4B5EA 5HGBB 1S7TB 5KVGH 1UYWL 1RHHB 4LLVB 2IQAA 5CGYD 4I1NB 2L7UA 3KLHC 3PGFH 2EDRA 1KCRH 4X9GA 1S7WB 3LEYH 4NFCA 5T5NG 4OI9A 2R29H 3GMMB 5IIEB 1OGAB 3RZCD 1BBJB 3D18A 1AD9A 3LKNB 5F6IC 5HGDB 2VLKB 4NJ9L 5EZLA 3GO1H 4TQEL 1NEZG 3PWJB 3MYJB 1BFTA 3TNNA 3EW3B 4AENA 1JZ2A 5FUZL 4F33B 3T1FA 2FX7H 3IXTB 1AXSA 1TCMA 2GJ6B 4LNVA 2K3TA 4LRIC 1NFDA 4PJHA 5KVDH 1CZ8L 2D31B 3PL6A 1G1CA 3JVGA 2EKSB 1FYHB 4Z7WE 5CCKL 3KPSE 3KYNA 3G5VB 3CSBA 1KC5H 4D9RD 1RZKC 3MV7D 4F58H 1QVOA 3HG1B 1BFSA 4TTGA 1K85A 3SDAB 1M05A 1NDGB 3FRUA 3TYGL 1T7YA 3L6FB 4MJ5A 1MJUH 3MODL 3VFMA 2DM7A 3MFFA 1RJYB 4XI5D 4N0YL 1FNAA 4RQQA 3QUMA 2EO9A 1IZKA 2UZIH 1M7XA 4NN5B 3MZGB 4MJIB 1T3FA 4XPHH 4X9FA 2HMIC 5J11B 1OCWH 4IMKC 2EDBA 1FE8L 1NCUA 5BVPL 4YZFF 1Q0XL 1KJMA 5CSZB 5BRZD 5L8KB 4RGNB 3FOMB 4IJ3C 5IMLB 1J0ZA 3IJHA 1KFAH 1YN6A 2B1AL 1VFBA 4EDXA 5IHUL 4U31A 4HWEH 2XA3A 4YDKH 2K9UA 1NBVL 3NGBC 1G1YA 3SQOL 1CU4H 4LSQH 3LDBB 4XCNA 4IMLB 3HB3C 4J1UB 2Q76B 3BPLC 3O6KL 3VH8G 3NTCL 2HLFD 2D03H 3DETC 4FRWA 3REWA 1C1EH 1ACZA 1PW3A 2P5EE 4MNHA 5J4MA 5E08L 1BQHA 4LLYB 3QXWA 1S7XB 1HYRC 5D7IB 3O0RL 5IKCA 3BQUC 1MJ7H 1YNLH 2BXZA 2PYFA 2RQ8A 5HYJE 3CD4A 3CSPA 1X4XA 3OJ2C 1BBDH 1JV5B 1BJ8A 1I8KA 4NQUA 1KPUB 4LKXA 4UDTA 4HIIA 5T3XH 3RDTB 1VFAB 5IV2A 3X12B 1QBBA 3QEUB 4MNQA 4QHMB 1MREH 3SKOA 1Z0MA 4FQHB 3MV9A 4R6UA 1DBAL 1BJ1J 3BIBX 3RGVD 3D25B 1G7LA 2VAJA 1XF1A 3QCUH 3QIWD 5CJQH 1ED3A 2OP4L 3LPWA 4K23L 3K2UL 4KK5C 3NTCH 2WM0A 3KPSD 4LMQI 2XA8L 4Y2DC 3V4PL 1RZJC 2VDKL 5K9OB 2MHAA 1OP3K 2Q87A 3MO1B 3VXUD 4U3HA 2VIRA 4DOHB 5IBLC 1AI1H 3PWVA 5DWUL 5DJXB 5JXEC 4LCIL 4N8CH 3QUYA 3WNKA 3JWOL 3DETD 2HLFC 3GIVB 1OAQH 2HG5A 2R2EA 3QDJD 3DVFA 4UV7H 4PV8A 1MCPH 1KXTB 4L3ED 3CMGA 4LCCC 3S3PA 1EFXA 2VUOA 4ZFZA 5JXEA 4NRZB 1UEYA 3X3GH 4WEBH 1J1XL 3ARGB 3QH3B 1NEZB 2C5DC 3B8YA 4CDHA 2KH2B 5IFAH 2OTUA 2D03L 3CLFL 4XTRD 3B9KD 3LH2L 4JFDA 2VXUH 4ZUSA 4UT6H 1ZTXH 5D7JC 1FVCA 3EYSL 5FUZH 1NGPH 5BMFH 1E6JL 1CGYA 1HNFA 2NY0B 4KHXH 4L4TE 35C8H 3K8KA 5GGSB 1TITA 4ZUWA 3HC4L 3H7BA 1HYSD 4G9DA 3G6JA 5F88A 2NTFA 4U1LA 4CJ1A 5KS9A 3L1OL 4M4RA 4S1SH 4PJXF 4IHOB 5EFIA 3DHJA 2W0PA 5D1XA 4HWUA 1NGYB 5J6GB 5EPMA 4JAMB 5D8JH 4KY1H 3K81A 2G60H 2PW1B 1XR8A 3CDCA 2L0DA 2W38A 1U3HB 2ZOKB 2AEPL 2XWTA 3VGGA 3GSWA 3OR6B 5E8EB 2VE6A 3VE0A 4JJHA 4PV9B 5TE4H 3QQ9C 3LS5L 3HPLA 5HYEA 3NN8B 3WLBB 4G7YH 4WI3A 3CVHB 4IM8A 3UROR 1K4DB 5DJYA 4C4KO 2RCSL 1P84J 4MAYC 5IVXA 2AJSL 5MENB 1AQDA 2D2OA 2EZ0C 4HMCA 4LARH 2EXWD 1J8HA 3FT3B 1QFWL 4H8WL 5KJRL 4IRZH 2R2HA 1QFWI 3T0XA 3BZ4B 1RULH 1P7QB 3INUH 3PHQA 1FDLH 4HUXA 4XVSH 1CU4L 1NGZA 4JM2C 1JWMB 4LSQL 2EDTA 1Q0YH 2PTTA 4TPRL 4K3JL 4UV4L 2X89A 1ZAGA 2DQIL 1GGIL 4OM1H 5JUEL 4L8DB 4M7KH 5B39G 4JRYE 5MERA 2IBZY 2VISB 4PJ9D 1YPZA 3ARBD 3GRWH 1A7OL 2B4CL 2HVJB 2IGFH 4CMHC 3I6KA 2VABA 4KRPB 5E08H 3F65A 1F90L 4Z76B 4U1GB 4FQ2H 1T5XB 3P4MB 4I5BB 3B6SB 3CXDL 1UKQA 1UENA 2RBLA 2NY2D 1OWWA 4LIQH 4X4MA 1IAKB 2FX9H 1VERA 4PG9A 5KW9L 3HE6B 5FUOH 4JB9H 4Q9RL 4JEGB 1T66C 1QSZA 3P4LA 1GZQB 4E42B 5KVGL 4G6KH 4XGZA 1MIEL 1YMMB 43C9A 1LK2A 1JWSA 4HIJA 4XMKL 3E1F1 1L6XA 3FQWA 4OLUL 4GXUM 1C12B 5EBWA 3T0EA 4ELKA 3VWJC 4RMQA 3O41A 3UTQB 5F7WC 3CFEB 2JIXB 1G9NH 1QSFD 2CMRL 4LHUA 1DANT 5FO9A 3K1DA 3S8WA 4CVXA 3UDWA 3WFCH 1C5DB 3T1WA 2ERJB 3VXNB 4EUPA 2QBWA 1TMCB 2A2QT 4P5MA 3NCJL 3QEHA 2FO4A 3G6JF 4C54A 2DAVA 4L4VA 4JO3L 4LSUL 4JDZA 5B39A 3QCVH 3FT4A 1JHKH 1ERNA 5K9QG 5CINL 5I1AA 2DM3A 1KCSH 3VXMD 4NQDB 4NDMB 4R0LB 3ES6A 1I9JL 1TQCC 5BXFA 4X7SH 4JKPH 1DBKL 2F8OA 2Q7YA 4MLIA 3QIBB 5T3ZH 1UVQA 5FV1L 3MLVH 3GUTB 1FNGA 1XR9B 2FNBA 4ZPVB 4EIGB 4Y16A 5IM7B 3FQNA 1H5BA 4PRIA 4LSTL 1AY1L 5EU4A 5E2WL 3RX8A 4PBXA 4H1LA 1R5VA 1HILA 2XXMB 4YC2C 5LGJB 3NCYP 5DZLA 4DGYH 1S7UA 2DWEB 2KZWA 3EO0A 2VZVA 4XZUB 1QSEB 3L3JA 2WP3T 3L3GA 3BZEB 3SDXF 2DQJH 2X4QB 4ZS7H 3B5TA 3MNZB 1F02I 2JJTC 1VGEH 4Q6IC 2FYYB 3P11L 1B4JH 2WLYA 4Z7OF 1CL7H 1UB5B 4ODHH 4ZAKA 3VDAA 5A3ID 2DICA 1NBVH 2WIIA 2BVUA 3GSVA 5I74B 5I75C 3TEUA 3T2OA 3CDGA 4HF5L 4QOKE 4LLWA 2E27L 3QRGH 4U7SA 5LCVH 2HT4C 4XXDB 1NFIA 3X14A 1G7MA 3B4NA 4FTVA 2CIKB 1OW0A 2AEIT 3SE3C 2WZPD 2CIIB 1KTLA 5CHNB 4KZEH 3RTQA 4Y0GA 5TF1H 2IBZX 2HJKA 4F7EA 5I8OH 2NCMA 4DFIA 1CFBA 4L3CB 2HJFB 2APVA 3RWHB 1FZMA 5HHVL 3W5NA 5SWZB 1SJHA 2VXTH 1ZVYA 5GRUH 3T77B 3BWUC 2BOCA 3O3AA 1K8IA 3TO4A 3AS3A 3U0WL 2ZSVA 1CL7L 5E8OB 3VWKB 3MJ8A 4XP9H 2IH3B 5GGRY 1OAUL 4L3EB 5DJDA 5EIIB 2B0SH 4RGOH 3WE6A 2J8UA 1S5HA 1X5IA 4KROC 1HEZA 4PJFE 1JF1A 4JANB 3NCBB 4KKNA 5H35B 1A9BB 5KZCD 1MEXH 3EGSA 4DGYL 2A83B 5GGQH 3GIZH 4PJCE 1YA5A 3ZDXF 2B20A 3MROB 4QWWD 3MTRA 3STBA 4I77L 4DVRH 1OAYH 5FM4A 5GIRA 5HHVH 3MRQA 2BK8A 1UWXK 4LF3A 1M7IB 1N7MH 4WU7A 5CWSB 2E7LA 2F9BT 3A67H 1BAFL 1FIGH 4LRNL 3BYYA 3PDDA 4ODTH 4Z7UF 1SHMA 1I8MB 4PUBH 5DRZB 5GISH 1A14L 1IT9H 3P0VL 2ZSWB 4LVNB 4K94C 5L2JB 4W4OA 5CJBA 4JFEA 5CUSL 3DRQB 5HYSA 5JW4N 1PY4A 3HUJB 1A2YA 1R24A 4JFHE 3BPOC 4BZYA 3HCVB 4MVBC 4APQA 4TRPH 5LWYL 1PGRB 1AGEA 4JRXA 4ZDHB 3TT3H 2DLIA 5ESQB 3CSYB 1AHWA 3LKQA 4LQ1A 2IADB 1EEYA 1WCBA 5C9JB 1RJCA 4YDVA 5HHOB 1QLEL 1B2WL 5JW4Q 3NZ8A 5A43C 3QG6A 1JZ8A 5F7HA 4BQ6A 4TULH 5FKPB 4M00A 1S7VA 2VSDA 4KJQC 1JMZA 4KJPC 3UPRB 1NQBA 5I2IA 2EYSA 3ILQC 4J2XA 3I84A 4M7LT 1NMBL 3DURA 5C7XH 4I0PC 4QRPE 2W9LA 1NC4B 3PV7A 1AC0A 4WV1C 4PB9L 3GMOB 3LRSB 4KV5F 3LN4A 4KK9D 4MHHG 3T0AA 4OCNC 1A3LL 3MLZL 5JORB 2BNQA 3GJFA 2XKNA 3DX7A 3V6OA 4Y4KD 3L5JA 4EVNA 2RJMA 4JY4A 3DVGB 5A2LH 3D0LB 4ZQKA 5C0JB 1IGFL 5E6IB 1KBGH 5DD5L 1A6WL 4LP4A 2IANB 5CILL 1KNOA 1OAZH 2ESVB 5B8CC 2K1MA 5JW5A 4TPRH 4JDVA 2A6KB 5CD5D 1MHHB 1OQXA 4Q9BA 3IFLH 3GSUA 2FEDC 5BV7C 4OFVA 5LQBL 2PN5A 4MD0B 3X3FL 4IOIA 5ILTH 1I1FA 5GSRB 3SCMC 3G5YB 5IR1A 3QUXD 4S1DC 1RZKL 1V7ML 2ZUXA 1I8IA 4MXVF 4YHKL 4XVTL 4L8SA 4P2YA 3TNMB 3AROA 5FYJD 1JZ3A 2YPLA 3OKOA 2NY6C 3MBEA 1E4WL 3SKNB 5C8JB 1UXSA 4NBXB 1I3GH 4FTVD 3EJYD 4NO3A 1D5XB 4Q9RH 5JNYB 4I48B 1KXQE 5CIPA 1Z2KA 1TETH 4M5YH 4M7JH 4JLRA 3S35L 5I1CH 1F2XK 3ME0A 4OZIB 5CGMA 4QGTA 4GXVH 7CGTA 3HR5B 4NHUA 2ADFL 5HI5D 3M1BA 5FAAA 4Z7WB 4K3EH 1AIFB 3MFGB 5HDQL 2NZIA 3S9DB 1T21A 2ICEB 4LLAA 1IGMH 1QO3B 2W9DH 1U95A 3DMMA 2G2RB 2AQ2A 1ZT7B 3OHXB 4FQCL 3FB6B 3RVUD 3EFDL 5IP4A 3UTZB 3IDXL 3ZHDA 1I1YA 1W72H 3BKYH 4FNLL 5EO9A 3C87A 1D5BA 2FATH 3LEVH 4XBPA 2WANA 1GIGH 4MJ4A 4MAYB 1KPRB 3LQMA 1II4E 5F9JB 1Z3GH 1NUDA 4Q0XH 1Y18B 4Z5RB 4M6NH 4ODVH 1UZ8A 2CXGA 5D1ZC 3BHBA 2EIZA 4YX2L 1BPVA 4WIQA 3DX8B 4G8GE 4FMKA 3NPSC 1MIML 4PRDB 2AABL 1UACH 2DQGL 1IGYA 3TFKD 5D5MF 2CPCA 3V52H 2LU3A 1P9MA 1NC4D 4Z78A 4EI5C 1CICB 3WS3B 1U8QB 5KSBA 4FQCH 4G8GD 2A6JA 1E4XH 5J89A 1A3RL 1RK1A 4LK4A 2YK1H 2D7TL 4N0UA 4R26L 4G42B 3MNWB 4NO2B 5CZXD 2P5EB 1BZ7B 5EWIL 1TQBC 2FEDD 4TULL 2F8VA 4XNZC 3UTPE 2F5BL 4NNXB 2WINB 1WEJH 5EU6E 1FRGH 1KJ2H 2GTWA 1HHIB 1QQDB 4P3WA 4H5SB 1BFVL 3A6OA 3DBXB 3ILPA 4MA7L 4PR5A 1B0RA 1MFAL 5GGVH 4Y5XB 1D5MB 4TSCH 4HIXH 1QFUH 1CE1H 1ETZB 2G5BA 5IBUB 2BNUA 2AK4B 2E27H 4A6YH 1J5OH 1X5LA 4YHLL 1AI1L 2ZWLT 4JG1L 4FQ2L 4LLVA 3IDXH 2IQAB 1R3HB 3VFTA 5IQ9B 1V7NH 2NY4C 5BVPH 1KV3A 1CGSH 4QRSA 5IB1B 3ZO0A 1RUAL 4U4BA 3PP4H 4LOUC 2QSVA 3GMMA 5IIEA 1EMTL 5J8OA 4XNUH 3CVHL 4XNMB 2YMXH 3G6JE 1U91B 3QDGA 1ZT1B 2A73A 3S97C 1CLCA 1M6OA 3C2AL 5IT2H 1IL1B 5FOJA 3G6AB 1VDGA 4Y19B 5C0CE 4BELD 4MJ6B 1KJ3L 4CL7A 1A9EB 4X7TB 1FZJB 1A4KA 1U8NA 5FYJU 4B50A 1J8KA 5DQJB 4NO0D 5JHDA 3QUML 5GS0C 2IFGA 3OGCB 1EEZB 4XVJH 5FV2A 2R69H 1YEIL 1J88A 3D39B 5DS8B 3L3DB 4ZFGH 5E8NB 2MKLC 3O0RH 4XVTH 1TQCB 5JW4M 1K4CB 5ISZA 3EJYC 1CD1B 5E7BA 5L88L 4NJAH 1ZKAA 1ZE3C 2VLJB 4X6DF 3OJDA 1QSVA 3P9MB 3CFKA 4OD1L 4XP6H 2B2XH 1U8IA 4H26B 1QZ1A 5D8JL 4R7NB 3GBNH 4KMTL 4AY0A 4NYLA 1YZZA 1A6UH 4RA0C 4KKBC 3KPOB 1RJYA 4DN3H 4H1LG 3BISA 1EIBA 3QUMB 4U6YA 1MCWM 4HJGA 5EC1B 3L3HB 4L8BB 3FN0H 1UCBH 2DQCL 2P5WB 2EE6A 3C9NB 4MAUL 4I8DA 4GKNB 1BM3H 1E0OB 5EBGA 2EH8H 4WJ5B 3S4SG 1W0YT 3MV7A 5J9PA 3JV4B 4Z77B 1A5FL 4X8JA 1CLOH 1TTFA 3QUYD 1Z9MA 2I25N 1GJIA 3H9SB 3AREA 1JF6A 4NZDA 2JTDA 4M93C 2OK0H 1DSFL 3QNYA 4WFFE 4YBHA 4ZO7A 1OAXH 5ERWB 4YXLH 5EUOA 1VGKA 3FONB 2VZ1A 4RMSA 1PLGH 2F54B 4AJ0A 4Q0XL 1KLUA 3ZL4L 2LVEA 3REWB 4ZFFB 4LPCA 1EH9A 4UDUA 4PJGB 3RBGA 1W72B 2QHRL 2A1WL 3MRHA 5D4QA 4HUWA 1WITA 5D7IA 2EDKA 4IRJA 2BSED 3JTSA 2P24B 3GHEH 3IDIB 3V95A 5E2UL 1LEIA 1HSBA 2PYFB 3UYRL 4HG4J 3KYOB 4OT1H 4PJFF 1PYWA 1OY3B 4OF0A 4DUWA 2MPAH 3RY6C 2E7MA 3EJZC 1I75A 1FVDA 3SOBL 3ZKSD 1A6AA 1NSNH 2DQFB 5FUOL 3CU7A 3LN9A 3QEUA 4C56D 3MREB 1DQJA 1DVFA 3QB7C 4PRHB 4GAGH 3ZHLA 4MXQD 4OKVB 5I1EH 1HWHB 3VFVB 1NAKH 4LEXH 5J7CC 4L4VE 4PP1D 5CINH 2UYLA 2PR4L 2A38A 1OSPH 3KPSB 1JHTB 4DZBB 2MHAB 4XRCA 4F57H 3QQ3A 4O2CA 1NUFA 2VLMD 4K8RL 1CI5A 3GHBH 3PGCB 3OAYH 5D5MA 3PWVB 3VFUB 3C6LC 2ITCB 1N64H 1EA9C 4NKQB 3FN3A 5EUKB 3WNOA 1QR1A 4OT1L 2APBA 1VSCA 4X5LA 3C2SA 5MEQB 1SEQL 3IYLW 1NGXB 3MLTB 1FO0A 3QEQA 4JHZA 5LXGL 3SJVB 4OLVL 4LVNC 5EORL 3LB6C 3N06B 5GS2H 4NRZA 1J05A 1NJ9A 5IW1B 1UM4L 4FN0A 4AT6B 5IHZA 4GAGL 4KWUA 1UGNA 4GRLB 5DEGB 1ADQA 1ONQB 3BPOB 3T0EE 3MRDA 5DMJB 1PEWA 3V0WL 2NW3A 3RWGA 3O3BB 1FVCB 3P11H 1U2CA 2QKIB 2Z4QA 1JHLL 5K33A 3NA4A 4F57L 3D2UB 4LPWA 1GYAA 4YUEH 3IAPA 5DD3H 2P42B 4JPKH 3GHBL 3W0WB 4Z8FL 2D7PA 1U8OB 4G9DB 3EOTL 5L88H 3LZFH 5DZOA 2R0KH 1NGQH 4X4YA 3WSQL 5I1EL 1FZOB 3GEWB 5F71A 3C5JA 1I1CA 3CCHA 5B38G 3LVEA 5DHVB 2GAZB 1F13A 3BP4B 4C58B 3HC3L 5HYFA 3MV8B 4LCWA 1CGTA 4KUCF 4DCQA 3KJ4C 1G9ML 1R3KB 1AXIB 4BK4A 1TZHA 2CRYA 1NDMA 4XBGB 4Z7OE 4Z18A 3RL1A 3MXVH 5C08A 3RFZC 3KR3L 1MFEL 5BOPA 4Q6IA 4HUKB 5JO5B 3ZE1F 3MPCA 2P8MB 1ZHKB 4HJJH 3FN0L 1T66D 1I3RB 1JJUA 4YX2H 1QA9A 3MACL 4S1RH 3QPQC 2R0WH 3KPPA 3ECBB 1YNTA 3W2DH 5FO8B 4P9HH 3O45B 4UQ3B 5IEHB 1NGZB 2Q3ZA 4F9PA 1U8MA 2HN7B 2I24N 4RAHA 1WC7A 1LO3H 3I85A 3MMEA 4LCUB 5EZIH 1DLFL 3OKNB 1IAIL 5MERB 3HE7C 3KPNB 2LV4A 1F42A 4KKLC 4KJYA 3ZSSA 4N0CC 1LO2H 4PJBB 4M7LH 4DUXA 4FFWD 2XI9A 4Z76A 2G5RA 1T5XA 2J4WH 3SEPA 3PE9A 3C8HA 3CFDA 1XIWB 3AVEA 2O5ZH 4MA3B 2FB4L 1M71A 4QRQB 1LHZA 1CE1L 2NY7L 3CH8A 4F7PB 4OCWH 3HE7A 4A6YL 2AI0L 5ESVA 2V2WB 3KPRE 1F00I 4LLQA 2COQA 4OQTL 4OZFH 5I6XB 1MJ8H 3O3DB 3OXSA 3F7VB 5L2KB 4G6JH 5KANG 4G8EA 4R97C 3T0EB 3JVGC 4DGIH 1HQRB 1SEBA 3MUGB 5J6HA 2F74A 4C56A 3GB7B 5E00B 2NNAB 2HKFL 3QPXH 3OPZH 4LSPH 5AZEL 4AM0B 3HE6C 1HINL 2VYRE 5IHBA 3TCLA 5TJWK 5IW6B 4G5ZH 1A7PH 5HDBE 3U1SH 3ZT6A 7FABL 3W5MA 1CGUA 3RUGB 3HPJA 3QFDA 2I9TA 3TYFA 3V9FA 4RZCB 5E6YA 4P2QB 1TENA 5T1KB 1FORL 4BKLB 5HHPA 1NLDH 4AL8L 4ENED 5D7JD 4IRSD 5ELIA 4KHTH 1T5WB 1JYWA 1EZVY 1KLGA 2IWGA 5I8CA 1QD0A 1QSFA 4LGRB 2W92A 3V8CA 1ZA3B 1ZGLA 2X4UB 1FNGB 4YAQA 1PBYA 4NQVB 3RL2B 4QYOB 5DRXA 1X5KA 3ET9F 5EU4B 4K9EC 2V2XB 2IAND 2VXUL 5JDSB 4J6RL 4S1QH 1EV2E 3U30C 4XCCH 3EDEA 1MCBA 4QRTB 5D96B 1TZGH 2Z8SA 4ZOEA 4XZUA 2YKLH 3U1SL 7FABH 5FKAA 1RZKH 1BJ1H 3HC4H 1XMWA 4G6JL 2ID5A 1ZXQA 2WNGA 4QRPB 5D72L 4R26H 2H6PA 4MNGA 3ZE1E 3DXAE 1IKFL 1LD9A 3V4UH 2VLME 1RZFH 2KUTA 2ADGB 4ZFOB 5K9QI 3JUZA 4Q9QH 4HKZB 5IJVA 5T1DL 1QBMH 1PX3A 4O5LH 4PGBB 1Z9LA 3DI2B 1NFKA 1V3JA 4XCYB 1B0WA 5E6ZA 5LBSH 2OL3L 4EXPX 3HZKB 4AIOA 1QTYT 3GNML 3A6CH 4WI9A 4QF1B 3KPMA 3RVUC 4B7IA 5E5MA 3BYTA 4LCYA 3RJQB 1CK0L 1F11A 1YEKH 4H88L 3OG6B 3PQYD 4UINL 5F7UA 4TRPL 5LWYH 1J86A 4WO4A 1EGJH 5C08D 2UY6A 1C5BL 2PCPA 1NUNB 3HC0A 4JRXD 3AU1A 1I3GL 4JREC 2EH7H 3KXFD 4FFYH 3U2SB 1CT8A 2BMKA 5EH1A 1I1AA 3O9WA 1JI2A 4NKOB 4XCFH 2VDNL 3NFPB 1OM3H 1ZLSL 3SJVD 1LE5B 4YC2B 2J8UB 2CO7B 2A0LD 3FQXB 3QIWA 3LMJL 4HS8L 2YXFA 2ZNXA 3DXAD 2F53D 2OL3B 5EOQL 1KB9K 3V0AC 3MCLL 1YJDL 3QUMH 4POZC 2WUCH 1EBAA 1C7TA 3LSOA 4ENEC 4PRPE 5DJCA 3HUJF 1T6VN 4HWBH 4X4ZA 3HMXH 4N1EA 2BY3A 5BRZB 4LCIH 3RWCB 3WNNA 2R1XA 4WU7B 2BSSA 1IGJA 4U1HB 4Q9CA 3MGAA 5D1QA 4XI5C 2AEQH 3NOIA 3K74B 5JXED 5LAXB 1NFDB 3DOSA 5IBLD 1ADQL 2YD3A 1CLYH 1Z3GL 3G5VA 4YXKL 4NN5C 3KLAA 3DGGB 4Y8DC 5I1GL 3SHSA 3MRBB 1T04B 5FM8A 2BJML 4OJFL 3GDBA 2IQ9H 4P23D 4QRUA 4LCWE 1IMHC 1WIUA 1HINH 1UACL 5EUOE 3TPKA 4F7CA 3FQTB 1RIVL 3UZQA 3KPRD 3DV4B 5MP6H 3IAQA 3CSYA 5DJ2A 4PJ8A 5FYKH 1YNLL 1HHHA 3P0YL 3LDBC 1T1XB 4W81A 2FGZA 4AL8H 4CADA 4LHUG 2IEPA 5HI3C 4HXAH 1R5WA 5GJSL 1NCDH 4PJ5B 4FABH 2YD4A 5E2VH 1FCGA 1PKQB 2GK2A 4QRPD 2BY1A 1HWGB 4JFED 4EDXB 2HT3D 5DVMA 2DYPD 2G60L 1TJGL 1IM9B 4EN3A 1T2QH 3SN6N 2KQMA 1ORSA 4GMTL 1XCTA 3QUXB 1P6AB 3LIZL 5D2LB 2UWEB 1FG2B 5EU6B 1FAKT 4HK0A 1D9KD 2PUQT 3T4AA 4E0RA 4N0UE 4HCRH 2VXQH 4R7DA 3ARZA 1PDKA 4LLYA 1KCKA 2B5IC 2F58H 1J8HD 4N8CL 2CLVB 4BUHA 2IANA 1MCFA 3FQRA 3HNVL 4KK8D 2RR3A 3U82B 2HMID 1UH3A 1P7KB 3QHFH 1S7TA 4XWGH 4K3JH 4IDJL 1BZ9B 2X9YA 3BJLA 3NIFE 2XACC 4UZGA 1IEAA 4PP2B 1DEEB 1OGTB 4OLXH 1S7WA 5E03A 3QXAB 5IBTL 2GY7B 4D9RE 4FQ1L 3CZFB 5HPMA 4M43L 3U7YL 3HNTL 5MEND 3ZT7A 3BT2L 2FLBT 5BRZE 1JTTA 2V5TA 4XCEB 3H9HA 4HAGA 4MCZB 5HHME 4K7PL 5EA0L 4W6XB 3SKNA 3Q3GA 1SMAA 4LSVH 5GJTH 2NY5H 1YQVH 3ARVA 3T8XA 3WFEL 5JNYA 2D7NA 1T22A 3ARFC 3LKPA 1SQ2N 5H37G 5IVZA 1MIEH 2YA2A 1EHLL 3E8UH 3IXTA 5TDNB 1FV1A 2R2EB 4P46A 4WHYH 5DGRA 1JNNH 3GI9H 5INCB 1WFNA 3L3IB 3T0ED 3OXRB 2E6PA 4ZUVB 1ND0A 4TUKL 5IFHL 2EDNA 1OT1A 1T21B 4RRPG 2XICA 3MRNB 4PB0L 3DMMB 3HG1A 4XP9L 2W0LA 2YPLD 4JY5L 1BWWA 1T0PB 5IG7A 4Z8FH 1F6FB 3HA0A 1M05B 1VESA 4UUJA 3DYOA 3GJEA 1YECH 3V6ZB 4BFIA 4WHDA 2YR3A 4XC1L 1TVBA 1SJXA 4OZGB 4NQCB 4P23B 5J56B 1P4LB 5K93A 4F8QA 1G0XA 5ICXB 5F3HA 1ES0A 1BFOA 1A6VL 5C0GA 3QUZA 1Y6MR 1XF3A 1L9NA 1A64A 4J8RA 3VFNB 3VXMA 5E24E 3WFZA 2A77H 3GMQA 5IJKA 1N7ML 4ZPTB 2CGRH 4X9BA 5CP3H 3JV0A 2ADJB 3MLRL 1G84A 1YDPA 1G6RA 3FT2B 5F1NA 5SV4A 5JA8B 2H9GA 1WWAX 4R96B 1T80A 4X6CA 2Z91A 3VRIA 4XCNB 1D9KC 2H2SD 2NY2B 1YUHA 3MRIB 3KPLB 3D0VB 2FJFB 4XC1H 4N0UB 4O58L 5CP3A 5KSUA 3VE0B 4APQC 4CW1B 1SMOA 4I2XE 3TM6A 4JM2B 4LIQL 1LE9A 3KNBB 4S0SD 4X5WB 4AMKL 1EO8H 1FP5A 3O6FA 4M1GH 4X6BA 3ZTJH 4Y5YB 4CDGC 2BVOB 1QQDA 3UTSB 1ZEAL 4PR5B 1PSKH 1JPSL 5DHVH 3SDCA 2HRPH 3NPSB 1YEEH 1NPUA 5DTFB 4ZAKD 4HIHB 5KSVB 4LKXB 2DKUA 1T2QL 4TNWK 5FK9A 1D7FA 5FHAL 5HI3D 4BUGA 1ETZA 2X41A 5J3HC 3ULSA 2AJZA 4NM8H 1V05A 4IOFD 4ZTOL 5HVWA 4G8GA 4PREA 1HKFA 1NGPL 3KJ6H 2DIJA 1DEDA 2HFGH 4BFEA 5T33L 4PJ8C 4WUUB 4HJ0C 5ANME 5IK3A 4U1KB 4QOKA 3V2AR 4MCYA 2C4FT 5CJXC 1HXMA 3NAAH 1A22B 5FDYA 4R4FL 1ZLWK 1BX2A 3ARED 5EIQA 5C09A 4YR6A 1WZKA 5DZNA 5EZJB 3F62A 2JB5L 2F8XC 4YHPB 3IFOA 1OTTC 1DL7H 3GSQA 3SE4A 5DD0H 3DVIA 3ULVE 5C71A 5FCSH 4X6EB 1EO7A 1I8LA 4HZLA 2X4PA 1K2DB 2EDDA 4GW1B 3VFPB 2R29L 1IGCH 4FQ1H 1I7UB 3QJHB 3S5LB 1S9WA 2NY1B 4JRXE 4HKXB 5ISZB 2WP3O 4HH9A 4WV1A 2IC2A 4ERSH 4XPFL 1DQLL 4WU5A 5FO9B 4ZUSB 4PLJD 1QEWB 4KVCH 2FR4A 1MQKH 4EUPB 2VERN 2HRPL 1A0QL 4OLZH 3EJJX 1MAKA 3UBXA 2QQNL 3EYQD 3TBTB 2C1OB 4OD2A 4U1JB 5HDLA 4UIMB 4HHAA 5F1OB 3AM8A 5K9JL 4Z7UA 3C09C 2W91A 2I07B 1UA6H 5GRVL 3L3HA 4L8BA 4J3XA 2NW2B 1V5JA 2XKUA 5BXFB 3TWCH 2FO1A 2EZ0D 3GMNB 4LSSH 3L3KA 4YIQB 1J0JA 3HFMH 4PGDB 4L29B 1BOYA 3ARTA 2EE2A 3OZ9H 3KXFE 5E8DH 3SDXA 2ATPB 1RUPL 5I16A 1FFOA 3JWDC 4QRRD 4KVNL 3BSZH 4J3VA 1HI6A 3LKSA 3WLBA 3KS0J 3H3KA 2X5PA 4JJ5B 1CFSB 5E95B 2R9HC 1WICA 5JOPE 1I9IH 2GY5A 1HH6A 4BH8A 4ETQA 5CBAB 1RUMH 1MCPL 4K7PX 4NZRL 1I1RA 2WWMD 4HUWB 4OCXL 4G6MH 1NANI 2ZUUA 3JTSB 3B2VH 5JDJA 2VDLL 1JGVL 4Z7VF 5MEOA 3U4AA 4NKIH 2VITB 1KG0B 1KENH 4HX1A 4F3FA 3TBSB 3Q6FA 3LH2H 1FVDB 1MELA 1YMHB 3VXUE 1Q9OB 2AABH 4HEPG 4GKOA 4ZXBD 3DRTA 1G7MB 3SO3C 4PJBE 3D3VD 2ZPKL 4OKVA 5AD0A 5CD3A 3D39E 1KTLB 5I1IL 3RA7L 1IEBB 4XPAH 5EOTA 1K6QH 1FSKB 3QCVL 4WUKH 2HYMA 2YK1L 3EOYG 1OSZA 4PRIE 3ZMRA 1KELL 3GFUA 3MLUH 3IFPA 1BIIB 1G9MH 2BY0A 1G7PB 3EYVA 3VWJA 2ZOLB 1QNZL 4MJIE 3DSFL 4ODSL 1RZ7H 4MB5A 2ATKA 4MWFA 3D85A 1VKXB 1JP5A 3RZCA 1R0AH 4RFNB 4LSSL 3LHPL 4FQJH 4M93B 5KSAD 4QXGH 4BZ1H 1LWRA 2YPKA 2H2PD 3C5ZB 2YC1B 4J7RA 1C12A 5DUBA 1JK8B 1YY9C 3N1GC 4HK3N 2A74A 4DKFH 3PGDA 3CX5J 1JPTH 5I0ZA 1GGYA 3HG1E 1S3KH 1WGOA 3AC0A 4HGWB 4KGLA 5HY9A 3VXQA 4GLRH 3BSZL 4U3CA 2OS7A 2W9EL 5IMOB 4WFGD 5H35A 1AKJD 2D9QB 4WI2A 5C0DB 5I73B 5DEGA 4FXGB 5JPNB 4M48L 1LO3L 2X1XR 4HFWA 3PGFL 2GIYA 5F89A 1EBPA 4QOKD 4WCYL 4IRZL 1HXYB 2QKIA 4U6VH 5C09E 5HYQA 3U0TA 1RZFL 3B2VL 5F9DC 3RDTD 1OL0A 2J8UF 2ZCHL 4U1MA 2DL2A 1HIMH 4EZMA 2AXFA 2FH8A 4NDMA 3T65B 4FQJL 1VPOH 3UTTA 1T1YA 3PIQA 4PJIB 3GRWL 1QHPA 3DMMD 5CFHA 2GITA 4Y5VA 1MI5B 4OF6A 4ZPVA 3FMGH 3QUXC 4S1DD 1I4FB 5EU3A 2CK0L 1FGVL 4ZG1A 2VDQL 1ZA6B 2CSPA 2XG4A 4LIQE 3STLB 5TE6H 1QSFE 4FABL 3PUCA 1S7QB 4QNPF 3P9LB 3L1OH 3U48A 4HS6B 1SVCP 4JO4H 1FNEB 1EHNA 5GGVY 1UQSB 1LEKA 1KIQA 1A1OA 4GAYB 1ZHKA 4Y7MA 1RHFA 3Q5YA 4QXGL 4BZ1L 4HAFA 4LKCB 5EBMA 5B38B 1TVHA 1GC1H 1GCFA 1MHCB 2VL5A 1XH3B 5IEKA 3OZ9L 3OKMA 4FQPA 4NRYB 4WGWB 4MHHI 5F9OH 1NCCH 4G9FD 4OF7A 3FO9A 3O8XB 3S96B 2X70B 1FGNL 4FS0A 2CIKA 2BVYA 3CAFA 3F7YA 1EO8L 3L5IA 2G9HB 4XAWH 3SE9L 5D7JA 3RJDA 1RUML 3TBYB 1KCRL 5DVLA 5BV7B 1MRCL 1IC5L 4NQEE 1S9VB 2FECL 2KDGA 5ICYB 1PLGL 1R5IA 3RIFF 5FYJL 3HZMA 1MCWW 1L6ZA 1KNOB 3QQ4A 4UAOC 2I5YL 2MFNA 2AV7B 4LBEA 3TO4B 5I66A 2ZSVB 1UJ3A 4GXUN 3IF1A 3MLVL 5HYJA 5HPOA 3IKCA 3L7FB 2Y06L 3N85H 1TZGL 1T7VA 2P8PA 4Y8AA 8FABA 1MUJB 3PDGA 4IRSB 4F7MB 3RA7H 3SY0B 3VXUA 1OAKL 5TH2B 3GBMH 3ZZ1A 2NY1D 5KVDL 4H8WC 1HQRA 1R6VA 3TH3T 1JE6A 3BD3A 1BBJA 4TOYH 1JYVA 1PAMA 4X99A 5F97E 1XIWC 2C1PA 1G7IB 3LV3B 1BIHA 5C2BH 4FFWC 4F2MB 2JCCE 2JB5H 4NO3B 4XHJC 3DO3A 2GT9A 4TVPD 2HVKA 4ZO6A 1L7TH 3QUZC 3TNNB 3WN5A 4F33A 5FO7A 3RAJL 5FM5M 3HE7D 2JJUA 3GM8A 4QHNB 2IALA 3MRPA 3NFSL 1BECA 2DJ4A 2YS4A 1UWEL 1QLFB 1HHGB 3KYKH 2UZIL 4PJ7E 1KCVH 4M8QB 1TDQA 4P2QD 4POYA 4XPHL 1KB5B 3VGHA 1GHFL 4WO4D 1MCDA 3FQUB 5HD8D 1H3PL 3DRQA 3U7WH 1OTUD 4HGKC 1NC2D 1QSFB 1A6VH 1D9KB 3FRUB 2Q6WA 4QY8A 5ABDE 4LRIA 1CTOA 3KXFA 5BZDA 3UTZA 1KTRL 2FIKB 3TVMA 1CR9H 1Q9KA 4QYOA 5SWQB 4APQB 1H3VA 1RMFH 3CLEL 3WO4C 4TUJB 2WSKA 3T4YA 2KKQA 5D1QC 1FN4A 3JWDH 4P4RB 3MLRH 4J4PA 5I6XC 1KEGL 2VLLB 4MAYA 1CICC 1D6VL 3HN3A 1YYML 3SGJA 3RWJB 2YRLA 3F5WB 3NIDF 5KS9F 1Y18A 4Z5RA 3QWRD 5SWSD 1VENA 4X4XB 4ELME 5FECB 2YUXA 4DK3A 1U92A 3AGVA 1MFDH 4XNZB 2LTQB 1E4KC 3EYUL 5BZWA 2J5LB 1ZLWH 3P4OA 3S6CA 3WHXA 5CEYB 1GC1C 1AY1H 3FB8A 1YEJH 3ISWA 5JOFA 3GIZL 4LVOC 3BUYB 5GS1A 3P9WB 4PD4J 2EKJA 3F6LA 5D1QD 1CS6A 5DA0B 4E5XB 1WWCA 4QGYA 3W11D 5TPWH 4O51A 1A8JH 2DI9A 5E0QA 3L5XL 2HT4D 1MRDL 4HLZH 4K3DL 3C2AH 3VXRB 4YNYB 4EDWH 1FNLA 3QO1B 1RQ5A 3AMLA 4XP5H 2ENYA 2XYCA 3JWDL 4NQXA 2X89D 1I7TA 3NIFF 4OQTA 4AEIH 1IFHL 3VMPA 2B8OT 4RFOH 1HDMA 2NXZC 1WZMA 5GRZA 4F9LA 3ZYOA 4P5KB 3GI8L 4N0RA 1A7OH 2IGFL 4Y5XA 2DIAA 2A6IB 2R69L 1EFQA 3M17B 3MRJA 2P44B 4JFPA 2AEWA 4HWZA 3U7WL 2NY5L 3WFEH 2R56L 4QXWA 2C7UA 1DBJL 3FOLA 2RGSA 1G6RL 2NXYB 1TNNA 3UC0L 1X4ZA 3KWWA 5LG1A 3G5YA 5E2VL 4M3KB 4F9LC 3GMLB 5ENWA 5IR1B 2F54D 5TF1L 3LKRA 4L8SB 1ED3B 1JNNL 3GI9L 3IKKA 1NAKL 1FZKA 2LABA 4R4BA 5F6HJ 3TP4A 3MBEB 2DQEH 5DMIH 2QR0B 1AGFA 5FYLH 2HH0L 2C4FU 3BKCL 1D5XA 3GJFK 5JPMA 4NZUH 1N4XH 2QLVB 3C60D 3DSFH 3EUUA 4ZYKB 1ZLVH 4MJ6A 2VKXA 4JDTH 2R1YA 1MFDL 4U1SA 1MCIA 4P4KA 4WTZA 3WIHL 4DW2H 2YD6A 4OBRA 3IETA 1S9XA 1U8LA 3O9WD 3HZYA 2CLRB 4PJFA 2F58L 4L9LA 4X0KB 4KRPD 1LP9E 4Y4HD 4HLZG 4PBWD 3EOBA 5DK2A 4L9DA 5AUMB 3DX9B 2XFXA 2IH1A 4XMKH 1DSFH 3FB6A 2YZ1A 4MSWB 4N8VA 4JFDB 2GSIA 2I60L 5EZOH 1MH5A 1WAAF 4EIZC 3S37H 4PJXA 4U6VL 2XWBB 1WZ1L 4UILH 1A1NA 4HIXL 2JCCA 3ARWA 1YN7A 3VD3A 5T3ZL 1J1OH 3LQZA 3SKMB 1KPRA 2CDGB 3DHMA 1JVKA 4D3CL 3BXNA 4GFTB 1EAPB 2BHUA 2XZZA 4R4ND 1VADA 1KEMH 4YWGL 2AJSH 4PJ5A 4WGVB 5E2WH 4OI8A 3L5WA 4YQXH 1MVUA 1NGYA 2ICES 1Q38A 3B9DA 1PKOA 4JGMA 1SYSB 4HK3J 3QULA 1H8OA 4LNRA 1N5YL 1IGIH 1YY8A 3QCTH 2EDJA 5DA4A 2V7HB 4G42A 1I9RH 4PV9A 2XWJB 3AAZA 3UTPD 4JO4L 4K94L 4OLWL 1FG2A 2W60B 4RMRA 3QFJE 3Q1SH 3E6FB 1CQYA 5IB4A 5LCVL 3U9PL 3QCUL 1ITCA 3IDYC 3MRHB 5HYSG 1YPZF 4LLMA 1AR1C 1EHXA 4M61B 3MV01 2CLVA 2P47B 3QEGH 3PWUA 3EYOB 1JWMA 3E3QC 1A7QH 4FZEH 4I18B 3SKJL 1XF2B 1I3VA 1YEDB 2BC4A 5CEZD 2B2XL 5E94A 2UY7A 4FQQA 2CH8A 4WW1A 3TA3B 1BZ9A 3QWRA 5SWSA 3C5ZC 4KDWA 4EN3D 5DJ6B 2OLDA 3L95B 3TGXA 2OXHA 1LDPL 2X2YA 4KQ4H 5BO1H 3BGFB 4R2GB 1T4KB 2PW2B 1UXWA 2IPTL 3BVNA 3HUJE 1FO0H 4K71B 5I76B 4D9QE 4M7ZC 3P4MA 4PTTB 3X3GL 2UYLB 3M45A 3DROB 3BFOA 3VXPA 2WBJC 4GBXA 5FA4A 1INEH 4XPTL 4NT6B 3RUGF 5KVEL 1CBVL 2DKMA 4OCWL 1A9EA 4X7TA 4BFGA 1ZTXL 1MIMH 2NY4D 1T22B 3EO1A 4IMKA 2M26A 4KVCL 3FO0L 3LKPB 4MD4A 3QWOA 43C9B 1G7QA 1YEKL 1EEZA 3MUJA 2O5XL 4PJHF 1FV1B 5D5ME 1R3LA 3OKEA 4G6AD 5DD1H 3QEQB 3BH9A 1C16A 4ELKB 5ISZE 3O2DA 3BP7B 4PJDA 4Y4KB 1MWAB 4HPYH 4CN6A 3QZWB 1INQB 4KQ4L 2XG5A 3CFEA 5K9JH 1Q72L 3SDAD 4NRXB 1T7XA 2PTVA 4HW6A 4YPJA 3QA3A 1DBMH 5FDWA 2BNRE 2DQUL 2BVQB 4FQIH 3QR2A 4ZTOH 3WFBH 4X9HA 3S36H 4NYLB 1ZANL 3RWGB 3TN0D 1INEL 1XGUB 2LFGA 2G75A 1MY5A 2WUCL 2VXVL 1P4BL 4KTDH 2R2BB 4XNQB 4U1NB 1DQDH 1OLLA 3DUUB 4ESKA 5I1AB 2ESVE 2W9DL 5JOEA 3O6LH 2O5XH 2GKIA 3ZKXB 4Y2DA 5CP7B 4JFQA 4LHQB 4X4YB 3DMMC 2FD6H 2NR6D 5SX4H 4MDJA 4DVBA 1W72L 4X8JB 4NQSB 2VLRA 2H9GB 1KELH 4LPVA 1N6UA 3S35H 3RGVC 1DBML 5HVHC 4L4TA 1MHEB 4DCQB 2XQBH 5ERWA 1MJJA 1PZ5B 1E4JA 2YEZB 4KK9C 2C3GA 5HDQH 4D8PA 1S7UB 2DWEA 3R4DA 4KAQH 4JZJB 2NY3C 3WKNA 4MXWL 2Y5TA 4UNUA 1K8DA 4K8RD 2PXYB 2D7QA 2YD2A 3QISA 3D18B 1A21A 2ZUWA 1QA9B 3BQUD 4GAJL 5CLWA 4D2NA 2OJEB 4ZAKB 2WW8A 2CRIA 4HIHA 4KJWC 5KSVA 1GZPB 1Q72H 1U8MB 3V4UL 5HI5C 1T1WA 3BESR 1YPZE 2BY2A 4O2FA 2ICWA 3LRGA 5M95B 3X14B 3ARDB 4FTVB 3TYGH 2P8LA 4X7EC 4NCC1 5JIPA 5IB3A 4MVBD 5DI8B 4M6NL 2CKBA 4OLUH 4JPVL 3VFVA 5I15H 5GGUA 2IMNA 3PWPA 3L3OB 4KK6C 1CG9B 5FM5O 1DQDL 1XGYL 2AXGA 2HP4A 5E4EC 3WUWA 1A4JA 1AC6A 2DDQL 1RUPH 5CIPH 3WNMA 2LAGB 1D6EB 4ZNEA 1EGJL 5FUCC 1XGQA 5DJ8A 1OP9A 3WFHB 4QRRA 1MJ7L 3MFFB 1I1AD 2V2WA 1FORH 3VXSB 1KFAL 5EBLA 3O2WH 5CEZE 1J10A 3MJ8B 3BD5A 3VFWA 3VG0H 5DJDB 4RISL 3MBXH 5D71H 4GKSA 4ZSOB 3ROOB 2BNRB 1FIGL 3QIUA 4PJ9B 1Q9WB 4Y4HB 4HKXA 4IDLA 3TH2T 2IPUG 1KCSL 3AREC 1SEBB 1U41A 3MGOB 3QI9B 1MLCB 3QDGE 4XH2B 3RKDC 3EO9H 1PQZA 3M07A 1CXFA 2YOCA 3UYPA 2RB8A 4WENB 5E00A 4FXKA 4F37K 3Q6GH 4P2OC 3HZVA 5C09D 3WDIA 4FQXA 4P9HL 4WFEE 3TO2B 4A2LA 3BIKB 3BX7C 4HUUB 2HLAA 4M3JA 2H1PL 3SE4C 4I2XB 1CZ8H 5C6TL 3TT1H 4B41A 3BGMB 3OAZK 5DJ0B 3HMWH 4HUVB 1GVIA 5H94B 2I9TB 1DVFC 1EJOH 3JWOH 4DEPB 1EXUA 1SY6L 4UI2A 4OFPA 5DT1H 3ILQD 4Y4FC 2F53B 2Q3AA 1VCAA 2VDPH 1TJHL 4KJPD 5DGQA 4BH7B 5BV7H 5HYSB 4MX7A 2GAZA 5JW4R 4OGAC 4Y89A 4ODHL 3WIHA 3HCVA 1N8ZA 1U8KA 4OD3H 3VWKD 1AO7D 2VJXA 5ESQA 3MRCB 4GUPA 3V0VB 3RL1B 3SKOB 4TSAL 5KOMC 4YDVB 5HHOA 4KZDH 2DQTH 2Z8WC 3NZ8B 3CXDH 4YFLI 1CYGA 5FYLE 3NFNB 2OR8A 1MJ8L 3IRZA 4F15B 1XF5B 4HKJB 2ZNWA 3EOAB 4CN1A 3O3UN 4U6XB 3UPRA 5F7FA 1P4IH 4XP4H 1BEYH 4QRPA 5MEPB 2VLJD 3MZTA 1H3UA 1QYGH 5M94B 3CXHJ 2VDML 2XT1B 4OZIF 4RMTA 1U8PA 1RD6A 5JQ6L 2VLRE 4KUCD 3DGCR 4J23A 1YMHA 4WWKB 1OTTD 3KPNA 4Z95H 2R23B 3DX7B 5F8RC 4NQEB 4JFZL 4LASH 2BCKB 3A6BL 2NX5B 2VLRD 1F4AA 4JPKL 3S88H 3SGKC 5C0ND 3MBEC 3QH3A 3ARGA 3KYKL 3QDMD 5JOPD 2YBRA 2DQHH 2X40A 3GMPA 5KBNC 4RDQG 1GGBH 3QIBC 5ADPL 3C6SB 3GKWL 5K9KA 5GJTL 5I71B 3KPQA 3UAJD 3IDGB 3ZKND 1MCHA 1HNGA 2JJVA 1GOGA 3RGHA 5GGSA 1PSKL 1JPSH 4ZUWB 3QDGD 1XGRB 3H7BB 3V5HB 2YWYA 2VAAA 2A6DA 3FB7A 1I9JH 4MNGE 1DBAH 5I15L 3CIQA 4WY7H 1LE5A 3BGAA 1I8IB 3D3VA 5IBTH 1WSST 2YA0A 1CFNA 1W0VB 5DQ9B 5J6HB 2W59A 3KYMB 3WFDL 2FX8H 3MJ6A 2DQTL 4YXHH 2EYTA 3GB7A 4G7YL 4PRID 3LEXB 1NCCL 2CKBL 5F7DA 1TNMA 1YECL 2J2ZA 3BRDA 1N64L 4ZFOL 5DXWA 5I75B 4AM0A 2NZ9D 4OZFG 1YQVL 3VWJD 2VQ1B 5EG6C 4KC3B 3UZEA 3W2DL 3TCLB 1BJMA 3QG7L 1NGWB 5LGHH 1YMMD 5I1HL 4P46D 2X4NB 3NN8A 4MS8C 4B7LA 1KTDA 1KSRA 1T03H 1Y0LA 2DQJL 4LEXL 4ZS7L 3NH7L 5A3IC 2P5WE 1B2WH 5EU5B 5D6CB 1OTUC 5IFHH 3K2MC 3I6LE 3O2DL 5BVJB 2R39A 3SDCC 3BDXA 4M1CD 4ODVL 1FSKC 4UBDC 3V5KA 2AVGA 2I5YH 3I6GB 3DIFA 3OHXA 3KLAB 2ENSA 4K8RH 1P7QA 1MI5A 4U6TA 4MDIA 3GI8H 1UH4A 5HGHB 3ULUL 4Q2ZA 4IJ3B 5IROA 1J11A 4XPFH 1MY7A 5E9DB 4L8DA 2V2XA 1CDYA 4XP1L 3VWKC 5C6TH 3QRFM 5C07B 3E0GA 3MGTB 3LZFL 5TDOA 1HQ4B 1EJOL 4MB4A 1A7RL 2AS5M 1UQSA 5E4IA 3IB4A 4D0BA 1P2CA 1FL6A 2VDNH 5DC4B 5JQHC 5FKAB 4I5BA 3VFRA 4AG4H 4FQXD 1A6TB 3UTTD 3V6BR 3OF6A 2EDYA 4DN3L 1GXEA 1AGBA 1TTGA 4O9HH 1V3LA 2VL5B 1TPXB 3IVKA 3QXTA 3JXAA 4PG9B 1NCAH 1S7RB 1NCTA 3SJVE 1EVTC 1UWGH 3RWIB 3VG9C 2X1PA 3T2PA 3SDDB 4R90L 3P73A 1RK1B 5LGKA 3OWEA 1NAMA 1KCVL 3WNPA 3E3QE 3QQ9D 3I6LD 1XCTB 4MAUH 3NCCB 4HBCH 2Z35A 2CDEB 5C08E 1OTSD 4X6CE 2JKXA 1Z0NA 5GGRA 3HZKA 2RCSH 1QRNA 4NNXA 2IAMC 5IHLB 3KPMB 3MC0A 2OK0L 4JO3H 4LSUH 4YHKH 3EAKA 2QJDA 2BX5A 3THMH 5FGSA 4YXLL 1UB6B 4HWNA 2RIKA 2F15A 3TVMD 3RPIB 1RMFL 2R0LL 2J6EL 3VGEA 1FVEA 4NHCL 3VD5A 4FP8L 4RNRA 2AK4A 2AP2A 3H9SD 2VB5A 4OLYH 3QP3A 1BVKB 4OJFH 5I66B 1I7ZB 1OSPL 3MV8D 1FLRL 1FH5H 1IEAB 1HH9B 5IQ9A 2P8PB 4GMSL 3FT4B 5C0FB 3ARFB 3ULUC 5A2IH 1E28A 2OJZL 3N9GL 3B5HA 3NCMA 4J6RH 5F1IB 3CZFA 4LCCB 4NZTH 1NBZA 1FL3B 4JZOB 4POZD 1ZHNA 4LEOB 3UCRA 5ADPH 3AB0C 3MRKB 1UVQB 3G6AA 1FL5A 1ZHLB 4JO1H 4NUJA 3C5SA 3EFDH 5EIVA 2GT9B 3AXLB 3EDDA 4GQPH 1K5NB 3ARGD 3BI9X 3OGCA 1DUYB 1KT2A 1JIBA 1MAJA 4P46B 1LP9B 5LAXA 5DJAA 4H20H 1RZGA 3LN5B 3O4OB 3JZ7A 3V6FA 3X17A 1BQSA 4MA8L 3FQUA 3V4VH 3BP6B 4IOSD 1P4BH 1WVZA 2FYYA 2IFFH 4UTBL 4X98A 2PTUA 4P48A 4H26A 4QY8B 1BVLB 1AQKL 3V6ZA 1Q1JH 3D69B 4G6FB 3HNSH 4RAVA 4IIQB 3FQTA 5D93B 2VZTA 4R8WL 4CVZB 1UM6L 1NFIB 3MNVA 4ZTPL 5F3HB 4M48H 5AZ2H 1BQLL 2GFBB 3ZYIA 5FYLD 2PXYC 5SX4I 1I9IL 4QTHA 3ZL4H 3QZWG 3RWJA 3ZDYE 2CR3A 3EZ8A 3S98A 5L0QB 3IS1X 3GSNB 4Z0XA 3LEYL 4P59H 4LU5H 2BDNH 4LQFH 2XN9A 1U92B 4ZXBB 1BD2B 3MA9L 2IMMA 4OGXL 5DSCB 3FFCB 1XCQB 3SCMA 5L2KE 3WHXB 4NKIL 4MA8H 3HFML 4X6CB 2H2PC 1RK0B 2NPLX 5HGBA 4D9QD 4MNQD 4FFVC 3ARDC 1AO7B 5M7QA 2IFFL 4JY6A 1YUHB 3MRIA 2Y7QB 4OV6F 5KOVC 2KPNA 1IGTA 4WDIA 3QFJB 2HWZH 1E4KA 5EU6A 4DQOH 4A6YB 3RGVA 4F8TA 5B8CA 1OF2B 1DR9A 3WDJA 3V7MA 4S2SA 5ALBL 3W9EA 1JNLL 3HAEB 4OI7A 4M02A 5HGDA 3L5HA 1HKLL 1HSBB 5F72S 1H9VA 3WEXA 3KYOA 3D5OF 1PYWB 2HAZA 2R4SL 4OV5A 5AAWA 2DTSA 1FG9C 3MLWL 1M7IA 5FF6A 3MACH 1NMAL 2QSCL 3K2UH 4R3SB 3OF6D 3WO4B 5ITBH 1DEEA 5I1LB 1CXHA 1IGML 4JN2B 3MLSL 3KWWB 1RZJH 2ZPKH 2J1KA 3QBTB 4ZFGL 1W0WA 4PJ7B 5AZ2L 3G6DH 1QVOB 3H9HB 2WWMC 4GRMA 3G5ZB 5JR1H 2QR0A 1AGFB 2QQNH 2E6QA 4OBSA 2RFXA 1G7JB 2BRRL 4U1GC 3PDOA 1WCQA 2Z8VC 4WFHE 4PJIF 1A6WH 1UA6L 5KSAA 5I9QB 2HT2C 3IETB 5IFAL 2X4PB 15C8L 4RGMC 1E6OL 1FC2D 3LMJH 4M6ML 2ZUTA 1FAIL 4JKLA 1ACYH 3GRWA 1OPGL 5TQ2L 5F7NC 3EOBB 5ILTL 4NSKA 2HFFA 4DGVH 4OQTH 3I75B 4N8VB 1BF2A 5E6ID 1XAUA 2OM5A 2ITDA 3RVTC 3BDYH 1DBBL 3P40A 5ANMA 2Y9RT 3SDYH 2X7LA 3LRSA 1DQTA 3MSPA 1CXIA 3HNVH 2E7BA 4KHTL 3KPTA 2MWCA 4OCYL 5IW3A 1KIPA 1NKOA 4KRMB 1Z6JT 4K2UH 1Z5LA 3RNQA 2QQKL 4PUBL 3DX6A 5F9WB 4DOHE 4G80B 4PLJC 4PIRF 4NO5A 3FFCE 4JGJA 1IJ9A 1AGDA 3OKLA 4ONFH 1KENL 3DXAB 3QPQD 4JFXA 4QHLA 4UTBH 1IKNC 4EBQH 5F1NB 4R0LC 4AIZA 1GGTA 3ULUD 4YBLC 4HS3A 4UDTB 4WEMB 4JCMA 1NMCC 4LNRB 1WWWX 4MNQB 3QXVA 4QHMA 1TZHB 4WUKL 3F58L 5D7SL 1U8HB 1KN2H 3QSKB 4IOIB 5GSRA 3BMWA 5IESL 4MQ7A 2OBGA 25C8H 5DUMH 2V2TB 2MNUA 2X09A 1KC5L 1WTLA 2YPLB 4L3EE 1SJVA 3UTSA 2W07A 2X1QA 1FFPA 4AQOA 4L9LC 5HJ3B 5ICZA 1HHKA 1PX4A 1G0YR 4UQ3A 1MFBL 3HS0A 3IGAA 1NFDE 4W4NA 5DJXA 1IAMA 1QBLH 1YEDA 1NCNA 5DK0A 3VDBA 3N0PB 1I9EA 2DQHL 3ALPA 3FTGA 5I74C 2I9LA 3EFFB 4HFUH 4PJHB 2GCYA 1HHJA 5ACZA 5IB5B 5AD0B 3LQAC 1AXTH 1JPST 2ICEA 3KAAA 4GO6B 5EORH 5I76A 3MBXL 1U95B 3QIBD 5D7KE 1CDJA 2JK5B 3LAFA 4Q9QL 4XX1G 1N3NB 2NYYD 1XIWA 4KROB 2QQKH 1CD9B 3IDYB 5CKAA 2R8SL 5FYKE 2ZKHH 3VXPB 4MA3A 4H25B 12E8H 1NDGA 2ZCKL 5GS0H 1M71B 4GBXB 5FA4B 3QHFL 4JFDE 4XX1E 3DARA 1RIUH 4PRNB 2HKFH 1XGPB 4OZFA 4AEIL 2X4OB 2E5EA 3N50A 4JM4H 1URLA 4LLQB 5F7EH 3NA9H 2DD8H 5KSBF 2D9CA 2FX8L 3UJTH 3IU3A 4Q74A 3GGWA 1RU9L 1R3LB 5F88B 3CZJA 4YHML 1JK8A 3PV6A 4JO2H 2GI7A 1LGVA 3MJ7A 4XNYL 1JPGA 3EOTH 1UZ8B 4HFUL 3OR7B 4EI6A 3NCJH 3JWOC 1C08B 1VFBB 4JO1L 5JPNA 4LLDB 5LVEA 2D0GA 2P43B 4Y16D 5HHNB 5CJOL 4DK6A 1OB1B 3JV6B 2R8SH 5KSBB 2VZUA 2O61A 4J1UA 2Z31D 3IDMB 4MXQC 1EX0A 4WI7A 5HYQB 3GSWB 3LOWA 3OR6A 1CFQA 5E8EA 4ZUTB 4WUUD 1DDHA 4U1JA 5TF0A 4U0QB 1X5FA 3HPLB 4XPBH 4TUOA 1TLKA 4JKPL 2A1WH 1ACYL 3EJZD 3F12B 3PWPD 5BOZG 3B2UC 4O2EA 4M43H 2AXHA 1PKQE 4P2QA 1P6FA 2SEBA 4PRBB 3UJTL 4BKLA 4XVJL 4MLSA 5T33H 3KPRA 3PL6C 1F6AA 1DQQB 4M7ZB 2AKRB 1SYVA 3SGJC 5TQ0L 2D7OA 1G9NC 1T0NB 1I8KB 1NSNL 4KMQA 4L29A 1DVFD 2PYEA 3J7HA 4HIIB 5DRXB 2WBJA 3JWNC 3OX8A 2ATPA 1SBBA 3INUL 4F58L 1MCKA 3RWFB 2UWEE 1NAML 3FZUD 2Q86A 1R3HA 1T1ZB 5CSBA 1BWMA 1WAAA 2UV3A 1MRDH 3QNZA 3MCKA 1FNEA 3VXME 4JZJA 1YYMH 1KIQB 3QUYC 2Y5TB 4JFZH 4ZOCA 4KDVA 4LKCA 2GW5A 3RVWD 4F80A 1MLBB 4HXBL 1OGAD 1H0DB 1MPAL 3DUHA 1JZ5A 4F37F 3N85L 2EEBA 1HZHL 3LB6D 4YDLB 1I7RA 3QEQD 1CDUA 1U8NB 3BP5B 1ZLVK 1T6WA 3CPLA 4KZEL 1MRFH 4W68A 4TOYL 3C6LD 3FQWB 5DF0A 1JGEA 5DT1L 5E8NA 1TCRA 2OSLA 3I02A 4OZIE 2CKBB 3QEQE 5D7JB 1CD1A 2WQ8A 3U6RA 1OSZB 3ZKXC 2AXGB 5ICYA 3OJDB 1DE4B 3NFSH 3LIZH 1BIIA 1MFBH 4OD3L 5DFWH 3BQUA 2DMCA 3I9GH 1CD0A 5DLMH 4N1CA 3G08B 2D3VA 4UNVA 1IM9D 4QKXB 3RY6A 1RUQH 3KJ4B 3VXSA 4P99A 1BBDL 3C5ZA 5B39B 4X83A 3QXUA 4WHTA 1ZMYA 3PP4L 5I1HH 1CFVH 5E9DD 1R3JA 2NY3B 4OUOA 1G9EA 1MLCA 3OKDA 3J8F7 5C0DA 4FXGA 4CU6A 3HR6A 1FNSL 1H15A 4BYHA 2YA1A 4IIQC 4Z77A 3MRRA 2F19H 3TPUA 3CC5A 3VFGL 2PR4H 4XAKE 2HT2D 3W0WD 1HN1A 3U0TB 1NANH 2MTPA 3RWCA 3TO2A 3GHEL 1CLZH 2R1XB 4HUUA 5J13B 2D4DA 4XPGL 3FONA 4GW4B 1LO5A 2HJLA 4XC3L 5B4MD 1FFNB 2BSTA 4NOFA 4AYFA 2Z92A 3HI1B 5DO2C 4XCCL 5DUPH 4U0RC 1KJVA 1XF4B 4QEGA 3L3GB 5ID1B 2AW2A 2QEJA 2VO5A 2GITB 4HC1H 4IRJB 4Y5VB 3ZTNH 1YQ2A 4BSVA 4JB9L 2V9RA 4CVUA 3AY4C 3MOQA 3ZKMD 3PHQB 2ORBL 2Y6SC 1U8JB 3FRPA 3FO2A 5D1ZB 1UB5A 5J12B 4D0CA 4LLWB 1FNSH 1ZV5A 4FP8H 4KU1A 4P49A 4WNQA 1DUZB 1KF9B 1WFUA 1YPZB 1EJ6A 1X5HA 1S9YB 3UPAA 4FTVE 3O3EB 2CUMA 3ZDZE 4NCDA 1A02N 4ZUUA 3NFNA 5JLZB 5HHQB 3BZDA 3HI5L 1UM5H 5LBSL 3FRPG 5DMGD 1LO0H 5H2BB 3UZVB 1FCCA 1JHTA 3NCYS 4KK6D 5C0EB 1N6QL 1CCZA 4L3CA 4I3SH 4NFDA 2YZ8A 1RZ8B 2ADIB 4NC1E 1AJ7L 2ILLA 1PG7X 2BOBB 4RA3A 3ULUF 2A0LC 4NP4L 1SJHB 2VC2L 3GSXB 1J18A 2AJVL 4Y5XC 2W0FB 1YMMA 2OTWA 1ORSB 1JNLH 3VWKA 4PS4L 2XXCB 3F7YB 2UWEA 4AH2A 3VD9A 4MA1C 1J0KA 4OLXL 5ID0A 3S3JA 3T4AB 4AT6A 3IXAA 4JANA 4ODTL 4TVPL 5K59F 2EIBA 1NCWL 4K07A 1TFHA 2OQJB 3H9YA 4N0FB 1KTKE 1R5IB 3RWEA 4K8RC 1SY6A 1JRHI 5BCAA 4TVPE 1E27B 5D1XD 4XPTH 4L8SC 4WFFD 3KLSA 4NIKB 1CF8H 1X5GA 1EDQA 4PY7A 4P5MB 2IPKB 4Q7DA 5I9QC 1JNJA 1AQKH 2FO4B 4LVEA 4KRNA 3FO1B 3RWDB 4GKZB 3C8KA 4TSBL 4KFZC 4YPGA 5JXAH 4XB8A 3TJEH 1U6AL 4IRSA 2UUDK 1OGAA 1K6QL 1D5IH 5D70H 3BZFA 1VEOA 3PQYE 1QLEH 3K46A 3LKRB 4EQ2A 1CFNB 3B83A 4MD5A 2Q7YB 3QDMA 3K7UA 4XCEA 1GSMA 4QNPE 3BN9D 3RI5F 4R90H 3WFBL 5CJXA 1RZ7L 3W39B 5DR5H 2J88L 2BVPB 4K23H 1BOGA 1DFBL 5I8KL 3V8OA 1T20A 3IDNB 1S5IH 4JHWL 5F7KC 1QLFA 4Q6IB 4PJEB 3QG6B 3WLWC 2CLRA 1CE6A 3TFKC 4PTUA 5JXAL 5IROC 4K3DH 3SGEH 5JIIA 1NCBH 3R0MA 3CFCH 5AUMA 4FNLH 4GW5B 4PY8I 1B3JA 4MSWA 2AK4D 3S4SA 2V9QA 3KXFB 5BZDB 5CJOH 5CEXB 4G6AC 4NQCA 4ODSH 1NC4A 5DMYA 2CLZB 4LVHC 3QO0B 4OGXH 1OAZL 3BPCA 5B4MC 2XTJE 1MJUL 3MODH 3QHTC 2FB4H 4NKDB 2H8PB 4ERSL 2H32H 2OL3H 5D2NA 4JQXA 3WJLA 1PZUB 2XKNB 2VLLA 2VH5H 2DI7A 1XF3B 5TDOB 1C1EL 2H26B 3H42L 1A3LH 3MLZH 3BXNB 3RTQB 1G6RH 3D0LA 3QYCA 4I0PD 4M1GL 4JFFE 1QFWM 2PF6A 3VFRB 1OARH 4KGJA 3TIEB 2HJFA 4X8XA 5DRNB 4XHQA 3TJHC 2ADJA 4DWHA 2IAMD 4N68A 1A6ZB 1YDPB 3O6MH 3CUPA 5FGCB 3P4OB 2ESVA 1OTSC 6FABH 4D0DA 3S7GA 1MI5D 4HWEL 1KBGL 5DD5H 3QULB 2H3NB 4NN7C 3SDDA 3DVNB 3KHQA 3P73B 3KPLA 3QUKB 1EERB 4U05A 4L4JA 3EYQC 1HIML 1QR4A 1CD8A 3K0WA 4ZOBA 1YYLH 2BSRB 3MRGB 4ODXA 3TA3C 5IKCB 4IBLT 3TH4T 4GG6A 4Y5YA 2BVOA 4S1QL 2VLKA 1HE7A 1Q1JL 4C56B 3SDCB 2FGWH 1IQWH 3H8NA 1JMXA 2V7NB 4K71C 3PWUB 3IJSA 2R1WA 4JFPB 2GQHA 2VQTA 3T1FB 3H3PL 4CGTA 2EO1A 2E9WA 3K1KC 3MV9B 4G8GB 4PREB 2C7UB 3C6LB 3BWAB 3RUGA 3P77A 4QXTA 4M7LL 4NJ9H 3ARFA 4L8CA 4RZCA 2EKSA 1E28B 3T3MF 1J1OL 4LMQE 2B1HH 2XZCL 4V2CB 4OIIH 1HSAB 4PTTA 4JFEB 4O4YL 4JZOA 2FJGA 4ORZC 3HUJA 1FL5B 4OB5H 4NUJB 4YAQB 3PWPE 4PJEE 5T5FH 2JB6A 3AXLA 3WO3B 3QT2A 1OP5K 3L7EB 1RURL 1F58H 1G7HA 2PO6B 5HXMA 5L8JB 1EEYB 1WCBB 4IEFB 1FYTA 1FE8H 5JDSA 1D5IL 2QHLA 5EU7E 5MENE 4RFEB 3MR9A 1Q9LB 2QL1A 2VR4A 2GK0B 1MRCH 4RMWA 2OMNA 4O02L 4S11A 3LEVL 25C8L 3G5XB 1N26A 3WS6A 4U6HB 3L5XH 3P0GB 4EEEA 4HH9B 4WV1B 3NACL 3HLAA 5I18L 3QQNA 5I2IB 3O4LB 5EC2A 2ZG1A 4NRXA 4JFYA 5B3NA 3IJHB 2CJUL 4HCRA 2GSIB 4G8IB 1QEWA 3IFLL 3QPXL 1ZGLM 4M62H 3UDWC 3ZT5A 5IF0B 4Y4FA 3WXWL 4G8FB 4L1DA 1KIUA 3VH8A 1IZJA 3PHOB 3DLQR 3G6JB 1ZGLP 5JORA 4B0MM 3TBTA 1YNKL 3LQZB 3SKMA 1DCLA 3Q48A 2CDGA 2R2BA 4XNQA 5JMRA 1CXKA 4XCYA 1HOCA 1N0XL 5EFIB 5T5NF 4YLQT 3O8XD 4QF1A 3RX5A 4HKBA 3DBXA 1CIUA 3ILPB 3UC0H 5F7MC 1IEHA 1XR8B 5DJZA 5BV7L 4YIQA 1KPUA 3WD5H 2A6KA 3ETBF 3SCMB 3JBG7 5AYUH 2EC9T 1CT8B 1AO7A 2XY1A 3UYOD 3RNKA 4X7SL 1I1FB 1DBKH 4YO0B 2XWJA 1IGTB 4H0HB 4JQIL 4UTAH 3QJFB 1DLHB 3OB0K 2GJZA 3O81A 1OHQA 4X80H 5CJ5A 3E6FA 4QRSB 4LFHG 5HSFA 1OF2A 1YNKH 4YHMH 2C9AA 2R2HB 5DD1L 5BS0B 2NYYC 2A73B 5FYKL 4JCLA 2Z93B 4LSVL 5F7LB 1TZIA 2PTTB 3NPZB 2EE9A 3BRFA 4K55A 3K8MA 2VSCA 5KW9H 2VDMH 4HX1B 4F3FB 3W11C 4WW1B 1PG7W 2FSEB 3ESUF 5FF6B 5D93C 5I1GH 5KAQF 5C0BE 4NQDE 3M1BB 1S78D 5C1MB 3CK0L 4RBPK 1N59B 4OUUB 2OMBA 2PW2A 2ESVD 1Z9OA 1JPTL 5EO0B 1W0WB 2A9ML 4PJ7A 3RPKA 5MP6L 5A2JH 3LRHA 3RX7A 1JGUL 1EUTA 1WFTA 3TIDA 3G5ZA 2E6JA 2EICA 2X1WL 2FWOB 1G7PA 5IUSA 2J12B 4DTGL 4L3AA 4KKAD 4G9FB 1KIRB 3LD8C 3HKFA 2NTSP 4S1SL 2OCFD 5DEZA 1FRGL 1KJ2L 1UC6A 4P2OB 1JHKL 4P5TA 4HJGB 5EC1A 4Y4KA 3ARUA 3VXQB 3Q0HA 3EHBD 5JIHA 3O4LD 2Y06H 4NFBA 2R2CA 4KHXL 4NZUL 4WJ5A 4OB5L 3Q5TA 1PJ9A 2CKBH 1MCQA 3WFCL 3W9DB 2ZOKA 2A6JB 4J3TA 3QIUC 2LU7A 4L4VB 5ACLA 3KS0H 4YHOH 5D2LF 3UEZA 3FB5A 3BMVA 1NGQL 1GAFH 3WL9B 1RUAH 3DUUA 3GZKA 1Z5LB 1EMTH 1U58B 2X44D 3CVHH 1OAXL 1FBIL 2YXMA 4HUVA 4JHBA 4ISVB 1AQDB 1XIWD 4PJGA 1WT5C 1M7DA 3OAUH 4ODUB 4GXVL 4UV4H 3P3YA 5C0CD 3WIIH 4MDJB 2ADFH 3FL7A 3DJ9A 4P3DB 1P7QD 2X9WA 2O5YH 4AIZB 2NY4B 1WZ1H 4MAYD 3B9VA 3C8DA 4HXBH 1WBYB 5T1MA 2ZG2A 3QDJE 3MRLB 4PJXE 2VOTA 1HILB 4L4TB 4NC1C 5LGJA 2AK1L 2DQFA 3OKYA 3ROLA 1GHFH 5CBEB 4XWOD 5F3BA 3RBSA 2DBLL 2HFTA 2VH5L 3EO0B 4KJWD 4PPTA 4KUZL 5IB1A 3CFBB 4GRWE 4NNPL 2V17H 2D0HA 1XF5A 4HKJA 5I1IH 2ZUQB 1KUMA 3U30B 1T7WA 3LQAH 3OBAA 4GQ9H 3CDFA 1C5CL 1TVHB 4RWYH 5D96C 1HHKB 1T83C 3FFDB 4M6OL 3OL2A 3Q3GB 3EO9L 3H7LA 3HS0B 3TZVB 4PRHD 2DQUH 1IFHH 5H8DA 2WQRA 4FQIL 4O2FB 3O8XA 3FO9B 3HTLX 3MLYH 4NCC2 3U4EA 1F90H 5CHNA 2I9LB 3EFFA 3TV3L 4HIEB 5DI8A 2GCYB 3B3IB 1JRHH 1P5VA 2OJZH 4AK1A 3FKUS 5I1JL 1J05B 3MRNA 1FJ1A 2D7TH 2H32B 5HVGB 4JGUA 3X11A 1EVUA 3VD7A 4DKAA 4YFDB 3T77A 1KOAA 1V3KA 3G04A 1LP9F 1D6EA 5DJ8B 3ARBC 2OYPA 2IH3A 2PO6D 5GGVL 3IF1B 5EBLB 3TN0C 1SVZA 5C0GB 8FABB 5DQDL 4OTXL 2QADC 1UKSA 3MA7A 3LKNA 3O6KH 2DBLH 2HFGL 3OR7A 3X3FH 3QIBA 4F7TB 2C1PB 5J9PB 2EYTB 4LVHB 3DO7B 3LEXA 1XR9A 4R96A 5JHLL 4NBZB 3UO1H 1JTPA 3JV6A 2XOTA 4ORGA 4PLNC 1AXSB 4QHNA 1WBXB 1NGWA 4M5ZL 3PABB 5E8PB 4I2XA 4CKVX 4K3HA 5DJ0A 4ODBD 1KTDB 3R06A 5D1XC 1YC7A 1MREL 1I3RA 1LO2L 4NUGL 4X5XA 3QXDB 3MOAH 3KPRB 5GS2D 4DW2L 3VI4F 3ECBA 2JJSC 5DTFA 3ZDZF 3VFMB 4C57C 4UQ2B 1ZANH 3BKJL 5EOCL 1BVZA 1AGEB 2PYEB 4P5TD 1OPGH 5TQ2H 3TBWB 5AG9A 2AJZB 1N8ZB 1U8KB 1UJ3C 1WC7B 1OLZA 3MREA 3C5ZD 4LCUA 4EN3C 2CKNA 4PJ5D 5HVFB 2E7LC 4GUPB 3V0VA 4XPAL 5A2KH 2BNRD 5L7XL 1CFVL 2PNDA 3HI6H 4WUUA 3HRPA 3BJ91 3O6LL 3U0PA 3AY4A 4FMFA 3B9KA 1KJMB 4PS4H 1S7SA 1IAOB 4NN6C 5ISZD 2B4CC 2XZAH 4QTIH 3VFGH 3PQYA 3U7AA 4I9WD 2ARJA 1JHLH 5D5MB 3X13A 1Q94B 3SCMD 3GMOA 2DM4A 2ITCA 3T3ME 1U8PB 2N7AA 3SDXE 1QR1B 1DQML 4NWTH 1PD6A 3VFOA 3WHE1 2NY7H 4WHCA 1JGDA 4EVNB 3SJVA 2EDWA 5ITBL 1JNHB 4OCMC 3ULUE 5L2KA 3R1GH 4NQEA 4TSBH 4X80L 4G8EB 2BCKA 4DQOL 2Y72A 4OZHA 3SE8L 4PJAB 1U6AH 2F74B 3QCTL 3TLRA 2Y07H 2DL9A 2Z31B 4M6OH 9CGTA 3S3SA 1HKLH 5HHXH 3RPIA 2HH0H 3BQUB 2DJUA 1RY7B 4YDLC 4U3XA 4HJ0D 2APFA 1IM3A 1VACA 4AIXA 1D3CA 5CWSA 2AJYL 1UH2A 5SV3A 1XGRA 1I7ZA 2C1OA 3HMXA 4KI5F 5C0AE 5GZOD 5JA9A 2V5MA 1MF2L 2V5YA 3FOLB 2XKSA 3CK0H 5DHYB 5I1JH 4JHAL 1A47A 1KGCE 1S5IL 1DN0A 2VWEC 4HQQH 1R3JB 4KVNH 1BGXH 2NW2A 1MSPA 2FBJH 1FL3A 4AENB 1Y6NR 4JLRB 4CMMA 2P5WD 2R4RH 1VFOA 3OMZA 5HGAA 4X4ME 3O4OC 4DTGH 4N0CD 1MNUL 4OZIA 2E9BA 2VNCA 1H8SA 3O11B 1VGEL 1NDMB 4XBGA 1AHWB 3NACH 4Z7WA 3SBWC 3F8UB 12E8L 1CXLA 4ZFZB 3P0VH 4K3GA 1LO5B 2HJLB 2UZXB 3C60C 2BSTB 1CIDA 1EGJA 2GYSA 4Y16C 1QO3A 1TJIL 3STZA 1JWUA 5E7FA 1HH6B 5IVOA 3GSRB 5DJAB 3FO0H 4URTB 1YNTB 3L6FA 4YHZL 2FL5A 4RAUB 2NQCA 5ESAA 5GS3A 2DB8A 2GUOB 1BLNB 1IC4H 3D9AH 3BP6A 3RU8H 2VDRH 2AI0H 5HGHA 4CNIA 5I30H 3GJFH 2ADGA 5IOPB 1D5BB 1L0XA 4IS6A 3K4DA 3OKNA 1FLTX 4PJCF 1ORQB 5F9JA 3CDYA 3JTTA 5J13C 3MGTA 1KCUL 3BN3B 1U93A 1YEHL 2GFBA 5SX5H 1FBIH 2WK2A 3T0VA 4QWWC 2AQ1A 3DVGA 1IEBA 5EOTB 4ZUUB 5JW3L 3FOMA 2NXZD 2B0SL 5E5MB 5FGCE 1EPFA 3L5WB 5C0EA 4NM4L 2DYPB 2O5YL 1CICA 3WS3A 5HYJD 5FHBH 3Q6GL 5DHXB 3WFDH 5DSCA 1CK0H 1MHHA 2CQVA 3T0EC 1LVEA 3RVVD 3TZVD 3MNWA 3D85B 2X05A 1VKXA 2LE9A 3WDHA 4LSRH 2Y36L 2P5ED 4QCIB 4XBEH 1BZ7A 3BDBA 5SWZD 3O9WB 3DSNA 4HCRL 1LK3L 2ZJSL 5SX5K 2Z35B 2IG2L 2WINA 5HHOE 1SJEB 4Q97A 4HBQA 3QFJA 1X5AA 4JZNA 1B0RB 2QSTA 2VLJE 5IB4B 2CUHA 2EDQA 4B53A 3WNLA 1K9TA 1MFCL 1JV5A 1P53A 1C8PA 5EU7C 1NL0L 4NQCD 3RWEB 5C8JA 2NNAA 4EOWL 4Y5VC 4IRJC 2OZ4L 1JN6B 1N6VA 4I48A 1RIUL 4QHKJ 5CIPB 3VXSE 2GSGA 3ABZA 5I1KL 4YHZH 3QI9D 4M62L 1L0QA 2GEEA 5FUCE 2A9MH 4F9PC 4PJ5E 5J1AA 1F4WL 1IQDA 5INDA 4ZSOE 1G7LB 3I6KB 4NHUB 4U1MB 3KVQA 5I17B 2AJXL 1FHGA 5D1QB 4WWKD 4W6YB 3C08L 2X4SB 3B6SA 5F8QC 2HTKD 4XP1H 3Q5OA 3MO1A 1RZIA 3SOBH 4MMXC 1RJZB 1T5WA 1MRFL 2BHYA 4Y19A 2C3HA 4DFHA 2LTQC 4UOW0 2X4UA 3MRBA 3QAZC 4HDIB 1A4KB 3CLEH 5FCUL 4XGZB 5CGTA 3WXVH 5JMOC 4C83A 1EEQA 3BW9B 3GBNL 3EO1B 4KMTH 1NH6A 1K5NA 4MQXC 2DMKA 5DS8A 1D6VH 4J3OC 4GG8A 4ONFL 3QUZD 2P7TB 2XA8H 2ZUYA 4LASL 4JHAH