1NPUA

Crystal structure of the extracellular domain of murine pd-1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
b'SLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFSNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 1
publication title Structural and functional analysis of the costimulatory receptor programmed death-1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2003-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1npuA00
1QLRA 1K8IB 1NC2A 2XWBB 5AEAA 4DGVH 5IT2L 4NIKB 4XBGA 2ATKB 4MD5A 3BN9D 1Q9OB 4R4BA 4G80B 5LCVH 5SWSE 4WU7B 2LTQC 4GKNA 4P2QA 4K7PX 3NIFE 1ZANH 1VFOA 3C8HA 4PJHA 1H0DB 1BJ1J 3RPKA 2IG2L 2EXWC 4WU5B 4GKZB 1EHNA 1EO8L 4LLMB 1CG9A 1MCHA 1Q72L 3P73A 1LP9F 1DQDH 1PDKA 3U0WH 4TUJA 4HCRH 2VDMH 3R1GL 5C2BL 3S3SA 5JTWA 5GGUA 3ZT7A 1X6LA 5BJTB 3N9GL 4KK8C 1OTSC 5D6CB 3UC0L 2R15A 3QUKB 3GJEB 2IAMC 3IFNL 4X9FA 4F57L 4LOUD 3ARFB 1NFKA 2GJ6A 1XGTB 3VXQA 5GGVL 1AO7B 3IVKB 4ETQB 3QQ4A 3SO3B 1B6UA 3O8XB 1CXEA 3JV4B 1T1WB 1IFHL 3P4OA 3RTQD 3T65A 4MJ2A 4RX4A 5FYKH 4JGUA 4HXAH 1B2WH 2CGRL 3U9UA 1KLUB 2HMID 1CE6A 5F7DB 2H6PA 4ODSH 5KTEH 2ZSVB 1FZOB 3W0WD 1ZEAL 3SQOL 3IDGB 5SWSD 4JFQB 5DGQA 5GHWL 5D1ZD 5FYKE 3KPSB 3TA3D 4EJ1C 2D9QB 5ITFA 3G5VA 1ITBB 4JFEE 4M8VA 3RWIA 2NNAA 4KC3B 5HY9A 1A6AB 3ALPA 3WUWB 8FABB 2B2XL 3OKOB 1CD1B 3KLAB 3AS0A 2AJZA 4HJJL 2VLMD 4TNWF 4RAVA 3V52H 1TPXB 2CLZA 1FCGA 3MMEB 4ZPVB 3VCLB 4LLAA 2VL5B 4M48H 2EICA 5E2UH 3DWTA 3MX0A 2IAMA 2OYPA 4D8PA 1AKJB 2AKRB 4MNQA 4NRYA 4OT1H 2OZ4A 2OTWA 1S9YB 4NZJA 4KZDL 4Z7VF 4O5LH 3PWPA 2BVQA 2HWZL 3MACL 3QIWC 5DHYB 2X89D 2OL3B 3CDGB 4WENB 3DVFA 2XTJB 3FO2B 5EFIA 3T0VA 1S5HA 4FQLL 5EU5B 1OY3B 3BPOC 5HYQA 1A6ZA 3MRBB 1I1FB 4LCIL 2VZSA 3MCLH 4I77L 3UYOD 4JFED 3MRCA 1AQKH 2YPVH 1TJIL 4WNQB 5EA0L 4D9RE 3KPMA 1MI5E 1PJ9A 2CQVA 3IFLH 2HKHL 3GRWL 4GJTB 1E27B 1QPPA 2A6KA 5AWNL 3NZ8B 4PJHF 1TQBB 3MFFB 1L9MA 4IOSD 5FKPA 5KSUB 3KYMA 1XH3B 5IJVB 2Y07H 3QXAB 5HVGB 4RBPK 5CILH 4Z78A 1GPOL 3SDDC 1W0WA 5CP7B 1NCAL 3VFVA 1NPUA 4JANB 1GRWA 1KLFA 3CZFA 1F8TL 1OM3H 1KPUB 1N59A 2L7UA 2DQHL 4GT7A 4JDVA 5TF1H 1G9MC 4ODHL 5D1XD 2PYFA 2F53B 3NAAH 1FFQA 2YUWA 3LV3B 4ZSOA 4HKXB 4WO4C 5FM4A 3QIWA 1UJTA 1KCLA 3RL2B 3PHOA 1D5XB 2F74A 1RURL 4XZUA 2FH6A 1U8KB 1S7RB 5ITBH 2X40A 2DOCA 4MJ6B 2BFVH 3MRLA 4IMLA 1KFAL 3SN6N 3WNLA 4LIQH 4X80H 4H0IA 5CD5D 4GLRH 3HUJB 1SJXA 3NFPA 4UNVA 1JGEA 5HVHC 1IGFH 1UENA 3B9KD 5KVGH 1DBJH 4R3SB 4FABH 4PJFB 3E6FB 3R4DA 2NXYC 4PGBA 5ETUA 1AD9A 4YHZL 4DKEL 3HMXL 5ID1B 2D7PA 3FOLB 1INDL 4KMTH 4YHYC 5K9OA 4LIQE 4D9RD 1KCRH 3FB6B 4JO2L 1ZE3C 5J56B 3M17A 3QUXC 4YHKL 4PJEE 3R0NA 2JJTC 4ENED 1KEGH 1IILE 3DRQB 4M5ZH 1OF2A 4Z7WE 1Q8MA 3TVMB 5EBWA 1FAIL 3QNXB 1ZS8A 4JPIB 4A6YL 4FQCL 3I9GL 4MSWB 3C6LD 3QUMA 4PV8B 1J1XH 1HHGB 2MSPA 2IWGA 4NGHL 1M7XA 5J6GA 2JB6B 2JJVA 5C0CE 2K3TA 1LK3H 4HIEA 3RWCB 1V7ML 4XMKL 5DMKB 4WO4A 5IEKA 1HHHB 4I48B 1C5CH 1BFOA 1JPSL 4LSVL 4NM4L 4GW4B 3CD4A 3VA6A 1DDHB 5C08A 4HWEL 3ARPA 3EO0A 4PYHA 2FB4L 2YK1H 5E2WL 3TO4D 3BMVA 3MBEC 5I1DA 3MR9B 4C55A 4TVPL 3AXLB 4HMEA 2MCG1 1EEZB 5AUMB 2UY7A 3PJSB 5LGHL 4ODUB 3ALWA 1LEIB 5FM8A 3JZ7A 1M7DA 4WWID 3S36L 5T1LD 5HHNB 4R0LA 5J06A 4OIIH 1VHPA 4NOFA 1DL7L 2VJXA 3QUXA 4AQ1B 2DQEH 5DZNA 1EJOL 2DL9A 3O3BB 3N85L 1AXSA 2JJTA 3LZFL 5EWIL 4LHUA 3O6KL 3NTCH 1WZ1H 5JA8B 5H2BA 5IW3A 1T03H 5JW5A 3CVIH 4Y2DD 2DQJL 1O0VA 3MROB 2QSTA 3C5ZC 3T4YA 1KN2L 4ALAL 5C9KA 5TPWL 4KTEL 1N6UA 3O0RL 2ZG3A 3RIAK 5LQBL 1TXKA 3MV8B 4LLUA 1HXMB 4XP4L 2AEIT 5E8OA 5H8DA 1UWEH 4QCIB 4ERSL 2ZJSL 4ODTL 1MHEB 1XZ0A 1GL4B 1ADQH 4X6CB 3BT2H 4CMMB 1SQ2N 1ZVHA 1JHTB 2GHWB 4UU9B 3CLEL 2I9TA 4P57B 5FHAH 1NMAH 1MVUA 1RIVH 3KJ6H 3MBEA 5L8KB 3K74B 2WBKA 2ESVE 1YJDL 1JE6A 1FYTB 2D4DA 4X4XB 3GK8L 3AGVA 2BJML 5INCA 4ZPTB 2VDNL 3CCHA 4G6KL 1AQDB 4NNYA 5DUMH 4JRXD 3ZKQD 3ULUF 1VEMA 3M1BB 2CPCA 2CXGA 1GGCL 2R56L 1TJGL 5DJCA 1ZT7A 5SV4A 4F7MB 4JPVL 5EOTA 1QYGL 4LCWD 4IRJD 2QR0B 3TCLA 1D5IL 3IF1A 3FFCA 4RMSA 1RHHB 1HHIB 3CFBA 2GITA 2CIIB 2F5AH 3MYZA 5JW4R 1LO4L 7FABL 1BVZA 1S3KH 4Q0XL 1ES0A 5HHMB 4P2OB 4TVPD 1A3RH 1E4WH 4QRPA 5J11B 4LKXA 4Z5RB 4U1KB 1PX3A 3FZUC 4DKDC 1JFQH 1UM6L 3HB3C 4JGMA 4OZIA 3T3ME 5IK3B 3KR3L 3WYRA 5BO1L 1CLOH 1W0VB 1YMME 4DGIH 5KS9B 4JG1H 5IG7B 5H35A 5JOPD 3X3GL 43C9B 4WW2A 3I84A 3I2CH 4RA3A 2EDYA 1KJMB 2AGJH 5B39G 1JZ6A 5IB4B 5D5MA 1MIEL 2XRAL 3BMWA 4YR6B 5ENWB 5CFHA 1MH5A 4CN1A 4APQD 5FECB 3QUZC 1P7KB 1ED3B 3WKML 2VKWA 1RPQA 2VLKA 4MA8L 1EH9A 5E70A 1F00I 1E4JA 5TFSH 3PG2A 1WLHA 4K8RL 4Y4KA 2WINB 3LEYH 4YEFA 1Z9MA 4WV1B 2FGWL 1BOGB 3UZEA 3NN8B 5DJ2A 3TPKA 4MD0A 3QNZA 4J23A 1E4KA 4MJ4A 1F02I 5C0BA 5DRNB 3QDMA 5SWZA 1N5AA 4KVNL 2AERT 1MCLA 5A43C 3VXMB 4OTXH 1QQDB 5KSBA 3FOMA 2CKBH 4Y4FC 4NO5B 2SEBA 1VADB 1D5ZA 5I16B 4GKSA 2JK5B 5D6DC 3BP7A 3FRPA 3HPLB 4PTTA 1FGVL 4AIOA 1YMMD 3CPLA 3O4OC 4L8CB 1Y0LA 3BAEH 3LN9A 4ZOEA 1LP9B 1I8IB 5E1HB 1MFDH 4PJ8D 3MOAH 4IRZH 2NCMA 4LHQB 3WFEL 2C4FU 1Q0YL 3GO1L 4HPOH 1QUNA 3VGEA 4HFUL 1I9JH 3QJHB 5BCAA 3UTTB 2QADC 4S1QH 1WJ3A 1TVHB 2A9ML 4HWUA 1CI5A 3MLUH 4HQQH 4ZFOL 2ADIA 3ZL4H 1GH7A 3A6BL 1NBVH 3C2SA 1D9KB 1FC2D 1QBLL 3CFIC 3QO1A 1LK2A 2X44D 4S1RH 4F58L 4ZD3H 4BELD 3RGVB 3JWDC 1WT5C 5DD6A 5I18L 1PSKL 4C56B 4YXHL 3RWDB 4XBPB 5DI8B 4ELMA 2Z35A 1CK0H 4TRPL 5C7XL 3EFFB 1EZVX 3IB4A 3FHQA 2BRRL 2FR4B 1UZ8A 3GHBL 1QBAA 1GJIA 4PR5A 5EBLA 3VJ6B 2ORBL 5DQDL 4LAJH 2HFGL 3IT8D 4U7SA 2RJMA 3LCYA 4EUPB 3QZWA 3D25B 4TNWK 5C0ND 4EDXB 1AJ7L 3BGMB 2J8OA 3IDJA 2DL2A 1D5BB 2Z92A 4LVHB 5D6DA 4PFEA 5BMFL 2P1YA 5CAYB 1Y6KR 4Z0BL 3ROLA 1QA9B 3LN4B 3BN9C 1RZFH 1FRGH 5E6IB 1FNFA 1MF2L 3GB7A 5J6HB 4OZIF 5E9DB 3WFBL 2P45B 2NY0D 2A9NH 4FQXB 4GBXA 4P2RA 3A6CL 3C60D 2NY4D 1YEHL 3E8UH 3QDHA 4RMTA 4L1DA 1JNHB 4P4KD 5HDQH 4WW2F 3C6SA 1A14L 1VFAB 4OCSL 1W8OA 5DURB 1T0NB 3MRDB 5D5MF 4AENB 2ICEA 1IC7L 4NRXB 1S7TA 5BVPH 2IQ9L 4FN0A 3NGBC 4JFFA 1SY6A 3EUUA 4Z7VB 4QNPE 1YN6B 1WT5A 2VE6B 5HGBB 1QVOB 4XNQA 2IFFL 4X7DC 1I3GH 5GGTA 3D69B 1F4YH 5EU4A 1B4JH 2HN7A 4LOUC 4W4OC 4J1UA 4LSTH 4NCDA 1V3LA 1RZKH 3C08L 1MUJB 4E5XB 5IB3B 1DLHA 4CGTA 4Y19E 5BV7C 4JVUA 2XXMB 43CAA 4MD5B 4TSAL 5L8LB 4R4BB 1M6OB 5TDOA 5KSBF 3X3FL 4KH2A 3BPCA 4CDGC 2EEDA 1ZAGA 4RGOH 2HMIC 1OAYL 3PE9A 1IQWH 4GKNB 1RU9H 4MA7L 1FNSL 1I3RA 4P2QB 1L0XA 4PJHB 4Z77A 2RCSH 4TOYL 5EB9A 5D1ZC 5FO8A 3TA3C 3H8NA 1CG9B 1KT2A 4DQOL 3EIFA 3P73B 1F97A 4FG6D 1R3KA 3OHXA 4TUJB 3Q1SL 4XP6H 5K59F 5GGUB 2XQBH 2ED8A 5T33H 3P9LB 3UYRH 4FXLA 1FIGH 4NO3A 4YUEH 1MWAL 4ZTOL 3MA9L 3KYNB 3UPRA 1MJ8H 3HNVH 4P5KA 2AK1L 2ICWI 3HZKB 2GJ6B 3H9HA 3WIIL 3VXQB 4M7JH 1WAAA 2H8PA 3GFUA 3IRPX 4LSPH 3QQ4B 4M6OH 1LGVA 2OXHA 4K7FA 5T1MA 3SGEH 4P3CL 4GLRI 1QRKA 4GRWB 2L0DA 3P4OB 4BQCA 4ELMF 4Y19D 1KJ3H 2W59A 3CVHA 3DJ9A 5E2VH 3T65B 5CGTA 1DVFD 1TJHH 5F1OB 2H6PB 2RIKA 4B41A 4XMLL 5M7QA 5CEYA 3LRSB 3OAZK 4F7PA 4H26A 1H9VA 5F93C 3ARXA 2B39A 4YDVA 4QXGH 5ITFB 1CN4A 3G5VB 3QAZB 1F6AA 3QBTB 1YNLL 4N0RA 3RWIB 2R0WL 1SM3H 5D1ZA 4HUNB 3TA3A 2BSTA 2AJZB 5D71L 5FEBA 4U3CA 1DBKL 3GHEH 5JR1L 5I2IA 5FUCE 3EYVA 3F6LA 1RUMH 2P42B 4PJ5E 5DMIH 4I0KA 4NP4L 3DGGA 3I6LE 3VGFA 3U7YH 1BAFL 3TWCH 3RU8L 4ZFZA 5JHDE 2IAMB 4G7VL 4YBQD 4OF3A 5HBBA 1CFQA 1A4JB 1X5ZA 4MNQB 4NRYB 5JHLL 4MWFA 3ZE2F 4HCRA 2DKUA 1IT9H 4OLXH 1U92A 4KTDL 2P48B 3PWPB 3E3QE 2BVQB 3GIZL 3L3KB 2O61A 5D1XC 1A6UL 1HDMB 3CXDH 4G7YH 5C1MB 3WNMA 4I4WA 1J9CT 4QY8B 1YY8A 1ERNA 1S5HB 3IS0X 2RAMA 4WRLA 3HLAA 3T0XA 1OTTD 1WSST 3MLTA 2MOVA 5HYQB 5I1HH 3KNBA 5CD5C 5FUZH 2BY0A 1JWUA 1OP5K 1OGAE 1CXLA 2X4PA 5DJ8A 2N7BA 4QT5A 3HE6D 1SEQH 5GXBB 1CFTA 1UCBL 5A2IH 2VDRH 2R8SH 4JFEA 2A77L 2XT1B 4Y1AE 2A6KB 5JW3H 2DLEA 4M7ZC 1T6WA 3VFGL 4PJ5D 1K4DA 1N7ML 3MV7B 4LRNH 3KYMB 3LRHA 1O7VA 4Z78B 3O6MH 4GRLD 1W0WB 4G6JL 3S37L 2VZ3A 4S1DD 3S9DB 2E3VA 4ENEC 4KK6D 4KI5E 4PGDA 3QPXH 1I1RA 4LSRH 4XPTL 5DQ9B 5KANI 4JDVB 3FFDA 5E5UB 5EZOH 2PYFB 4LMQE 3T2PA 5IGXH 1X5JA 4OI7A 2YD5A 2WP3O 3QHFH 5LXGH 4UV7H 5ANME 3QEGH 4XZUB 1MRCL 1VENA 4IRSC 2VXQL 3MRLB 1WAAF 1FFOA 4IMLB 5M94B 4F7EA 3RL1A 5HPMB 2NY3B 3OWEA 3RPIA 2X4QA 4CAGA 4OGZA 4Z6AT 3BPOB 1A0QL 3VG9B 3QP3A 2H45A 5TE6L 5DVKA 2N7AA 1AD9B 4KFZC 2XG4A 3BUYA 1Z3GL 3QEQB 2D7TH 3TO4C 5HTSA 5IHZA 3LMJH 5CINH 3U4EA 2AEWA 1PX4A 4R4FL 4XGZA 3M17B 3VGGA 1U8OA 3IGAA 1EHXA 4Y1AD 2Y7QA 1MI5A 5FYKU 2WBWB 4RRPA 5CEZL 1OF2B 1G7IA 4KKBD 3PGFH 3NIFF 3SDXA 1JIBA 2Y4SA 5EBWB 2R1XA 3DROA 2HRPL 4N5UA 5C07B 1WTGT 1ZS8B 4BQ9A 1YPZB 2QQQA 4HT1H 4FXKA 2DBJA 3BSZL 3QUMB 4KQ4H 4Y2DC 4HIXH 2QSVA 3QJFA 4PG9B 1IARB 3D85A 1WFTA 4MB3A 4OF6A 3ZKMD 1G7PA 2QHLA 4HIEB 5C0RL 4WO4B 1EO5A 1BFOB 5DJXA 3QG6A 2VDQH 3DUUA 4LARL 4IRSA 4BFBD 5C08B 5D1QA 2H32H 1MCPH 1D6EA 3CDCA 4PJ7B 1J5OH 1LD9A 5ALBL 4TNVK 4IDJL 4Z7NE 4FZEL 2XWJB 3UJIL 2Y5TA 1ACZA 3SHSA 3P11H 1MCCA 3QHZL 3UBXI 2ICWA 3TO4A 1V7NH 2H1PH 1M7DB 2ADGA 4R0LB 2ZNWA 1NAML 3QUXB 2Y6SC 3QFJD 3L7EB 2J3SA 4LHUB 2MCPH 4Z9KB 1OAKL 1GZPA 4BSWB 2CIKA 3EOBB 4PJEA 5H2BB 1AI1H 4IRJC 4YZFE 3T3PE 5JW5B 5HYSG 2ZUQC 3H3PL 4Z7WA 4YDIL 4UZGA 3T4YB 1Q0XH 2A38A 4Q74A 3SKNA 2XZCH 4Y2DA 5IWLC 1AC6A 4PJ9D 4Z95L 1L7IL 3VW3L 3L3HA 3KWWA 5I1JH 2F5BH 4N0UE 1XZ0B 5ILTH 5C0CA 4GAGH 2FJFA 4H8WL 2FIKA 4PBWD 5D70L 3MLWL 1X5YA 1BD2E 2FYYA 5CEZD 4BQBA 3LS4H 1UXSA 5EU6D 1QR1A 1KCUL 3O4LE 1XCTA 2XA8L 4OGXL 1Q9LA 5GRUL 2DM3A 1GZQA 3HNSH 3W11D 4LFHG 3TBYA 2PUQT 5E2TL 5BQ7A 4X4ZA 3CCHB 3SOBL 4NNYB 2APXA 5FA4B 5DJCB 1MFBL 2WUBH 4APQC 4QXUL 3KJ4B 1C8PA 5EOCL 3VFUB 3FKUS 2NY5H 1QSZA 3F7YA 3TCLB 4KUZL 1FFNA 3IF1B 2WANA 3FFCB 5TDNA 3JBG7 3CFBB 4OKVA 3TV3L 5IMLA 3RVVD 4V2CB 5FYLH 1B90A 3W5MA 1NLBH 1NGPL 1S9KC 1DBAL 1ES0B 3HAEH 3QA3B 5DC0A 2AI0L 4DZ8A 2BY3A 3SDXF 2ZUWA 3U4BH 3OKKB 2B5IC 1WCQA 4LKXB 3O9WB 5IWLA 1JF1A 5DVMA 2R0LH 5FYLE 3TGXA 4HAGA 1YJDC 5DJZA 5IW1B 2RB8A 1LNUB 1FE8L 3QUYA 4OZIB 4XVUD 2XPGA 3U30C 1Y18A 4XAWL 1EHLH 1R0AH 4G8EA 5HHXL 3STZA 4M5YL 1RFDL 4U6HA 1B4RA 4N0FA 5AG8A 1GC1L 5H35B 2V2TA 4HG4J 4WW2B 4R2GC 1AGDA 4MXVE 2EH8L 4KY1L 3VDAA 2D4FA 4MYWB 5ID0A 1SEBB 2B0SH 1ZLWK 1P84J 2HT4C 5D5MB 4L9LC 5I1CH 1MH5B 4AMKH 4XNZC 2BXYA 2XN9E 3DIFB 3TZVA 1CE1H 2ESVA 3TNNB 1ZV5A 3G5YB 2NW2B 4O2CB 4ZUWA 1P4LA 4Y4KB 4APQA 1ZHKB 5F7HA 1QSFD 1C5BH 2D3VA 3VFPB 1FLRH 1GXEA 1IJ9A 4DUVA 1X44A 5DD5H 2ZKHL 3QNZB 5C0BB 2DI9A 5IQ9B 3K8LA 4J12A 2IFGA 3QDMB 5SWZB 2ZOKA 4NKMA 3RY6C 2F8OA 2KL6A 3LN5A 3QSKB 5HGHA 1OB1A 2ADJA 3WXWL 5KSBB 3FOMB 4PJEF 1QEWA 2FZ3A 1JYVA 2SEBB 5CCKH 5DQJA 3NFNA 5FYLD 5D96C 3VD4A 2E8YA 1D5ZB 1RUKL 4GKSB 4Z7WF 1QZ1A 2ERJC 3QWQB 3FO1A 1VGKA 2EH7H 1FVDA 2HJLB 3FMGH 4WUUE 4R97C 4XRCA 3PXJA 3CLFH 3KPPA 3QB7C 1XGUA 1GGIH 4NO0D 1RUQH 4PTTB 5C0NC 3NPSB 3CPLB 3MRMA 5EIQA 5HDOA 4WI5A 1FPTL 3V0VA 1JF5A 1MLBA 1EV2E 2VLRE 1IM9A 5EDXA 1YMMA 4GOSA 1QO3A 5I6XC 3W2DH 4BSVB 3CH1A 1C7TA 1TZGL 2Z91B 5I19H 3OF6D 5C0AD 5D7IE 2XN9D 1PAMA 4LAQL 2NY0C 3JWOL 1AE6L 2QQLH 5A1AA 3O45A 3C60C 2VXUL 1MCEA 1Q72H 4RZCA 2JIXA 3MRPB 3QO1B 1LK2B 4ONGL 3IDNA 1ITCA 1BM3H 5E08H 1A1MA 3TP4A 2VO5A 4YK4C 1A6TB 5DD6B 3EYOA 5D7JC 3SGEI 4ELMB 1JPTL 1CFBA 1RZJL 1F13A 4F57H 2HVKA 4X7EC 4NKQB 4K3DH 2DLFL 5EORL 5KW9L 1Z2KA 1UZ8B 3RY6A 4PRIE 4PR5B 1U95B 4XNMA 3VFSB 5C8JB 3UBXA 2YD9A 1TCMA 3OKMB 2JELH 5JMOC 3QZWB 5JDJA 4K2UL 2N1KA 5F6HI 1UH3A 2OMNA 5T3XH 1WCBA 1IC1A 3HI6H 2XOTA 1IAOA 4WUUD 1ZA3A 3ROLB 1UM4L 2BERA 3P0VL 3O4OB 4AEIH 1TZIB 4ZUSA 4L3ED 3GBML 3GB7B 5T3XE 3OR6A 3SDAA 5GS1C 5K33A 5HHPA 1RZGB 2CKBA 4XCEA 4GBXB 3SJVD 3D3VD 4P2RB 4DCQB 3H3KA 3UCRA 2QADB 1YYMH 4LF3A 4OLWH 1G6VK 1CGSH 2MKWA 3QCVL 3JTTB 3O3UN 5FM5M 4FG6C 4FQ1L 3BRFA 1CU4L 1U93A 1S7TB 1CDJA 1F3DJ 4ZAKD 1BEYL 1CDCA 3D18A 4JFFB 4ZG1A 3TBVA 4N9GA 3ZKNC 4ZDHA 3CSPA 3SDCD 4P49A 5D7JA 3BJ91 1JGUH 1GGBL 4UDUA 5EU4B 2HN7B 4J1UB 4MAUL 4PRID 1UJ3A 1EAPB 2NY1D 4ODVH 1DLHB 5ECJE 1LO0H 4Q9QH 4JKPH 5C09D 3GSNH 3TNMA 4H25A 43CAB 4HJ0D 4FFVC 1K6QL 3ARRA 3GI8L 1KEML 3AS1A 1PEWA 4LVOB 5TDOB 3BPCB 3I3BA 2FCBA 4FQLH 1MREH 1OPGL 4PRDA 4NJAH 3EDFA 4Q9RL 3GMQB 2QJDA 5GS1A 1P4BL 3OR7B 3Q5YA 1DQMH 5KAQF 5FO8B 4LPCA 4HPYH 1GOFA 4KTYA 1KT2B 1J1PL 1QD0A 3T3MF 2AJXL 1R3KB 1EGJH 3OHXB 2ARWA 4LMQI 3RWJA 1JHLL 1QRNE 4P2CG 1PGRB 35C8H 3ZDXE 4OLYL 1T21A 4YPGA 4PJAE 5L8JB 2DD8L 3T08A 4NO3B 2EO1A 2VXVL 3UPRB 2IQAB 4AH2A 4P5KB 4QWWD 4NNPL 3JWNC 1JGVH 2EE9A 3H9HB 1AGCA 3VGAC 3MXVH 4YBQC 2H8PB 1JJUA 4LDLB 1HCVA 1XEDA 4K7FB 3S98A 5T1MB 2YPLD 5F6IB 1KN4H 1F3RB 1FO0B 2WIMA 3AMKA 1A7OL 3CVHB 4XCCH 3BXNA 2O5ZH 6FABL 5T1DL 1MHHB 4JFDE 2WWKT 4YEEA 2ITCA 5AG9A 5M95B 2Q3ZA 4Y19A 4WJ5A 1JPST 2DTSA 2V9RA 1KFAH 1MCBA 3D39E 4AK1A 2R29H 3GSUA 1JV5A 3CGTA 2VSCA 1OTTC 5I1IL 3VXPA 3Q48A 1T7VA 5EG6C 2DIBA 2BSTB 3LD8C 4G6FB 3WO3B 3SKJL 4ONFL 5I2IB 4L4VE 1F3JA 3EYVB 1QRND 3LDBB 2K9UA 2YKLH 1G0YR 3DGGB 4NOBA 4LASH 4KHTL 5EC1A 2QL1A 3S8WA 3PGCA 3TJEL 2X4TA 1Z9LA 4Y5XC 4OD3L 4ZFZB 4D9LL 4GRLC 1YEEL 3X17A 1CFQB 1WWCA 3JXAA 4TQEL 4S1DC 4MGXA 5HHVH 4KK6C 1WVZA 4MWFB 4WFED 1H8NA 1P4IL 3TESA 1U92B 1FH5L 3UO1L 4Q58C 5GZOD 4I4WB 3CZJA 1EA9C 1UH2A 1V7MH 2R69H 1A7BA 1F90L 3E3QC 4JFDD 4K07A 1IL1A 3BIKA 1E4XL 5EZLA 3MRGB 4GMTL 4PS4H 3QXUA 4JM4L 3MLTB 5F3HA 4GXUN 3D39D 4QHLA 4LU5H 1CICD 3KNBB 1YNTB 1AGFA 5IVZA 1DTUA 2X4PB 3AREA 3VXRD 2AJYL 4NQED 5DJ8B 4RGNE 4QT5B 2Q86A 4NRZB 1D3CA 2YD8A 4JFEB 4P4RB 3MLYL 1JRHL 1RY7B 4L4VD 4UQ3B 4PGCA 4GAFB 1K4DB 5LVEA 1OSPL 5JQ6H 2GIYA 3BZFB 4HULB 3T2NH 5LBSH 4PPTA 4H1LG 3MZTA 4MQ7A 3STLB 4ESKA 4PJ5A 2I9LB 4LPXA 5K9JL 4Y5XA 1J0KA 4KKBC 4K3HA 4LEXH 4PGDB 3SKUD 4GRLA 2IADA 3KG5A 1C5DA 2F19H 5JIIA 4PV9A 3FFDB 3FT2A 3HS0A 4MNHA 2G9HA 3WMSA 5JHDA 3O0RH 3WFDL 4NQDD 4TVSa 1FJ1A 4XP4H 4BH7A 3ZKMC 1P69B 1WZKA 2E9BA 3EYQD 1QSEE 3G5ZA 5ACZA 4QNPF 1U91A 4F7EB 3FAWA 3RL1B 1FIEA 1MCQA 2X5PA 5CWSA 3RPIB 2X4QB 1P5UA 3RY4A 2DQUH 1KJ2H 3U0TA 1HZHL 3D9AH 2FO4A 1QFUH 3Q5OA 3E6HA 3FT4B 5IHZB 3U4EB 1GHFH 3DPBA 4XCNA 1IC5H 4EKXA 4X9GA 1OGAA 1U8OB 2EE2A 3AFLA 2Y7QB 1MI5B 3EO9L 4M7ZB 4YXLH 4JREC 1AO7E 3TT1H 1G7IB 4HFWA 4XNXH 4HS6B 3WN5C 1JPFB 3SDXB 1MRDH 5IHUH 5F6HJ 2VAAA 4UTBH 3K4ZA 5GJTL 1A47A 1DSFH 1UA6L 2R1XB 3DROB 5E8EA 4D94A 2E9WA 1MJ7L 2WWKO 1Q9KA 4I13B 4FXKB 1G7MA 5GGQL 1A02N 5EOQH 3QJFB 4K94H 3W39A 4Q0XH 3V79C 3D85B 3EJJX 4H0GA 4JN1L 2W0FA 4YFDB 2PO6A 3HG1B 1DBBL 5F7WC 4PTUA 4WCYL 1ORSA 5HYIA 3J8F7 2MMXA 4JFOA 4PJ9C 3DX9B 3QG6B 1HSAB 1S7UA 4L4JA 3DUUB 4IRSB 3HHRB 3UZQA 5D1QB 4Y8AA 5GS2H 1OGTA 5ANMA 1D6EB 2HH0L 1WFUA 2GTZA 4HC1H 4PGEA 2ED9A 1LD9B 3OV6A 4U6VL 2XNAB 4LK4A 3RWGA 2HFEA 3QQ9D 2Y5TB 3FQWA 4M7LH 1S9XA 3C9NA 1IBGL 2DI8A 2ICWB 4UMGA 1DEEB 2XRAH 3E0GA 4JR9L 3W11C 2ADGB 1G6RH 1NGQL 3C87A 5J7CC 2GJJA 1Q94A 4BKLA 3I02A 5I71C 3MRNA 5DJ6A 5CJOH 2K7QA 1AO7D 2FL5A 1CBVL 4LPVA 1XR9A 3FB8A 4MX7A 3ZKXC 1GZPB 3O8XD 2CIKB 3QR2A 5DFWH 4NCC2 1T5XA 1A6PA 3OPZL 5CD3A 1ONQB 5HJ3A 4Y4HB 3WJJA 1URLA 4Z7WB 4X9HA 1WICA 3KGRA 3RVVC 3SKNB 5DJ0B 2A6IB 3H42H 2HTLD 4YIQA 1LO2L 1QLFA 2PW2A 4FA8A 3KPSD 2NZIA 4HG4K 5DC9B 3L3HB 1MAMH 4E0RA 2Z8RA 3KWWB 1HNFA 4FFZH 2DS4A 3SY0A 4XVSL 1P84K 5C0CB 2FJFB 4HBCH 5E00A 2FIKB 4QHMA 4DFHA 1GAFL 3VFMB 1F58H 1LMKA 4XVUC 4G3YL 3BUTA 3BDXA 4LQFH 1R24A 1QR1B 1XCTB 1Q9LB 2FBOJ 3WXVH 1N6QL 4ZS7H 1UXWB 3TBYB 4QHUA 4PGJA 1GSMA 2DICA 4YHMH 1KPRA 2DMCA 3ALXA 5ABDE 1RJCA 4H0HB 2H32A 4JFHE 1AKJD 4J2XA 1H3PL 5LAXA 3RX8A 1W8NA 5JO5B 5E7BA 1ACYL 4XI5D 1FVEA 1DZBA 2P8PB 1IAMA 1FFNB 1OQXA 1U8MB 5TDNB 1M71A 1NCDL 4OKVB 5IMLB 3SGDH 1BQHA 5BZWA 1OT2A 1KGCE 3VFTA 3SDYH 3OXSB 4YXHH 1SBBA 4NN5B 1IGIL 3IAGC 2P5WB 4DZ8B 4FQJL 1Z0NA 3HUJE 1QSVA 5DSCB 2O5XL 2NY5C 3CX2A 1JF1B 4XVTL 2VABA 2VLJB 1HK6A 2HFGH 1T2QH 5DJZB 5KVFH 4OI8A 4XPAH 3QUYB 4P5TA 2XPGB 1Y18B 1EFQA 5FIEA 4G8EB 4KI5F 1IEHA 3STZB 2CD0A 3H9SE 4U6HB 2YEZA 4LDEB 1I7ZA 5GRYA 4N0FB 1U8LA 4N0UA 4JHWH 1AGDB 3CFEA 1KELL 2F58H 5F7EH 4O00A 1CLZH 4MJIE 4P9ML 5ID0B 1UKQA 5ADOL 1BD2A 1LHZA 4XXDB 3PHSA 3O4LA 5F71A 4MNGE 4BZ1L 2FECI 5KSAA 4TUOA 3TZVB 2AV7A 2ESVB 4J3XA 7CGTA 4YDKH 2NW3A 3O2DL 1P4LB 4UT7H 4APQB 3L1OL 3QT2A 12E8L 4FHBD 5CJQL 2F53D 5D72L 4B0MM 4EN3C 4I3SL 5L9DL 1FN4B 3K1KC 5DA0B 4LCCC 4M3KB 4CW1A 4KJYA 4U1MA 4OFIA 4LSDA 2V9QA 1ND0A 3ARTA 4M1DL 5ICXA 2ZOKB 4NKMB 1MCWW 3LN5B 5HGHB 5JOFA 1OB1B 1MQKL 2ADJB 4R90H 1QEWB 2FZ3B 4JHAL 5DQJB 5TE4H 3N1MC 4HKZB 3G08A 1A6WH 1VGKB 3FO1B 1C7SA 4Q2ZB 3VRIB 2VZ1A 4XRCB 3P0YH 4JRWA 3KPPB 3H9SD 1XGUB 3INUH 2WIIA 4TPRH 3RVTC 4V1DB 1EHAA 3BN3B 1F6FB 3NCJH 3PP3K 3HAEA 5J9PA 1YECL 3V0VB 1MLBB 4R2GB 4KUCD 1IM9B 4LCUB 1C16A 4XPGL 4BA8A 1YMMB 1QO3B 1IKFL 2E5EA 3GSVA 3CH1B 4XT1C 5I66A 3PL6A 5IM7B 2DDQH 3TVMD 4I0CC 5AAMA 5I0ZA 3SGKC 4MMZC 1IAIL 3O45B 5MEQA 2ITDB 2PR4H 3BKCH 4RZCB 2JIXB 5SWQA 4XWGL 2DI7A 3Q1SH 2XN9A 3IDNB 1VFBA 4KGLA 2BHZA 4FQIL 3F8UB 1A1MB 4Z7NF 3HZVA 4D0DA 1PLGL 1RIHL 4EN3A 4LCYB 3CMOL 1K5NA 3EYOB 4LCCA 4O58L 4Q9CA 3V6OE 4G8FA 4PY8J 4ZAKC 5L7XH 5CUSH 2HVKB 4DOHB 1N5YH 3WIHH 2VXSH 3SDCC 4XNMB 3WIIH 3PDDA 3QCTL 4D3CL 4L9DA 3UBXB 1IZJA 2A6DA 4UT9H 4WUKH 3MFGB 4OSUH 3EO1B 4NZUH 1FYTE 3S35H 1LE9B 2NY1C 2BOBA 2ERJB 1BX2A 1NSNL 4NZRH 3T3PF 3WJLC 4YZFF 1IAOB 1INEH 3PIQA 3NA4A 3NOIA 3PNWA 1NCCL 1INQA 1ZA3B 4HJ0C 5IMMA 3RKDD 3QDJE 2UYLA 2VSDA 3ILQD 4ZUSB 3FL7A 4NPYA 1BF8A 4WUUA 3OR6B 3SDAB 4B7LA 4WGWB 3U0PA 1PG7W 2CKBB 5JUEL 2ZCHH 5EOCJ 1MCKA 3DSFH 2FX7L 1YNLH 5F88A 2OP4H 3U2SA 3EOTH 2Z31A 4I3RH 1H8OA 2VLRA 3BW9A 1CGVA 5FK9A 3MLRL 5DD3H 1RZJC 1TTFA 1KIPA 1ORQB 1MIMH 4F7CA 5CJXC 1ZVYA 5D7IA 1Y6MR 4U1JA 3EYUH 3MV8D 1U93B 2HVJA 2OJZL 4P46A 4E42B 3D18B 2UZYB 1EFXA 5L6YH 1BAFH 1YEFH 4N9GB 4ZDHB 3FJTA 5F7YC 3RRQA 5D7JB 2YA0A 4GH7B 4G7VH 3H7LA 4UDUB 1L7TL 1HHKA 2VXTL 1UJ3B 1GCFA 2YN5A 4JDTH 1EEQA 1JWMA 1MCRA 3SDCA 5AAWA 2NYYD 1CGWA 3KPQA 4MCYB 4GMSL 4AEEA 4ZFGL 3WNNA 1FYTD 4JZJB 4PRIA 2DWDA 3VG0L 2EZ0D 32C2A 1QLEL 2ICES 3WJLA 3DTXA 2D0FA 2BC4A 1PYWB 3AMLA 1J0HA 4PRDB 2EC8A 5JZ7D 4NHCL 1LQSR 2YD2A 3J7HA 2FHBA 5DR5H 3GMNA 1CGTA 2E6JA 5GGRA 4WVRA 1MFAL 5JXED 2OSLA 4JN2B 5ICZA 2Y06H 2D9CA 1QNZH 3RWJB 4NN7C 3NACL 2AK4E 4IS6A 4UAOC 1R5WB 3HZYA 2GTWB 4TTDC 2LU3A 2WUCH 3ES6B 5HHMD 5F7KC 2DM7A 1T21B 1NH6A 4P2OD 4ZMAT 3VXME 1F11A 1AGEA 1QBMH 2HLFC 4MXVF 4XNYL 5AD0A 1FLTX 2ZCKL 3LS5H 3PABB 1HILA 2GJZA 2HJFA 2R4RH 1EMTH 5ESQA 5DA4A 4AH2B 4OGYL 5IR1B 2CK0H 1AGCB 4NNXA 3ARZA 5IFAH 4DN3L 3RJQB 4PG2C 4YBLC 1NGYA 4PP2A 4RQQA 2X10A 2JB5H 4W6YB 1CL7L 4QRRB 3BXNB 3K4AA 4OIAA 4OM0H 4NHUA 5HGDA 1R3JA 2ITCB 5IMKA 3O3DB 3SGJC 1YEDB 3QCUL 2Q76B 4WJ5B 2E27H 3IU3B 4NUGH 4HKBA 3GSUB 5I8CA 3S5LG 4U0RB 3GDBA 1D6VL 1JV5B 2ZG2A 3VXPB 3KYKH 2CDEA 1CICC 5DMJB 3GSNA 2EDXA 1KB9J 1MJUH 3NCBB 4QTHA 3EAKA 1IEAA 1RJZA 1TENA 3DNKA 4Y89A 5ADPH 1OAQH 1OLZA 4L8BA 1U6AL 1F45A 3VXMD 1G9NC 1HWHB 3MLVH 4U1NB 3PGCB 1QRNA 2X4TB 5DRXB 3BOVA 1NMCC 2EEAA 5J57B 2EC9U 3NCEB 3IJSB 4PJAA 3V4PL 2HRPH 2C3VA 5D7IF 1XGQB 4Z7UB 3VD5A 1EGJA 4RFEB 3TBWB 4XP9H 5IFJB 2I5YL 1IGTA 4PG2A 5KG9A 4XNUL 3EYFA 3HMWL 4M1CD 4FFYL 5E9DE 1JNNL 1KBGL 5GSRA 1DLFL 1T4KB 4K3EL 4G9FE 3UTTD 4FP8H 2YR3A 2D0HA 1IL1B 3SGJA 3BIKB 1UWGL 5EZLB 1MAKA 3EYQC 4BFGA 1B0WA 4QHLB 3LEVL 4JFDA 4OCWL 3RA7L 1S5IL 1EXUA 1D9KD 2QEJA 1AGFB 1G1CA 2GSGA 3AREB 5D8JH 5BZDA 1CDYA 2Y72A 3KPNA 3D39A 3N1PC 3L7FA 1CICA 3LKSA 3RGVD 2Q86B 3GIVA 4C56D 3I75A 3P3YA 4JKLA 1NCTA 3NIGE 3LY6A 4RGNC 2DTML 3T0AA 3ZHLA 3QDGB 4JO3L 2ADFH 3QPQC 4L4VA 4MQ7B 4J7RA 1AFVH 4PJ5B 5IIEB 4N0YL 3UTZA 3PP4L 4Y5XB 1WFNA 3D5OF 5I1LA 2I60L 5TE7L 5ESAA 2IADB 1C5DB 1J8HE 1U2HA 4PV9B 3FT2B 3HS0B 5CKGA 4MNHB 2G9HB 1OHQA 3VI4E 3QXWA 5J3HD 2GY5A 5JHDB 1QKZL 2BX5A 1CZ8H 4X6DE 4BM7A 4DZBA 2VQUA 5E6ID 4DTGH 1FJ1B 4BH7B 5E9DD 4P9HH 5F96L 1P7HL 3OAUH 1NUFA 4YNYA 4FQXD 1DUZA 3G5ZB 1ZT1A 3T04D 5ACZB 1U91B 4XP1H 4X83A 5D7SL 4Q7DA 4O4YL 2FX9H 3N1QC 4NWUL 5CWSB 4K7PH 5DK0A 3V4UL 3OKEA 2BHUA 5DURD 1NEZA 3IS1X 3U0TB 2PXYB 2CR6A 4G5ZH 5FGCE 1JZ3A 5GRUH 4UTAL 5J89A 1AH1A 2FO4B 3E6HB 3A67L 5IFHL 4AIZA 3MLXL 4KROB 2Z8WC 1IGJA 3HPJA 4O02H 1OGAB 3MBXH 2WK2A 4QRUA 5ISZE 4IDLA 1CXKA 3SGDI 4XBEL 4YHLL 3IDXL 2XZAH 2X1QA 5EULV 4NKIL 1G1YA 3EOYG 3AC0A 1T0PB 4GRWE 4NZTL 4LLDA 3TIDA 1UM5L 3GSWA 3SO3C 3O8XC 1Q9KB 2DBLL 2Q8BH 5JDSA 4X5WB 1K8IA 3W39B 2G2RB 2W0FB 2DQDL 1BF2A 2PO6B 2RQ8A 3ZDXF 3EHBD 1Q9OA 4QLRA 4PTUB 5GRVL 4PJAF 2OZ4L 2IPTH 3I50H 3VH8G 4DAGL 1ORSB 2HTLC 4JFOB 1NCBH 1S7UB 1QFPA 2R2HA 1CDGA 4NQSB 1H0DA 5ANMB 1CGUA 4GG6E 2YRLA 4WU5A 1QSEA 4PGEB 4OFVA 4K94C 1GC1H 4MXQC 3RWGB 3SKOA 2HFEB 5IESH 4DUXA 3FQWB 1S9XB 3C9NB 2O26U 4HEPG 3RIFF 1UACH 5GJSH 1MHCB 4IIQC 3BDBA 4WDIB 4LVNC 4JQVC 1I9EA 1Q94B 3I02B 1VDGA 4MAYB 3MRNB 5DJ6B 1U3ZA 4M6MH 3VWKA 4MDJB 1XR9B 3FB8B 4I0PA 1KJ2A 5F1NB 4NT6A 1XGTA 3AU1A 1AO7A 4HLJA 4MDIB 4XI5C 3IVKA 4L4TB 4N90D 4JY5H 1KC5H 3UPCA 2EIDA 4WY7L 4YIQB 1SBSH 2RFXA 3QEUA 4L8DA 5SX4H 1KLUA 4H20L 5F7DA 1QLFB 1PQZB 2ZSVA 3BP5A 4PB0H 3O6FC 2GT9B 3NCMA 3IDGA 1A1OB 2QQKL 3SY0B 3VI3E 3BD5A 3IU4H 1GIGH 4TULL 4R8WH 1A6VH 3N06B 1UFUA 1MFEH 5DVNA 1QFOA 3FONB 5A2KH 1X5LA 1CF8H 8FABA 4UBDD 3UAJD 2AABL 3OKOA 1CD1A 4S11A 3MV7E 2ATPA 5F9JA 3VA2C 4Y7MA 2B1HL 1YNKH 3ULUL 4KK8D 1TQBC 4GUPB 1OTSD 5GGRY 4XCFL 3MMEA 1KPRB 4ZPVA 1PVHA 5HPOA 2IAMD 3VCLA 4IIQA 2A74A 4G6MH 2EDTA 2H32B 1UH4A 4MNQD 3V0AC 2BSSA 5CZVL 5LAXB 4GSDH 3VFWB 3GEWB 5I8KH 1IAKA 4HC1A 1FVEB 2DWEA 4C4KT 2CSPA 1BQHB 5ALCH 3VFTB 2A1WH 1S9YA 1DP0A 1NFDE 1G6RA 1JPTH 5DHYA 1TLKA 2OL3A 4HGWB 1CFSA 1HEZB 4OCRH 2GK0A 4NO2B 1RMFL 5I1KH 4JG0H 2DLFH 3ELAT 1AY1L 3QUML 5IBTH 2VABB 1OTUD 1IQDA 3REVB 1G9ML 5EU5A 3O6FA 5LGJB 4P5TB 3QEQE 2EDLA 2FEEI 3KPRE 3GJFK 1R3LA 1XIWA 2YEZB 1I7ZB 4XPHH 4DKAA 2O5YH 1U8LB 4I18B 1ZLVK 2JCCE 2CLRB 3CFEB 5FAAA 2OLDA 2IBBA 5KVEL 3MV7D 2W9DL 4JHBA 4K23L 3TJHD 1JNLL 1BD2B 4RMWA 5GS0H 1E27A 5I8OL 5GRXG 3O4LB 3SE9H 5F44A 5KSAB 1CDIA 3BIBX 4TUOB 2AV7B 2MJWA 2FX8L 4IJ3B 5A2FA 4YLQT 5C07E 2D0GA 1IGMH 4L3CA 5HVWA 2NW3B 1YPZE 3NH7L 4OJFL 3TVMC 5T5NG 4KAQH 4JANA 3EYSH 1TIUA 5E7FA 4EI5A 3ARWA 3NCYS 4OFDA 3EDEA 2VZTA 4DW2L 3QG7H 1XCQA 4CW1B 4ONHA 1HN1A 1VB9A 4U1MB 4X6FA 1CXHA 3NZHL 3R8QA 3V95A 4KHXH 1ND0B 3LH2H 1A3LH 4XPFH 5CSGA 5JOFB 1R3IL 2NY3D 4PJ7E 3M8OL 3ULUD 1MEXH 4MAUH 1PY4A 2QHRL 4XH2A 1CFNA 3OSKA 4X9IA 4X9BA 1I8LC 3G08B 3D1MC 3HUJA 4FQ2L 4JO1L 3QEQD 1GYAA 1FNAA 3MUY1 4PRAB 4G8IB 2WIIB 3TYGL 5AYUH 2EE6A 4YQXL 3HAEB 2CO7B 2YMXH 5J9PB 3S34L 1UEMA 3H9SA 1C16B 3RKDC 3GSVB 3ILQC 5DVLA 1UADC 1HOCA 5I66B 1B3JA 3PL6B 2VDKH 4KZEH 3ZTNL 5DLMH 4YE4H 4MJIA 5IP4A 5C07D 4XC1L 4MD4B 3OZ9L 5DWUH 5SWQB 2F9BT 4MNGA 4OM1H 1H5BC 1VFBB 2CDGA 4OB5L 4Z76A 1NBZA 3HZVB 4MSWA 4EN3B 3WSQL 2GKIA 2DMKA 1PFCA 3OGOE 4PV8A 4WO4D 5DJDB 1UEYA 2DQTH 4O51A 5DK2A 3WNPA 1SVCP 3UJJH 1P5VA 2JB6A 3WD5H 4WI3A 1KENH 5C08D 3DHMA 3V6OC 2OR9H 4AQOA 2EIEA 1WWWX 2X4OB 1HH6B 2C9AA 1WV7T 4U1LA 2BOBB 3VFOA 1I8LA 1CDBA 1BX2B 1ZLSH 3PWNA 2NYYC 5F3BA 1YEGH 3PIQB 4CADB 3QDAA 4LGRB 4FMKA 4MXWL 4NQCE 1INQB 3AXLA 2EZ0C 5IMMB 2UYLB 3KS0J 4QF1A 4NPYB 3QUXD 3MODL 5I73B 4DVRH 1E6JL 3LKQA 1LEIA 3BKMH 2FJGB 5JZ7C 3MXWL 4LHUD 3VWJA 4HIIA 5F88B 1OL0A 4M61B 2Z31B 4HD9A 2IPUK 1OD7A 2VLRB 1KJVA 3BW9B 3FN0L 3MNVA 4HK3J 3C2AL 5JXEC 5EUKA 1KIPB 4PRPE 2BP3A 2LQRA 5D7LE 5D7IB 1NCWL 3K46A 3ETBF 4IHOA 1H5BA 2HVJB 1XF4B 1FL3B 4P46B 4HK3N 3BX7C 4P2OC 1EFXB 5F9OH 5LG1A 2VNCA 3W9DA 1HXMA 5E99L 1BQLL 1DN0A 2VUYA 1NBQA 1HE7A 4KKLD 3V6OA 1JWMB 4HW6A 4TUKL 3KPQB 1JHTA 4UU9A 4PRIB 2DWDB 1PY9A 32C2B 2X70A 5FYJL 2VERN 4HS8L 1MRFH 5FKAB 3DTXB 1KB9K 1FYTA 3C5JB 4QRSA 4ZPTA 2YD6A 1E4XH 3U4AA 4WFGD 3WIHA 1WEJH 2D7QA 3HUJF 4M1GL 4UB0H 5ACLA 1AQDA 3GMNB 5GGRB 4JPWH 5B8CB 3QDJA 5FOBB 3JUYA 5C0JA 3FFCD 4KQ3L 3H3BC 3OB0K 1MHPL 1G7JA 2QR0A 4IS6B 4WV1C 5JXEA 4NC0B 1JRHH 4LFHD 2CMRL 3JSSA 4QHKJ 3U1SH 2CIIA 5AD0B 5CS7A 5TH2A 3O9WD 5CZXD 1HILB 2GJZB 1NANH 1N4XL 2HJFB 4MVBD 5C0EA 3L9RB 4P2OA 5ESQB 4LSQL 4KXZH 4Z5RA 2AJVH 1FFRA 1A7PL 1IRAY 1FBIH 1ZOXA 2PTUA 2AJSL 2NY7L 5C86A 2VOTA 1NGYB 3U9PH 3QYCA 4OBRA 4PP2B 3HRPA 4RQQB 3WFDH 4XC3L 2XFXB 2IBZY 3OQ3B 3AS3A 3RWEA 4NHUB 4M7LT 2RGSA 5IMKB 3NFSL 3CAFA 4PJIB 2VDOL 4M1CC 1EPFA 3D2UB 3JV0A 1KTDA 3OTTA 3BRGC 2HFFA 3FRUA 5F89B 3MOBH 4HKBB 5ENWA 5I8CB 2YD4A 4Y4KD 5F9WC 4RWYL 3OKLB 1WISA 1OAZL 5JOEA 2X2YA 2V7HA 3HNTH 5HD8D 2BNRB 5INDA 1BWMA 3HC3H 5CP3H 3KLSA 1CYGA 1IEAB 1RJZB 3RGVC 5EZIH 4AEHH 3QDMD 4WTZG 4R9HA 1DUYB 1FNHA 4MZ3A 2XKNA 3S37X 2AK4A 4Y5YA 1ZGLP 2QSCH 5B39A 2EDQA 1BZ9B 4PJAB 3VXMA 2EDJA 4U3XA 4M43L 1MJ7H 1SY6L 3JWDL 4M93B 3RDTB 1VPOL 1F5WA 3QFDA 4I9WE 2EKSA 1FORH 1BP3B 4PLJC 4YXKH 1TCRA 5GGTL 5KG9B 1I1AA 4X4ME 2P7TA 2PYEE 3EYFB 4LVHC 2P8MA 5J3HC 4KRNA 5J13B 4OKDA 4FNLL 3IETA 4L8CA 3DX6A 3MCG1 4OCXL 5GSRB 5FGSA 5E6IC 4E9LA 4ZO9A 3CDYA 4QKXB 4FQXC 4BZ2L 2HAZA 3BD3A 1EXUB 5I15H 5DJAA 5JPMA 2GSGB 5BZDB 3L7FB 3LKSB 2Q8AL 1P1ZA 3GIVB 2W9EL 5MP6L 3BFOA 3BDYL 1S7XA 2YBRA 1MFCH 2DQGH 3PDOA 2FD6L 3F58L 3AY4C 4RGMB 4WWKB 4M62L 4AG4H 4XBPA 5DI8A 5JLZA 1MAJA 4LP5A 2DLHA 4JY6A 2M26A 3UTZB 3ORJA 3GI9L 5SX4I 1C08A 3GSXA 1IGCL 5ESAB 4NYLA 2FATH 2R0ZH 3EJYC 4I9WD 2HT2D 1A21A 1ZKAA 2KPNA 4DZBB 1D5BA 2JJSA 1BFVH 4RBPH 4GBXD 1DUZB 1ZT1B 2QQNL 3LN4A 2FLBT 3EHBC 3CVHL 1ODAA 5BV7L 2QADD 4JFZL 1H3TA 5I9QC 4WHYG 5DK0B 1NLDL 4FFWD 2G60L 3OKEB 1PG7L 4J6RL 1NEZB 4G9FA 2LU4A 1AR2A 1WTLA 1B88A 4HUMB 2VDPL 1A7QL 3LPGA 4P9HC 4AIZB 4PLKD 2R4SL 1MCSA 1T0NA 3DYOA 4JFFD 4AENA 1IGJB 3HPJB 4NRXA 4JFPA 1FO0H 4QRUB 5L88H 5KVDH 3QI9C 3T0WA 4DGVL 4RGNB 2LFGA 1YN6A 5HGBA 1QVOA 3MUHL 5IW6A 2UZXB 5LCVL 1N0XH 1A5FL 4HHAA 3ME0A 3TIDB 3GSWB 3MJ8A 3CC5A 3G5XB 4PRHE 1R5VA 3BGFB 1ZANL 1L4IA 2X1XR 5JDSB 2Y25A 3NA9H 4X5LA 3S96A 1RZ7L 3CFJA 4CVWA 2V2XB 1RJLA 3SE8L 2YD1A 4HH8A 1RUAH 3H9ZA 1J8HA 1DQDL 3U0WL 1M6OA 4KDTC 4HCRL 2VDML 4JKWA 2HLAA 3D6GA 3PGDA 4X6DA 1F6LL 2R2HB 2R1WA 3QAZC 3WCYA 3T09A 4EDWH 2B4CH 4JE4B 2ZUSA 3DV4B 1QSEB 2GI7A 2UV3A 2EYSA 4X7TA 4XX1G 3W81A 5CBAA 3OMZA 3SKOB 1KELH 2P47B 1YEIH 3IXTA 1SYVA 1T1ZA 4UBDC 1FVCA 3MGTB 3UAJC 2IF7A 3WIFB 4F3FA 3GNMH 4OAWA 2AV1A 3DX8A 1RZIA 1KXQE 5GQBA 2ENSA 5I75B 3P9LA 1BLNA 5FYKL 3QI9A 2UUDK 3KPOA 1B2WL 4QGYA 4CJ0A 1VCAA 2DKMA 4KKNA 3VWKB 4ODSL 2DQCH 4HXBH 5KTEL 2DQFA 2V5MA 3KYNA 1X5XA 4GRMA 4I0PB 1IEBA 5EU3A 1KJ2B 5ISZA 4NT6B 3LB6D 3OGCA 1T20B 3MC0A 5FXCH 3HZKA 3AU1B 2XWTA 1I1YA 2X9YA 5F21B 4ZXBA 3I6GA 1N64H 4K71C 4M00A 2RFXB 3QEUB 3ARGC 4L8DB 5BVJA 1YMHA 3BP5B 3V52L 4LSUH 4R96A 5E56A 3LRSA 4HJGA 4KDTA 4Y16A 1U8JA 4R7DA 4PJXE 1OTUC 3LQAH 5T1KA 4M48L 4G6FD 3QO0A 4UQ2A 5JIHA 1RJYB 5D2NE 5E2UL 4QEGA 5HI3D 3TEUA 2FBJH 2ATPB 3GKWH 3BP4B 5F9JB 2HG5B 4GG6A 3CX5J 1ZLUK 4YH6A 2VH5H 4OT1L 3O2WH 3ARDD 5HHQA 3N1FC 3TJHC 4IIQB 2A74B 4LVNB 3TBSA 2CJUH 5DHVH 2BSSB 3DMMB 3X13A 3H7BB 1IAKB 4GXVH 2XTLA 2DIAA 1YEKH 3QWRA 5C0IB 4O2FA 3MV01 3RZWA 3S7GA 4JQXC 3L5XH 1A4JA 2DWEB 4H1LH 5C6WH 5B3JE 4DN4H 3OX8B 2LVCA 3RUGB 3K1DA 1G6RB 1AQKL 2YPVL 3L3KA 2AXHA 1CFSB 1HDMA 2GK0B 3V6BR 2X09A 3NIGF 5E8DH 4QY8A 3AUVA 3ARGA 2CRIA 3BH9B 3IFLL 4D9QE 2HYMA 1IQDB 1J1OH 1JZ5A 5DD0H 3I85A 1HNGA 3O6FB 2NY3C 3T0EB 5C9JB 4EBQH 4P0DA 1S8DA 3ULUC 3JTSB 3VG9C 3REWB 1A7RH 2Y07L 5CILL 1R3LB 5FYKD 1REIA 3ROOA 1XIWB 3DI3B 2D2OA 4LBEA 1OM3L 3VI4F 1A2YA 4PD4J 4X6DF 5F7NC 1P9MA 4OCYH 5TF1L 3SDXE 4KV5E 1JZ7A 3Q6GH 3IAPA 3NAAL 5FUOL 3MV7A 4W4NA 2VMFA 2GCYA 2ZUXA 1ZT4A 4L3CB 1V8HA 4YPJA 3WO4B 3THML 3RWFA 3TC9A 1A9EA 1CGXA 3GSQB 5ITBL 2BFVL 4EI5B 5I1GL 1JGLL 4LIQL 4X80L 5E03A 3HG1E 5DQ9A 1XCQB 4JQXA 2GAZA 1IGFL 5DUPH 4ONHB 5GS0C 4X6FB 2G75A 1DBJL 4FABL 3IXAA 1X5AA 2H26A 2JTDA 4NFBA 4BJLA 4C59B 5GPRA 1X5HA 1KCRL 1NL0H 1D5MA 5A3ID 3RZCA 1L7TH 5JORA 3ZT5A 1NFDA 4XH2B 3QIUA 1CFNB 3O3EA 5HI5D 5HPMA 3U82B 2AXGA 4GRWF 1KEGL 2WZPD 1IGYA 2OK0H 4M5ZL 3R06A 5K9KA 2J4WH 3L5JA 1W72H 2IGFH 3QEQA 1MI5D 1UWXK 4S0TD 3KPRA 1JN6B 4F9PC 5DTFA 3H9SB 1MCIA 3SQBA 4R0LC 3AB0B 2DJUA 4LLVA 1J1XL 1HOCB 5J12C 2FH8A 2JCCA 2C1OB 3ARYA 4MJIB 2OR7A 1M4KA 1LK3L 4YX2H 1CVSC 1NANI 4GG6F 1C5CL 3DYPA 4MNGB 4RCAA 5B38G 2WLYA 4KXZI 2CDGB 4CMHB 3G6AA 5GZNC 2EDEA 3G9AB 4M7KL 4Z76B 1FC1A 3D85D 5C07A 1NBZB 3LKRA 1BIHA 3HG1D 1YPZA 2YK1L 4K9EH 1DBMH 4R4ND 4F15B 3TH3T 4WHCA 4O51B 4PG9A 3H2WA 1FG2A 5DK2B 3KYOA 5MEOA 4IRSD 2Y23A 5D1QD 4RDQG 5SX5K 4KDWA 4JO4H 5EBMA 3WFCH 4OBSA 1L6XA 4NUJA 3B2VH 4KKLC 2DQEL 1L9NA 4U1LB 3VFOB 1CL7H 4PJ7A 3PWNB 5F3BB 3LSOA 4K3JH 3NTCL 5DRZA 5MERB 1WZ1L 1X6NA 2B20A 2XWJA 5C3TA 1T03L 4QF1B 1JHKH 3CVIL 2UVFA 3LKQB 4F9PA 3GKZA 1Z5LA 3VWJB 3NPZB 2Z4QA 4HIIB 5KOVC 5E24E 3KJ4C 1H3GA 3QEHB 1I9RH 5HGAB 3VI3F 1KJVB 1VA9A 3L7EA 3MNVB 4PREA 4Y4HD 5EUKB 1P7QB 1UWEL 2E7LC 4BSWA 5CKAA 5CEXA 1DEDA 2P5WE 5KVMC 3EOBA 2KUTA 3L6FA 3BT2L 1H5BB 2VIRB 4IHOB 4LKCA 2MWCA 1U3JA 2KBGA 4N9OB 4TSCH 3P30H 2VLJE 2ED7A 5FHAL 1NMAL 4YWGH 1NEUA 3W9DB 1RIVL 3KJ6L 4KJQC 3O9WC 5CZXC 5H94A 3TN0A 5C0CD 1DN0B 4WFHE 4MVBC 2MHAB 5GRJL 3ZYZA 3PV6A 1FDLH 5DUML 5DXWA 1RI8A 3SE4A 3UTQA 3WV0A 1DQLH 4QXTB 3HMWH 1UYWH 4FTVB 2X70B 4FFYH 4WW2C 1JYXA 3P4MB 5HYSA 1MWAB 3DECA 1NFDF 3CFCL 4QRSB 2EE3A 2F5AL 1F4XH 2A83A 3AAZA 2Y6SD 4NQCA 4LLQA 4UILH 3O6LH 1S3KL 5FA4A 3QDJB 3WS3A 4HUXB 5EZJA 2BNUB 4XAKE 1VEOA 5C0JB 4Y4KC 1YDPA 4HV8B 1A3RL 1E4WL 1FZJA 4JCMA 3VFUA 1AD0B 2B1AL 1G7JB 1KIUA 4LSSH 5HD8C 1JFQL 4FMFA 2E7LA 2P5WD 2VQTA 3V7AG 5A40E 5IBLD 3DHJA 4YHOH 5GRWA 1CLOL 2JCCF 1E4KC 3B43A 4K7PY 4JRYE 5TH2B 2NLJA 4PRPA 1T1YA 4HBQA 4JG1L 3QA3A 4P3DA 3V4VH 5C0EB 2VLJD 5D7LA 1BGXH 2YSSA 3OKKA 3QUYD 4XPBH 1S7QA 1AP2B 1RD6A 2AGJL 2W38A 3O9WA 4Z0XA 2NX5E 4KPHH 4V1DE 1YPZF 5IW1A 1LNUA 1OCWH 3GBNH 1IC4H 1LO3H 1UCTA 1GGUA 4JLRB 3RNKA 3EJZD 4OGAC 3SCMC 3NPSC 5TFSL 1CDHA 5LKNA 3RWEB 2Q7YA 4OF0A 5I1EH 3LEYL 15C8H 2X41A 1KTDB 2LVEA 3TZVD 2HFFB 2ESVD 2J6EH 1SEBA 3FRUB 3FO0H 5IVXE 1QFWH 1W0YT 4RNRA 1YYLH 2CXKA 4NWUH 1R5IA 3CFKB 2FRGP 4G43A 4MZ2A 4PJ7F 1T1XA 4P5MA 3DIFA 3VDBA 2V7HB 4KKAD 3TNNA 2V7NB 4Y0GA 4M6NH 3G5YA 2NW2A 4O2CA 4OTXL 4DUWA 5INDB 2CKBL 1ZHKA 3MOQA 1CFVH 3VFPA 2VWEC 5LWYH 2VN4A 3OAZH 4OLZH 4DOHE 1OOAA 3K3QA 2V5RA 3MLZH 3O11B 4XMPH 2XKNB 4L1HA 2AK4B 4Y5YB 1RIUH 2DLTA 3TM6A 3BAEL 2K1MA 5IQ9A 5B39B 4JZOA 1EO7A 2ZCLH 3P2TA 4N0CD 3MOAL 3GM8A 4IRZL 3T8XA 4HPOL 4Q97A 3GM0A 3I3DA 5HYJE 3QFDB 1I9JL 2HP4A 2EKSB 3IKCA 4V1DD 5C70A 3O3AA 4S1QL 1TCRB 1LEGA 1I1AB 3MLUL 4UUJA 2HJLA 2P7TB 3WHXB 5JQHC 4HQQL 3K8KA 2P8MB 4DK3A 4R2GD 2QTEA 4OLUH 1IM9D 3ZL4L 2J12B 2HT2C 2LABA 3IETB 4OD2A 3SCMA 1NBVL 3DX6B 2HT4D 4ZQKA 3S97C 4S1RL 3HCVA 2DJ4A 4ZD3L 4GBXC 1I7RA 4WHTA 4BSVA 2Z91A 4NC1E 3NVQA 1HINH 2JIXD 1SJHB 1CK0L 4JZNA 1T3FB 4XVJH 5DJAB 5JPMB 3TF7C 5F9WB 5TQ0H 4FFWC 5HSFA 3MZGB 4ZO6A 2OMBA 1P1ZB 3FQNA 3MRPA 1S7XB 3BKYH 2YBRB 1AHWC 3T1FB 3PDOB 4PLKC 1A8JH 2F15A 3OB8A 1A6TA 4RMRA 2W92A 5JLZB 1NJ9A 1U8NA 4JY6B 2DYPA 5CGMA 1WGOA 1OP5H 4G9DB 1V5JA 1C08B 1RZFL 3GSXB 2QKIB 1U95A 3VFSA 5C8JA 4NYLB 2IPKA 2A9NL 2EIBA 5HYFA 5CP3A 3OKMA 3E8UL 1NGXB 1N2RB 5HDQL 1OW0C 4LVOC 4KDVA 4WY7H 1B0GA 2HJKA 3SDAD 1XF3A 2WV3A 1TZIA 3LKNB 4X4MA 2EYRA 2BSRB 2PYEA 5BVPL 1ZSDB 3OKNA 4OZGE 1RZGA 1HKLH 4DCQA 1NGZA 1RULH 4G9FB 5HHOB 5T3ZH 1U3HB 1I3GL 1F4YL 1PZ5A 1B4JL 2YC1A 4LSTL 1RZKL 1LO5B 2G5RA 3JTTA 1DQQA 4JFPB 4HSQA 5E4IA 3B8YA 4OCMC 5D7JD 1AHWA 3W9EA 5T3ZE 4NM8H 4WI9A 3DVGA 4YHPB 4X7CC 3O2VL 5CZVH 5IW6B 3HC4H 4MQSB 4RGOL 3MLSH 4HHAB 4M8QA 4QRRE 1OWRM 1IQWL 1RU9L 3CC5B 3MJ8B 2BDNL 4ODWA 1R5VB 2AJUL 1EAPA 3LB6C 2RCSL 5F6IC 2CH8A 5FB8B 4M4PA 1O5DT 1X9QA 3S96B 3CFJB 3UJTH 4R26H 1HIMH 1KB5H 1RJLB 3IFOA 3UXFA 1YC7A 3S88L 1J8HB 3GZKA 4P23A 4UOW0 1OW0A 3MUGA 4XP6L 4JQIH 1YEJL 2C1PA 5GGSB 2XQBL 2HLAB 3PGDB 4JPKH 3Q6FB 4X6DB 3CX5K 4L3AA 2R1WB 1F4WH 5T33L 3UYRL 3GMQA 1FIGL 5AZ2H 1UT9A 4YUEL 5I9QB 5EUOE 3OR7A 2EYSB 4X7TB 4ZUTB 3MRKB 5CBEA 5CBAB 1MJ8L 4IOFD 4UIKH 3HNVL 4AM0A 3LHPH 4M7JL 3IXTB 3LDBC 5HI3C 1SYVB 1T1ZB 1FVCB 2NY6D 4K23H 4N8PA 4U05A 4ETYA 4F3FB 4LSPL 4M6OL 4OAWB 5ESVA 4HWBH 3LQMA 4IM8A 4F33B 1DFBL 2AV1B 3DX8B 1RZIB 3P77A 5FGCB 1MJJB 1KJ3L 3ZKND 4NBXB 5E2VL 1BLNB 3QI9B 1JPGB 3KPOB 4Z7UE 1TJHL 3ARDC 3C09B 5DFVD 4OJFH 3X12A 2DQFB 4GRMB 1IEBB 2FSEA 2IQAA 5EU3B 5ISZB 2J88H 2F54E 3OGCB 1LILA 5JNYA 4QRRD 2XWTB 1I1YB 4G8GE 4QXGL 4ZXBB 3I6GB 5I30H 4FFVD 4GW5A 1FO0A 3QRGH 3V6FA 2BK8A 1SM3L 5D2LE 4PRHA 4NJ9H 3MPCA 3VXUB 5BVJB 4NWTH 3K7UA 1MHHA 5FGBC 2GUOA 1YMHB 3OL2A 3M8OH 3GHEL 4R96B 1MCWM 1OAUH 1PZUB 4HJGB 4XB7A 1RUML 4PD4K 5DMIL 2ZPKH 4ZNEE 4Y16B 1U8JB 4R7DB 3U7YL 5T1KB 4LQ1A 2W60A 2J8HA 2C3XA 3QO0B 2NMSA 4UQ2B 4L5FH 4DKFL 3TWCL 4U1GB 4RFNB 1BVLA 4GAYA 3QDGE 4LRIC 4GG6B 1S7WA 1CQYA 5JW4Q 1KTRL 3VXSB 2M1KA 2C4FT 4XP5H 3MRRA 1SJEA 1IT9L 4OLXL 3V5KB 2BVOA 5HHQB 1JMZA 3LQAC 1I7UA 3ZTNH 1C1EH 2FEDD 3H9YA 4TN9A 3V0WH 3CXDL 4G7YL 5GRVK 3TBSB 3X13B 1KTKE 4HLZG 3ARDA 2X1OA 4EOWH 1JYNA 4MMXC 4O2FB 5I1AB 2DQIH 5FCUH 5I1HL 5FUZL 3MJGX 3L3IA 4K71B 3CFDA 4D0BB 4YDJB 1VGEH 1SEQL 3ARGB 1OP3K 2VDRL 4N1CA 2R8SL 5FGBA 5JW3L 1T89A 3Q2CA 1OARH 3BE1L 1JK8A 5A3IC 3ARED 3LPWA 1Q38A 1S8DB 3MRGA 4BFEA 4LRNL 3CK0H 9CGTA 3O6ML 3ROOB 4E41B 1YNTA 1WF5A 5HI5C 1CLYH 4LLYA 2EDFA 2EXYC 3MREA 4LBEB 1UKSA 5DDHA 4MXWH 1OP9A 4I3GA 5DD1H 3ARBB 4PJXA 1A2YB 2HTKC 1GOHA 4NRZA 4LSRL 2XACC 3FHAA 3QDGD 4OQTH 4LRIA 5D2NA 4MQTB 4P4RA 3RFZC 1U58B 5EZOL 2I24N 4KVCH 2FIRT 4UQ3A 5IGXL 1I7TB 1AC0A 3DUHA 1DANU 3MGOA 3BZFA 3QHFL 3I6LD 5LXGL 1I4FB 2GCYB 1ZT4B 4UV7L 3RWFB 2UVEA 3FN0H 3QEGL 4JDZB 3STLA 4WEBH 1A9EB 1HXYA 2DAVA 2I9LA 2F8XC 3MJ7A 5JHDD 1A1NA 3B8SA 3RX7A 2R1YA 4NFDA 1MOEA 4ZUVB 2GAZB 1ZLWH 1CT8A 2G75B 1MNUH 3IXAB 2H26B 1YQVH 5BXFA 2MPAH 1UB6A 5MI0C 2D7TL 5KJRH 4OZFG 4R4NC 1U8IA 5EIVA 1D5MB 1E6OH 3LMJL 5CINL 3RZCB 3UTSE 3BKJH 5DHVA 5E6YA 2VDLH 2LU7A 5JORB 1NFDB 4KMLB 5D1QC 3QIUB 2YZ1A 2H9GA 2PXYD 3O3EB 3UDWA 4KRPC 4H1LA 2AXGB 4S2SA 3R0MA 4PGZA 1IGYB 1I3VA 3ABZA 3QQNA 3PGFL 3R06B 4KROD 5K9KB 4Z8FH 3G6DH 1CIDA 1OGAD 2IH1A 5EBGA 1WUNT 2XQYG 3KHOA 3S4SG 3FT4A 3KPRB 3VFRA 1BBDH 5DTFB 4LLVB 1ROWA 4KQ4L 2XZQH 4HIXL 2JCCB 1EBPA 4UOJA 4S1SH 4HKJA 2WQRA 4AY0A 3BISA 4HS6A 1JPFA 4L4TE 1RVFH 4Y8DC 1WWBX 3ZDYE 2VDQL 3G6AB 4KI5D 4QTIL 4Y4HC 3MV9B 3LKRB 1WC7A 2PO6D 1MCPL 3K0WA 1XF2A 1J5OL 4B7IA 3WHE0 4N8CH 3UROR 1T6VN 5BOPA 1FG2B 3QH3A 3KYOB 5MEOB 2UY6A 3HG1A 3MRIB 4OLVH 1CWVA 1YA5A 3EFDH 3P11L 2H1PL 4U1HB 5CHNA 3DX9A 2NY2C 1HSAA 3MJ9H 3ZZ1A 5EBMB 4KWUA 5IB1A 4NUJB 1QFWI 1NMBH 1WIUA 4GKOA 5AZEH 4POUB 3BZ4A 3DUSB 1FYHB 3LSOB 1H3XA 2AEPH 2MCPL 2XNAA 5DRZB 4PYGA 3GBLA 3WE6B 5CIPH 1AI1L 1EZVY 3LQZB 1J18A 1NAKH 1KCVH 4MAYD 1DEEA 2ARJB 1Z5LB 3DLQR 2Z4QB 3ULVH 1TETH 1QHOA 2XZCL 3V5DB 5J12B 1LDPH 5T5FH 2OTPA 2DIJA 4PREB 1CR9H 4PJXF 3DI2B 2R39A 4L4TD 2VC2H 3OKDA 5I1JL 2F5BL 5CEXB 5IKCA 1G7HA 1W72A 2LV4A 5ILTL 3ULVE 1KCSH 3L6FB 4GAGL 4X98B 1ONQA 5BRZE 1J88A 4LKCB 3UMTA 4Y4HA 5DT1H 3LIZH 2X4SA 1J12A 4NN5C 1RUPH 3LS4L 5IBLC 5DJ0A 2A6IA 1F42A 5I17A 3KXFB 4O9HH 3MA7A 5EIIA 2C5DC 5H94B 3TN0B 3HNSL 5KZCB 3WKNA 4OZHB 3RIAF 5IB2B 5FHBH 3QUYC 3PV6B 2DLGA 4ZTPH 3HI5H 2L4OA 3UTQB 1WBXA 4FZ8H 3VFMA 2NXZB 4JKKA 4KRLB 4LEOB 2D03H 5B3JF 2NY5L 2P5EE 1R6VA 3EJZC 2DB8A 5HYSB 1UXWA 4KK9D 5IHLB 2IALB 3VXTA 3KVQA 5FYLL 3KLDA 4J3TA 2A83B 1NLBL 2ICWJ 1M05B 4RAUA 3AAZB 1RHFA 3M45A 3JUZA 5DEGB 3TZVC 1LE5A 4NQCB 4LLQB 3FQTA 3WS3B 1MPAH 5EZJB 3U4BL 1YDPB 1ULVA 1FZJB 1LEKB 4KKAC 2R0LL 5JO5A 1FGNH 3MO1A 4FOMA 4RISL 2P8PA 5GISH 3WEXA 1U8MA 2V17H 1EAJA 5FO9B 1ZTXH 3ULVD 1R0AL 2H3NA 2E7MA 2G5BA 3NABH 3P4NA 1MCOH 3DBXB 3OXSA 3QXTA 2NLJB 4U3HA 2AEQL 4PRPB 1T1YB 4P3DB 2P5WA 4ODXA 4KV5F 5D7LB 1AXTH 2YSSB 3S6CA 4P5TD 2VZOA 1S7QB 5DSCA 2B0SL 1FNGA 4OUUA 2XYCA 4Z0XB 1MCNA 1XFPA 5I1CL 4DGYH 2Y36H 2VLJA 2OQJA 3K2UL 4N0CC 4AMKL 1NKRA 1CE1L 4L8SA 3RNKB 4KJPD 5E8NA 2R0KH 1J0YA 1B9ZA 1BD2D 2Q7YB 5JXAH 1C5BL 1I9IH 3GMRA 3O4LD 4KJWD 4UINH 4X4YA 1FLRL 5KSAD 1CTOA 4YHIA 5EO9A 4M6AA 4RNRB 4WFFE 1UZ6E 1KIQA 4XXDA 2XV6B 5DD5L 1R5IB 3IDMB 4G43B 3T77A 2P24A 1T1XB 4P5MB 4Y5VB 5I8EB 3QRFM 4UV4H 1ADQA 3PV7A 3PDGA 2HKFH 2O93L 4PJCE 3OAYK 3MV11 5CCKL 4DK6A 2FNBA 2YUZA 4BH8A 4X7SH 2C3GA 5F9AC 2X4RB 1FN4A 3HFMH 4GQ9H 2EH7L 3FMGL 4QXWA 2ENYA 2ZG1A 3DXAB 5IROC 3CLFL 1GGIL 1RUQL 3W0WE 2W07A 1BZ7B 4P59L 1FL6A 2DJSA 3LKOB 1N8ZA 1J8KA 4JZOB 3CSYA 4H88H 4HEME 1A5FH 1NGWB 4GAJH 5I74B 4JRYA 3T8XB 3MGAA 2FWOA 3W2DL 1OQOA 1NUGA 1MSPA 5I19L 3IKCB 4HKZA 1EJ6A 3O3AB 1LEGB 1A7NL 1RZ7H 4U1SA 4UUJB 4Q2ZA 3VRIA 1Z0MA 5IT2H 4YC2C 3SE8H 2QQLL 3U36A 2NX5A 1CS6A 1WITA 2FJHA 2VLME 2V9TA 4OD2B 3SCMB 5IHBA 4V1DA 4ZQKB 1GOGA 1V05A 3PL6D 5B3NA 5ELIA 3HCVB 1BM3L 3QISA 5E08L 3SDAC 1BVKA 2W65B 4LCUA 1I7RB 1YZZA 4WHTB 4W68A 4WFFD 4HX1B 5J1AA 5IM7A 2IG2H 2MQ0A 2PNDA 4JZNB 2YWZA 4EQ3A 2FGZA 3K8MA 2IMNA 1EO8H 4K3DL 5AYQA 5IVXA 2DM4A 4NC1C 2ITDA 4EN3D 3ARUA 3WUWG 4MA1B 3FQNB 1X3DA 3R1GH 3U6RB 5C2BH 2JELL 1S78D 1A64A 3N9GH 1TQCB 1HSBB 4LCYA 2J6EA 5T3XL 3UC0H 2CRZA 3X14A 3HI6L 1NJ9B 1U8NB 1E28B 1ZHNA 2DYPB 4HK0A 3IFNH 5IROA 3G9VA 4LVEA 1MY5A 4AJ0A 4AEIL 2XICA 1UJ3C 1G7LA 3IDIA 4JM2C 5GGVH 2YA2A 4LGPB 2IPKB 2WBJC 4HWZA 3U46A 4JZJC 3EO1A 1LE9A 1IFHH 3RVTD 1YYML 4OLWL 2CGRH 1B0GB 3EDKA 4YDLB 2HJKB 1CGSL 5HYJA 1VERA 2VAJA 1XF3B 1PKOA 1ZEAH 3CU7A 3SQOH 4WTXA 3QXVA 2EYRB 1EVTC 2FECL 2IANB 2PYEB 2Z31D 3PWUB 5IUSA 2VLRD 3OKNB 5GHWH 1Z9SA 5B21A 1NGZB 3EW3B 4A2LA 1X5GA 4CN6A 1W2KT 1JGUL 1I8KA 2B2XH 1PZ5B 4HJJH 2YC1B 1JNJA 3V8OA 4IOFC 4PUBL 3L3JA 1ORQA 4P46D 2WLZA 1DQQB 1EFXD 4ODVL 3R8BB 1NC4A 3CSBA 4BSJA 2MKLC 1LO0L 4Q9QL 3UPAA 4JKPL 1AHWB 2NY6C 3W9EB 3GSNL 3DETD 4NCC1 4E42A 3DVGB 1ZGLB 3WDJA 5DMGD 1KXVC 4WHDA 4NBYB 5DFVC 1MREL 4M8QB 3H0TA 4ODWB 4NJAL 4H5SA 4IMKC 4JM2A 5EU7E 4PJIE 4UNUA 2WBJA 1DQML 4KZDH 4MCYA 4HPYL 3IFOB 4JZJA 2HWZH 3MACH 1MVFA 2JE8A 1RQ5A 1EGJL 4P23B 3MUGB 3GMMA 1PYWA 1WZLA 2C1PB 1QFWM 3B9EA 35C8L 2BNRE 4U0RC 3IFPA 1R3HA 1RZKC 5T3XD 2H41A 2VR5A 1CDUA 4LCIH 3F6IA 5CBEB 4I77H 2W9LA 4JN2A 3SKMB 3PQYE 5EA0H 1TJIH 3JV5A 4AM0B 1JGVL 4OZGA 1N0LA 3MXVL 3V5HA 1R5WA 2GTWA 2HKHH 3GRWH 3ES6A 5ESVB 5AWNH 2AS5M 1KN4L 3P77B 3OJDA 1FZKB 5FUOH 1GGTA 4XCCL 2O5ZL 3F5WA 3MNZA 3VMOA 3PABA 3BP6B 1GPOH 3HC0A 1NCAH 5IVXF 3THMH 3X12B 2FEDC 2FSEB 1F8TH 3TFKD 5CJ8A 5IR1A 5JNYB 5I1GH 1JGLH 2R29L 4FXGA 2DQHH 5C0DB 3W82A 1G9NL 4ODHH 4MLSA 4IMKA 4GW5B 3GGWA 3V6FB 3D2UD 4QRRA 1IKNC 3DYMA 3WLWD 4PRHB 5EO1A 4U31A 2KDGA 2ARJQ 1OT1A 2GUOB 3O3DA 1RURH 1YEDA 2Q76A 3HE7C 2CLVA 2YKLL 3IU3A 5FDWB 3AM8C 4LASL 2BNRD 2W60B 2BNQE 3AREC 2OJEB 1MCDA 4YHZH 3SDDA 1BVLB 2P8LA 4DKEH 3HMXH 4TTDD 1INDH 1KB5A 3PQYD 3Q0HA 4GAYB 2MNUA 2X4NA 1HH9B 1S7WB 5HHVL 5MENE 4JO2H 4YO0A 5LGKA 2IH3B 2VQ1B 5EUOA 2HLFD 1MLCA 3MRRB 1SJEB 2VR9A 2BVOB 4YHKH 1I7UB 5FUCC 4N1HB 4U1NA 3GMLA 4OV6F 5DRXA 4X6EB 3RDTD 2R69L 5D9SA 3ARDB 1WIOA 4JVPA 1T5WA 3IJSA 1FAIH 3S5LA 4PS4L 5E5MA 4M7KH 1XGQA 2ZOLA 4Z7UA 1UKTA 4C83B 4A6YH 4LU5L 4FQCH 3I9GH 4RFEA 3TBWA 1YY9D 2GY7B 4JB9L 5IFJA 3NCYP 3BQUB 2APBA 4HWBA 3L3IB 2F54A 3CFDB 4NGHH 5D93C 3B9VA 1IKNA 4G8GA 4XMKH 2FHCA 1T4KA 1JPSH 1OVZA 4JRXE 5LJYH 4JM2F 4LSVH 1JK8B 4NM4H 5D2LA 4QRTA 3HE7A 5IB5A 3BH8A 5JQ6L 5F7FA 3T2NL 1FHGA 1HKFA 4ZODA 5LBSL 4HWEH 3AM8A 2R9HD 2FB4H 2PXYC 1FNLA 4LCWE 2OM5A 1AGBA 2BNQD 5E2WH 3ZE1E 4LLYB 1L0YA 3L95B 3MREB 3VFNA 5DDHB 1N3NA 4WHYH 4TVPH 1U41A 4ZNEA 4LEXL 4PJXB 4KROC 1U8HB 1QP1A 4WWKD 5LGHH 2F19L 4FQQA 2AAVA 5D2NB 5MEND 4MJ5A 4RFOL 3S36H 3D48R 3MGOB 4ZYKA 1DL7H 4TVPE 2AQ1A 3QDGA 1EJOH 4NQXA 4K3GA 3N85H 3LZFH 4OZGF 5EWIH 3O6KH 1HXYB 5IIEA 4KU1A 3MJ7B 3WFHA 1A1NB 4HH9A 1M1SA 4ZO7A 4Q6YA 5DFTA 1Q9WA 2R1YB 2DQJH 1CT8B 2DQUL 3Q3GB 4KI5C 1KN2H 2Z0BA 4ALAH 4DEPB 1KJ2L 2BCKA 2PO6C 1ZHBA 4KTEH 5TPWH 5BXFB 4W6WB 5I0DA 5JOPE 1UB6B 5LQBH 3D9AL 4BFIA 4MB4A 1QFUL 1U8IB 1BJ8A 2X05A 5IEHA 1HWGB 1GHFL 5DHVB 1IC5L 5GRJH 2P44B 1K8DA 4ERSH 3WUZA 2ZJSH 4ODTH 4PJBB 2H9GB 3VRLE 4Z7OE 4H1LB 4YXLL 4S2SB 3TT1L 2CR3A 3CLEH 4XNXL 3HR5A 1MRDL 5IHUL 2PXYA 4UTBL 2IH1B 1DSFL 4MHHG 3FN3A 1YJDH 3MCKA 3VFRB 3GK8H 4RGND 3CFCH 2BJMH 3ISWA 2VDNH 1G7QA 4G6KH 4CU6A 1U2CA 5EOQL 4MAYC 4K94L 5F7UA 4UT6L 2V5TA 3VXOA 3C5ZA 3QPQD 1GGCH 2R56H 1TJGH 4HKJB 4CNIB 4XX1E 1DQTA 3ZTJG 3TBTA 3OJMB 4JPVH 1QYGH 2B1AH 1ZK9A 3K81A 5EUOF 3JVGC 1D5IH 3WJJC 3PP3H 1WC7B 4ORGB 4OQTA 3SBWC 1XF2B 4HC1L 2HA1A 1LO4H 4X5WA 1FP5A 7FABH 2G2RA 3QH3B 1F3DH 3TYFA 3U48A 5F1IB 4M7LL 5MI0B 5SV3A 3WL9A 5J1TC 1P2CA 3VD7A 1FG9C 4Z7UF 5CHNB 3VD3A 1QSED 4HUKB 4HWNA 1G6RL 4XCYA 3W5NA 1UM6H 5IB1B 2OL3L 4NQSA 3KR3H 5BO1H 4KRPB 3BZ4B 5CJOL 3UTSA 3F7VA 3X3GH 2YUVA 1RZ8A 4TNVF 5D2LF 1MIEH 1MHCA 4KK9C 3VGDA 3VWKD 1G84A 2W0LA 4I0PD 4WDIA 3WKMH 3H42L 4MAYA 3VH8A 3LEXA 4MA8H 4MDJA 3HR6A 4K8RH 4FQHA 3RUGE 1MAML 4FFZL 3OKDB 5F1NA 5IKCB 1G7HB 1W72B 3KPLA 1NUNB 4NDMA 4HBCL 2FGWH 4MDIA 3JVGA 4K55A 2YPKA 1F58L 4NSKA 2X4SB 2OI9B 4L4TA 4LQFL 3ULVC 2EDDA 3SBWA 3T0EE 5I17B 3I6KA 2AW2A 5E4EB 1U8QB 3MA7B 5EIIB 3WXVL 3EZJB 4ZS7L 4KVNH 3QWOB 1PQZA 3FQUA 2GT9A 1A1OA 2KZWA 3ZLQC 4P5TC 4YHML 4NKDB 4OFYA 1WBXB 5TDPB 2NY2B 3QUZA 5JMRA 4MXQD 3QXDA 5BS0B 5FM5O 1WZMA 3FONA 4I18C 4EUPG 1EEYA 4XHJD 3CDFA 1FGVH 4KJPC 5E94A 5CZKA 3RNQA 1HYSD 3BO8A 3C8KB 3VXTB 25C8L 4KJWC 4GUPA 3WFEH 1Q0YH 3GO1H 5GS2D 5KSAC 3DMMD 3SDYL 4RAUB 1V3MA 1LE5B 4IJ3C 4HFUH 3FQTB 3O81A 3MJ9A 2A9MH 3MYJA 2P49B 4KI1A 4PY7A 3HA0A 3FB5A