1NPUA

Crystal structure of the extracellular domain of murine pd-1
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
116
structure length
116
Chain Sequence
b'SLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFSNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 1
publication title Structural and functional analysis of the costimulatory receptor programmed death-1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 28
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2003-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1npuA00
3ZSSA 5I1JL 1QR1B 2WW8A 2QSTA 5D2LA 5IB1A 5KVEH 3N1QC 3W81A 5IJVA 4QTHA 5JHLL 2MJWA 1T04A 5LG1A 5E8PA 4KJPD 5JIHA 4AL8H 1EUTA 3TBSB 4ZNEA 2AQ3A 3BP6B 1FFNB 2IBGA 2A0LC 5I1LB 5EA0L 5ESQA 1SJHA 4LHUB 4Z7VE 2R1XB 3VXTA 2VWEE 1UFUA 4TPRL 4OFYA 5A40E 4DVBB 5DT1L 2QSCH 1F4YH 5DJDA 1UADC 1K2DA 4QRQB 2WM0A 3HCVA 1NBZB 4YFLF 4YEFA 2YBRA 2AEIT 4GMSH 4ODHL 1LDPL 2Z8WC 4ETYA 1R3IL 1IZJA 4HXBL 2XFXA 4KU1A 3QHTC 2OSLA 5GRUH 4U0RB 3P4OA 7FABH 3CXHJ 3VG9B 5DVKA 2EO9A 4YC2B 1T83C 2W9EL 4NN6C 2Q3ZA 5EDXA 3MRFA 1Z3GL 4RNRB 3OAZH 4KMTL 1AGCA 3HC4H 3O8XA 3L3JA 1KIQB 4JRXE 2EDNA 2AEWA 4ZS7H 4OCXH 3DRQB 1BM3H 1H15B 1Q94B 5INCA 3OR6B 5E7FA 3C60A 1JRHL 1K4DB 5L2JB 3EHBD 1BQUA 1X5ZA 2BMKA 5EORL 1U93A 1EHAA 2AJUL 3BWAB 4RA3A 1WCBB 1ZKAA 3GNML 1MHEB 5ETUA 1IL1B 1IM3B 2ADJA 4I3RL 4M7KL 1CZ8H 3QZWG 5MP6H 4RAUB 5FECA 1WF5A 2R0KH 3D5OF 4JFDD 1JHKH 5ADOH 2VLRD 3KLAA 4K8RD 3PQYD 4X7CC 3ARXA 1IEBB 3MRBB 5DO2D 1QG3A 1AY1L 1QA9A 3NCYP 4GW1B 4IEFB 2KQNA 3RVTC 4QT5A 2HVJB 3MCLH 3NCFB 3GSVB 1CGSH 3L3DA 3O45A 1RZ8B 2Y6SC 1ROWA 1HYSD 5E5MB 1OAYH 2FRGP 4NQCB 4DZ8A 4ZG1A 5A16B 1QBLH 3BP5B 5C6TL 3ZYJA 3OAZK 35C8H 5TDNB 5F8RC 5T3XL 4WEMB 4GRMB 2F19H 5F1NB 4IRSD 4MXQD 3QULB 5D7IB 1VEMA 2OK0L 3DJ9A 1MJJB 2UVEA 3G5YB 1G7MB 1DUYB 4G9FD 1S7XB 5E2TL 1I3GH 3BP4A 5TE6L 5J9PB 4YHOL 4YFEA 3IGAA 5C70A 1CTOA 2ZKHL 2WQ8A 1CT8B 3VW3H 1U8HB 4XT1C 1DVFA 4U1LA 4XMKL 4AEIL 1S7VA 2F54A 4HQQL 1A7OL 1E4WL 3MBXH 2OP4L 4JY5L 4NQEE 3VXSE 3X13A 2YUWA 1Q9LA 1Q9KB 5FCUH 2J8UF 3BPLB 1AXIB 3A67L 3P9WB 4X7SH 1QP1A 4PGEB 1B0RB 5DURB 1FRGL 1QR4A 5F1KC 4J2XA 4YQXL 3LD8C 4X9IA 2EIZA 2DB8A 2YA2A 3IJSB 4OT1H 3CSPA 4HZLB 4WO4B 4I77L 3VXRD 1P5VA 2AJ3B 5DVLA 3MGTB 1NAKL 5EU6D 1ETZB 1UZ8B 2KBGA 1H5BB 3JWOL 2DM4A 4XPBH 3K2MC 2A38A 1J87A 3WFDL 2HTKC 1JPTL 5C2BL 3C2AL 3ZKSD 2I25N 2EH7H 4EOWH 4U1HB 1IQDA 5C09A 5CZXC 4NJAH 3RZWA 4JANA 3SGDI 3O9WA 3MXVH 1DANT 5ISZB 4Q9QL 1MI5D 3AUVA 2X1XR 1ITBB 1X6LA 4GUPB 5DFWH 1AFVL 4PUBH 5C9JA 5D2NE 2BNRD 4NP4L 3L95B 2OLDA 5HHXL 2UWEE 4AH2B 1EBAA 3SJVA 3T1FB 1FORL 2P5ED 4YPJA 3O2WH 3WS3B 1VB9A 1ZHLB 5ACMA 4PJDE 1G9ML 3RGVA 4HUVB 5GS0D 4MD5B 5DYOB 2V5MA 1BECA 4F9LA 2BNUA 4ISVA 3RPIB 1DN0B 5LCVL 1JZ2A 4UBDD 5ALCH 1AGBB 3I6LD 5FGRA 4JKKA 1JGDA 2FEEI 1QLRB 4FQIH 4CMMA 4YE4H 5SX4I 3ECBB 1JMXA 3QIBC 2GCYB 4JQXA 5JHDA 1JGVH 1XF3A 1CD1A 1TJGH 4ESKA 4PREA 5FUZL 4OM1H 5LVEA 4P57B 3TNMB 4LARL 3QQ4A 4NQUA 3SDXE 5I9QB 3O3AB 4KJYA 4LIQL 5CCKH 3DMMD 4WFGD 2KDGA 4MLIA 3H7LA 1Z9SA 3GBML 3SDYH 4L8BA 1Z9OA 4UB0H 1IGYA 2X6MA 2QLVB 1A6TB 4O9HL 4GAYB 3UROR 1FBIL 5GJSH 1F11A 1KGCE 3T0VA 5DMKA 3IKCA 5I8CB 1EMTH 3ZE2E 4M03A 4FS0A 2GEEA 3RWCB 4QF1A 4Y4HB 3VXUB 4PRDB 2AJVL 2BRRL 4PJXA 3BO8A 5C0CB 5D1QC 1INEL 4HGWB 3D39E 1GGIH 4UV4H 2Y36L 3AREB 1FYHB 1D5XA 4ZTPL 1Y0LB 3T77A 3KPNB 1CGTA 2XWBA 3QUKB 3MREB 2WSKA 3QUZB 5T3XD 5EPMA 3PGCB 3BDXA 4HIJB 4D9LH 2A73A 4JFZL 5CEXB 5T1LB 2VXQH 3NCJH 4OQTL 2AV7A 4LLVB 2X5PA 1L6ZA 4Z7VB 3MLPA 3LQZA 3QDAA 2EDXA 4XGZB 1RHHB 2HG5A 4HUWA 2MHAA 1HNGA 5GGTH 2FD6H 5I74B 2EDKA 2YA0A 1MUJB 5HYJA 3LV3A 5B38G 2APXA 3WNMA 3ZO0A 3PWPE 3MR9A 5TE7L 4GSDL 3MLXH 3WXWH 5DRZB 2AJZA 1NEUA 1Y18A 4ETQB 3HI6L 3HN3A 5HGDB 4QHKJ 4CUCA 3HR5B 4Y5VB 3RDTD 3WDIA 1DBAL 3O6LL 4D0CA 1SHMA 1CDYA 2EDLA 1MFBH 4R4NC 2BJML 5KS9F 3QA3B 5DFVD 5I30H 1U8LB 4QRPB 4O02H 3PWUB 2R2HA 3B3IA 3BI9X 3ZZ1A 3VWJC 1BD2B 2VDOH 2QSCL 1F4YL 4F7CB 5DRXA 1SYVB 1MCCA 2V7NA 1HQ4A 3MRHA 2FJHA 2IF7A 1MNUL 2BOCB 2VDLH 3MRLB 4GMSL 1G6RH 1MCDA 3LPWA 3U0PA 4F3FB 5TFSH 4KI5D 3OX8A 4W6WB 4F2MB 2EC9U 1TMCB 1VGEH 3THMH 3E6FB 1VHPA 4HF5L 5DJDB 3X12A 1F4AA 2QQNL 1S9XA 3QHFL 1QLEH 4R90L 3SE4C 5E5RB 3MRCB 3OQ3B 4MA3B 5DEGB 5TE4H 4MJ4A 2APWA 3HC4L 4TVPE 5L8JB 4JZNA 4YDJA 1BM3L 3S96B 1F45A 4UZGA 4JRYD 2OSLB 2ICEA 3ARVA 5A3ID 3WLBA 3IF1A 4N0RA 2KKQA 3JV5A 4Z0BH 5JW5B 4XVTH 2J1KA 3V6OC 4KDWA 2IGFH 3H9HB 3QQ9D 3JVGA 4WY7H 2JCCE 1YUHA 1CZ8L 3GI9H 5MP6L 5E2WL 4ENEC 2R0KL 5ADOL 1JHKL 2H3NA 1LD9B 4M00A 4CW1B 4PYGA 1I9JH 4P2OB 4BM7A 2AJXL 4QXUL 1Z6JT 1IT9H 3U0TB 3QUZC 1FPTL 4OCSL 1NLDL 4R97C 4NQEB 5MHSD 3BRFA 3R8QA 5TPWH 5CJQH 3VCLB 1OAYL 3FT2B 2HLFD 2OMNA 1ED3B 4GRLA 5ETUB 4XHJD 2FCBA 3MLYL 4QHLA 1QBLL 1CXEA 2VL5B 1HQRA 4OLXH 2LVEA 5F89A 5IB5A 1J5OH 2F19L 2PYEE 2Y23A 5C1MB 3IDJA 3P4MA 4HBQA 3VRLE 5T3ZH 2APFA 3FHQA 2W0LA 1KJ2B 2EXYC 1TCRA 5DRNB 3FMGH 2Y5TB 3F12B 3CFJA 3VW3L 2CLVA 3DO7B 5T33H 4F7TB 3RKDD 1I9EA 1T2XA 5SX5H 3H7BA 1H8NA 3MBXL 1VADB 4HKXB 1G0YR 3MZGB 4BH8A 4GW4A 2HLAA 5FF6B 4Y8DC 3ISWA 4G7YL 4X7SL 1I7UA 4R26H 2QJDA 3GFUA 1KTRL 1S9WA 2R1WA 4I18B 1VESA 1ZANH 3ZT5A 3STBA 5IQ7H 5GIRB 3BN9D 5IG7B 4JE4B 4UIMB 1OOAA 1QEWB 4P46A 3RTQB 2X4OA 1G7QA 2V5RA 4NYLA 5E4EC 5D2NB 4OT1L 1CL7H 5CP7A 5I19H 2VITB 2UWEB 2JF1A 4YIQB 3FCTB 2CD0A 2P24B 3MV7B 3UYOD 3S88H 5C07D 3H9ZA 1FFRA 3W0WE 4L3ED 3OZ9L 1IRAY 1IM9A 2ZUUA 4XPBL 5I16A 4KRPD 1K8DA 3DX9A 1T0NB 2VABB 4GMTL 4NJAL 5C08E 2EZ0C 2ZPKH 4PV9B 4NO2B 2CDGA 2AABH 5SX5K 2X4NB 2ZJSH 1OAZH 2G60H 3SE8L 2QADD 2EDWA 2EDFA 2DTSA 3MNZA 2LU7A 3AC0A 3FRPG 1BEYL 1I1YB 2APVA 3RWIB 2ARWA 1OP3H 2EIBA 2JIXA 1WC7A 1IQDB 3HA0A 3MJ6A 5FA4B 1I1AA 1XIWD 3U4EA 5FO9B 4XMPL 3MLTA 4LLMB 3O9WB 3HAEH 3O8XC 3OR7B 4XNZB 1OAXH 3NCEB 5JOFA 1P6AB 5D5ME 3PIQB 1C1EL 3HNVH 4P2OC 3AU1A 3WN5A 3RAJL 1BGXL 1G7IB 4QHUA 1LNUB 3C60C 2D2OA 3T8XB 4OCYH 1HSBA 2IPUG 4YE4L 3N1MC 4JPVH 5EOCL 1DQDL 2R0LH 1TJGL 2EDYA 1F3RB 4OM1L 1IC1A 4L8DA 5C0DB 5CCKL 2H2PD 4O2CA 4A2MA 3QDMA 4JR9L 5DMGC 4HPOH 3HMXH 1V3JA 5FFLA 3CXDH 2WUCL 1CFTA 3K8KA 3SDYL 4UB0L 3CC5B 2ZUWA 1JE6A 4CMMB 4F33B 4QRUB 5GJSL 4DUXA 1IC4L 4LU5H 2MWCA 1GL4B 2XTJD 3IDIB 5DJ8B 1OP3K 5CGYC 4OFVA 4LQ1A 1ZHBB 1U8OB 4ZTOL 5E9DB 3QO1B 4OCWH 4UT6L 1QRNA 1MCLA 3EAKA 1OPGH 1PZ5B 2CXGA 3MRKA 3I85A 1GGIL 2J3SA 1DCLA 1W72H 2VSDA 4RFNB 3ZYOA 1EEZB 1MIEH 5AZEH 3DBXA 1RURH 1DVFC 4D9LL 3OXSB 1U8IA 4GH7B 5D7LB 5AG9A 2DQDL 2VXQL 3OAUH 2YUZA 3GRWL 4JDVB 4JG0L 2IQ9L 3MRIA 2MQ3A 1KLUB 5E2JA 2NYYC 3UC0L 5E1HB 3K1DA 3D0VB 1JTPA 4KAQL 4RFEA 5F7MC 4R3SA 1I7RB 1UQSA 3UAJD 4NNYA 1EBPA 5C0RH 3UTPD 2A73B 2Q8BH 1IZKA 1MIMH 4HEPG 4UOJA 1S78C 4D2NA 3MLXL 5AD0B 4ZODA 4ZOCA 3JTTB 1F6LL 4P23B 5E6IB 2P42B 4UILH 3ARRA 4N0YH 2AQ1A 4ONFH 1W0VA 2NCMA 2LFGA 3HNSH 1YN6A 2E3VA 5KW9L 5BMFH 5FB8A 5D7JD 1BX2A 2B2XH 2CKBL 3TT1H 3AS2A 5LXGL 5CJ8A 5I30L 4O02L 3T4YA 4C57C 1KC5H 4KK8D 3A6OA 2QKIA 5F7UA 2IALA 3RWEB 2VDOL 2AXJA 1C12A 3O9WC 4DGYL 2V7HB 3PNWA 4HHAA 3ULSA 5C0NC 2AXGA 3E2HB 2H8PB 3KYMA 3MROA 4EVNA 2VDLL 4OLZL 2FGWL 3LMJL 2OQJA 2R39A 4CADB 1EGJH 4QTIL 1GPOH 3BEWB 5AYUL 1A6VH 2JCCB 4OLVH 2MTPA 3THML 1RULH 3OHXA 4QRTB 4PJCB 4OGAD 3ULVE 1XF2A 4ELKA 2XICA 3RGVC 1HHHA 4LSPH 5GGTA 4F9LC 1C5DB 1QLEL 5FO7A 5TE4L 5DQDH 5IF0B 3HUJE 5GSVB 4MNHA 4G42A 5EU4A 1UXSA 3CFCL 1KUMA 4RRPG 2MNUA 3FJTA 1HILB 1N59B 3U6RA 3LN5A 4N90D 4FMKA 4MA7L 4XVTL 5CBAB 3O3EA 4BFBD 2PYEB 1BFVH 5KOVC 1XR8B 2XKUA 3ALXA 3VXPA 3O6KH 4ODBD 1JV5A 1X5LA 1BBDH 1LO3L 3ARWA 4EJ1C 5I73B 1LK3H 5K9JL 5H94A 3QJFA 3I75A 1ZVYA 2PETA 1I9JL 2D03H 3LRHA 1DFBL 4RFNC 3REVB 5JDSB 3PDGA 4Z7UE 5DK0B 1NC2B 3DETC 1MWAB 4PJ7E 1P84K 2A0LD 3BT2H 1G6RA 3QQNA 3IJHB 1E28A 3KPLB 3NPSC 5CJQL 4S0SD 1GOHA 1FAKT 2OL3B 1T5WB 4LCWE 3HS0A 3VFSB 2APTA 3PG2A 2YD4A 2J8HA 4JFFA 3EKCA 3OXRA 4AEFA 4OIAA 3ARUA 1UACH 4OFDA 3LRSB 2G2RB 3TBWB 3CVHH 3OMZA 4HSQA 3FMGL 3WNNA 2ESVA 2LVCA 4GG8B 5I1AB 4UTBH 3ARGB 3MNWA 3DLQR 5D1ZB 5E6IC 4LNRB 4HWUA 3W0WB 3LEYH 2BOBA 2Q3AA 2DQJH 3Q48A 5HXMA 1DBMH 4RGNE 3SDXF 1A3LH 1T5XB 3QIUD 1JPSH 1CXFA 2DQEL 2XWTA 3JUZA 3VE0A 4LNVA 4ZAKD 3CFIC 1Q9OA 5IQ7L 3UTSA 3B9AA 4RAVA 4LVOB 5D9SA 4K7FA 3RZCA 3EOAA 3EZJB 3GMOA 2EE9A 3ZE2F 2BXYA 5I19L 3VD7A 1J0HA 2B1HH 3JTSA 4NM8H 4NNXB 2JJTA 5KSAD 3NFSH 4AT6A 1VENA 4D9QE 4G9DB 4LPCA 3BDYH 2YPKB 2RCSL 3MSPA 4MHHG 4WUUD 3RVTD 1HHGB 2F8VA 5F7LB 1P4LB 5D5MB 2X05A 5KS9A 2QR0A 1YMHB 2QHRH 2DQGH 4NSKB 2Y6SD 4GXVH 4U6VL 5F3BA 12E8L 5CP7B 2CDFB 2F5AH 2UY7A 3UJTH 4JFED 1OAZL 4XI5C 3V4PH 4P5KB 2Q86A 4ODUB 1OT1A 2WIIB 4LAJH 5MEOA 1C8PA 3ELAT 1MCRA 5IMLB 1EPFA 4PJ5D 1J1PH 4W4OC 2VLKD 1FIEA 2CR3A 5I17B 3TYFA 1WCQA 2OS7A 3LH2L 4CVXB 3DVIA 5I73C 3U7YL 3FFCA 1OAXL 1OD7A 4D0DA 1LEKA 3S34H 2FEEL 1H8OA 3MBEB 4UT9H 1WZKA 4OCYL 4XBEH 4IJ3B 5TGBA 3G6AA 2DN7A 4JPVL 1BHGA 4DW2H 2ITCA 4PB0H 1WC7B 5L6YH 3TC9A 1JZ6A 3MLTB 5CKAA 2R0ZH 1QBMH 4R9HA 4PGDA 3GGWA 5DF0A 2E7CA 4C4KT 2ITDB 3QWQB 5CIPB 2CH8A 5I1EL 3BUYB 3O3DB 1U3ZA 5KSVB 4HPOL 1PQZA 4HH8A 4PJHF 3CXDL 1RK0B 3QR2A 4JZJA 3MJ7A 4Y88A 1ONQB 2D7TH 3O4LB 4LEOA 4X6BB 1PGRB 3S8WA 1A0QL 4GRLC 1E6JH 3C9NB 4EUPB 2EC9T 2HTKD 1FYTA 3HG1D 4PJGF 3EO9L 4OCWL 4G43B 2BVOA 5FM5M 1QFOA 3EYFB 2E9IA 3V0VB 5CZXD 4I48B 3TPKA 5FK9B 1QFUH 3H9SE 1DZBA 4LKCA 5I15L 4HFUL 3HAEA 5E6YA 3UZVB 4HWBL 5IMMB 2VE6B 5EC2B 1MIEL 5AZEL 4Y89A 1TPXB 4ORGB 1KIPB 4LVOC 1S9VA 1TTGA 2CKNA 4WGVB 4PLKD 1BIIA 3WL9B 2B8OT 1RIUH 2CQVA 2XXMB 3CCHB 3CDFA 3W39A 3S36X 3IB4A 2VZOA 3Q5YA 2YEZB 4BSVB 1H3VA 2VLLA 2NY6B 4MNQA 1WQVT 3TA3A 4CU6A 1LEIB 1A1MB 2PCPA 1GC1C 4P46C 2Q8BL 3C2SA 4LL9A 5I1KH 3HMXA 3VDCA 3QIBD 3GMPB 43C9B 1KNOB 3KWWA 1F3DH 3IRZA 2R4RL 4HUMB 4NQCD 1XH3B 1OY3B 5EOTB 4UILL 1RVFH 3CUPB 4N0YL 4OZGF 3MRIB 4ONFL 4CVZB 3HNSL 3D69A 4PJIE 3DTXA 3MNVB 5GRJH 5DGQA 4XC3H 4KPHL 3TT1L 4JO2H 2J8UB 3QDGE 4MSWB 1KCKA 3LKOB 3HUJB 3F7YB 1GXEA 4LDEB 3EYOA 2DS4A 4NT6B 3VRLF 1W72A 5JNYB 2JK5B 3V95A 4HMCA 4IDJH 5FOJA 3F6IA 4WI3A 4L4TE 3CH8A 5ICZA 3L3IA 2HJFB 3DUUB 2BCKA 1FQ9C 3PJSA 2EKJA 4XCCH 4WHYG 3U2SA 4WCYH 1RULL 5D71H 5FA3A 1H3GA 5C0AA 3GSRB 3QUYA 2ADFH 3S97C 1MREL 4P4KA 4PGZA 3AROA 1FO0B 1KIRA 4Z7UB 2RHEA 5IKCA 3VFUA 3KYMB 3MROB 3A0OA 3MODH 3O2DH 3WN5C 4G8IA 4BQ8A 1A1OB 1AI1H 1FZOB 2FHBA 5DSCB 4LCWB 3IDGA 3ESVF 4KQ4H 4CDGC 2YD9A 1J1XL 1GZQB 3KGRA 1BFVL 3Q6FA 2IMMA 3O6KL 1XR9B 2R23A 1A14L 3MOAH 1JF1B 4POYA 1YNLL 1JL8A 4HLJA 5ISZD 5BV7H 3BXNB 3QIWA 1LK3L 1IAOA 5BJTA 3FTGB 3IFOB 5LWYL 2LAGB 1CLYH 1X5JA 2D03L 4N8VA 4YPGA 5LAXB 3U6RB 4R4ND 1DE4A 1JWUA 1TPXC 3BT2L 1W0WB 5IEKA 1ZT4B 4LRIA 3GSOB 1EGJA 1ZE3C 4YLQT 3P9MA 4NO5A 4ZUSB 3VWJD 1CDIA 2DAVA 2HJKB 4FXLA 1WAAF 1HHJB 1V3LA 4YDLB 4R4BB 2YPLA 2RQ8A 2I5YH 4IMKA 4EN3B 4NCC2 1PKQE 3ZSTA 1TFHA 2IMNA 1UEMA 5FYLD 3T3MF 3ZE1E 2HMIC 3TN0B 5DWUL 1X5KA 5J6HA 4P2CG 1O7VA 2PR4H 2D7OA 5KJRH 3QUMB 4JRXA 1EEUA 4WI6A 5JW3L 4D0BB 3TO2A 4O58H 3FO2A 4OUOA 4XHQA 3ARZA 3RUGE 3D9AH 1DBML 4HZAA 2P4AB 3UPRA 4CVUA 1AKJA 1VFOA 3KYNB 1BJ1H 4TQEH 2YKLL 5FXCH 1DSFL 3SO3B 3QEHB 1XZ0A 1NSNH 3FOLA 3LHPH 3BKML 2NY1B 3MNWB 3PP4H 3QXAB 2ZOKA 3DVFA 4JFOA 4K71B 3FQXA 5JMOC 1ZGLB 1MY5A 3GM8A 3BPNB 1FVDB 3MLVH 2EIEA 3DNKA 1KJ2L 4URTB 3DIFB 1P4IH 1KTDB 2B1HL 2WLYA 3ARED 4NM8L 4ENED 4OGXL 5E00B 3CLEL 4RAHA 2AI0H 2CGRH 2V5TA 1DQQB 2A6KB 3MRNB 2PYFB 2IANE 1J7VR 1MCIA 3P0YH 3QUZD 4LSVH 4M5ZH 3F58L 4U3CA 2NTFA 3WFBL 4JDZA 4P2RE 3PWVA 5T1LD 5T1DH 5B39A 4R7NA 1KN2H 1I7TB 3KDMA 5HI4C 4XAWL 1KACB 4GG6E 1DEEA 3CVHA 2F5AL 1FL6A 4GJTB 1AO7E 4LLDA 5ESAB 2R2EB 3V4PL 3KVQA 4NHCH 5HHME 2BC4A 5DUBA 5ILTL 1T1YA 3VFTB 1X5YA 4ODVH 1TVBA 4C83A 1J1PL 1LE9A 2OTWA 2EXYD 1NLBH 3VXSA 4M6OH 5EU5A 4YHLH 5F3BB 4FNLL 1Y6MR 1SJEB 1IJ9A 5KANI 5DDHA 3WIIL 4NBXB 5E8EA 3WEXB 1QHOA 5J1SC 4KC3B 3ZDZF 1U58B 3LS5H 4WFHE 5I2IA 3NIGE 1I7ZA 4XBEL 3T2NL 4GAGL 5HD8C 4QHMB 5I76A 4QRPD 4DW2L 4PB0L 2MKWA 5L6YL 1I8MB 4K23L 1J18A 1BD2D 3TV3L 1P7QB 3H9SB 1PG7X 2FJFB 3MRGB 4LF3B 2YD5A 3MGOB 4G80B 2PTVA 4YNYA 3DUSB 1LEKB 1CGVA 4FHBD 3X17A 1WFTA 3SGJA 5HBBA 4BSWA 4HGKC 2Q8AH 4XP9H 2H2SC 1RU9L 4M9OA 5FUCC 3DSFH 1AP2A 5KVGL 1F3JA 1AXTH 4OFYD 2HN7A 3GSXB 4FQPA 2BSSA 1REIA 1T0MB 4D8PA 3ULVF 2EZ0D 2HFFB 1EFQA 1S5HA 1E6OL 5T1KA 4HDIB 3EO1A 5IVOA 4V1DA 1HSAA 1QFUL 2DLGA 5IHBA 3MJ7B 1MRCH 3F7QA 3EUUA 1TCMA 2P47B 2WP3O 3VXMA 4X6FB 5J6GB 4U6HA 2BHUA 2Y72A 4XPFH 2NY1C 4JVPA 2AJYH 1Q0YH 5ITFB 3KYKL 4GXUN 2XQBH 4PJIB 2VDML 5IK3B 3TBTA 2H9GA 4XWOC 3BPNC 4X6EB 1SYSB 4PJAB 1OARH 1ODAA 1M71B 3WKML 3O8XD 2E5EA 4KKNA 1S9KC 3L9RA 2F53E 2BVYA 3MLRL 1YYLL 3AXLB 5EUOE 4OF7A 4P2OD 5HY9B 4XVJL 1Q72H 1U2CA 1ADQH 3HPLB 1X5GA 5HJ3B 1CK0H 4PGCA 1NKRA 3SDXA 3QG7L 4NQED 4OKVB 2YSSA 5I1KL 1D5ZA 1UYWH 4MCZA 4PJ7F 2BNQA 3BRDA 2L7UA 5ALBL 4PRIE 5KTEL 3U7WH 3QXDB 1XGRB 1RVFL 1XGTB 2DLTA 4ZYKA 43CAA 3ZYIA 4M7LT 1CE6B 2JJTC 5IBUB 1K6QH 1IAII 5GRJL 1OSPH 1ORSB 1S7UA 4KHXH 2X40A 5DMGD 3FB6A 3BN3B 5DVMA 5HDQH 4JO2L 2GUOA 4OBRA 4X5WA 2YMXH 4S2SB 3DPBA 3MCKA 1WFNA 2R8SL 2DM3A 5CWSB 1OB1A 3D39A 3MJ9L 4LLYA 3L5JA 5CGYD 4IDJL 1AGEB 3FQTB 5ID0A 4YHMH 5ERWB 3HRZA 1LE5A 4JFXA 5DEFA 3DVNB 2CSPA 2B5IC 3P0VH 4R8WH 4WWKA 3TEUA 3EYQD 5F1SA 1NCUA 4YHZL 1TZIA 4WCYL 3WFHB 1CFSA 3QPQC 2YD3A 2HKHH 1QSEA 4XP6H 1DVFD 2I07A 5J12C 1M05A 3ULVH 3QPXH 2F54D 3B9EA 1A4JB 5E94B 1UT9A 3WIHH 1B90A 3LKSA 1CIDA 4APQA 5FGBC 3AMLA 4TVPL 2PXYA 1AI1L 3PWPA 3MV7D 2NYYD 3R1GL 3SKNB 3GUTA 2YC1B 3H0TB 4HK0B 4KQ4L 2I24N 4WI7A 3ROOB 4NQSB 3MTRA 4PG2A 4GAJH 4KTDL 3KS0H 4EKXA 1OP5H 3FB8A 5JMRA 3QCUL 1S78D 4UUJA 1PKQB 3MOAL 1ZS8A 2ARJQ 2VLJE 3HHRB 5DJXA 5BS0E 1AGFA 5C8JB 3VFPA 3N85H 1S8DA 2B1AL 2E6QA 4UT7L 1DBKH 5KVMC 1KF9B 4PJHA 2BSTB 4X4ZA 2O5YL 5HYQB 3QEQE 3MRMB 2VDNH 5HHVL 4XZUA 3O9WD 1ZEAH 1U9KA 2J8OA 1IAKB 1EA9C 4LSUH 5C0ND 4PJGA 1CLOH 4P4RB 5L2KE 4OZHE 1F6FB 3DRTA 1YDPB 3VGGA 2VQ1A 1G9NH 4J3OC 1JK8A 1T1XB 3O2DA 4MD4A 1XGUB 3ZL4H 1ZWIB 5IBLD 3SJVD 3WLWC 4KXZI 1A7QH 4AIOA 2XWJB 3L5XH 3P9MB 4NO5B 4WDIA 2E7LC 4ODXA 4JAMB 4B0MM 1PBYA 1RUML 4LP5A 3RGVD 3G5XB 5TF0A 1OP5K 3LZFH 3ZTJH 3KJ4B 4LPVA 1MWAL 1ZT7A 2A9NL 4PTUB 4BELD 4BJLA 4CAGA 4U1SA 5DHYA 3TA3C 3VH8G 5I8EB 4P2RB 4KWUA 4NN5C 4JFQB 2OL3L 4TQEL 1IKNC 1XGYH 3QUXB 5H8DA 3D2UA 1CU4H 2J6EH 3RJDA 3RWGB 1U8NB 3T0EE 4JFHE 2H26A 3LKRB 4MJIE 3WFEH 1BVKA 4IBLT 4DFHA 5FHBL 4WTWA 5E9DD 1MCKA 3MLVL 3NZ8B 2GSGA 1C5BH 2FJGB 4M7JH 5EZLA 1HEZB 1NGPH 1IGJB 2VQTA 3MGAA 1P4IL 3VWKB 5EBMA 1AKJB 5KVFL 1RJLB 4OZGA 4XCFH 2SEBA 3SPVA 1ORQB 6FABH 1FH5H 3DETD 4XTRC 4LSVL 4GBXB 2Z91A 3FOLB 5C0IB 1A5FL 5LBSL 2DQHL 2FX9H 4XB7A 1J11A 4XNQA 4L3CA 4NC2B 5D7LD 3AM8A 5T1DL 5IGXL 3BD4A 1KIUA 1HIMH 2OX5A 2XA3A 2DLIA 4HWNA 4DOHE 2MCPL 4ODWB 5ANME 4BZYA 4UQ3A 2GJ6E 3KPRE 1VACB 3QUYC 5ADPH 3KHOA 4P4KC 2FL5B 3V5HA 1DLHB 1ZVHA 4M6OL 1YECH 2LABA 5JUEH 3MA9H 4G8GE 3LN9A 4KVNL 4M6AA 5E6ID 5E70A 1FL6B 2NY2C 4GKZB 4KZDH 3MRJA 4R2GB 1A6ZA 1RZKH 4HBCH 3MV8B 3DYMA 1OP9A 1QLFB 1GC1L 4OZFG 1TVBB 4C83B 1IGMH 3ILQC 4HIEA 4LKXB 1QFWI 2DI8A 3QO0B 1CDUA 2IFFL 3EBAA 3QWRA 4MDIA 1N7ML 1N26A 5HYSB 2VWEC 3VDAA 3BJLA 5CP3H 5I2IB 4LHUG 4NFDA 2Q8AL 2J5LC 4LSQL 1G1YA 2H41A 1B88A 1NQBA 4LRIC 3TYGL 4NRXA 1CF8H 2DYPA 3EDKA 4DVRH 2DM2A 4DTGL 1KJMB 5GZNC 5BQ7A 4FQHA 1LO0H 1OTTC 4X9FA 4HKBB 2HTLC 3S36H 4Z7QE 2OXGA 2A83A 5EIIB 2VZ3A 4O5LL 4TNWF 1QSFA 5KSUA 1WAAA 4XI5D 3GKWH 3QEUB 2O5XH 4LFHG 1BJ8A 3FRUA 1GOGA 4HXAH 4M1DL 5EO1A 2WK2A 4XPFL 3WNOA 4U05A 1GZPB 2OTUB 4V2CB 4PP1D 5J7CC 2FH8A 4BQ6A 4YHNB 5C3TA 3OKLA 2G5RA 1A1NA 5INDA 3CSGA 4DKEH 1OARL 3IJYB 3CX5J 4NO0B 1FGVL 1FVCA 4OUUA 4X83A 2X10A 1M7IB 2XY1A 3E3QC 1PX3A 3W5NA 1L0YA 1A6AB 4WFFD 2ZOLB 1Q72L 1NC2D 1ADQL 4YAQB 4YDKH 5MEQB 3MUZ1 2CRZA 5E24E 2C3GA 1INQA 1W8OA 4RCAA 4DKAA 3AFLA 3WHE1 2COQA 4PG9A 2X89A 2ZCKH 4R0LB 4XNMB 1UC6A 4K94L 5BRZA 1NGWB 4LVHB 5EZJB 1JYVA 3VMPA 2BY3A 4RMSA 4UDTB 3U7WL 5DRWB 1P1ZB 1N0XH 4JFYA 1RUAH 4P5TB 1K6QL 1IAIM 3D18A 4PRHB 2ZCLL 2HKFL 4PY7B 2OR7A 4DN3L 5HDQL 2DD8H 2X7LA 5D6CA 3LQAL 2YMXL 3BEVA 1XCTA 5A2LH 2YWZA 1RUQH 2GT9A 3MLZH 1JN6A 2BNQB 1F8TH 4GRLD 3BKJL 3ARGD 2I27N 2FB4H 2OJZH 4V2BA 5E08L 1W8NA 2JELL 3PGFL 3EOTH 3P0VL 4TOYL 2CUHA 4TUJB 3RUGF 5DD5L 2ZP0T 3C8DA 4CGTA 2VLJB 2HKHL 5DJAB 1T7ZA 5MENB 1MPAL 1NUNB 2GW5A 4XP6L 1DQTA 5K59E 4E42A 1ADQA 4XCNB 4LBEA 3EFDL 3KLDA 1LE5B 2IPTL 1OCWH 3UYPA 4CJ0A 3OKDA 5GZOC 4Z77B 2VDPH 3PWNB 3B8SA 3ARSA 2R9HC 5IB3B 5I1CH 1SMOA 3SKMB 5F9DC 1MSPA 2HT3C 1F00I 1U8KB 1TZIB 3CLFL 3K81A 3IU3B 1MH5A 2FZ3B 4HMDA 1AHWB 3M07A 4JN2B 1QSEB 1WTLA 2I07B 1JWSA 4G8EB 5E7BA 4NZTH 1QTYT 2I9LA 4WUKH 3CSBA 2IAMA 3HAEG 2OXHA 2DJUA 1EEYB 3FOMB 1JPFA 1SEQH 3N85L 1A3RH 4QGYA 2X4TB 4GG6F 1DBKL 4OCLC 1IM9D 5GGQL 1H3XA 1YEHH 2GFBA 3GSWA 4Q2ZA 2AKRB 3I6KB 2QBWA 4I0PB 2UZIH 2EEDA 2C1OA 1U6AH 2BFVL 4X5LA 3NCYS 4Q6YA 5E5UB 1CLZL 3O0RH 4XC1L 2XN9A 5DMYA 2Z31B 2FR4B 4TNWK 3DI3B 3VFPB 4G8FA 1PLGL 4MJIB 5FGCE 5I1HH 4HH9A 4PJHB 4JG1H 2CUMA 4L1DA 3ZL4L 4R4FH 4R0LC 4MZ2A 3WIHA 3TPUA 1A7QL 3L5XL 4MJ5B 3P77B 3DO3A 3NIGF 4JHWH 1F4XH 4YDVA 4U1NA 4JFDE 1U95B 4P59H 2VLRE 4PRAA 5A2JH 1J86A 2LU3A 3PQYE 1SVCP 2EYSA 4YWGL 5I18H 3DV4A 2FO4A 3B9KB 4JPIA 3P11H 3UJIL 3NA9L 3KPMA 1SBSH 2DQFB 5CINL 1I75A 4M8QA 2X9XA 5F44A 3OKNA 1FN4A 1XGYL 2GQHA 1CU4L 2J6EL 3O4LD 3D85B 5JQ6H 2OR9L 2E27L 3D25A 2I9TB 3TH2T 5ANMB 1M7DA 2GJ6B 2IADA 2Z93B 3FQUB 3KPRB 5DHXB 1C5BL 4OLYL 1NGPL 4OD3H 4PJ7A 3MRRA 1ZLVK 5E1AB 1BBJB 4G9FE 3QISA 3V6FA 2AXFB 1A4KB 3VFMA 5ICXA 3H42L 3QUML 4G8GB 4XCFL 3AS0A 1CICB 6FABL 2BSED 4Y2DA 5IM7B 1RIHL 3PV6B 4NC1E 1BVKB 3FFDB 3TIDA 4E0RB 1KPUA 2NW3B 4I4WB 1AC6A 1UM5H 1J10A 4I9WD 3GMQA 2JLLA 1IKFH 1V3MA 4TSBH 3REWA 5BVPH 2WINA 3P9LB 1R6VA 2A6IA 4WHTB 4U1JA 4U6YB 4LLUB 1KBGL 3MOBH 5D96B 5L88H 1AHWC 1MCJA 1PG7H 2V2TA 2D4DA 3VFWB 2HMID 1YECL 4AM0A 5JUEL 3MA9L 4DUWA 3T3PF 3VXRE 1CVRA 4N8VG 5EU6E 2ICCA 3K1KC 3IT8D 2PXYC 3K74B 4TTDD 1RZKL 4M61B 4ONGL 1V05A 1G0XA 1BVLB 3D48R 3NABH 4ZOBA 5AZ2H 4LSSL 3H3PL 2P8PB 2DIAA 1NC4A 3HFMH 2IBZX 4PD4J 1OAKH 4PG2C 1VFUA 2D9CA 2X4QB 1HKLH 3GBNL 5D70H 4M4RA 1MFCH 5SWZB 1MI5E 4WU7A 4XCEB 1JF6A 3EGSB 5GGRB 4DGVH 3MZTA 3OKOB 1CG9A 2BNRE 4ORZC 1TJHL 2Q76A 3MUGA 3GEWB 2ZSVA 1HINH 2P5EE 1S7WB 3L3OA 5H35B 2FBJH 1ZLWK 3RA7H 4EIZC 3JV4A 3GMRB 4M02A 4U1KB 1CF8L 1NJ9B 1IILE 4NQXB 3IFNH 4X6DF 3WUWA 5J11B 1TJIL 4EI6A 3LKNA 3BP7B 4JM2F 4JZOA 3B9KC 4P3CH 4XXCA 5JA9A 3I6LE 5HI4D 1FNSH 2YR3A 4UNTA 4HC1H 2GK0B 3ZTNH 2A77H 2GJJA 3GKWL 5IW6B 1EAJA 2CLZB 2RIKA 2O5XL 2X4SB 4HXAL 2G75B 4XNYH 4EXKA 2AQ2A 5ACLA 1YEDA 1SBBA 3ARFA 5GISH 5JR1H 2CIIA 4PFEA 4U3HA 32C2A 1FJ1A 4WFGE 3L7FA 2VISB 3QNZB 1UM4H 1IGTB 4N0UB 3HE6B 4JCMA 4HUKB 3MPCA 1CICC 5TQ2H 5FYJD 4J3SA 4KZEH 4JJHA 5B39G 2OJEA 1I4FA 1NCCH 5HD8D 1KLGA 2IC2A 4JY6A 5CP3A 3PWJA 2PW2A 4H88H 3IETB 4RIRB 3V5KB 3OKLB 1B0WA 4OD1L 4PJEF 3WV0A 4S1QH 3M45A 1IAIL 5IIEA 1FVCB 3O6ML 3QFDA 3FAWA 5IROA 4EN3D 4XRCA 5C9KA 4S1RH 3QNYB 5JW4Q 3JWNC 2KH2B 3Q1SL 4GS7B 4LMQE 1OTUD 1RUQL 1I85A 3G5ZA 4OZHF 3GJFH 3GMNA 4BSJA 1FNLA 1YN7A 5E99L 2IQAA 2HFGH 5JQHC 1BFOA 3SQOL 4MD0A 4KKCC 1MVUA 1WBXA 1T4KB 4DZBB 4JFFD 4Z7WE 3Q5TA 2W65A 2ERJB 3NFNA 3VFRB 5K9OB 1ZTXH 5HGAA 3BZ4B 2ZZUT 4PY8J 1YEJL 4JVWA 3C6LA 3PE9A 3KAAA 5DXWA 1A21A 2MKLC 4QLRA 1T1ZA 2WQRA 5IEHA 2NY1D 3VFVA 2AV1A 1BWMA 4XWOD 4Y7MA 3RI5F 2XZQH 3ULUC 5ABDE 5IOPB 1NCAL 2L4OA 2VDRH 4WHCA 3ROLA 2R69H 1KFAH 4N5EC 2VZTA 1CR9L 2DLEA 3GZKA 3QSKB 1NCDH 3NAAH 5I0ZA 1X7QA 4UU9B 5CSZB 4ODTH 4P9HH 3JWDH 4MQTB 4DGIH 2VUYA 3UTSD 1WWBX 1MFAH 3GJFK 4QRSB 3X11A 4P9MH 1R3LB 1A47A 2W0FA 3OG6B 1XGQB 1MCPH 5SWQA 3GBLA 3RWJA 2YA1A 3UBXA 4MYWB 4KI5E 3QDGA 1XEDA 4I2XE 3O11B 2V2WB 4Z78A 3DWTA 3I50L 4JFDB 4U31A 3PQYB 2NW2A 5EFIB 1MHCB 2ORBH 5CEYB 2D3VA 4L4TA 1HNFA 2R0WH 3IAQA 3DURB 1NGQL 2FHCA 4RX4D 2UZIL 1WISA 5T3ZD 2XKNB 1U6AL 3BH9B 3MA7B 3CMGA 2FSEA 1YPZE 2F9BT 4YHPB 1BREA 4UV7L 3OGOE 1NMCC 3E8UH 4JRYE 5HVFB 1JUFA 1AIFB 4RZCA 3CSYB 2NXZC 3GDBA 2FLBT 5I1HL 5J8OA 5JO5A 1RZJH 4JG1L 1OWWA 4ONHB 3RWDB 1G7PA 4AZ8A 4GW5A 1RSFA 4J23A 3QPQD 3H2WA 4JHWL 5DJZA 4O2EB 3FFCD 3G6JB 5I18L 3PHSA 2PO6A 4LIQE 5CJOH 4UOW0 3P11L 1JNHB 5MHSE 3FB7A 1RUPH 1ZK9A 4AY0A 2BDNH 3RL2A 3V7MA 1KENL 2V5SA 4IOIA 3VMNA 3HB3C 3EDJA 5KSBB 1BWWA 2A6JA 4KH2A 1R5IA 1Z5LA 4Q6IB 1HH6A 2XZCL 3UO1L 2QQLH 1MAMH 5JIIA 3MMEB 3BZEA 2KZ1B 4LAQL 3VGAC 2DKSA 1T80A 2BVQB 1GGCL 3BHBB 4HWZA 1EVUA 4ELMF 3TIEA 1WBZA 2K9UA 1MHPL 5IQ9B 5DJ6B 4O51B 2D31A 5EU6B 3G04A 5GS2H 1I8IB 3OJDA 3D3VA 3KR3L 1RK1B 5D4QA 4FFYH 1IEAB 1UM5L 1OSZB 1OGTA 3PABB 2JB5H 5IVXE 3IDMA 1O7SA 5BVPL 1N5YH 1FFOB 5IVZA 1MI5B 4Z5RA 2MPAH 5HGBA 5EU3B 1HXYB 3KJ6L 5A43C 1G6VK 1CFQB 4JKMA 4P3DB 1XF4A 1B3JA 3IDYB 1I8KA 1HE7A 4X9GA 3RUGA 4NO3A 3WLWD 5TDPB 3VG0H 4Z18A 1KJ3H 1U8JB 5MEPA 2P5EB 3QDJA 2WZPD 3RI5K 4OFIA 4RISL 1NCTA 1PDKA 1N6QH 4Y16A 5C07E 4L3EE 5A2IH 4Z76A 5D72L 4G6AC 5BVJB 4MNQD 2D7QA 4PP2A 2K1MA 3BIKB 3SO5A 1OAKL 4L9DA 2VL4A 4H25B 2P7TB 2FIKB 2ATPA 4MXVE 1MRFL 3GK8H 5DLMH 2IAMC 5EBWA 4RMUA 1B6DA 4DGVL 1EXUA 1JPGA 5FYJU 3ILPA 2IANA 3UTQB 1YNKH 1HINL 2Y06L 4XNXH 5GRVL 3UTOA 3EJZC 5EOQL 1WT5A 2V9RA 1NGZB 2DBLL 3TP4A 5KG9B 5HPMB 4GG6A 5DK2B 4NN7C 1U92B 4XTRD 4W68A 1AO7A 3RIAK 25C8H 4DEPC 3FQRB 4GLRH 4NKDA 3J7HA 4NZUH 3R0NA 3HZKA 4HIHB 4K55A 1SVZA 3K3QA 3ULVC 3CFDA 3MUGB 4UI2A 4AIZB 1X5AA 3Q5OA 4X7TA 2A77L 2ICWJ 5C0AD 3QUYD 4PJFE 3QAZB 2C7UA 4P4KD 2WUBH 2BK8A 3RHWK 1PY9A 4OM0H 2WBWB 3BWUC 4EI6B 2ZUQB 1P9MC 4PJ9A 3RU8H 4J4PC 4QHNA 1I1FB 2GK2A 3NACH 1UM4L 4FOMA 4NKOB 5EZOH 4U1MB 2NY2D 4HFWA 5CFHA 4E5XA 4TYUA 4F7PA 2XTJE 2BRQA 4MB3A 4U7SA 2P43B 3FQNB 3DSNA 1NCCL 2Z4QB 1YYML 3ILQD 3ARFB 3CVIL 3L1OH 3OPZH 1I8LA 3P30H 3BZDA 4S1QL 3L5HA 1MFNA 4O4YH 3IXTB 5B3JE 5TF1H 2X4UA 2NY4B 4Y2DC 1R0AH 3IDYC 5C0FB 1CGYA 3Q2CA 1SM3H 1KLGB 5DJ2A 3U9UA 4HC1A 1G9NC 5B8CA 1FIGH 4BQ9A 5J57B 4X4XB 2HFGL 3ZYZA 3IXAB 1NCWH 4M4PA 3IFLH 5GZND 4L9LB 1IGIH 4LMQI 4OB5H 4Q7DA 1OTTD 4S11A 3V6ZA 5DJCB 3D0LA 3UTPE 3UPCA 5ENWB 4OZIF 3BAEH 3M1BA 4KHTH 2X1WL 1L4IA 2C1PB 2DQTL 4OLWH 5CMAB 5IESL 5KN5A 3VGHA 4F7EA 4MCYB 5IHLB 3G6DH 4EDXB 4HJGA 4PJBE 3GIVA 2K7QA 3UTTB 2CXKA 2F53A 3GIZH 5EUOA 4WJ5B 1ZA6A 4CMHB 2Q6WB 1CD9B 2P8MB 3ORJA 1RD6A 1G7HA 1AKJD 2Z92B 3R0MA 4RGOL 1RZGB 3NAAL 5HGAB 4P9HL 3GMMA 3JWDL 4PRIA 1F90H 4DGIL 1RZIB 1MFAL 3MRPA 4JRYB 5JPMA 4YGVA 3C8HA 1MF2H 3BVNA 4P9ML 1ZHNB 4NWUH 5CEZD 2YUXA 3IDUA 5LKNA 1I1RA 2A6DA 2AK4B 2LTQB 4YHIA 1FG2A 1BOGB 1QO3A 4AMKL 1YNTB 5IB2B 3GJFA 1OVZA 3QB7C 4HKJB 3GB7B 4TSAH 3PHQA 1IQWH 2UUDH 4RFOH 3FO1B 2BVUA 1I3VA 4MNGE 3CZFA 4XPGL 4Z0XB 3PWLB 3B6SA 3U9PH 4IRJA 3TJEH 1T03H 1QBAA 3HZMB 4H5SA 4Y4FB 2G9HB 2EKSB 2VSCA 3SKJL 4XXCC 2VB5A 4NFBA 2W0FB 1MLBB 4ZDHB 3KYOA 4IMLA 3DX6B 4X6DA 4DK3A 1K8IB 1LO2H 3E8UL 3KHQA 1P7KB 4ZSOB 4R2GD 4JM2A 4N90E 3V52H 3MV8D 1A6WH 2E9BA 1DR9A 4U6XB 1FNEA 5ICYB 1KCRH 1RZJL 3FZUD 4U7KA 3BZFB 4KMLB 1VERA 4FQXA 4WW1A 3ARFC 3UX9B 3TZVA 1I3RA 5JZ7C 1DQJB 4MQ7A 3D87B 3U46A 1NUFA 1ZVSB 4KKBC 2VXVL 4HS6B 1G1CA 3ME0A 1HHKA 4JQVA 1JGEB 1YJDH 5CJOL 5IFHH 2DM7A 4TTGA 2EYTA 2CR6A 2NY4C 4DAGH 1YY9C 2RJMA 4J6RL 4PJ8B 5GZOD 5JO5B 4MDJA 3MV9B 2EDOA 2UUDK 1RUPL 2R9HD 2X4RA 2LE9A 4KFZC 2HT3D 1J12A 2QL1A 1WITA 4CJ1A 5BS0A 3BKCH 1PYWB 1T21A 2QQLL 3NFPA 5DA0B 5D1XB 4KVCL 1NFIB 4PJEA 3MX0A 4YXLH 3UJJH 2W60B 5J1AA 1NFDE 1OTSC 2H32A 3RWHA 3ARDB 1U2HA 3F7VB 1I85C 1ZV5A 2GITA 5L8LB 4X6CE 3O2VH 1AD9B 1RFDH 1WEJH 4OLUL 1FCGA 4HS3A 4FFYL 2CK0L 5E8OB 5L2KA 4OZHA 4KRPB 3BZEB 4P3WA 2CUIA 4NO0D 3IFPB 4L8SB 4V1DD 1EJOH 1JHLH 1L7IL 1A9BB 2MPAL 5DD0L 3TVMA 5KAQG 1E0OB 3C6LC 3DV6A 5I6XC 3VXMD 1KPRA 4XP4H 3QZWB 4CRPA 3DGGA 1CN4A 3D3VB 3FONB 3VG0L 1M6OA 3WNLA 2CDEB 5I1JH 1XIWB 4NKMB 1QVOB 5T5NF 3GJEA 2BSRA 1ND0B 5FIEA 3V4UL 5IVZB 4QYOA 4PRHD 4WUUE 3T0EA 3UTZB 2CO6B 5C0GA 3T65B 5JORB 5EOCJ 3S3SA 3LKQB 2AEQL 4XH2B 2DQUH 3GK8L 5EA0H 4NQVB 2BNQD 1JGLH 5LGJB 4JFEE 4OFPA 1HWHB 5C0EB 1VEOA 4TPRH 4X4YB 4CNIB 3N0PB 1HI6A 3BMWA 5FKAB 2Y1VA 4PJ5E 4PJFB 4U1IA 5HVHB 2VLKE 3GO1H 3ZDYE 4GQPH 4XNXL 4OD2B 4HUUB 1LDPH 2WNGA 4GKSB 4Z7WF 1R3IH 1E27B 4HXBH 2ADIB 2ATPB 2VLJD 5MEND 4GRWE 5GS0H 5IHZA 5JLZB 4Y19A 4NZUL 1LK2A 2ZSWA 3VXQA 4LDOB 1RJZA 4PJ8C 5MI0C 4MX7A 4KMTH 2GJZB 5EZIL 5BZDA 1JZ8A 1R3JB 5D6DC 1T66C 3QNXB 4WEUD 5E03A 3VRIB 1QSED 1NMBH 4MZ3A 4OM0L 4NKDB 4BH7A 3K4ZA 1BZ7A 2AJUH 2P8LB 3RU8L 3NACL 2B4CL 2DDQL 4HCRL 4B50A 3GNMH 4Z7OE 3OGCB 3BGMA 5E56A 1WZLA 4I3RH 5IHUL 4LASL 4UAOB 2BHYA 5FOBA 4C59B 1MLCA 3HG1E 3TT3H 1MCHA 4H1LH 1MELA 5JW4R 3MJ8A 3L1OL 3QEGL 4O2FB 3HZYA 1KTLA 1U8QB 1GGUA 3AVEA 3M17A 4L8SC 4YR6A 3ZTJG 1CGXA 5FDWA 5E8NA 4PJBB 2ENYA 2M26A 4E5XB 3HLAB 3FT4A 2BY0A 4Q58C 3EYVA 2Y7QA 1WZ1H 4L1HA 4WV1A 1JFQL 5T3XH 4ELMA 1SM3L 1KB9K 3BX7C 2OK0H 4P2QB 5D7JB 3VXOA 2F74B 5BO1H 3LRGA 4P5MB 2PTTB 3KNBA 5E2TH 1NCWL 2DI7A 5HHQB 1IGIL 4ZUVA 4YHOH 1R5VA 3VRJA 3WHXA 5IFJB 4L4VB 3RNKB 3B9KD 4LCUA 4AEIH 1NGXA 1A7OH 5F7KC 4IRZL 4L8CA 1NANH 2OP4H 1S7RA 4FXGA 3BESR 3BAEL 4KHTL 5HDLA 1U8MA 2CLRA 3TNNB 5F1IB 5LGHL 1UG9A 4XXDA 2GHWB 4HX1B 3A67H 5ESVB 2ADGA 4JQIL 4NQCE 3CPLA 1RJYA 4X99A 3NIDF 1FLRL 4OIIL 2A74A 4E41A 4MNGB 5D7IE 3V0WL 1KJVB 5ITBH 3INUL 1CFVH 5F6IB 2M1KA 3I9GL 1NCBH 2DOCA 1FZKB 1CICD 1WJ3A 4IIQA 3WUWG 5FCSH 1AR1C 3JWOH 4MS8C 5DJ0B 3F8UB 1K4CA 3C8KB 1VFAA 1YEEH 3WFDH 3JV6B 1JPTH 3C5SB 3C2AH 5C2BH 2H1PL 5GS1B 4ZUTB 4X98A 4TSAL 5C0JA 4RDQF 1FFPA 2HFEB 1YMMB 3I6GB 4Q9QH 5IVXF 3PXHA 3EFFA 1NCNA 1U42A 4KRLB 1EAPA 3VGDA 4S1SH 1AFVH 1NAMB 5JXEA 3TJEL 4XPTH 2DI9A 1YY8A 4NP4H 1DUZB 5DHVH 3IAPA 1GIGL 5HHXH 5IJKA 2XPGA 2NLJA 3QCTL 1FORH 1K5NB 3L3GA 1J8HA 1FZMA 1KT2A 5B38B 4KKCD 1ZA3A 1SEBB 4HUNB 3QG6B 1F13A 1HHIA 1F5WA 4XPHH 3ARBB 4Q9BA 5DC0A 5ISZE 3E0GA 1TZHA 1N4XL 5SWZD 4PJ9C 4M43H 5A2KH 3NN8B 3PL6A 4X6DB 5FUZH 1LP9E 4X6CB 5EBLA 4K8RL 4NN6B 4JPWL 4DAGL 3AB0C 3ULUD 2EDDA 2UYLB 4LIQH 4HKZB 3KPQA 4N5ED 4Q9RL 5GGSB 3TCLB 3GBMH 1HDMB 4LCCB 4LLWA 3U36B 4QNPE 4YO0A 3SKUD 1I8LC 2B20A 1A9EB 3B4NA 4O9HH 4JLRB 3DHJA 3QT2A 4ZPVA 3QH3A 3TBYA 5DMIH 2X41A 4Y4KA 4RRPA 1R3KB 1N5AA 4JGMA 2AJVH 2BRRH 4OCNC 3U79A 4OQ1A 2ARJB 5FYLE 4YXLL 1NDGA 1INEH 1B9ZA 2RFXB 4ZFOB 3UJJL 3GSNB 5F3HA 5TH2A 1HH9B 3Q3GA 2H6PA 3M8OL 2Y36H 3OKKB 1QQDB 1O5DT 4OBSA 3O2VL 1YC7A 5B8CC 5TQ0L 3UCRA 4CL7A 3G5VB 3KPSA 4KKAD 4OI8A 4AENB 1NPUA 4YX2L 1GJIA 2A2QT 1T21B 1WIOA 5DJYB 4NQDA 3U30C 2WMPA 4JHZA 1P69B 4BKLA 1SQ2N 3DHMA 4H26B 4HLZH 3I02A 4OQTH 3TO4B 1EJOL 1QSFD 5TJWK 2FWOB 1JHLL 2VAAB 5DQ9B 1J05B 4R96B 3HC3L 2Y5EA 4JFEB 5TDOB 3CNKA 2NXZD 5F88A 2VLRA 2NY0B 3FN0H 4JY4B 3V6OE 4OZIA 5EO9B 3UBXG 5DI8B 3MO1A 2P1YA 1GRWA 1R5WA 3ETBF 4H8WC 4ZD3H 2R2BB 1UB5A 5F9AC 4EQ2A 5TE7H 4GSDH 3N1PC 3TWCH 4Y5YA 2BVPA 1BOYA 3HI6H 4HUXA 4GRWB 4KUZH 3T1WA 2FIRT 1DBAH 3O6LH 4A2LA 4X8JB 5C0BB 1S7SA 4IRSA 2DQUL 2BJMH 4PTTA 5BRZD 3T4AB 5F7WC 1JGLL 1KN4H 4G9FA 3B5HA 3HB3D 3L5WB 2XT1B 3V79C 3OJMB 2MQCA 2VZUA 5HHNA 3LD8B 4N9GB 4QYOB 4DWHA 5FV2A 3GO1L 3BYYA 4LSTL 1MNUH 3ARBC 3ALWA 5HI5C 1FL5A 4J8RA 4IRJC 1X6NA 3OB0H 5FHAL 4LVEA 5GS0L 4WW2F 1HI6B 4HF5H 3P73B 4JM2C 3HG1B 2QQNH 3L3HA 3QHFH 1D6EB 4R90H 5FKPB 4QRPE 5SWSA 3GSQB 2E7BA 5DD6A 3WMSA 2QSQA 1BD2E 4LCCC 5D2LE 4HAFA 3WSQL 2YK1H 5FO8B 5KZCD 4DCQA 1FNGA 1NMBL 3NOIA 1VGKA 3ZKQD 5HHPA 4Z7NF 1VCAA 2EICA 1MRDL 3MRQA 3S5LA 4DFIA 3CU7A 3ARTA 4JFPB 2LQRA 4FXKB 4RMVA 5I1DB 3DXAA 2ZCHL 5E2WH 2QHLA 4G6AD 3SDDB 4YK4C 3MFFB 3L3KB 3RNQB 3VXNB 3TT3L 4QEGA 2AJXH 2Y4SA 4QXUH 3OB0K 3MYJA 3ZT7A 1FPTH 2BNRA 4OCSH 1NLDH 3SQBA 4KQ3L 1V8HA 2Q7YB 2IAMD 3QIBB 5DS8B 5IBTH 5IMOA 3HI1B 1FG9C 3TO4C 1WK0A 1CFNA 1HOCA 3R4DA 4YZFF 3WDHA 3MLYH 3C6SA 5GSRA 4OCRL 1RPQA 2CMRL 3BQUB 2NY0C 3V9FA 1IBGL 1WZ1L 4ZPTA 5GGVH 1M1SA 5DD3L 2BX5A 4ZFFA 4PGBA 2NY5L 1IMHC 3HPJA 2X09A 5BO1L 1EX0A 5D8JH 1AH1A 2G5BB 5F9WC 1KTLB 3LDBC 1N0LA 3FB5A 3GSUA 4JDTH 3RX7A 1JHTB 2XN9D 1XCQB 1JTTA 5FGSA 3TVMC 4ZOAA 1P84J 2LAAA 2D0GA 1MAKA 5D1QB 1OGAB 1RJCA 4PV8B 3DVGB 3DMMA 1OHQA 5GRYA 4KRNA 5I66A 3VXOB 5E2UL 4G7YH 1KB5B 5EO0B 3KNBB 2O61A 3QWOA 3B2VL 2DWDA 2VO5A 4K9EC 3GMLA 5GQBA 3AGVA 5GGRY 5EC1B 3HZVA 4H1LA 3WIFB 2IJ0C 2R1YB 5ITBL 1CFVL 1NGXB 4J4PD 1MJ7L 1W0YT 5DQJB 4K3DL 4QWWD 1LO5B 3OTTA 1NCBL 2MMXA 1VFBB 1Q9WB 1H3UA 1EH9A 4BFIB 4MAYA 1N8ZA 1RJYB 5EUKB 3OZ9H 4X7FC 1NFDF 1MFEL 2HYMA 3CFEA 3L7EA 3OKMA 4I8DA 2E9JA 5BXFA 1YEEL 4YDIL 2DWEA 1EO5A 4GMTH 4QCIA 1TENA 1NEZB 4DKFL 1NGYA 1YEGL 1T1WA 4KROC 1NMAL 4L29A 1BMGA 4Y2DD 2VAJA 2VIRA 4MVBC 4TULL 3SE8H 4S1SL 1DBJL 1LP9B 2F54E 4IS6B 3BH8B 1H0DA 4XPTL 4F15C 4XBPB 1GHFH 3OSKA 1BEYH 4X4MA 4Z7WA 3IS0X 1MQKH 1G7LA 3FO9A 1ZHKA 2NR6C 3SKOB 4LGPB 3SGEI 4P0DA 3MV7E 1T20A 4AJ0A 4XMPH 1MQ8A 3VWJB 3S4SA 3SDDC 2NNAA 4XPHL 1C1EH 3EO0B 3MCG1 3RDTA 4PPTA 3RAJH 1BGXH 5GRZA 3PHOA 3BIBX 1MHHB 2P5WA 3QRFM 1BZ9A 3DX8B 1S9YB 3OKEB 3X14B 4N0FB 1K3ZA 5FDYA 4KMQA 4M43L 1AQDB 1ZSDA 5EOCH 1DQDH 2ILLA 4JREB 1ZLSL 5CD5D 4U49A 4JJ5B 4X5XB 4XVSH 5F7DB 5IV2A 1UB6B 3BQUC 2N1KA 2ZUTA 4NRZB 4OV5B 2VXSL 5JPNA 4JR9H 4J1UA 2YZ8A 2WUCH 2HVKA 3EOBA 3DX7A 3VD9A 1JWMA 4F9PA 5HYSG 5FV1L 1IC4H 5DMIL 3S35H 5DVOA 2XYCA 1CWVA 1K9TA 2J88L 3BE1L 4TNVF 1FV1A 4UQ2A 3VI4E 1R24A 1AXSB 4ZTOH 4UT6H 4PLJC 5DHVA 5CBEA 3STZB 4WV1C 3KPOB 3SJVE 4N8CL 2KL6A 4UDUB 4A6YB 3LN4B 1INDH 2W0PA 3NIFE 5ACZA 1IGFL 1F6AB 4R7DA 1T3FA 2OI9C 2X4PB 1YPZA 3RIFK 1TETH 1GYAA 1JGUL 1NDMA 4PR5B 1QD0A 3IDNA 3ARQA 4KY1L 4HIIB 4R97B 5K9KB 1T7YA 2DQDH 3P4LA 2EXWC 2Z0BA 3GRWH 4NDMA 4JG0H 2IQ9H 1WBYA 4WI9A 1D6VL 1TITA 3UC0H 3FN0L 3CFBA 1A8JH 2E8ZA 4OSUL 4OLEA 4QOKA 4KAQH 5E9DE 3UZEA 2XZZA 3ARFD 2GTZA 4ZD3L 3P4NA 3QYCA 5JZ7D 1C08B 4I5BA 3PGDA 3QJHB 4M7LL 2GSIB 4KKBD 5BOPA 3TWCL 4ODSL 4Y8AA 3RWFB 3VFGL 4ZUWB 2NY4D 4IIQC 1VKXA 4KUZL 1YY9D 1CYGA 1MAJA 4LSDA 3SY0A 3VJ6B 4PJXE 5D7LE 3PDOA 2DKMA 4ZO8A 3WE6A 5KW9H 1OM3L 4JKLA 4OI7A 3KXFB 2CKBH 3L6FB 5LXGH 4ZXBB 1D5MB 3AAZA 2CIKB 1KN4L 4K2UL 3MACH 2XNAA 5CGTA 5D2LB 5IB1B 4U4BA 4DGYH 5JIPA 5IJVB 4QTHB 1T04B 5E4EB 5E8PB 5H2BA 4OLZH 3W9DA 2FGWH 2ICWA 3LMJH 4RQQA 3LKPA 1OF2A 4C56A 1OTSD 5GHWH 4GKNA 4QTIH 4OZFH 5AYUH 3C5JA 4OQTA 5IJKC 5ESQB 5IVXA 1SJHB 3UTTD 1V5JA 3VXTB 4KDTA 1CVSC 4JREC 3SDAA 4RWYL 5L0QC 1OAUH 4FQQA 4N0CD 3KYAA 1KG0A 1VSCA 1K2DB 4HS8L 3N06B 3HCVB 2YBRB 3CFKA 5T1MA 3CFCH 5FM8A 1D5BA 2XFXB 2X1QA 2IBZY 2YK1L 3BISA 1FC2D 4L3EA 5L9DH 5FYKD 3P4OB 3PL6C 1D9KA 1JPST 3FT3A 3VMOA 4MA7H 4FTVA 2AK4D 1KLFA 3MRFB 2PW1A 1UXWA 3NGBC 5SWSB 1LO3H 1AGCB 3F7RA 3O8XB 3L3JB 4PJCE 5K9JH 2X44D 2RGSA 4KKLD 4RWHA 1EDQA 4NPYA 2W1NA 4D94A 1DFBH 3EYUL 3C08H 5INCB 2GAZA 1F3DJ 2HA1A 3C60B 3FQWA 4HV8A 8FABA 4Y4FD 4Y4KC 3KPPA 2BMKB 2WV3A 1U93B 4TNVK 5IBTL 3NH7H 5IR1A 3CDCA 3W2DH 5HDBF 4EDWH 2ADJB 1H8SA 5ID1A 2V2XA 5FECB 3Q6GL 4OZ4A 3KLAB 4Q97A 3WNKA 5GGVL 1UJ3A 1QA9B 4XCYA 5F7HA 4QT5B 1UZ6F 4K3GA 5D8JL 4KTEL 3L3DB 3O45B 2Q87A 4MHHI 3O3BA 3VFOA 4OAWA 4JDTL 4WFFE 4QRRA 1MEXL 4DZ8B 4XMLH 3C6SB 4PJ8D 3MV9D 1YJDC 4HG4K 3ZE0E 1HXMA 1N2RA 4ZXBC 3WO4C 2OR8A 2DQEH 3BP4B 5M95B 3IGAB 4Y5YC 3JZ7A 4QNPF 1DVFB 4U1LB 4PRBA 5D1XD 1S7VB 2F54B 3ESUF 3X13B 2YXFA 5K9QG 2HJLA 1Q9LB 1QFPA 1NKOA 1U91A 3RGHA 4RMTA 4U33A 4TUOA 4XP5H 3ARDD 1X4YA 2P45B 3CDYA 1C7SA 4HJJL 5I66B 3C5ZA 4CN1A 1FVEA 2C4XA 1C5CH 2RCSH 4PRNA 2DWDB 4WTZA 4M1CC 3SGDH 2EIZB 2C3XA 4WIQA 4NUJA 2FATL 4WU5A 1UVQA 1DDHA 5L8KB 4U6VH 5KOMC 2BY2A 12E8H 4IHOA 1CD0A 1OLLA 5HSFA 4M8VA 1FE8L 3CD4A 1AGDA 4ERSH 3SHSA 1GHFL 3D3VD 1PJ9A 1MQKL 4LLAA 2VLMD 1BLNA 1FHGA 1JRHI 5C09B 2X1PA 4MWFA 3KLHC 3LH2H 4JANB 5EU7C 1C16A 3U7YH 4WW2A 1NBVL 1GGBH 1UWGH 2OBGA 5F97E 5SX4H 5C9JB 4B7IA 4YBHA 3SJVB 4F58L 3QDJD 5EN2A 4Y1AA 1CDHA 3MXWL 4XVSL 3RGVB 4Z7VF 4EBQL 1NAML 3K2UL 1BJ1J 5F96L 1N3NA 1DJSA 2BNUB 4ISVB 5I1EH 3R8BB 1TQBC 4WTXA 2B7DT 2VDKL 4JO1L 4HJ0C 4LCYA 1JGDB 3KG5A 1BZ9B 3ES6A 1AR1D 4Y2OA 3STLA 3LEXA 3S35L 4ZUUA 5JHDB 1F97A 1XF3B 2IH1A 1CD1B 3E6HA 4PREB 1A0QH 5AUMA 5IW1A 3QQ4B 1EK3A 3EO9H 2NTSP 1J0YA 3J8F7 1RAMA 4KJYB 4BK4A 1JNJA 4B41A 1JYNA 5FYLH 1INDL 2E7HA 4X0KA 2IH3A 4UBDC 4X7EC 3SOBL 5BZWA 4ZFGL 2AAVA 4L8BB 1IGYB 3OWEA 5I15H 4HFUH 1TETL 1F11B 1Q0XH 4HWBH 5DMKB 3IKCB 1QSZA 1S7TA 2VXTH 4C55A 1GGYA 4QF1B 1DEDA 4PJXB 3BO8B 3NPSB 1N64H 2ED8A 3O4LE 1PX4A 4MJ6A 3C09B 2KQMA 1D5XB 4H0IA 2C3VA 4FQ2L 4ZQKA 3T77B 1B6UA 2XWBB 5EPMB 1FZJA 3RVXD 3LEVL 1JTOA 4ZFOL 3GSNL 4KGLA 4PJ9D 3T0BA 2WWKT 1FL3A 2AV7B 2R4RH 4G6FD 5IB4A 3B83A 3LQZB 4QY8A 4PRPA 2EDTA 3QDHA 4OTXL 2YPVH 2HG5B 4HUWB 4MAYC 5FYKU 5JOEA 2MHAB 2FYYA 4P2QD 3EDFA 4KPHH 4EEEA 4I9WE 5HYJB 3LV3B 2MFNA 1HCFX 3NTCH 2N7AA 4MJ2A 5IMKA 3VH8A 3MR9B 3MACL 1CE1H 2L7JA 4F7MA 4N9OB 1CIUA 1NFDA 2AJZB 4FQLH 4OV6F 1XF5A 1Y18B 4L4VD 1PZUB 1IVLA 2D9QB 1EHXA 4D0CB 4LCIL 1H3PH 1ZT1A 2WBJA 5GHWL 3W82A 2C3WA 2X70A 2XG4A 3IAGC 3GRWA 3QIUA 3OV6A 2QTEA 5KVDH 2R2HB 1B4JH 3B3IB 2E7MA 3VI3E 4AG4L 4ZAKA 1OAUL 2NX5A 1MREH 5DRXB 2V7NB 4L5FL 1HQ4B 1MCOL 3MRHB 3ZKND 3BW9A 2FJHB 1TVHA 2J8UE 1ACZA 3CK0L 3RDTC 2P46B 3NCMA 1U8PA 2X9WA 5JA8B 3U0PB 3OX8B 4NZRL 5F72S 5DFVC 5KSAA 4HPYL 4JQXC 5L9DL 3GHEL 1AE6L 5HHOA 3T0DA 2W0KA 5CHNA 2EC8A 1J1XH 4WUUA 2KPNA 3X12B 3JWOC 2J2ZA 5CD3A 1S5IL 2D0HA 1S9XB 3NMEA 2CKBA 4L4JA 3G08A 4LLQA 1A14H 3WO3B 1YNLH 2JB6A 1F42A 1YMMD 5EWIL 5F9OL 4JZNB 4YDJB 4H0GA 5LWYH 5F9JA 5I75B 7CGTA 2C5DC 3EJJX 4XBGA 3QFJA 3C08L 3IRPX 1A2YA 3U82B 2ICEB 1D9KB 3MLWL 3WLBB 3IF1B 4FTVB 4PJ5A 4ZFZA 1NBYA 3F5WA 2V17L 3NH7L 2RAMA 3W2DL 4OZFA 2QQQA 2VQUA 4EDWL 1QR1A 1K85A 1YUHB 2DJSA 2UWEF 2JKXA 2NZ9C 3C09C 2H3NB 1L0XA 1G9MC 3ARBD 4PJDF 5HI5D 3TBSA 4IRJD 1GGTA 4JPKL 4J3XA 3BP6A 1FFNA 2IFGA 2UY6A 8FABB 1U0QA 4M48L 5I1LA 5DWUH 4LHUA 2R1XA 5F6HJ 4GRLB 4DVBA 5JW3H 4XMLL 2QQKL 5FYJE 5ID1B 4QHLB 1HQRB 4KGJA 5F89B 5IB5B 4QRQA 5CJXA 1DLFL 1NBZA 3IDJB 3P4MB 2WIMA 5C6PB 1TCRB 2GKIA 2YKLH 3VA2C 1DSFH 4TRPL 3CFJB 4WFED 3K80A 4GXUM 2CLVB 3BKMH 1T89A 3H7BB 2UVFA 4HWEH 1QKZH 4RNRA 4BH8B 5FUCE 4WRLA 3PDDA 1KJ2H 4GW4B 4XP5L 1N2RB 2HLAB 1KIQA 4M6NL 1QNZH 1KTKE 4OGXH 1I7UB 3KS0J 3CLEH 4CN6A 1C5CL 1H15A 1Q94A 1S9WB 2R1WB 2AXHA 3S6CA 3NIFF 5B3NA 3OR6A 4JFFE 3LIZL 1K4DA 3F58H 1WICA 1J8KA 4NUGH 4P46B 3WFBH 1WCBA 2X4OB 1G7QB 4NYLB 5EIVA 1WIUA 4NWTL 4UNUA 4XAWH 3TO4D 1MHEA 1IL1A 1IM3A 4IM8A 1KB5L 4MXWL 4RAUA 4ERSL 4LSRH 3C5ZB 2NY0D 3NPZB 3S5LG 5ILTH 1IEBA 3MRBA 1KCVH 3SDAC 1IM9B 3D6GA 2HH0L 2EO1A 4GW1A 1FNHA 3O81A 3RJQB 5I16B 1UCBH 2HVJA 3V6BR 3BN9C 5GGVY 4WVRA 4CU8A 1K8DB 3DX9B 5F7YC 2C9AA 1RZ8A 3BMVA 2WANA 3D1MC 4FNLH 2CDGB 5E5MA 4NQCA 2WWMC 4LRNH 3TVMD 3UTSE 3WIIH 5A16A 3BP5A 1GGBL 4JGUA 5I75C 1UWGL 3MNZB 5C0BD 4GRMA 5F1NA 1D9KC 5D7IA 3QULA 3JXAA 3T2NH 4P99A 4GAGH 1MJJA 2EECA 2JIXB 3G5YA 4J3UA 1DUYA 4HD9A 1S7XA 3JVGC 1I1AB 3U4EB 4K23H 5J9PA 3TV3H 1C16B 1U8HA 5JOFB 2BVEA 3AU1B 3WN5B 1ITCA 4XNUL 4QHUB 2EIDA 5T3ZE 1HSBB 4YBLC 1QPXA 1RU9H 4PGEA 1RIVL 1B0RA 5KVGH 2GY5A 5J06A 3EYSH 5IFAL 4L8DB 4KDVA 4FABH 1EEQA 5I8KL 4OGYH 3IJSA 3OB8A 4O2CB 3QDMB 1UJ3C 1E6OH 5FYLL 3O4OC 4HZLA 4WO4A 4YFLI 1CFTB 2AJ3A 3MGTA 3FFCE 4MVBD 2DMBA 1ETZA 1UZ8A 4H1LG 1Q0XL 1H5BA 4ZUUB 2VXTL 4Y19D 1BJMA 4WHDA 3QXWA 3KYKH 5T5NG 2NR6D 2VDMH 3U4BL 3IDXH 4U1HA 4P48A 1N64L 1QRNB 1F4WH 3EOYG 3MRKB 2Y9RT 3WKMH 1T2QL 3LAFA 5ISZA 4AK1A 3SDDD 3MLRH 1YYLH 2F5BL 2FO1A 2JCCF 4GUPA 3ET9F 4XVJH 4PJCF 4EI5A 3DBXB 3L95A 3QG7H 1U8IB 2FGZA 3SE9L 4AH2A 3T1FA 6CGTA 3WS3A 2IPKA 3DYOA 1ZHLA 2O26U 5ALBH 5KTEH 2YOCA 4HUVA 1E4XI 4J7RA 4MD5A 5DYOA 3C5ZC 3BQUD 2YPVL 3RPIA 2HT4C 1DN0A 4RFEB 4RSVA 4M5YL 4R3SB 1UQSB 3W5MA 1AGBA 1J0ZA 1L6XA 3OBAA 4PJAE 4NNYB 5J13C 1FZJB 3S4SG 1QLRA 3NTCL 1KXTB 1PSKL 3ECBA 1CE1L 2R8SH 2GCYA 1HYRC 4FQLL 3MJ9H 1G0DA 4TN9A 4P57A 2DMCA 3TNMA 4HWBA 4JHAH 1W0VB 3O3AA 5D1QD 1QOKA 1OGAD 2Z9TA 4PLJD 3NCBB 3SE4A 1YN6B 1H3PL 5FB8B 4F37F 1BX2B 4YHZH 4NNPL 3T4YB 4KJWC 1A6TA 1IARB 1IGCL 5KVDL 4GAYA 1B4JL 2QKIB 1I1AC 4PBWD 2IALB 4RA0C 5I8CA 3RVWC 1PVHA 1C12B 5DGRA 1VFMA 4MNQE 4WW2C 3PNWB 4Y4HA 3RWCA 4HHAB 4I3GA 3ULSB 3VXUA 2AXGB 4PRDA 4EVNB 3RX5A 5C0CA 2J12B 2EXWD 2OQJB 5GGSY 4HGWA 4NJ9L 4U1GC 4TVPH 3AREA 4S0TD 3QRGH 3R06A 3R1GH 1UGNA 3OHXB 1KULA 3KPNA 2R2CA 1XF2B 3QUKA 3MREA 4E41D 3QUZA 4ELKB 1HHHB 3PGCA 4KTDH 3QCUH 5FO7B 1TQCC 4JVUA 4GT7A 5CEXA 4F8QA 4M7ZC 3I2CH 4MNHB 2HRPH 4LLVA 1IC7H 1ZGLP 4G42B 5EU4B 3ZDXE 1UXSB 4Z7VA 5EH1A 1TDQA 2B1AH 4XGZA 4UT7H 1RHHA 5IUSA 3LN5B 1NUGA 3S37H 2O5YH 1MUJA 3O3EB 5CD3B 3VXPB 1JV5B 5HHVH 5DRZA 5C0AE 4ETQA 5H94B 3QJFB 3I75B 5HGDA 3HR5A 4Y5VA 5DUPL 1A7RL 2NY3C 1KCSL 5D5MF 1TZGH 1UM6H 5T5FL 1G6RB 1U8LA 4QRPA 1E28B 3PWUA 1P4BH 4QO1A 1J8HD 1ZLUH 2ZNXA 3HS0B 1BD2A 1OQXA 1YQ2A 1RUMH 4F7CA 1SYVA 1JZ5A 1FSKC 3NA4A 1MWAH 2A9NH 4JFFB 3H3KA 2BOCA 3SN6N 3MRLA 3OXRB 4F3FA 2OL3H 4F2MA 1KXQE 2ESVB 2R56L 3PL6D 3E6FA 2MOVA 1N6UA 3T09A 3WCYA 1CQYA 3G9VA 4RDQG 4HWEL 5FHBH 2BOBB 1QKZL 4HLZG 5K33A 3MRCA 3OJ2C 4MA3A 5DEGA 4N68A 1OD9A 5KVFH 1QNZL 3WKNA 3S96A 2XWTB 2XIDA 3VE0B 4GOSA 1Q9OB 2YPLE 3UTSB 3X3FH 4RAVB 4Y4KD 3IU4H 5JW5A 1A5FH 4NUGL 2DQHH 5LBSH 3V7AG 5D9SB 4K7FB 3RZCB 1PFCA 3EOAB 2VR9A 3GMOB 1ZLUK 5IGXH 3H9HA 3MC0A 1BQHG 2WBJC 2DRUA 2MCPH 3JTSB 2OYPA 4LSRL 4F37K 1MJUL 1LD9A 1Q1JH 3QIUC 4AT6B 4CW1A 3KPSD 4P2OA 5HGGS 1KCVL 4ZAKC 2EH8L 3U0TA 1UCBL 5KS9B 1MCNA 2QR0B 4NQEA 3ZLQC 4NQDD 3E3QE 3VCLA 2PN5A 4KVNH 2Y07H 3FT2A 4OKDA 5C3LD 1ED3A 1T22A 1O0VA 3F6LA 4LRNL 5J1TC 4KK6C 2VL5A 4NGHL 5KSAC 2Q86B 2DLFH 5CEZE 5AWNH 5MEOB 1GC1H 3KXFD 2B5IB 5KAQF 4ZXBD 1KJ2A 1ULVA 2GIYA 3TYFB 5DRNA 5CJ5A 2IFFH 2W07A 2Y5TA 3F12A 4FFZH 3FFCB 1N7MH 5J12B 3DO7A 4F7TA 1ZXQA 4D0DB 1J0KA 1V7ML 1VADA 4HKXA 2XA8L 1AQKH 2DKUA 2Z8VC 4TSCH 5FF6A 4LSQH 3P40A 5TGBB 3G6AB 2I60H 3TYGH 4FRWA 2ITCB 4FG6C 1EZVY 3EYSL 4I18A 4DTGH 3MV8E 5GIRA 4PGDB 5IG7A 3GGWB 2VH5L 4FABL 4M1CD 4UIMA 1QEWA 2XOTA 3QBTB 3RTQA 1J0IA 2YD1A 4OGYL 3VI3F 5D2NA 1PQZB 4O5LH 2VITA 2UWEA 3MLUL 3OF6A 4YIQA 3FCTA 5I1IL 4JZJB 1MCBA 2P24A 3HUJF 2APBA 3MV7A 2GY7B 1JI1A 1WWCA 4PJDA 4LEOB 4XX1G 4M1DH 3A6BH 5CIPH 1OQOA 4I0CC 1FYTB 4IDLA 1T0NA 3IDXL 2VABA 2BVOB 4KI1A 3KLHD 5SWSD 1F4WL 4PV9A 5CJXC 4NO2A 1FGVH 4WTZG 2X4NA 4LKCB 1CL7I 3HAEB 1CGWA 4EUPH 4Q74A 2FX7H 3C60D 1XAUA 4U0RC 3VG9C 5DZLA 1I1YA 4YC2C 3RWIA 1T89C 1S9VB 4OIBA 3RZCC 1EVTC 4KRMB 4Z7UF 4K94H 4M1GL 5FA4A 1BIIB 1E4XH 1LHZA 5FO9A 4LLMA 3DXAD 3W39B 3OR7A 1U3HA 3T2PA 2Q20A 3PIQA 4YUEH 2ZCLH 2VLLB 2HKFH 4M93B 4MNQB 4OF6A 4DN3H 1G7IA 3TA3B 3V4VH 1LNUA 4HJ0D 3T8XA 4EI5B 3LQAH 2PCPB 4NN5B 1JMZA 5DR5H 4V1DE 3MYZA 5DMJB 3KWWB 2IPKB 2A1WL 4PLKC 3BKJH 3UYRH 4JHAL 1EHLH 3VXME 5E08H 5C0DA 4NM4L 3D69B 2JELH 2DJ4A 1V7NH 3DTXB 5AAWA 3PGFH 4G7VH 4TOYH 1MCEA 4FQ1H 4GFTB 1I1CA 3CC5A 4F33A 5DD5H 4QRUA 3EYOB 1LEGA 4PRHE 1MPAH 1W72B 3IDIA 5DJ8A 3K8MA 3RBGA 2P44B 1ZHBA 1ES0A 1U8OA 3EFDH 5E9DA 3QO1A 2IPTH 5ICZB 3L3IB 5JW4N 4G3YL 1PZ5A 2BCKB 2BNQE 3TF7C 3PJSB 3QRGL 4I3SL 1IEHA 3TFKC 3U2SB 3MUY1 3CLFH 1IE5A 5FA3B 5C0AB 3QUYB 1EEZA 1RMFL 4P4KB 1RV6X 2OZ4H 1KIRB 3OXSA 3OL2A 2M2DA 5IKCB 3VFUB 5D7LA 5E8DL 3I2CL 4DUVA 2HRPL 1HN1A 1IC7L 4G8IB 4X9HA 3RX8A 4JDVA 5GXBB 3BPLC 5MENE 2NY2B 3TESA 3CMOL 4JB9H 4JZJC 3MJ9A 1UJTA 3R06B 1KLUA 4MAYD 3VGEA 3D0VA 2DL9A 3IDGB 3S37L 1FO0H 2IG2H 5GGQH 1I7RA 3OJVC 2L0DA 3Q6FB 5C09D 4AEEA 1FP5A 2R23B 5AD0A 3JTTA 2BFVH 1A7NL 3QIWB 4WO4C 1IAOB 4P23A 5BJTB 5E6IA 1A7PL 1CLZH 4XC1H 1RZFH 1RI8A 1QSEE 4K07A 1X5IA 5EIQA 1PLGH 4N8VB 4YPGB 2YZ1A 1H5BC 2YN5A 1DE4B 1JWUB 1TZGL 2J5LB 2DQCL 1UM6L 5IEKB 5C92A 5E2VH 3RY4A 3BJ91 1P4BL 3BDBA 2VC2H 1MRCL 3BGAA 3RWEA 1FNFA 5KVEL 2V7HA 4YWGH 5FYJH 1CD8A 2H8PA 2YPLB 4AL8L 4M93C 3UJIH 3NA9H 1LDSA 4CADA 2P5WD 5CINH 4EI5C 3BEWA 4PIRF 5J6HB 2JCCA 4XPAH 5JHDD 4QRTA 2OR9H 2E27H 4PJCA 4JRXB 3TO2B 3FO2B 1NFKA 4P49A 4PJHE 2RBLA 5DEZA 1I3UA 1C5DA 4OLYH 1JZ3A 5IF0A 5GSVA 3UPRB 4DN4H 5J89A 4G6MH 3SDCA 3H42H 3QUMH 5HYIA 1HILA 1N59A 5GRUL 4PJGE 1RIHH 1IFHH 3X3FL 1XZ0B 7FABL 3IU4L 2VNCA 4W4OA 5CBAA 2ZOKB 4JFOB 3FQXB 2PYEA 5I9QC 4YHKH 1XR8A 1CXKA 1EO7A 2NZ9D 1Q1JL 1CCZA 4OCXL 4ZS7L 4Q0XH 5JDSA 3REVA 2DBJA 2H45A 5DK0A 1NC2A 1KBGH 1MWAA 1C7TA 1L9NA 2NTFB 3EZ8A 4Y4HC 1ZGLM 4JDZB 4OF0A 3PWVB 3IJHA 1E4KA 5B39B 4R7NB 3KPLA 3MV01 3KDMB 5IP4A 2OL3A 1T5WA 1KEMH 1S3KH 2Y07L 1DEEB 1SMAA 4HMEA 3CVHB 3VFSA 2P48B 4LLDB 3AREC 4ONGH 2DLFL 2BC4B 3P2TA 5DUBB 4QOKD 1T1YB 3LPFA 5AWNL 4LSSH 3H3PH 3S3PA 5HYJD 1LE9B 2OTWB 3MCLL 3LRSA 4PJIF 4YHYB 3VXSB 2G2RA 3GBNH 3TBWA 1CGSL 1KOAA 3JUYA 4OZGE 3I3EA 5EU5B 3TBVA 1BPVA 3LQMA 1T7VA 1II4E 4PJAF 3LS4H 4FFZL 4GG8A 5I1AA 3QIWC 3UMTA 2D7MA 3ARGA 5D1ZA 1T22B 4LNRA 3RVUC 5DDHB 3W0WA 4C54A 4CDHA 5E8EB 4PGJA 1TJHH 35C8L 4QXGH 4KUCF 1BFSA 1AQKL 5EG6C 4TSCL 1WIPA 1I7ZB 5I74C 2F58H 1IAMA 3P3YA 2I60L 5I76B 1T5XA 5C08A 3ZHDA 2BP3A 1I3GL 1N6VA 3BGFB 3JBG7 1TJIH 4XAKD 2YD6A 3K8LA 4YNYB 4Y5VC 4J12A 4IMKC 2AGJH 2BXZA 4BSWB 4C56D 5FCUL 5SWZE 3WFZA 1CLCA 4NNXA 5F7NC 3U48A 1AP2B 4G9DA 2YPKA 1F3JB 3A6BL 3SDAD 3ULUE 2FX8H 1QZ1A 4WGWB 1HHGA 1JNLH 1P4LA 5D5MA 2HN7B 2BSSB 1YMHA 4D8PB 4NSKA 1S5HB 1EO8H 4G5ZH 5T1KB 3EO1B 2AEPH 1KYOK 2CDFA 4V1DB 1HSAB 2QSVA 2WWMD 5GPRA 3IVKA 1KV3A 4P5KA 2FX7L 4ODUA 4PJDB 2WIIA 1D9KD 3ZDXF 3VXMB 3RL1A 5IMLA 4U6HB 2YD2A 5JXAH 4FTVD 5I1GH 3TBTB 2H9GB 3MJGX 5I17A 2EH7L 4EOWL 1E4XL 4OD1H 1CGUA 2OCFD 3MXVL 1IAIH 4CVXA 3L9RB 4BK5A