1NPXA

Structure of nadh peroxidase from streptococcus faecalis 10c1 refined at 2.16 angstroms resolution
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title Structure of NADH peroxidase from Streptococcus faecalis 10C1 refined at 2.16 A resolution.
pubmed rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase(h2o2(a))
total genus 140
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1991-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1npxA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1npxA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1npxA02
4H4TA 5U1OA 4K8DA 4H7UA 3ATRA 3AECA 1VDCA 1B8SA 2V6OA 3ZDNA 3UOYA 2YVJA 3GMCA 3VRAA 1TDNA 1K0IA 3UCLA 1Q1WA 1PN0A 1MXTA 4GUVA 1H6VA 4EIPA 3ICSA 3K7MX 4Y4LA 2C73A 3NGCX 4MJWA 2YM2A 4DSGA 3SFEA 5CKUA 3DK4A 4KPRA 4C74A 2R0PA 5CQFA 1KSUA 3FG2P 3NH3X 3QFAA 2OA1A 2WS3A 4TM4A 2V5ZA 4TLXA 1YY5A 2IVDA 3CNSA 4FX9A 4DSHA 1PJ6A 2BCGG 2B7SA 3GYIA 3NHOX 3RHAA 4XWRA 4Z2TA 1GPEA 3FIMB 2BXSA 4C5OA 2WDQA 4H2NA 1ZMDA 3D1CA 3CGDA 3NYCA 1FL2A 2IVEA 1Y56A 1GRGA 2YG4A 3H4KA 1LQTA 4CCQA 3L8KA 4H50A 3UTHA 1CJ4A 3IC9A 4J34A 4U8IA 4EM4A 2C76A 2GQFA 4Z2UA 2C67A 2GEWA 3AEBA 3NN0X 1VG9A 4HB9A 1M64A 5FMHA 1YKJA 4H4UA 2Q0LA 4O5QA 2JBVA 4JQ9A 2NVKX 4GDPA 3B6DA 5EBKA 4ZCDA 1OJCA 3P1WA 2XLUA 2ZZBA 4B65A 3RP8A 2R9ZA 1RP0A 2BS2A 2FJAA 1CF3A 4DGKA 3LZWA 4NEWA 4IV9A 2WDRA 1K0JA 1PJ7A 4EMIA 4YSZA 4OPLA 3LOVA 2GR2A 1M6IA 3KLJA 1JRXA 4EQRA 1PBFA 1XPQA 2GV8A 2BXRA 1NHSA 2WPCA 1PBBA 2PYXA 1O5WA 1JRYA 4H2QA 3S61A 4J36A 3DJJA 1JU2A 4JN9A 1GXFA 2CULA 4H4VA 3GD3A 4LU6A 1VG0A 1F8WA 4LIIA 4Z24A 2W0HA 1F3PA 3UKAA 2ZZ0A 1DODA 4PABA 4RG4A 3AEFA 3S5WA 1LTXR 2C70A 3CIRA 3AYJA 1E1MA 1V59A 1O95A 2VRMA 3B3RA 3ICRA 3WE0A 3EANA 1GRTA 1YQ3A 3BI2A 1EBDA 3CNDA 4IVMB 1E7PA 4ZCCA 1GERA 2BC1A 2AR8A 2B9YA 1REOA 3CNTA 1F6MA 3K30A 2JAEA 2OAMA 2XLTA 2R0GA 3NN6X 4U2TA 2R45A 3AE1A 5JCNA 4H4XA 3AE6A 1L0VA 4A99A 3CGCA 2C7GA 4A65A 4REKA 3CNPA 2E4GA 4OCGA 1GRBA 3UKFA 4Z25A 1OJAA 4I59A 1TYPA 1CC2A 2YLXA 2X8HA 1ZOYA 3NK0X 5FS7A 3AE2A 1FECA 1VRQB 4Z43A 1LV0A 4EQXA 4EQWA 2C75A 3H8LA 4U8PA 5IQ1A 1ZMCA 2APGA 2C3DA 3AEDA 4CY6A 1TDEA 4K2XA 1K4QA 3SQPA 1PXAA 3CPIG 4YSXA 2YG7A 2V61A 3M0OA 3QSSA 4OPCA 2GR1A 2I0ZA 2BABA 1SEZA 1TRBA 1DOEA 5HYMA 1N4WA 5J60A 4Z2RA 4UDPA 3ZYXA 5BUKA 2GF3A 2VRLA 3CN8A 2XVIA 2WU5A 4O5UA 4UDQA 2GR3A 4D03A 4OPGA 4U8JA 4HA6A 1LJ1A 2TMDA 3C4NA 4AOSA 1NG3A 4U8KA 2YLWA 4TM1A 2C64A 2YR6A 4GCMA 3G5SA 2Y6QA 2WP5A 1E1KA 2FJEA 4ECHA 2R4EA 4J56A 5BRTA 4RG3A 3QSMA 5EOWA 5ER0A 4H4ZA 3IWAA 2R0CA 1L9EA 1DJNA 3KD9A 3NT6A 1FEAA 4XWZA 4XXGA 2ARDA 1LVLA 1L9CA 2BA9A 2XLRA 2TPRA 3BI5A 1IUSA 4JNQA 2YR5A 3UP4A 2JB2A 2B7RA 4AT0A 1CJ3A 4USRA 1ZY8A 2ZZCA 4FDCB 4JY2A 1DXLA 1CC4A 2A89A 2O9ZA 1S3EA 4EMJA 3KU9A 5JCIA 1IUVA 1ELIA 1N1PA 1NPXA 5KVHA 1E6EA 3QVPA 4WCTA 4USQA 3UOVA 1KDGA 1FOHA 2BACA 3KA7A 4AT2A 1GOSA 5M0ZA 4D04A 2RGJA 4B68A 4K5SA 4A6NB 4PAAA 4J31A 3PO7A 1ZKQA 2WQYA 4U8OA 2YAUA 4M52A 3UKQA 5IQ4A 2GVCA 1BGNA 3DGZA 1YQ4A 4OVIA 2WOIA 3I6DA 1NENA 4J33A 3CPHG 1GTHA 3K7QX 3GRSA 4ICYA 3DMEA 1H81A 2V60A 2BK4A 4CNJA 4NZHA 4C77A 3CTYA 3CGBA 2XVHA 3GDPA 2YG6A 1XHCA 3AYLA 4YXDA 1GREA 3UKHA 3RP6A 2EQ7A 4YSYA 2QCUA 2V3AA 1FCDA 1Q9IA 2WU2A 2YLZA 3GWFA 1NHQA 3HZLA 3DH9A 1PBEA 3Q9TA 4WX1A 1TDOA 3T37A 3NK2X 3LADA 3P4SA 3IHMA 5KRQA 3AD8B 1DNCA 5U63A 1F8SA 3C4AA 2Z5XA 1GSNA 1PBCA 3GSIA 5HXIA 4NTEA 3P4PA 2VVMA 3RNMA 1XANA 2DKHA 2XCGA 2NPXA 2F5ZA 1NG4A 2C65A 2ZBWA 3JSKA 3QFBA 2XFOA 5KOWA 4Y4MA 3RP7A 4BK2A 3UKLA 2BK5A 2WESA 3NK1X 2XVEA 1ZDLA 4CCRA 4YTNA 2CVJA 1D4DA 2R4JA 4IA6A 3AE4A 3NNEA 3UKKA 2WP9A 4AP1A 2X8GA 5JCMA 2WPFA 1KNPA 1CHUA 4EIQA 1GT8A 4BV6A 2WOVA 1VQWA 3L1RA 5IPYA 2XDOA 1LQUA 3NYFA 4NTCA 1TYTA 4E0VA 3IHGA 3UKPA 5LV9A 3NIXA 4A5LA 3DGHA 3EAOA 1CC6A 2WOWA 4YTPA 3AD9B 4J2WA 3BHFA 1QJDA 2GH5A 3PS9A 2FJDA 1MOKA 3FBSA 4YSHA 4NEVA 1ZK7A 2JB1A 2BS3A 5HY5A 3AEEA 1EL8A 5M10A 1D7YA 5FS6A 2OLNA 1GALA 3BNMA 1UKVG 2YR4A 3LJPA 2DKIA 3M13A 4YTMA 5GSNA 1CL0A 2BCPA 3VRDB 4A9WA 5L46A 4C3YA 1ZOVA 1ZX9A 5C3JA 1LPFA 1D4CA 4GDEA 2RABA 4U2SA 5FS8A 1H7XA 3AD7B 1IUUA 1IUXA 1NEKA 1P2EA 2XFNA 2Z5YA 2AQJA 2H88A 3I3LA 1D4EA 2XLSA 3KPFA 1COYA 2QA2A 3C96A 4U8MA 1RSGA 3AE3A 5C2TA 2YVGA 3NLCA 2Q0KA 3DJDA 1B37A 2XYOA 2YLRA 3KVEA 3LZXA 4DNAA 4H2RA 1E39A 1D7LA 1F8RA 4U8NA 4U8LA 2RGOA 3ALJA 1Y0PA 1RYIA 4ADWA 4A79A 4I58A 2VQ7A 2XVJA 4B1BA 1IUTA 1DOBA 2YLTA 4GF7A 3KKJA 1IUWA 2WDVA 5GRTA 4J57A 4TM3A 3UTFA 2HQMA 1QO8A 2QA1A 3DK9A 3NKSA 4B66A 4BJZA 2VOUA 2V3BA 3REDA 5BULA 2X99A 2GB0A 5JCKA 1ZP0A 2B9XA 2IIDA 1Q1RA 3ABVA 3F8RA 4IA5A 1GRFA 3LB8A 4P9SA 4APNA 2VQBA 2XFPA 1DOCA 1H82A 1W4XA 4FK1A 1D5TA 3ALMA 1TDFA 2XFUA 3BI4A 3V3NA 3AE5A 4CBQA 3CPJG 2WEUA 1KNRA 4N9XA 4YKFA 4C3XA 3BNUA 1KFYA 1NHRA 3NYEA 4ZN0A 1JEHA 3AE7A 1BGJA 2VVLG 4YWOA 2GMJA 1P2HA 2Y6RA 3QVRA 3LXDA 1PHHA 3GYJA 3AE9A 4U2LA 2OALA 1JNRA 3UOXA 5EB5A 1E1LA 3OC4A 1TDKA 3P4QA 4IVOB 1GESA 2GR0A 2XVFA 4RSLA 2FJBA 3AEGA 4GR1A 3II4A 4BJYA 2BS4A 3NTAA 4CY8A 1CJ2A 4EQSA 1PS9A 2Q7VA 1Y56B 1O94A 1PBDA 4JDRA 5KVIA 1HYUA 3EPTA 4A6NA 1S2YA 2B76A 1PXBA 3NG7X 3NRNA 1OJDA 4Y4NA 4EMWA 1S3BA 1GETA 1N4UA 1X31B 4NTDA 3VQRA 4H4WA 1H7WA 1Z6LA 1EL9A 2B9WA 3DK8A 2GAGB 2UZZA 1QLBA 4TLZA 3AXBA 4A7AA 1GRAA 1OJTA 3URHA 1BF3A 3EF6A 3G5RA 2E5VA 3OZ2A 3ALLA 3CNJA 3DA1A 1GV4A 4H4SA 3QJ4A 1H86A 4B67A 1CJCA 3PVCA 4KX6A 2WETA 2XFQA 2BK3A 1B4VA 4H4PA 2A87A 3AB1A 3H8IA 3Q6JA 3SM8A 2EQ6A 1FEBA 3ITJA 3D8XA 3SGLA 1L9DA 2Q6UA 3E1TA 3P9UA 1EL7A 3FMWA 4JNAA 3SFDA 3AYIA 1JRZA 4H2PA 4OPTA 1GRHA 2VZ2A 3COXA 2CFYA 2GMHA 2YWLA 3V3OA 4K7ZA 1E1NA 3F8DA 2YVFA 3VR9A 1BWCA 5TR3A 1H84A 5HHFA 2BC0A 2JB3A 3P4RA 4H4RA 1H83A 4CRTA 5DBJA 2JKCA 1CBOA 3IF9A 3QSEA 2X8CA 2GRTA 4LA1A 2E1MA 1PDHA 2PHHA 4K22A 2YLSA 3AE8A 1ONFA 4H4QA 3ICTA 2YM1A 3GWDA 4B64A 3ISHA 4FK1C 2YG3A 2JK6A 1BKWA 2WHDA 2EQ8A 3ADAB 4H4YA 4TM0A 2GQWA 5J7XA 3VRBA 5KOXA 1GNDA 1AOGA 2EQ9A 3AWIA 1YQZA 4JY3A 2C3CA 3GDNA 2RGHA 3M12A 3NTDA 4OPUA 5EB4A 2WPEA 4UDRA 2J3NA 3GMBA 2GAHB 2CDUA 4AOXA 3DJGX 3O0HA 5KXJA 2R46A 1KF6A 3BHKA 3UOZA 3UTEA 2ACZA 4BK1A 4YT0A 2OLOA 5U25A 2A8XA 1B5QA 3GD4A 2FBWA 1KSSA 1IJHA 2BYBA 2YG5A 2AAQA 2C66A 4X9NA 4BK3A 2QAEA 4Z44A 5BVAA 3VR8A 3FPZA 4B63A 1EL5A 3ATQA 2WP6A 4Z26A 5JCLA 4OPIA 1PJ5A 2C72A 4K5RA 1GEUA 1MO9A 4BURA 1S2QA 2X50A 1BZLA 3F8PA 2XLPA 4YKGA 5KWFA 1OJ9A 2H89A 2X3NA 4AP3A 3K7TA 1XDIA 1N4VA 1JOAA 5FS9A 1JNZA 3DJEA 4X4JA 3UP5A 1NDAA 2WBAA 3CGEA 1GTEA 1DJQA 2YQUA 3G5QA 4OPDA 1NHPA 1NAAA 4EM3A 1K0LA 4B69A 3R9UA 4GRTA 1PXCA 4UP3A 2VVLA 3AEAA 4CNKA 3UTGA 4X9MA 3V76A 3GRTA
chains in the Genus database with same CATH superfamily
4K8DA 3AECA 1B8SA 4G8TA 1PDYA 3UOYA 3GC2A 2YVJA 3VRAA 3SY4A 3DFHA 3MKCA 3OTRA 3NGCX 3T2YA 1N62C 3PWIA 4DSGA 1S7MA 2R0PA 1KSUA 3RRAA 2OQHA 3QKEA 4XWRA 2BXSA 2WDQA 3D1CA 3CGDA 2GGJA 2IVEA 1GRGA 3ES8A 2PMQA 4ZOHB 3ZVIA 4GMEA 3T4WA 4EM4A 2GEWA 3AEBA 4A6GA 1VG9A 3NN0X 4HB9A 1MRAA 2JBVA 5EBKA 2PU0A 2ZZBA 4B65A 3LZWA 3T2ZA 4YSZA 3KLJA 5EU9A 1PBFA 1XPQA 2GV8A 1TKKA 1P48A 2BXRA 1O5WA 3TOYA 1JU2A 3SN4A 4ENLA 2CULA 4H4VA 3GD3A 1F8WA 4Z24A 2W0HA 2ZZ0A 4YWSA 3S5WA 2C70A 3EANA 1EBDA 3K30A 4U2TA 2R45A 3CGCA 3N4EA 2C7GA 4A65A 2AL1A 2OO6A 1ONEA 2RDXA 2QJNA 3FXGA 2YLXA 1RM6B 2X8HA 5FS7A 1VRQB 4Z43A 4EQXA 3THUA 2C3DA 3QSSA 4OPCA 1JPDX 4JN7A 1TRBA 4UDPA 2VRLA 3CN8A 2QJJA 4UDQA 4U8JA 1LJ1A 2C64A 2YR6A 3UXLA 4J56A 4RG3A 4H4ZA 3VC5A 2BRAA 2R0CA 1MDRA 1DJNA 4XWZA 1RVKA 2ARDA 2P8BA 3BI5A 2JB2A 1CJ3A 4USRA 3VA8A 1N1PA 1E6EA 4WCTA 1ZXIC 4K5SA 3IJQA 2AKMA 2GDQA 4IP4A 4M52A 3NZGA 1VDVA 1NENA 1XS2A 3MY9A 3H8AA 3CTYA 3L5OA 2YG6A 4H19A 3NXLA 3TW9A 3R1ZA 1FCDA 2YLZA 4FI4A 1SJDA 3LADA 3P4SA 3IHMA 4GAPA 3AD8B 1F8SA 1PBCA 2OZ8A 1XANA 2NPXA 3QFBA 2XFOA 5KOWA 4H83A 4Y4MA 3RP7A 3R10A 4G6HA 3SZFA 3AE4A 3UKKA 2WPFA 1GT8A 4E0VA 1MDLA 6ENLA 3CXBA 2WOWA 3BHFA 2GH5A 3FCPA 4NEVA 4EWJA 3T2KA 1FFUC 5M10A 1EL8A 1MNSA 3NVVB 2OLNA 4NWZA 3LJPA 2YR4A 4E4UA 2BCPA 4A9WA 1YEYA 1ZX9A 3GY1A 5C3JA 1D4CA 2ZADA 4F4RA 3AD7B 1IUUA 1NEKA 1PDZA 3UCDA 2H88A 3I3LA 3KPFA 1COYA 4U8MA 2YVGA 1F8RA 4U8NA 2GGGA 4ADWA 2VQ7A 2ONEA 3KKJA 5GRTA 3ZLHA 1QO8A 2V3BA 3REDA 2X99A 5JCKA 1KKRA 2IIDA 3ABVA 1H82A 1TDFA 2OVLA 4C3XA 1KFYA 1FO4A 4ZN0A 3TWBA 2VVLG 4YWOA 1P2HA 3T0KA 5EB5A 1E1LA 1TDKA 4IVOB 2I5QA 2QVHA 3AEGA 2BS4A 1CJ2A 3EPTA 2OLAA 3A7RA 1PXBA 4Y4NA 1S3BA 1GETA 1N4UA 4II3A 4NTDA 3VQRA 1Z6LA 1EL9A 2GAGB 1OJTA 1BF3A 1CJCA 4KX6A 3MQTA 3H8IA 3D8XA 2Q6UA 1EL7A 3FMWA 4OPTA 4K7ZA 1E1NA 3TCSA 1BWCA 1NU5A 2BC0A 5DBJA 2JKCA 3QSEA 4GISA 4LA1A 3ES7A 1PDHA 3SR6B 4B64A 4H4QA 3TJ4A 4FK1C 2YG3A 2JK6A 1BKWA 3ADAB 1H2IA 1GNDA 2EQ9A 4GYPA 4E6MA 1KKOA 3OPSA 3NTDA 4A35A 4DX3A 3SQSA 3DJGX 3O0HA 3BHKA 5G5GB 3FJ4A 2A8XA 2GSHA 3EKGA 2YG5A 2QAEA 2W54A 5BVAA 4Z26A 5JCLA 4TVWA 4OPIA 1GEUA 1MO9A 3F8PA 2PCEA 4IT1A 2DW6A 4AP3A 1JNZA 4JN8A 3CGEA 3G5QA 3CYJA 1NAAA 1PXCA 3SJNA 3V76A 3GRTA 4H4TA 5U1OA 3ATRA 4FP1A 2V6OA 3ZDNA 3UJ2A 4EIPA 1BQGA 2C73A 4MJWA 2YM2A 3SFEA 4KPRA 1ECQA 4GGHA 2OA1A 2P3ZA 4DSHA 4FX9A 1PJ6A 3RHAA 1W6TA 1FL2A 4K1WA 3S47A 4CCQA 3L8KA 3R0UA 3KUMA 1CJ4A 1WUEA 2C76A 2C67A 1M64A 4O5QA 1YKJA 4H4UA 4JQ9A 2XH0A 2XLUA 3RP8A 2R9ZA 4X2PA 2OPJA 4NEWA 1EBHA 2W3RA 1PJ7A 3LOVA 1JRXA 3VFCA 3ENLA 3Q4DA 4J36A 1GXFA 2OQYA 3TTEA 3AEFA 4GFIA 1FFVC 3CIRA 3AYJA 1V59A 1O95A 3FV9A 5FJPA 1GRTA 1YQ3A 3CNDA 4IVMB 3FYYA 3AMZA 1REOA 1F6MA 2OAMA 3QPEA 5JCNA 4H4XA 2POZA 3CNPA 4OCGA 1ZOYA 3NK0X 3H8LA 2PTZA 1TDEA 4K2XA 1BKHA 1K4QA 3SQPA 1PXAA 3CPIG 2XH4A 4G74A 2BABA 3PK7A 1SEZA 1N5XA 4KPLA 5BUKA 2GF3A 2XVIA 4O5UA 4D03A 4OPGA 2TMDA 4U8KA 2YLWA 4TM1A 2Y6QA 2WP5A 3R25A 4MKSA 3R11A 1FEAA 1IUSA 3T31A 2B7RA 3NVWB 3DG7A 4FDCB 1DXLA 2A89A 2O9ZA 3QLDA 1SJAA 2BACA 1GOSA 2XH7A 2WQYA 5IQ4A 2GVCA 3DGZA 4IL0A 3UJRA 3CPHG 3K7QX 4KEMA 4C77A 4HCLA 2XVHA 4HN8A 4YXDA 3UKHA 2EQ7A 4YSYA 2QCUA 2PP1A 3DH9A 3T37A 5U63A 2Z5XA 3GSIA 5FJTA 1KD0A 3P4PA 2DKHA 3SN1A 3JSKA 2QGYA 3UKLA 2BK5A 3NK1X 2XVEA 3BOXA 1D4DA 4M6UA 4AP1A 2X8GA 1KNPA 1L8PA 4BV6A 1VQWA 1X2GA 5IPYA 2XDOA 1LQUA 1TYTA 3H70A 3DEQA 4A5LA 3DGHA 4J1OA 4YTPA 4J2WA 1QJDA 2FJDA 2BS3A 3IJLA 3SSZA 4YTMA 2AKZA 1UKVG 3VRDB 5L46A 3DGBA 4A3RA 3UXKA 1ZOVA 1LPFA 2GGEA 1P43A 1SB3B 2RABA 4HYRA 2Z5YA 1D4EA 2XLSA 3IK4A 3NLCA 2QDEA 2XYOA 3LZXA 1E39A 1D7LA 4HCDA 3H12A 3ALJA 2E5AA 4I58A 3SN0A 1DOBA 1IUWA 3NFUA 3DK9A 1JROA 2FYMA 2PTYA 1ZP0A 2B9XA 4IA5A 4APNA 2PODA 3ALMA 3BI4A 1KNRA 4YKFA 3BNUA 2OKTA 3AE7A 3QVRA 1SJBA 1SJCA 3LXDA 4GYPC 4M0XA 4U2LA 2PTWA 4BJYA 2MUCA 3NTAA 4CY8A 1PS9A 2Q7VA 4E8GA 1Y56B 4JDRA 3OZMA 2BRYA 1S2YA 3NG7X 1H7WA 1QLBA 3AXBA 3QTPA 1XPYA 3OZ2A 1FIQB 4H4SA 3QJ4A 4B67A 3PG6A 2BK3A 1B4VA 3CT2A 4G7FA 2A87A 3SM8A 2EQ6A 1FEBA 3SFDA 3P9UA 4JNAA 3AYIA 1JRZA 2CFYA 2GMHA 3RGTA 1H84A 5HHFA 2OG9A 3P4RA 2X8CA 2GRTA 3JVAA 4K22A 2YLSA 3GWDA 4TM0A 4H4YA 3VRBA 1YQZA 3GDNA 3M12A 4OPUA 4HPNA 5BOFA 2R46A 2ACZA 2OLOA 3GD4A 3R0KA 1IJHA 2BYBA 1R0MA 2AAQA 4X9NA 4Z44A 2PPGA 3NRZB 2X50A 1DTNA 1STZA 1JOAA 1NDAA 5KMSA 2WBAA 3V4BA 4EM3A 1K0LA 4B69A 3HYVA 1EC7A 4H7UA 4HNCA 2OZ3A 1TDNA 1K0IA 1MXTA 4GUVA 3P93A 1H6VA 3ICSA 3K7MX 3DK4A 5CQFA 3NH3X 2WS3A 2E3TA 2V5ZA 4TLXA 1YY5A 2IVDA 3CNSA 3D47A 2PSNA 3GYIA 1GPEA 3FIMB 4C5OA 4H2NA 1ZMDA 2ZC8A 2P0IA 1Y56A 3DERA 5FJUA 1V97A 2GQFA 4Z2UA 5FMHA 3NVYB 3I6EA 3A7UA 1CF3A 4DGKA 4IV9A 3U4FA 1KN0A 2WDRA 3Q45A 2GGIA 4OPLA 3T8QA 4ZA0A 2WPCA 2PYXA 5BOEA 1JRYA 3S61A 4JN9A 4LU6A 4E5TA 3TQPA 3JW7A 1F3PA 3UKAA 1DODA 4PABA 4RG4A 1LTXR 5KNLA 2VRMA 3WE0A 3ICRA 3P3BA 1ELSA 2BC1A 2AR8A 2B9YA 4G73A 2R0GA 3NN6X 3AE1A 4REKA 3SX6A 1GRBA 4Z25A 1OJAA 4I59A 3AE2A 1FECA 4U8PA 2APGA 4TVYA 3GD6A 4CY6A 4ROPA 2V61A 3OW1A 2OX4A 4Z2RA 3ZYXA 3N4FA 2WU5A 1N60C 3AM9A 4HA6A 3C4NA 1NG3A 3G5SA 2R4EA 5KMQA 1L9EA 3A7AA 3KD9A 3NT6A 2BA9A 2XLRA 2TPRA 4KWSA 4JNQA 2PTXA 4JY2A 4EMJA 1ELIA 3JZUA 3V5CA 3UOVA 1FOHA 4AT2A 2RGJA 4B68A 4MGGA 4PAAA 4J31A 1ZKQA 4U8OA 2YAUA 1BGNA 1YQ4A 5IDZA 2WOIA 3B97A 1GTHA 3UCCA 2GGHA 3DMEA 1H81A 2BK4A 4J3ZA 4CNJA 4NZHA 3CGBA 1XHCA 4G6GA 3U9IA 1GREA 4IL2A 3GWFA 1Q9IA 3HZLA 4WX1A 3CXOA 1DNCA 1GSNA 1E9IA 1NG4A 5FJOA 2ZBWA 2PGWA 4BK2A 2WESA 1ZDLA 4IP5A 4YTNA 2WP9A 3DIPA 3L1RA 3IHGA 3DFYA 2OZTA 3EAOA 3N6HA 4IZGA 3FBSA 4YSHA 3DESA 5J04A 3R07C 1D7YA 1GALA 2DKIA 1CL0A 4C3YA 5FS8A 1H7XA 2GL5A 1IUXA 1P2EA 2XFNA 3VC6A 1FHUA 2QA2A 3C96A 2Q0KA 2NQLA 2YLRA 1OEPA 1RYIA 4A79A 4B1BA 2YLTA 5G5HB 4GF7A 2WDVA 4KT2A 4J57A 4TM3A 3TWAA 2QA1A 3SYIA 4B66A 7ENLA 4GAVA 5BULA 2GB0A 4DYEA 3LB8A 4P9SA 2XFPA 3T9PA 1DOCA 4FK1A 2XFUA 4CBQA 3CPJG 2WEUA 4N9XA 1N63C 3I4KA 1PHHA 1MUCA 3PWGA 3AE9A 2OALA 1JNRA 3UOXA 3SZ0A 1GESA 2XVFA 4MMWA 4GR1A 4EQSA 2PP3A 4G9KA 3NRNA 1OJDA 4EMWA 2MNRA 4H4WA 2B9WA 3DK8A 4A7AA 3EF6A 2E5VA 3ALLA 3DA1A 1H86A 2WETA 4H4PA 3ITJA 3SGLA 1L9DA 1GRHA 3NVZB 2VZ2A 2YWLA 3V3OA 3F8DA 2JB3A 3D46A 4CRTA 5KMPA 2E1MA 3MUCA 2PHHA 3AE8A 2YM1A 5J7XA 5KOXA 1AOGA 2FKPA 3ETRB 4JY3A 2C3CA 2RGHA 5EB4A 2WPEA 3RO6A 2P8CA 4ZCWA 4Z1YA 4AOXA 2XGZA 5KXJA 5U25A 2FBWA 4BK3A 3FPZA 1EL5A 4JHMA 3ATQA 1PJ5A 3P0WA 4BURA 4HNLA 1BZLA 4YKGA 2H89A 3EUB3 2X3NA 3S5SA 3K7TA 3QN3A 3CK5A 1N4VA 5FS9A 3DJEA 3MWCA 4HCHA 1GTEA 1DJQA 2YQUA 4OPDA 3ZLFA 3CMMA 3AEAA 2HXTA 4CNKA 3GYXA 1JEHA 1VQZA 1VDCA 1X2HA 3GMCA 3T6CA 3UCLA 1Q1WA 1PN0A 1R6WA 4Y4LA 5CKUA 1FHVA 4C74A 2PA6A 1TE6A 3FG2P 3QFAA 4TM4A 2BCGG 2B7SA 3NHOX 4Z2TA 3NYCA 2YG4A 3H4KA 1LQTA 4H50A 3UTHA 3IC9A 4J34A 4U8IA 1JCTA 2PP0A 2Q0LA 4H1ZA 2NVKX 4GDPA 3B6DA 3MZNA 4ZCDA 1OJCA 3P1WA 1RP0A 2BS2A 2FJAA 3SZCA 1K0JA 4EMIA 3K1GA 2GR2A 1M6IA 4Z17A 4EQRA 1NHSA 5ENLA 1PBBA 2W3SA 4H2QA 3DJJA 2HZGA 3ZVHB 1VG0A 3SZWA 3MSYA 4LIIA 1E1MA 3B3RA 3V3WA 3BI2A 3ZLGA 1T3QC 1E7PA 4ZCCA 3DG3A 1GERA 5JRBA 4DWDA 3CNTA 2JAEA 2XLTA 1JDFA 3SXIA 3AE6A 1L0VA 4A99A 3OP2A 2AL2B 4GGBA 3NO1A 2E4GA 3UKFA 1TYPA 1CC2A 2W55A 3VDGA 3N6JA 1LV0A 4EQWA 2C75A 5IQ1A 1ZMCA 3AEDA 3SBFA 4DN1A 4YSXA 2YG7A 4DHGA 3M0OA 2GR1A 2XSXA 2I0ZA 1DOEA 5HYMA 1N4WA 5J60A 3BJSA 2GR3A 4AOSA 2CHRA 4GCMA 1E1KA 2FJEA 4ECHA 5BRTA 3QSMA 5EOWA 5ER0A 3IWAA 5KMRA 3HYWA 4XXGA 1LVLA 1L9CA 3PFRA 2YR5A 4K2SA 3UP4A 3VCCA 4AT0A 1EC8A 1ZY8A 2HNEA 2ZZCA 1CC4A 2QDDA 1S3EA 3TJIA 3KU9A 5JCIA 1IUVA 1NPXA 5KVHA 3QVPA 4USQA 1KDGA 3KA7A 4D04A 2QQ6A 5M0ZA 4II2A 4A6NB 3PO7A 3UKQA 4OVIA 3I6DA 4J33A 3GRSA 4ICYA 2V60A 3GO2A 3UJEA 3GDPA 3AYLA 1N5WC 3RP6A 2V3AA 5FJRA 2WU2A 1NHQA 2XH2A 1PBEA 3Q9TA 1TDOA 3NK2X 5KRQA 3C4AA 5HXIA 3D9XA 4NTEA 2VVMA 3RNMA 2XCGA 2F5ZA 3I6TA 2C65A 4CCRA 3ZVHA 2CVJA 2R4JA 4IA6A 3NNEA 5JCMA 1CHUA 4EIQA 2WOVA 3BSMA 4IHCA 3NYFA 4NTCA 3DG6A 3UKPA 5LV9A 3NIXA 1CC6A 3AD9B 3PS9A 1MOKA 1ZK7A 1WUFA 2JB1A 5HY5A 3AEEA 2AL2A 3HW2A 3CAWA 5FS6A 3M13A 3BNMA 3NS1B 5GSNA 4GDEA 4U2SA 3FVDA 2AQJA 3EEZA 1RSGA 3AE3A 5C2TA 3DJDA 1B37A 3KVEA 3RR1A 4H2RA 4DNAA 4K8GA 4U8LA 2RGOA 3CB3A 1Y0PA 3VCNA 2XVJA 1IUTA 4E4FA 2P88A 2QJMA 3UTFA 2HQMA 1TZZA 3OZYA 3NKSA 4BJZA 3STPA 2VOUA 1Q1RA 3F8RA 1GRFA 3RITA 1F9CA 2VQBA 1W4XA 1D5TA 3UJFA 3V3NA 3AE5A 1EBGA 1NHRA 1JPMA 3NYEA 2PGEA 3UJSA 1BGJA 3V5FA 2GMJA 2Y6RA 3HYXA 2PU1A 3GYJA 4GIRA 3OC4A 3P4QA 2GR0A 4RSLA 3UGVA 2C4CA 2FJBA 1JRPA 1WYGA 3II4A 1KCZA 4NNJA 1O94A 1PBDA 5KVIA 1HYUA 4A6NA 3B9JB 2B76A 1X31B 2UZZA 4TLZA 1GRAA 3URHA 3G5RA 3CNJA 1EC9A 1GV4A 3PVCA 2XFQA 3AB1A 2PS2A 3Q6JA 2DW7A 3E1TA 4H2PA 2OFJA 3IJIA 3COXA 2YVFA 3VR9A 5TR3A 1IYXA 3T14A 4H4RA 1H83A 1CBOA 2O56A 3IF9A 4H2HA 1ONFA 3ICTA 3ISHA 2WHDA 2EQ8A 2GQWA 3AWIA 3HPFA 4UDRA 2J3NA 3GMBA 2GAHB 2CDUA 3RCYA 1KF6A 3UOZA 3UTEA 4BK1A 1N61C 4YT0A 1B5QA 1KSSA 1NELA 3H7VA 2C66A 2HXUA 3VR8A 4B63A 2WP6A 4DXKA 2C72A 4K5RA 1S2QA 3KPKA 3DDMA 2XLPA 5KWFA 1OJ9A 3AN1A 1XDIA 3UP5A 4X4JA 1NHPA 3R9UA 4GRTA 3HRDC 4UP3A 2VVLA 3UTGA 4X9MA
chains in the Genus database with same CATH topology
4H4TA 5U1OA 4K8DA 4H7UA 3ATRA 3AECA 1VDCA 1B8SA 2V6OA 3ZDNA 3UOYA 2YVJA 3GMCA 3VRAA 1TDNA 1K0IA 3SY4A 3UCLA 1Q1WA 1PN0A 1MXTA 4GUVA 1H6VA 4EIPA 3ICSA 3K7MX 4Y4LA 2C73A 3NGCX 3T2YA 4MJWA 2YM2A 4DSGA 1S7MA 3SFEA 5CKUA 3DK4A 4KPRA 4C74A 2R0PA 5CQFA 1KSUA 3FG2P 3NH3X 3QFAA 2OA1A 2WS3A 4TM4A 2V5ZA 4TLXA 1YY5A 2IVDA 3CNSA 4FX9A 4DSHA 1PJ6A 2BCGG 2B7SA 3GYIA 3NHOX 3RHAA 4XWRA 4Z2TA 1GPEA 3FIMB 2BXSA 4C5OA 2WDQA 4H2NA 1ZMDA 3D1CA 3CGDA 3NYCA 1FL2A 2IVEA 1Y56A 1GRGA 2YG4A 3H4KA 1LQTA 4CCQA 3L8KA 4H50A 3UTHA 1CJ4A 3IC9A 4J34A 4U8IA 4EM4A 2C76A 2GQFA 4Z2UA 2C67A 2GEWA 3AEBA 3NN0X 1VG9A 4HB9A 1M64A 5FMHA 1YKJA 4H4UA 2Q0LA 4O5QA 2JBVA 4JQ9A 2NVKX 4GDPA 3B6DA 5EBKA 4ZCDA 1OJCA 3P1WA 2XLUA 2ZZBA 4B65A 3RP8A 2R9ZA 1RP0A 2BS2A 2FJAA 1CF3A 3SZCA 3LZWA 4NEWA 4DGKA 3T2ZA 4IV9A 1KN0A 2WDRA 1K0JA 1PJ7A 4EMIA 4YSZA 4OPLA 3LOVA 2GR2A 1M6IA 3KLJA 1JRXA 4EQRA 1PBFA 1XPQA 2GV8A 2BXRA 1NHSA 2WPCA 1PBBA 2PYXA 1O5WA 1JRYA 4H2QA 3S61A 4J36A 3DJJA 1JU2A 4JN9A 1GXFA 2CULA 4H4VA 3GD3A 4LU6A 1VG0A 1F8WA 3SZWA 4LIIA 4Z24A 2W0HA 1F3PA 3UKAA 2ZZ0A 1DODA 4PABA 4RG4A 3AEFA 3S5WA 1LTXR 5KNLA 2C70A 3CIRA 3AYJA 1E1MA 1V59A 1O95A 2VRMA 3B3RA 3ICRA 3WE0A 3EANA 1GRTA 1YQ3A 3BI2A 1EBDA 3CNDA 4IVMB 1E7PA 4ZCCA 1GERA 2BC1A 5JRBA 2AR8A 2B9YA 1REOA 3CNTA 1F6MA 3K30A 2JAEA 2OAMA 2XLTA 4G73A 2R0GA 3NN6X 3SXIA 4U2TA 2R45A 3AE1A 5JCNA 4H4XA 3AE6A 1L0VA 4A99A 3CGCA 2C7GA 4A65A 4REKA 3CNPA 3SX6A 2E4GA 4OCGA 1GRBA 3UKFA 4Z25A 1OJAA 4I59A 1TYPA 1CC2A 2YLXA 2X8HA 1ZOYA 3NK0X 5FS7A 3AE2A 1FECA 1VRQB 4Z43A 1LV0A 4EQXA 4EQWA 2C75A 3H8LA 4U8PA 5IQ1A 1ZMCA 2APGA 2C3DA 3AEDA 4CY6A 1TDEA 4K2XA 1K4QA 3SQPA 1PXAA 3CPIG 4YSXA 2YG7A 2V61A 3M0OA 3QSSA 4G74A 4OPCA 2GR1A 2I0ZA 2BABA 1SEZA 1TRBA 1DOEA 5HYMA 1N4WA 5J60A 4Z2RA 4UDPA 3ZYXA 5BUKA 2GF3A 2VRLA 3CN8A 2XVIA 2WU5A 4O5UA 4UDQA 2GR3A 4D03A 4OPGA 4U8JA 4HA6A 1LJ1A 2TMDA 3C4NA 4AOSA 1NG3A 4U8KA 2YLWA 4TM1A 2C64A 2YR6A 4GCMA 3G5SA 2Y6QA 2WP5A 1E1KA 2FJEA 4ECHA 2R4EA 4J56A 5BRTA 4RG3A 3QSMA 5EOWA 5ER0A 4H4ZA 5KMQA 4X9MA 3IWAA 2BRAA 1L9EA 2R0CA 5KMRA 1DJNA 3KD9A 3NT6A 3HYWA 1FEAA 4XWZA 4XXGA 2ARDA 1LVLA 1L9CA 2BA9A 2XLRA 2TPRA 3BI5A 1IUSA 4JNQA 2YR5A 3UP4A 2JB2A 2B7RA 3T31A 4AT0A 1CJ3A 4USRA 1ZY8A 2ZZCA 4FDCB 4JY2A 1DXLA 1CC4A 2A89A 2O9ZA 1S3EA 4EMJA 3KU9A 5JCIA 1IUVA 1ELIA 1N1PA 1NPXA 5KVHA 1E6EA 3QVPA 4WCTA 4USQA 3UOVA 1KDGA 1FOHA 2BACA 3KA7A 4AT2A 1GOSA 5M0ZA 4D04A 2RGJA 4II2A 4B68A 4K5SA 4A6NB 4PAAA 4J31A 3PO7A 1ZKQA 2WQYA 4U8OA 2YAUA 4M52A 3UKQA 5IQ4A 2GVCA 1BGNA 3DGZA 1YQ4A 4OVIA 2WOIA 3I6DA 1NENA 4J33A 3CPHG 1GTHA 3K7QX 3GRSA 4ICYA 3DMEA 1H81A 2V60A 2BK4A 4CNJA 4NZHA 4C77A 3CTYA 3CGBA 2XVHA 3L5OA 3GDPA 2YG6A 1XHCA 4G6GA 3AYLA 4YXDA 1GREA 3UKHA 3RP6A 2EQ7A 4YSYA 2QCUA 2V3AA 1FCDA 1Q9IA 2WU2A 2YLZA 3GWFA 1NHQA 3HZLA 3DH9A 1PBEA 3Q9TA 4WX1A 1TDOA 3T37A 3NK2X 3LADA 3P4SA 3IHMA 5KRQA 4GAPA 3AD8B 1DNCA 5U63A 1F8SA 3C4AA 2Z5XA 1GSNA 1PBCA 3GSIA 5HXIA 3D9XA 4NTEA 3P4PA 2VVMA 3RNMA 1XANA 2DKHA 2XCGA 2NPXA 2F5ZA 1NG4A 2C65A 2ZBWA 3JSKA 3QFBA 2XFOA 5KOWA 4Y4MA 3RP7A 4BK2A 3UKLA 2BK5A 2WESA 3NK1X 4G6HA 2XVEA 1ZDLA 3SZFA 4CCRA 4YTNA 2CVJA 1D4DA 2R4JA 4IA6A 3AE4A 3NNEA 3UKKA 2WP9A 4AP1A 2X8GA 5JCMA 2WPFA 1KNPA 1CHUA 4EIQA 1GT8A 4BV6A 2WOVA 1VQWA 3L1RA 5IPYA 2XDOA 1LQUA 3NYFA 4NTCA 1TYTA 4E0VA 3IHGA 3UKPA 5LV9A 3NIXA 4A5LA 3DGHA 3EAOA 1CC6A 2WOWA 4YTPA 3AD9B 4J2WA 3BHFA 1QJDA 2GH5A 3PS9A 2FJDA 1MOKA 3FBSA 4YSHA 4NEVA 1ZK7A 3T2KA 2JB1A 2BS3A 5HY5A 3AEEA 1EL8A 5M10A 1D7YA 5FS6A 2OLNA 1GALA 3BNMA 1UKVG 2YR4A 3LJPA 2DKIA 3M13A 4NWZA 4YTMA 1CL0A 2BCPA 5GSNA 3VRDB 4A9WA 5L46A 4C3YA 1ZOVA 1ZX9A 5C3JA 1LPFA 1D4CA 4GDEA 2RABA 4U2SA 5FS8A 1H7XA 3AD7B 1IUUA 1IUXA 1NEKA 1P2EA 2XFNA 2Z5YA 2AQJA 2H88A 3I3LA 1D4EA 2XLSA 3KPFA 1COYA 2QA2A 3C96A 4U8MA 1RSGA 3AE3A 5C2TA 2YVGA 3NLCA 2Q0KA 3DJDA 1B37A 2XYOA 2YLRA 3KVEA 3LZXA 4DNAA 4H2RA 1E39A 1D7LA 1F8RA 4U8NA 4U8LA 2RGOA 3ALJA 1Y0PA 1RYIA 4ADWA 4A79A 4I58A 2VQ7A 2XVJA 4B1BA 1IUTA 1DOBA 2YLTA 4GF7A 3KKJA 1IUWA 2WDVA 5GRTA 4J57A 4TM3A 3UTFA 2HQMA 1QO8A 2QA1A 3DK9A 3NKSA 3SYIA 4B66A 4BJZA 2VOUA 2V3BA 3REDA 4GAVA 5BULA 2X99A 2GB0A 5JCKA 1ZP0A 2B9XA 2IIDA 1Q1RA 3ABVA 3F8RA 4IA5A 1GRFA 3LB8A 4P9SA 4APNA 2VQBA 2XFPA 1DOCA 1H82A 1W4XA 4FK1A 1D5TA 3ALMA 1TDFA 2XFUA 3BI4A 3V3NA 3AE5A 4CBQA 3CPJG 2WEUA 1KNRA 4N9XA 4YKFA 4C3XA 3BNUA 1KFYA 1NHRA 3NYEA 4ZN0A 1JEHA 3AE7A 1BGJA 2VVLG 4YWOA 2GMJA 1P2HA 2Y6RA 3QVRA 3HYXA 3LXDA 1PHHA 3T0KA 3GYJA 3AE9A 4U2LA 2OALA 1JNRA 3UOXA 5EB5A 1E1LA 3OC4A 1TDKA 3P4QA 3SZ0A 4IVOB 1GESA 2GR0A 2XVFA 4RSLA 2C4CA 2FJBA 3AEGA 4GR1A 3II4A 4BJYA 2BS4A 3NTAA 4CY8A 1CJ2A 4EQSA 1PS9A 2Q7VA 1Y56B 4NNJA 1O94A 1PBDA 4JDRA 5KVIA 1HYUA 3EPTA 4G9KA 4A6NA 2BRYA 1S2YA 2B76A 1PXBA 3NG7X 3NRNA 1OJDA 4Y4NA 4EMWA 1S3BA 1GETA 1N4UA 4II3A 1X31B 4NTDA 3VQRA 4H4WA 1H7WA 1Z6LA 1EL9A 2B9WA 3DK8A 2GAGB 2UZZA 1QLBA 4TLZA 3AXBA 4A7AA 1GRAA 1OJTA 3URHA 1BF3A 3EF6A 3G5RA 2E5VA 3OZ2A 3ALLA 3CNJA 3DA1A 1GV4A 4H4SA 3QJ4A 1H86A 3PG6A 4B67A 1CJCA 3PVCA 4KX6A 2WETA 2XFQA 2BK3A 1B4VA 4H4PA 2A87A 3AB1A 3H8IA 3Q6JA 3SM8A 2EQ6A 1FEBA 3ITJA 3D8XA 3SGLA 1L9DA 2Q6UA 3E1TA 3P9UA 1EL7A 3FMWA 4JNAA 3SFDA 3AYIA 1JRZA 4H2PA 4OPTA 1GRHA 2VZ2A 3COXA 2CFYA 2GMHA 2YWLA 3V3OA 4K7ZA 1E1NA 3F8DA 2YVFA 3VR9A 1BWCA 5TR3A 1H84A 5HHFA 2BC0A 2JB3A 3T14A 3P4RA 4H4RA 1H83A 4CRTA 5DBJA 2JKCA 5KMPA 1CBOA 3IF9A 3QSEA 2X8CA 2GRTA 4LA1A 2E1MA 1PDHA 2PHHA 4K22A 2YLSA 3AE8A 1ONFA 4H4QA 3ICTA 2YM1A 3GWDA 4B64A 3ISHA 4FK1C 2YG3A 2JK6A 1BKWA 2WHDA 2EQ8A 3ADAB 4H4YA 4TM0A 2GQWA 5J7XA 1H2IA 3VRBA 1GNDA 1AOGA 2EQ9A 5KOXA 3AWIA 1YQZA 4JY3A 2C3CA 3GDNA 2RGHA 3M12A 3NTDA 4OPUA 5EB4A 2WPEA 4UDRA 2J3NA 3GMBA 2GAHB 2CDUA 4AOXA 3DJGX 3O0HA 5KXJA 2R46A 1KF6A 3BHKA 3UOZA 3UTEA 2ACZA 4BK1A 4YT0A 2OLOA 5U25A 2A8XA 1B5QA 3GD4A 2FBWA 1KSSA 1IJHA 2BYBA 2YG5A 2AAQA 2C66A 4X9NA 4BK3A 2QAEA 4Z44A 5BVAA 3VR8A 3FPZA 4B63A 1EL5A 3ATQA 2WP6A 4Z26A 5JCLA 4OPIA 1PJ5A 2C72A 4K5RA 1GEUA 1MO9A 4BURA 1S2QA 2X50A 3KPKA 1BZLA 3F8PA 2XLPA 4YKGA 5KWFA 1OJ9A 2H89A 2X3NA 4AP3A 3K7TA 1XDIA 1N4VA 1JOAA 5FS9A 1JNZA 3DJEA 4X4JA 3UP5A 1NDAA 5KMSA 2WBAA 3CGEA 1GTEA 1DJQA 2YQUA 3G5QA 4OPDA 1NHPA 1NAAA 4EM3A 1K0LA 4B69A 3R9UA 4GRTA 1PXCA 3HYVA 3CMMA 4UP3A 2VVLA 3AEAA 4CNKA 3UTGA 3GYXA 3V76A 3GRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H4T A;  5U1O A;  4K8D A;  4H7U A;  3ATR A;  3AEC A;  1VDC A;  1B8S A;  2V6O A;  3ZDN A;  3UOY A;  2YVJ A;  3GMC A;  3VRA A;  1TDN A;  1K0I A;  3UCL A;  1Q1W A;  1PN0 A;  1MXT A;  4GUV A;  1H6V A;  4EIP A;  3ICS A;  3K7M X;  4Y4L A;  2C73 A;  3NGC X;  4MJW A;  2YM2 A;  4DSG A;  3SFE A;  5CKU A;  3DK4 A;  4KPR A;  4C74 A;  2R0P A;  5CQF A;  1KSU A;  3FG2 P;  3NH3 X;  3QFA A;  2OA1 A;  2WS3 A;  4TM4 A;  2V5Z A;  4TLX A;  1YY5 A;  2IVD A;  3CNS A;  4FX9 A;  4DSH A;  1PJ6 A;  2BCG G;  2B7S A;  3GYI A;  3NHO X;  3RHA A;  4XWR A;  4Z2T A;  1GPE A;  3FIM B;  2BXS A;  4C5O A;  2WDQ A;  4H2N A;  1ZMD A;  3D1C A;  3CGD A;  3NYC A;  1FL2 A;  2IVE A;  1Y56 A;  1GRG A;  2YG4 A;  3H4K A;  1LQT A;  4CCQ A;  3L8K A;  4H50 A;  3UTH A;  1CJ4 A;  3IC9 A;  4J34 A;  4U8I A;  4EM4 A;  2C76 A;  2GQF A;  4Z2U A;  2C67 A;  2GEW A;  3AEB A;  3NN0 X;  1VG9 A;  4HB9 A;  1M64 A;  5FMH A;  1YKJ A;  4H4U A;  2Q0L A;  4O5Q A;  2JBV A;  4JQ9 A;  2NVK X;  4GDP A;  3B6D A;  5EBK A;  4ZCD A;  1OJC A;  3P1W A;  2XLU A;  2ZZB A;  4B65 A;  3RP8 A;  2R9Z A;  1RP0 A;  2BS2 A;  2FJA A;  1CF3 A;  4DGK A;  3LZW A;  4NEW A;  4IV9 A;  2WDR A;  1K0J A;  1PJ7 A;  4EMI A;  4YSZ A;  4OPL A;  3LOV A;  2GR2 A;  1M6I A;  3KLJ A;  1JRX A;  4EQR A;  1PBF A;  1XPQ A;  2GV8 A;  2BXR A;  1NHS A;  2WPC A;  1PBB A;  2PYX A;  1O5W A;  1JRY A;  4H2Q A;  3S61 A;  4J36 A;  3DJJ A;  1JU2 A;  4JN9 A;  1GXF A;  2CUL A;  4H4V A;  3GD3 A;  4LU6 A;  1VG0 A;  1F8W A;  4LII A;  4Z24 A;  2W0H A;  1F3P A;  3UKA A;  2ZZ0 A;  1DOD A;  4PAB A;  4RG4 A;  3AEF A;  3S5W A;  1LTX R;  2C70 A;  3CIR A;  3AYJ A;  1E1M A;  1V59 A;  1O95 A;  2VRM A;  3B3R A;  3ICR A;  3WE0 A;  3EAN A;  1GRT A;  1YQ3 A;  3BI2 A;  1EBD A;  3CND A;  4IVM B;  1E7P A;  4ZCC A;  1GER A;  2BC1 A;  2AR8 A;  2B9Y A;  1REO A;  3CNT A;  1F6M A;  3K30 A;  2JAE A;  2OAM A;  2XLT A;  2R0G A;  3NN6 X;  4U2T A;  2R45 A;  3AE1 A;  5JCN A;  4H4X A;  3AE6 A;  1L0V A;  4A99 A;  3CGC A;  2C7G A;  4A65 A;  4REK A;  3CNP A;  2E4G A;  4OCG A;  1GRB A;  3UKF A;  4Z25 A;  1OJA A;  4I59 A;  1TYP A;  1CC2 A;  2YLX A;  2X8H A;  1ZOY A;  3NK0 X;  5FS7 A;  3AE2 A;  1FEC A;  1VRQ B;  4Z43 A;  1LV0 A;  4EQX A;  4EQW A;  2C75 A;  3H8L A;  4U8P A;  5IQ1 A;  1ZMC A;  2APG A;  2C3D A;  3AED A;  4CY6 A;  1TDE A;  4K2X A;  1K4Q A;  3SQP A;  1PXA A;  3CPI G;  4YSX A;  2YG7 A;  2V61 A;  3M0O A;  3QSS A;  4OPC A;  2GR1 A;  2I0Z A;  2BAB A;  1SEZ A;  1TRB A;  1DOE A;  5HYM A;  1N4W A;  5J60 A;  4Z2R A;  4UDP A;  3ZYX A;  5BUK A;  2GF3 A;  2VRL A;  3CN8 A;  2XVI A;  2WU5 A;  4O5U A;  4UDQ A;  2GR3 A;  4D03 A;  4OPG A;  4U8J A;  4HA6 A;  1LJ1 A;  2TMD A;  3C4N A;  4AOS A;  1NG3 A;  4U8K A;  2YLW A;  4TM1 A;  2C64 A;  2YR6 A;  4GCM A;  3G5S A;  2Y6Q A;  2WP5 A;  1E1K A;  2FJE A;  4ECH A;  2R4E A;  4J56 A;  5BRT A;  4RG3 A;  3QSM A;  5EOW A;  5ER0 A;  4H4Z A;  3IWA A;  2R0C A;  1L9E A;  1DJN A;  3KD9 A;  3NT6 A;  1FEA A;  4XWZ A;  4XXG A;  2ARD A;  1LVL A;  1L9C A;  2BA9 A;  2XLR A;  2TPR A;  3BI5 A;  1IUS A;  4JNQ A;  2YR5 A;  3UP4 A;  2JB2 A;  2B7R A;  4AT0 A;  1CJ3 A;  4USR A;  1ZY8 A;  2ZZC A;  4FDC B;  4JY2 A;  1DXL A;  1CC4 A;  2A89 A;  2O9Z A;  1S3E A;  4EMJ A;  3KU9 A;  5JCI A;  1IUV A;  1ELI A;  1N1P A;  1NPX A;  5KVH A;  1E6E A;  3QVP A;  4WCT A;  4USQ A;  3UOV A;  1KDG A;  1FOH A;  2BAC A;  3KA7 A;  4AT2 A;  1GOS A;  5M0Z A;  4D04 A;  2RGJ A;  4B68 A;  4K5S A;  4A6N B;  4PAA A;  4J31 A;  3PO7 A;  1ZKQ A;  2WQY A;  4U8O A;  2YAU A;  4M52 A;  3UKQ A;  5IQ4 A;  2GVC A;  1BGN A;  3DGZ A;  1YQ4 A;  4OVI A;  2WOI A;  3I6D A;  1NEN A;  4J33 A;  3CPH G;  1GTH A;  3K7Q X;  3GRS A;  4ICY A;  3DME A;  1H81 A;  2V60 A;  2BK4 A;  4CNJ A;  4NZH A;  4C77 A;  3CTY A;  3CGB A;  2XVH A;  3GDP A;  2YG6 A;  1XHC A;  3AYL A;  4YXD A;  1GRE A;  3UKH A;  3RP6 A;  2EQ7 A;  4YSY A;  2QCU A;  2V3A A;  1FCD A;  1Q9I A;  2WU2 A;  2YLZ A;  3GWF A;  1NHQ A;  3HZL A;  3DH9 A;  1PBE A;  3Q9T A;  4WX1 A;  1TDO A;  3T37 A;  3NK2 X;  3LAD A;  3P4S A;  3IHM A;  5KRQ A;  3AD8 B;  1DNC A;  5U63 A;  1F8S A;  3C4A A;  2Z5X A;  1GSN A;  1PBC A;  3GSI A;  5HXI A;  4NTE A;  3P4P A;  2VVM A;  3RNM A;  1XAN A;  2DKH A;  2XCG A;  2NPX A;  2F5Z A;  1NG4 A;  2C65 A;  2ZBW A;  3JSK A;  3QFB A;  2XFO A;  5KOW A;  4Y4M A;  3RP7 A;  4BK2 A;  3UKL A;  2BK5 A;  2WES A;  3NK1 X;  2XVE A;  1ZDL A;  4CCR A;  4YTN A;  2CVJ A;  1D4D A;  2R4J A;  4IA6 A;  3AE4 A;  3NNE A;  3UKK A;  2WP9 A;  4AP1 A;  2X8G A;  5JCM A;  2WPF A;  1KNP A;  1CHU A;  4EIQ A;  1GT8 A;  4BV6 A;  2WOV A;  1VQW A;  3L1R A;  5IPY A;  2XDO A;  1LQU A;  3NYF A;  4NTC A;  1TYT A;  4E0V A;  3IHG A;  3UKP A;  5LV9 A;  3NIX A;  4A5L A;  3DGH A;  3EAO A;  1CC6 A;  2WOW A;  4YTP A;  3AD9 B;  4J2W A;  3BHF A;  1QJD A;  2GH5 A;  3PS9 A;  2FJD A;  1MOK A;  3FBS A;  4YSH A;  4NEV A;  1ZK7 A;  2JB1 A;  2BS3 A;  5HY5 A;  3AEE A;  1EL8 A;  5M10 A;  1D7Y A;  5FS6 A;  2OLN A;  1GAL A;  3BNM A;  1UKV G;  2YR4 A;  3LJP A;  2DKI A;  3M13 A;  4YTM A;  5GSN A;  1CL0 A;  2BCP A;  3VRD B;  4A9W A;  5L46 A;  4C3Y A;  1ZOV A;  1ZX9 A;  5C3J A;  1LPF A;  1D4C A;  4GDE A;  2RAB A;  4U2S A;  5FS8 A;  1H7X A;  3AD7 B;  1IUU A;  1IUX A;  1NEK A;  1P2E A;  2XFN A;  2Z5Y A;  2AQJ A;  2H88 A;  3I3L A;  1D4E A;  2XLS A;  3KPF A;  1COY A;  2QA2 A;  3C96 A;  4U8M A;  1RSG A;  3AE3 A;  5C2T A;  2YVG A;  3NLC A;  2Q0K A;  3DJD A;  1B37 A;  2XYO A;  2YLR A;  3KVE A;  3LZX A;  4DNA A;  4H2R A;  1E39 A;  1D7L A;  1F8R A;  4U8N A;  4U8L A;  2RGO A;  3ALJ A;  1Y0P A;  1RYI A;  4ADW A;  4A79 A;  4I58 A;  2VQ7 A;  2XVJ A;  4B1B A;  1IUT A;  1DOB A;  2YLT A;  4GF7 A;  3KKJ A;  1IUW A;  2WDV A;  5GRT A;  4J57 A;  4TM3 A;  3UTF A;  2HQM A;  1QO8 A;  2QA1 A;  3DK9 A;  3NKS A;  4B66 A;  4BJZ A;  2VOU A;  2V3B A;  3RED A;  5BUL A;  2X99 A;  2GB0 A;  5JCK A;  1ZP0 A;  2B9X A;  2IID A;  1Q1R A;  3ABV A;  3F8R A;  4IA5 A;  1GRF A;  3LB8 A;  4P9S A;  4APN A;  2VQB A;  2XFP A;  1DOC A;  1H82 A;  1W4X A;  4FK1 A;  1D5T A;  3ALM A;  1TDF A;  2XFU A;  3BI4 A;  3V3N A;  3AE5 A;  4CBQ A;  3CPJ G;  2WEU A;  1KNR A;  4N9X A;  4YKF A;  4C3X A;  3BNU A;  1KFY A;  1NHR A;  3NYE A;  4ZN0 A;  1JEH A;  3AE7 A;  1BGJ A;  2VVL G;  4YWO A;  2GMJ A;  1P2H A;  2Y6R A;  3QVR A;  3LXD A;  1PHH A;  3GYJ A;  3AE9 A;  4U2L A;  2OAL A;  1JNR A;  3UOX A;  5EB5 A;  1E1L A;  3OC4 A;  1TDK A;  3P4Q A;  4IVO B;  1GES A;  2GR0 A;  2XVF A;  4RSL A;  2FJB A;  3AEG A;  4GR1 A;  3II4 A;  4BJY A;  2BS4 A;  3NTA A;  4CY8 A;  1CJ2 A;  4EQS A;  1PS9 A;  2Q7V A;  1Y56 B;  1O94 A;  1PBD A;  4JDR A;  5KVI A;  1HYU A;  3EPT A;  4A6N A;  1S2Y A;  2B76 A;  1PXB A;  3NG7 X;  3NRN A;  1OJD A;  4Y4N A;  4EMW A;  1S3B A;  1GET A;  1N4U A;  1X31 B;  4NTD A;  3VQR A;  4H4W A;  1H7W A;  1Z6L A;  1EL9 A;  2B9W A;  3DK8 A;  2GAG B;  2UZZ A;  1QLB A;  4TLZ A;  3AXB A;  4A7A A;  1GRA A;  1OJT A;  3URH A;  1BF3 A;  3EF6 A;  3G5R A;  2E5V A;  3OZ2 A;  3ALL A;  3CNJ A;  3DA1 A;  1GV4 A;  4H4S A;  3QJ4 A;  1H86 A;  4B67 A;  1CJC A;  3PVC A;  4KX6 A;  2WET A;  2XFQ A;  2BK3 A;  1B4V A;  4H4P A;  2A87 A;  3AB1 A;  3H8I A;  3Q6J A;  3SM8 A;  2EQ6 A;  1FEB A;  3ITJ A;  3D8X A;  3SGL A;  1L9D A;  2Q6U A;  3E1T A;  3P9U A;  1EL7 A;  3FMW A;  4JNA A;  3SFD A;  3AYI A;  1JRZ A;  4H2P A;  4OPT A;  1GRH A;  2VZ2 A;  3COX A;  2CFY A;  2GMH A;  2YWL A;  3V3O A;  4K7Z A;  1E1N A;  3F8D A;  2YVF A;  3VR9 A;  1BWC A;  5TR3 A;  1H84 A;  5HHF A;  2BC0 A;  2JB3 A;  3P4R A;  4H4R A;  1H83 A;  4CRT A;  5DBJ A;  2JKC A;  1CBO A;  3IF9 A;  3QSE A;  2X8C A;  2GRT A;  4LA1 A;  2E1M A;  1PDH A;  2PHH A;  4K22 A;  2YLS A;  3AE8 A;  1ONF A;  4H4Q A;  3ICT A;  2YM1 A;  3GWD A;  4B64 A;  3ISH A;  4FK1 C;  2YG3 A;  2JK6 A;  1BKW A;  2WHD A;  2EQ8 A;  3ADA B;  4H4Y A;  4TM0 A;  2GQW A;  5J7X A;  3VRB A;  5KOX A;  1GND A;  1AOG A;  2EQ9 A;  3AWI A;  1YQZ A;  4JY3 A;  2C3C A;  3GDN A;  2RGH A;  3M12 A;  3NTD A;  4OPU A;  5EB4 A;  2WPE A;  4UDR A;  2J3N A;  3GMB A;  2GAH B;  2CDU A;  4AOX A;  3DJG X;  3O0H A;  5KXJ A;  2R46 A;  1KF6 A;  3BHK A;  3UOZ A;  3UTE A;  2ACZ A;  4BK1 A;  4YT0 A;  2OLO A;  5U25 A;  2A8X A;  1B5Q A;  3GD4 A;  2FBW A;  1KSS A;  1IJH A;  2BYB A;  2YG5 A;  2AAQ A;  2C66 A;  4X9N A;  4BK3 A;  2QAE A;  4Z44 A;  5BVA A;  3VR8 A;  3FPZ A;  4B63 A;  1EL5 A;  3ATQ A;  2WP6 A;  4Z26 A;  5JCL A;  4OPI A;  1PJ5 A;  2C72 A;  4K5R A;  1GEU A;  1MO9 A;  4BUR A;  1S2Q A;  2X50 A;  1BZL A;  3F8P A;  2XLP A;  4YKG A;  5KWF A;  1OJ9 A;  2H89 A;  2X3N A;  4AP3 A;  3K7T A;  1XDI A;  1N4V A;  1JOA A;  5FS9 A;  1JNZ A;  3DJE A;  4X4J A;  3UP5 A;  1NDA A;  2WBA A;  3CGE A;  1GTE A;  1DJQ A;  2YQU A;  3G5Q A;  4OPD A;  1NHP A;  1NAA A;  4EM3 A;  1K0L A;  4B69 A;  3R9U A;  4GRT A;  1PXC A;  4UP3 A;  2VVL A;  3AEA A;  4CNK A;  3UTG A;  4X9M A;  3V76 A;  3GRT A; 
#chains in the Genus database with same CATH topology
 4K8D A;  3AEC A;  1B8S A;  4G8T A;  1PDY A;  3UOY A;  3GC2 A;  2YVJ A;  3VRA A;  3SY4 A;  3DFH A;  3MKC A;  3OTR A;  3NGC X;  3T2Y A;  1N62 C;  3PWI A;  4DSG A;  1S7M A;  2R0P A;  1KSU A;  3RRA A;  2OQH A;  3QKE A;  4XWR A;  2BXS A;  2WDQ A;  3D1C A;  3CGD A;  2GGJ A;  2IVE A;  1GRG A;  3ES8 A;  2PMQ A;  4ZOH B;  3ZVI A;  4GME A;  3T4W A;  4EM4 A;  2GEW A;  3AEB A;  4A6G A;  1VG9 A;  3NN0 X;  4HB9 A;  1MRA A;  2JBV A;  5EBK A;  2PU0 A;  2ZZB A;  4B65 A;  3LZW A;  3T2Z A;  4YSZ A;  3KLJ A;  5EU9 A;  1PBF A;  1XPQ A;  2GV8 A;  1TKK A;  1P48 A;  2BXR A;  1O5W A;  3TOY A;  1JU2 A;  3SN4 A;  4ENL A;  2CUL A;  4H4V A;  3GD3 A;  1F8W A;  4Z24 A;  2W0H A;  2ZZ0 A;  4YWS A;  3S5W A;  2C70 A;  3EAN A;  1EBD A;  3K30 A;  4U2T A;  2R45 A;  3CGC A;  3N4E A;  2C7G A;  4A65 A;  2AL1 A;  2OO6 A;  1ONE A;  2RDX A;  2QJN A;  3FXG A;  2YLX A;  1RM6 B;  2X8H A;  5FS7 A;  1VRQ B;  4Z43 A;  4EQX A;  3THU A;  2C3D A;  3QSS A;  4OPC A;  1JPD X;  4JN7 A;  1TRB A;  4UDP A;  2VRL A;  3CN8 A;  2QJJ A;  4UDQ A;  4U8J A;  1LJ1 A;  2C64 A;  2YR6 A;  3UXL A;  4J56 A;  4RG3 A;  4H4Z A;  3VC5 A;  2BRA A;  2R0C A;  1MDR A;  1DJN A;  4XWZ A;  1RVK A;  2ARD A;  2P8B A;  3BI5 A;  2JB2 A;  1CJ3 A;  4USR A;  3VA8 A;  1N1P A;  1E6E A;  4WCT A;  1ZXI C;  4K5S A;  3IJQ A;  2AKM A;  2GDQ A;  4IP4 A;  4M52 A;  3NZG A;  1VDV A;  1NEN A;  1XS2 A;  3MY9 A;  3H8A A;  3CTY A;  3L5O A;  2YG6 A;  4H19 A;  3NXL A;  3TW9 A;  3R1Z A;  1FCD A;  2YLZ A;  4FI4 A;  1SJD A;  3LAD A;  3P4S A;  3IHM A;  4GAP A;  3AD8 B;  1F8S A;  1PBC A;  2OZ8 A;  1XAN A;  2NPX A;  3QFB A;  2XFO A;  5KOW A;  4H83 A;  4Y4M A;  3RP7 A;  3R10 A;  4G6H A;  3SZF A;  3AE4 A;  3UKK A;  2WPF A;  1GT8 A;  4E0V A;  1MDL A;  6ENL A;  3CXB A;  2WOW A;  3BHF A;  2GH5 A;  3FCP A;  4NEV A;  4EWJ A;  3T2K A;  1FFU C;  5M10 A;  1EL8 A;  1MNS A;  3NVV B;  2OLN A;  4NWZ A;  3LJP A;  2YR4 A;  4E4U A;  2BCP A;  4A9W A;  1YEY A;  1ZX9 A;  3GY1 A;  5C3J A;  1D4C A;  2ZAD A;  4F4R A;  3AD7 B;  1IUU A;  1NEK A;  1PDZ A;  3UCD A;  2H88 A;  3I3L A;  3KPF A;  1COY A;  4U8M A;  2YVG A;  1F8R A;  4U8N A;  2GGG A;  4ADW A;  2VQ7 A;  2ONE A;  3KKJ A;  5GRT A;  3ZLH A;  1QO8 A;  2V3B A;  3RED A;  2X99 A;  5JCK A;  1KKR A;  2IID A;  3ABV A;  1H82 A;  1TDF A;  2OVL A;  4C3X A;  1KFY A;  1FO4 A;  4ZN0 A;  3TWB A;  2VVL G;  4YWO A;  1P2H A;  3T0K A;  5EB5 A;  1E1L A;  1TDK A;  4IVO B;  2I5Q A;  2QVH A;  3AEG A;  2BS4 A;  1CJ2 A;  3EPT A;  2OLA A;  3A7R A;  1PXB A;  4Y4N A;  1S3B A;  1GET A;  1N4U A;  4II3 A;  4NTD A;  3VQR A;  1Z6L A;  1EL9 A;  2GAG B;  1OJT A;  1BF3 A;  1CJC A;  4KX6 A;  3MQT A;  3H8I A;  3D8X A;  2Q6U A;  1EL7 A;  3FMW A;  4OPT A;  4K7Z A;  1E1N A;  3TCS A;  1BWC A;  1NU5 A;  2BC0 A;  5DBJ A;  2JKC A;  3QSE A;  4GIS A;  4LA1 A;  3ES7 A;  1PDH A;  3SR6 B;  4B64 A;  4H4Q A;  3TJ4 A;  4FK1 C;  2YG3 A;  2JK6 A;  1BKW A;  3ADA B;  1H2I A;  1GND A;  2EQ9 A;  4GYP A;  4E6M A;  1KKO A;  3OPS A;  3NTD A;  4A35 A;  4DX3 A;  3SQS A;  3DJG X;  3O0H A;  3BHK A;  5G5G B;  3FJ4 A;  2A8X A;  2GSH A;  3EKG A;  2YG5 A;  2QAE A;  2W54 A;  5BVA A;  4Z26 A;  5JCL A;  4TVW A;  4OPI A;  1GEU A;  1MO9 A;  3F8P A;  2PCE A;  4IT1 A;  2DW6 A;  4AP3 A;  1JNZ A;  4JN8 A;  3CGE A;  3G5Q A;  3CYJ A;  1NAA A;  1PXC A;  3SJN A;  3V76 A;  3GRT A;  4H4T A;  5U1O A;  3ATR A;  4FP1 A;  2V6O A;  3ZDN A;  3UJ2 A;  4EIP A;  1BQG A;  2C73 A;  4MJW A;  2YM2 A;  3SFE A;  4KPR A;  1ECQ A;  4GGH A;  2OA1 A;  2P3Z A;  4DSH A;  4FX9 A;  1PJ6 A;  3RHA A;  1W6T A;  1FL2 A;  4K1W A;  3S47 A;  4CCQ A;  3L8K A;  3R0U A;  3KUM A;  1CJ4 A;  1WUE A;  2C76 A;  2C67 A;  1M64 A;  4O5Q A;  1YKJ A;  4H4U A;  4JQ9 A;  2XH0 A;  2XLU A;  3RP8 A;  2R9Z A;  4X2P A;  2OPJ A;  4NEW A;  1EBH A;  2W3R A;  1PJ7 A;  3LOV A;  1JRX A;  3VFC A;  3ENL A;  3Q4D A;  4J36 A;  1GXF A;  2OQY A;  3TTE A;  3AEF A;  4GFI A;  1FFV C;  3CIR A;  3AYJ A;  1V59 A;  1O95 A;  3FV9 A;  5FJP A;  1GRT A;  1YQ3 A;  3CND A;  4IVM B;  3FYY A;  3AMZ A;  1REO A;  1F6M A;  2OAM A;  3QPE A;  5JCN A;  4H4X A;  2POZ A;  3CNP A;  4OCG A;  1ZOY A;  3NK0 X;  3H8L A;  2PTZ A;  1TDE A;  4K2X A;  1BKH A;  1K4Q A;  3SQP A;  1PXA A;  3CPI G;  2XH4 A;  4G74 A;  2BAB A;  3PK7 A;  1SEZ A;  1N5X A;  4KPL A;  5BUK A;  2GF3 A;  2XVI A;  4O5U A;  4D03 A;  4OPG A;  2TMD A;  4U8K A;  2YLW A;  4TM1 A;  2Y6Q A;  2WP5 A;  3R25 A;  4MKS A;  3R11 A;  1FEA A;  1IUS A;  3T31 A;  2B7R A;  3NVW B;  3DG7 A;  4FDC B;  1DXL A;  2A89 A;  2O9Z A;  3QLD A;  1SJA A;  2BAC A;  1GOS A;  2XH7 A;  2WQY A;  5IQ4 A;  2GVC A;  3DGZ A;  4IL0 A;  3UJR A;  3CPH G;  3K7Q X;  4KEM A;  4C77 A;  4HCL A;  2XVH A;  4HN8 A;  4YXD A;  3UKH A;  2EQ7 A;  4YSY A;  2QCU A;  2PP1 A;  3DH9 A;  3T37 A;  5U63 A;  2Z5X A;  3GSI A;  5FJT A;  1KD0 A;  3P4P A;  2DKH A;  3SN1 A;  3JSK A;  2QGY A;  3UKL A;  2BK5 A;  3NK1 X;  2XVE A;  3BOX A;  1D4D A;  4M6U A;  4AP1 A;  2X8G A;  1KNP A;  1L8P A;  4BV6 A;  1VQW A;  1X2G A;  5IPY A;  2XDO A;  1LQU A;  1TYT A;  3H70 A;  3DEQ A;  4A5L A;  3DGH A;  4J1O A;  4YTP A;  4J2W A;  1QJD A;  2FJD A;  2BS3 A;  3IJL A;  3SSZ A;  4YTM A;  2AKZ A;  1UKV G;  3VRD B;  5L46 A;  3DGB A;  4A3R A;  3UXK A;  1ZOV A;  1LPF A;  2GGE A;  1P43 A;  1SB3 B;  2RAB A;  4HYR A;  2Z5Y A;  1D4E A;  2XLS A;  3IK4 A;  3NLC A;  2QDE A;  2XYO A;  3LZX A;  1E39 A;  1D7L A;  4HCD A;  3H12 A;  3ALJ A;  2E5A A;  4I58 A;  3SN0 A;  1DOB A;  1IUW A;  3NFU A;  3DK9 A;  1JRO A;  2FYM A;  2PTY A;  1ZP0 A;  2B9X A;  4IA5 A;  4APN A;  2POD A;  3ALM A;  3BI4 A;  1KNR A;  4YKF A;  3BNU A;  2OKT A;  3AE7 A;  3QVR A;  1SJB A;  1SJC A;  3LXD A;  4GYP C;  4M0X A;  4U2L A;  2PTW A;  4BJY A;  2MUC A;  3NTA A;  4CY8 A;  1PS9 A;  2Q7V A;  4E8G A;  1Y56 B;  4JDR A;  3OZM A;  2BRY A;  1S2Y A;  3NG7 X;  1H7W A;  1QLB A;  3AXB A;  3QTP A;  1XPY A;  3OZ2 A;  1FIQ B;  4H4S A;  3QJ4 A;  4B67 A;  3PG6 A;  2BK3 A;  1B4V A;  3CT2 A;  4G7F A;  2A87 A;  3SM8 A;  2EQ6 A;  1FEB A;  3SFD A;  3P9U A;  4JNA A;  3AYI A;  1JRZ A;  2CFY A;  2GMH A;  3RGT A;  1H84 A;  5HHF A;  2OG9 A;  3P4R A;  2X8C A;  2GRT A;  3JVA A;  4K22 A;  2YLS A;  3GWD A;  4TM0 A;  4H4Y A;  3VRB A;  1YQZ A;  3GDN A;  3M12 A;  4OPU A;  4HPN A;  5BOF A;  2R46 A;  2ACZ A;  2OLO A;  3GD4 A;  3R0K A;  1IJH A;  2BYB A;  1R0M A;  2AAQ A;  4X9N A;  4Z44 A;  2PPG A;  3NRZ B;  2X50 A;  1DTN A;  1STZ A;  1JOA A;  1NDA A;  5KMS A;  2WBA A;  3V4B A;  4EM3 A;  1K0L A;  4B69 A;  3HYV A;  1EC7 A;  4H7U A;  4HNC A;  2OZ3 A;  1TDN A;  1K0I A;  1MXT A;  4GUV A;  3P93 A;  1H6V A;  3ICS A;  3K7M X;  3DK4 A;  5CQF A;  3NH3 X;  2WS3 A;  2E3T A;  2V5Z A;  4TLX A;  1YY5 A;  2IVD A;  3CNS A;  3D47 A;  2PSN A;  3GYI A;  1GPE A;  3FIM B;  4C5O A;  4H2N A;  1ZMD A;  2ZC8 A;  2P0I A;  1Y56 A;  3DER A;  5FJU A;  1V97 A;  2GQF A;  4Z2U A;  5FMH A;  3NVY B;  3I6E A;  3A7U A;  1CF3 A;  4DGK A;  4IV9 A;  3U4F A;  1KN0 A;  2WDR A;  3Q45 A;  2GGI A;  4OPL A;  3T8Q A;  4ZA0 A;  2WPC A;  2PYX A;  5BOE A;  1JRY A;  3S61 A;  4JN9 A;  4LU6 A;  4E5T A;  3TQP A;  3JW7 A;  1F3P A;  3UKA A;  1DOD A;  4PAB A;  4RG4 A;  1LTX R;  5KNL A;  2VRM A;  3WE0 A;  3ICR A;  3P3B A;  1ELS A;  2BC1 A;  2AR8 A;  2B9Y A;  4G73 A;  2R0G A;  3NN6 X;  3AE1 A;  4REK A;  3SX6 A;  1GRB A;  4Z25 A;  1OJA A;  4I59 A;  3AE2 A;  1FEC A;  4U8P A;  2APG A;  4TVY A;  3GD6 A;  4CY6 A;  4ROP A;  2V61 A;  3OW1 A;  2OX4 A;  4Z2R A;  3ZYX A;  3N4F A;  2WU5 A;  1N60 C;  3AM9 A;  4HA6 A;  3C4N A;  1NG3 A;  3G5S A;  2R4E A;  5KMQ A;  1L9E A;  3A7A A;  3KD9 A;  3NT6 A;  2BA9 A;  2XLR A;  2TPR A;  4KWS A;  4JNQ A;  2PTX A;  4JY2 A;  4EMJ A;  1ELI A;  3JZU A;  3V5C A;  3UOV A;  1FOH A;  4AT2 A;  2RGJ A;  4B68 A;  4MGG A;  4PAA A;  4J31 A;  1ZKQ A;  4U8O A;  2YAU A;  1BGN A;  1YQ4 A;  5IDZ A;  2WOI A;  3B97 A;  1GTH A;  3UCC A;  2GGH A;  3DME A;  1H81 A;  2BK4 A;  4J3Z A;  4CNJ A;  4NZH A;  3CGB A;  1XHC A;  4G6G A;  3U9I A;  1GRE A;  4IL2 A;  3GWF A;  1Q9I A;  3HZL A;  4WX1 A;  3CXO A;  1DNC A;  1GSN A;  1E9I A;  1NG4 A;  5FJO A;  2ZBW A;  2PGW A;  4BK2 A;  2WES A;  1ZDL A;  4IP5 A;  4YTN A;  2WP9 A;  3DIP A;  3L1R A;  3IHG A;  3DFY A;  2OZT A;  3EAO A;  3N6H A;  4IZG A;  3FBS A;  4YSH A;  3DES A;  5J04 A;  3R07 C;  1D7Y A;  1GAL A;  2DKI A;  1CL0 A;  4C3Y A;  5FS8 A;  1H7X A;  2GL5 A;  1IUX A;  1P2E A;  2XFN A;  3VC6 A;  1FHU A;  2QA2 A;  3C96 A;  2Q0K A;  2NQL A;  2YLR A;  1OEP A;  1RYI A;  4A79 A;  4B1B A;  2YLT A;  5G5H B;  4GF7 A;  2WDV A;  4KT2 A;  4J57 A;  4TM3 A;  3TWA A;  2QA1 A;  3SYI A;  4B66 A;  7ENL A;  4GAV A;  5BUL A;  2GB0 A;  4DYE A;  3LB8 A;  4P9S A;  2XFP A;  3T9P A;  1DOC A;  4FK1 A;  2XFU A;  4CBQ A;  3CPJ G;  2WEU A;  4N9X A;  1N63 C;  3I4K A;  1PHH A;  1MUC A;  3PWG A;  3AE9 A;  2OAL A;  1JNR A;  3UOX A;  3SZ0 A;  1GES A;  2XVF A;  4MMW A;  4GR1 A;  4EQS A;  2PP3 A;  4G9K A;  3NRN A;  1OJD A;  4EMW A;  2MNR A;  4H4W A;  2B9W A;  3DK8 A;  4A7A A;  3EF6 A;  2E5V A;  3ALL A;  3DA1 A;  1H86 A;  2WET A;  4H4P A;  3ITJ A;  3SGL A;  1L9D A;  1GRH A;  3NVZ B;  2VZ2 A;  2YWL A;  3V3O A;  3F8D A;  2JB3 A;  3D46 A;  4CRT A;  5KMP A;  2E1M A;  3MUC A;  2PHH A;  3AE8 A;  2YM1 A;  5J7X A;  5KOX A;  1AOG A;  2FKP A;  3ETR B;  4JY3 A;  2C3C A;  2RGH A;  5EB4 A;  2WPE A;  3RO6 A;  2P8C A;  4ZCW A;  4Z1Y A;  4AOX A;  2XGZ A;  5KXJ A;  5U25 A;  2FBW A;  4BK3 A;  3FPZ A;  1EL5 A;  4JHM A;  3ATQ A;  1PJ5 A;  3P0W A;  4BUR A;  4HNL A;  1BZL A;  4YKG A;  2H89 A;  3EUB 3;  2X3N A;  3S5S A;  3K7T A;  3QN3 A;  3CK5 A;  1N4V A;  5FS9 A;  3DJE A;  3MWC A;  4HCH A;  1GTE A;  1DJQ A;  2YQU A;  4OPD A;  3ZLF A;  3CMM A;  3AEA A;  2HXT A;  4CNK A;  3GYX A;  1JEH A;  1VQZ A;  1VDC A;  1X2H A;  3GMC A;  3T6C A;  3UCL A;  1Q1W A;  1PN0 A;  1R6W A;  4Y4L A;  5CKU A;  1FHV A;  4C74 A;  2PA6 A;  1TE6 A;  3FG2 P;  3QFA A;  4TM4 A;  2BCG G;  2B7S A;  3NHO X;  4Z2T A;  3NYC A;  2YG4 A;  3H4K A;  1LQT A;  4H50 A;  3UTH A;  3IC9 A;  4J34 A;  4U8I A;  1JCT A;  2PP0 A;  2Q0L A;  4H1Z A;  2NVK X;  4GDP A;  3B6D A;  3MZN A;  4ZCD A;  1OJC A;  3P1W A;  1RP0 A;  2BS2 A;  2FJA A;  3SZC A;  1K0J A;  4EMI A;  3K1G A;  2GR2 A;  1M6I A;  4Z17 A;  4EQR A;  1NHS A;  5ENL A;  1PBB A;  2W3S A;  4H2Q A;  3DJJ A;  2HZG A;  3ZVH B;  1VG0 A;  3SZW A;  3MSY A;  4LII A;  1E1M A;  3B3R A;  3V3W A;  3BI2 A;  3ZLG A;  1T3Q C;  1E7P A;  4ZCC A;  3DG3 A;  1GER A;  5JRB A;  4DWD A;  3CNT A;  2JAE A;  2XLT A;  1JDF A;  3SXI A;  3AE6 A;  1L0V A;  4A99 A;  3OP2 A;  2AL2 B;  4GGB A;  3NO1 A;  2E4G A;  3UKF A;  1TYP A;  1CC2 A;  2W55 A;  3VDG A;  3N6J A;  1LV0 A;  4EQW A;  2C75 A;  5IQ1 A;  1ZMC A;  3AED A;  3SBF A;  4DN1 A;  4YSX A;  2YG7 A;  4DHG A;  3M0O A;  2GR1 A;  2XSX A;  2I0Z A;  1DOE A;  5HYM A;  1N4W A;  5J60 A;  3BJS A;  2GR3 A;  4AOS A;  2CHR A;  4GCM A;  1E1K A;  2FJE A;  4ECH A;  5BRT A;  3QSM A;  5EOW A;  5ER0 A;  3IWA A;  5KMR A;  3HYW A;  4XXG A;  1LVL A;  1L9C A;  3PFR A;  2YR5 A;  4K2S A;  3UP4 A;  3VCC A;  4AT0 A;  1EC8 A;  1ZY8 A;  2HNE A;  2ZZC A;  1CC4 A;  2QDD A;  1S3E A;  3TJI A;  3KU9 A;  5JCI A;  1IUV A;  1NPX A;  5KVH A;  3QVP A;  4USQ A;  1KDG A;  3KA7 A;  4D04 A;  2QQ6 A;  5M0Z A;  4II2 A;  4A6N B;  3PO7 A;  3UKQ A;  4OVI A;  3I6D A;  4J33 A;  3GRS A;  4ICY A;  2V60 A;  3GO2 A;  3UJE A;  3GDP A;  3AYL A;  1N5W C;  3RP6 A;  2V3A A;  5FJR A;  2WU2 A;  1NHQ A;  2XH2 A;  1PBE A;  3Q9T A;  1TDO A;  3NK2 X;  5KRQ A;  3C4A A;  5HXI A;  3D9X A;  4NTE A;  2VVM A;  3RNM A;  2XCG A;  2F5Z A;  3I6T A;  2C65 A;  4CCR A;  3ZVH A;  2CVJ A;  2R4J A;  4IA6 A;  3NNE A;  5JCM A;  1CHU A;  4EIQ A;  2WOV A;  3BSM A;  4IHC A;  3NYF A;  4NTC A;  3DG6 A;  3UKP A;  5LV9 A;  3NIX A;  1CC6 A;  3AD9 B;  3PS9 A;  1MOK A;  1ZK7 A;  1WUF A;  2JB1 A;  5HY5 A;  3AEE A;  2AL2 A;  3HW2 A;  3CAW A;  5FS6 A;  3M13 A;  3BNM A;  3NS1 B;  5GSN A;  4GDE A;  4U2S A;  3FVD A;  2AQJ A;  3EEZ A;  1RSG A;  3AE3 A;  5C2T A;  3DJD A;  1B37 A;  3KVE A;  3RR1 A;  4H2R A;  4DNA A;  4K8G A;  4U8L A;  2RGO A;  3CB3 A;  1Y0P A;  3VCN A;  2XVJ A;  1IUT A;  4E4F A;  2P88 A;  2QJM A;  3UTF A;  2HQM A;  1TZZ A;  3OZY A;  3NKS A;  4BJZ A;  3STP A;  2VOU A;  1Q1R A;  3F8R A;  1GRF A;  3RIT A;  1F9C A;  2VQB A;  1W4X A;  1D5T A;  3UJF A;  3V3N A;  3AE5 A;  1EBG A;  1NHR A;  1JPM A;  3NYE A;  2PGE A;  3UJS A;  1BGJ A;  3V5F A;  2GMJ A;  2Y6R A;  3HYX A;  2PU1 A;  3GYJ A;  4GIR A;  3OC4 A;  3P4Q A;  2GR0 A;  4RSL A;  3UGV A;  2C4C A;  2FJB A;  1JRP A;  1WYG A;  3II4 A;  1KCZ A;  4NNJ A;  1O94 A;  1PBD A;  5KVI A;  1HYU A;  4A6N A;  3B9J B;  2B76 A;  1X31 B;  2UZZ A;  4TLZ A;  1GRA A;  3URH A;  3G5R A;  3CNJ A;  1EC9 A;  1GV4 A;  3PVC A;  2XFQ A;  3AB1 A;  2PS2 A;  3Q6J A;  2DW7 A;  3E1T A;  4H2P A;  2OFJ A;  3IJI A;  3COX A;  2YVF A;  3VR9 A;  5TR3 A;  1IYX A;  3T14 A;  4H4R A;  1H83 A;  1CBO A;  2O56 A;  3IF9 A;  4H2H A;  1ONF A;  3ICT A;  3ISH A;  2WHD A;  2EQ8 A;  2GQW A;  3AWI A;  3HPF A;  4UDR A;  2J3N A;  3GMB A;  2GAH B;  2CDU A;  3RCY A;  1KF6 A;  3UOZ A;  3UTE A;  4BK1 A;  1N61 C;  4YT0 A;  1B5Q A;  1KSS A;  1NEL A;  3H7V A;  2C66 A;  2HXU A;  3VR8 A;  4B63 A;  2WP6 A;  4DXK A;  2C72 A;  4K5R A;  1S2Q A;  3KPK A;  3DDM A;  2XLP A;  5KWF A;  1OJ9 A;  3AN1 A;  1XDI A;  3UP5 A;  4X4J A;  1NHP A;  3R9U A;  4GRT A;  3HRD C;  4UP3 A;  2VVL A;  3UTG A;  4X9M A; 
#chains in the Genus database with same CATH homology
 4H4T A;  5U1O A;  4K8D A;  4H7U A;  3ATR A;  3AEC A;  1VDC A;  1B8S A;  2V6O A;  3ZDN A;  3UOY A;  2YVJ A;  3GMC A;  3VRA A;  1TDN A;  1K0I A;  3SY4 A;  3UCL A;  1Q1W A;  1PN0 A;  1MXT A;  4GUV A;  1H6V A;  4EIP A;  3ICS A;  3K7M X;  4Y4L A;  2C73 A;  3NGC X;  3T2Y A;  4MJW A;  2YM2 A;  4DSG A;  1S7M A;  3SFE A;  5CKU A;  3DK4 A;  4KPR A;  4C74 A;  2R0P A;  5CQF A;  1KSU A;  3FG2 P;  3NH3 X;  3QFA A;  2OA1 A;  2WS3 A;  4TM4 A;  2V5Z A;  4TLX A;  1YY5 A;  2IVD A;  3CNS A;  4FX9 A;  4DSH A;  1PJ6 A;  2BCG G;  2B7S A;  3GYI A;  3NHO X;  3RHA A;  4XWR A;  4Z2T A;  1GPE A;  3FIM B;  2BXS A;  4C5O A;  2WDQ A;  4H2N A;  1ZMD A;  3D1C A;  3CGD A;  3NYC A;  1FL2 A;  2IVE A;  1Y56 A;  1GRG A;  2YG4 A;  3H4K A;  1LQT A;  4CCQ A;  3L8K A;  4H50 A;  3UTH A;  1CJ4 A;  3IC9 A;  4J34 A;  4U8I A;  4EM4 A;  2C76 A;  2GQF A;  4Z2U A;  2C67 A;  2GEW A;  3AEB A;  3NN0 X;  1VG9 A;  4HB9 A;  1M64 A;  5FMH A;  1YKJ A;  4H4U A;  2Q0L A;  4O5Q A;  2JBV A;  4JQ9 A;  2NVK X;  4GDP A;  3B6D A;  5EBK A;  4ZCD A;  1OJC A;  3P1W A;  2XLU A;  2ZZB A;  4B65 A;  3RP8 A;  2R9Z A;  1RP0 A;  2BS2 A;  2FJA A;  1CF3 A;  3SZC A;  3LZW A;  4NEW A;  4DGK A;  3T2Z A;  4IV9 A;  1KN0 A;  2WDR A;  1K0J A;  1PJ7 A;  4EMI A;  4YSZ A;  4OPL A;  3LOV A;  2GR2 A;  1M6I A;  3KLJ A;  1JRX A;  4EQR A;  1PBF A;  1XPQ A;  2GV8 A;  2BXR A;  1NHS A;  2WPC A;  1PBB A;  2PYX A;  1O5W A;  1JRY A;  4H2Q A;  3S61 A;  4J36 A;  3DJJ A;  1JU2 A;  4JN9 A;  1GXF A;  2CUL A;  4H4V A;  3GD3 A;  4LU6 A;  1VG0 A;  1F8W A;  3SZW A;  4LII A;  4Z24 A;  2W0H A;  1F3P A;  3UKA A;  2ZZ0 A;  1DOD A;  4PAB A;  4RG4 A;  3AEF A;  3S5W A;  1LTX R;  5KNL A;  2C70 A;  3CIR A;  3AYJ A;  1E1M A;  1V59 A;  1O95 A;  2VRM A;  3B3R A;  3ICR A;  3WE0 A;  3EAN A;  1GRT A;  1YQ3 A;  3BI2 A;  1EBD A;  3CND A;  4IVM B;  1E7P A;  4ZCC A;  1GER A;  2BC1 A;  5JRB A;  2AR8 A;  2B9Y A;  1REO A;  3CNT A;  1F6M A;  3K30 A;  2JAE A;  2OAM A;  2XLT A;  4G73 A;  2R0G A;  3NN6 X;  3SXI A;  4U2T A;  2R45 A;  3AE1 A;  5JCN A;  4H4X A;  3AE6 A;  1L0V A;  4A99 A;  3CGC A;  2C7G A;  4A65 A;  4REK A;  3CNP A;  3SX6 A;  2E4G A;  4OCG A;  1GRB A;  3UKF A;  4Z25 A;  1OJA A;  4I59 A;  1TYP A;  1CC2 A;  2YLX A;  2X8H A;  1ZOY A;  3NK0 X;  5FS7 A;  3AE2 A;  1FEC A;  1VRQ B;  4Z43 A;  1LV0 A;  4EQX A;  4EQW A;  2C75 A;  3H8L A;  4U8P A;  5IQ1 A;  1ZMC A;  2APG A;  2C3D A;  3AED A;  4CY6 A;  1TDE A;  4K2X A;  1K4Q A;  3SQP A;  1PXA A;  3CPI G;  4YSX A;  2YG7 A;  2V61 A;  3M0O A;  3QSS A;  4G74 A;  4OPC A;  2GR1 A;  2I0Z A;  2BAB A;  1SEZ A;  1TRB A;  1DOE A;  5HYM A;  1N4W A;  5J60 A;  4Z2R A;  4UDP A;  3ZYX A;  5BUK A;  2GF3 A;  2VRL A;  3CN8 A;  2XVI A;  2WU5 A;  4O5U A;  4UDQ A;  2GR3 A;  4D03 A;  4OPG A;  4U8J A;  4HA6 A;  1LJ1 A;  2TMD A;  3C4N A;  4AOS A;  1NG3 A;  4U8K A;  2YLW A;  4TM1 A;  2C64 A;  2YR6 A;  4GCM A;  3G5S A;  2Y6Q A;  2WP5 A;  1E1K A;  2FJE A;  4ECH A;  2R4E A;  4J56 A;  5BRT A;  4RG3 A;  3QSM A;  5EOW A;  5ER0 A;  4H4Z A;  5KMQ A;  4X9M A;  3IWA A;  2BRA A;  1L9E A;  2R0C A;  5KMR A;  1DJN A;  3KD9 A;  3NT6 A;  3HYW A;  1FEA A;  4XWZ A;  4XXG A;  2ARD A;  1LVL A;  1L9C A;  2BA9 A;  2XLR A;  2TPR A;  3BI5 A;  1IUS A;  4JNQ A;  2YR5 A;  3UP4 A;  2JB2 A;  2B7R A;  3T31 A;  4AT0 A;  1CJ3 A;  4USR A;  1ZY8 A;  2ZZC A;  4FDC B;  4JY2 A;  1DXL A;  1CC4 A;  2A89 A;  2O9Z A;  1S3E A;  4EMJ A;  3KU9 A;  5JCI A;  1IUV A;  1ELI A;  1N1P A;  1NPX A;  5KVH A;  1E6E A;  3QVP A;  4WCT A;  4USQ A;  3UOV A;  1KDG A;  1FOH A;  2BAC A;  3KA7 A;  4AT2 A;  1GOS A;  5M0Z A;  4D04 A;  2RGJ A;  4II2 A;  4B68 A;  4K5S A;  4A6N B;  4PAA A;  4J31 A;  3PO7 A;  1ZKQ A;  2WQY A;  4U8O A;  2YAU A;  4M52 A;  3UKQ A;  5IQ4 A;  2GVC A;  1BGN A;  3DGZ A;  1YQ4 A;  4OVI A;  2WOI A;  3I6D A;  1NEN A;  4J33 A;  3CPH G;  1GTH A;  3K7Q X;  3GRS A;  4ICY A;  3DME A;  1H81 A;  2V60 A;  2BK4 A;  4CNJ A;  4NZH A;  4C77 A;  3CTY A;  3CGB A;  2XVH A;  3L5O A;  3GDP A;  2YG6 A;  1XHC A;  4G6G A;  3AYL A;  4YXD A;  1GRE A;  3UKH A;  3RP6 A;  2EQ7 A;  4YSY A;  2QCU A;  2V3A A;  1FCD A;  1Q9I A;  2WU2 A;  2YLZ A;  3GWF A;  1NHQ A;  3HZL A;  3DH9 A;  1PBE A;  3Q9T A;  4WX1 A;  1TDO A;  3T37 A;  3NK2 X;  3LAD A;  3P4S A;  3IHM A;  5KRQ A;  4GAP A;  3AD8 B;  1DNC A;  5U63 A;  1F8S A;  3C4A A;  2Z5X A;  1GSN A;  1PBC A;  3GSI A;  5HXI A;  3D9X A;  4NTE A;  3P4P A;  2VVM A;  3RNM A;  1XAN A;  2DKH A;  2XCG A;  2NPX A;  2F5Z A;  1NG4 A;  2C65 A;  2ZBW A;  3JSK A;  3QFB A;  2XFO A;  5KOW A;  4Y4M A;  3RP7 A;  4BK2 A;  3UKL A;  2BK5 A;  2WES A;  3NK1 X;  4G6H A;  2XVE A;  1ZDL A;  3SZF A;  4CCR A;  4YTN A;  2CVJ A;  1D4D A;  2R4J A;  4IA6 A;  3AE4 A;  3NNE A;  3UKK A;  2WP9 A;  4AP1 A;  2X8G A;  5JCM A;  2WPF A;  1KNP A;  1CHU A;  4EIQ A;  1GT8 A;  4BV6 A;  2WOV A;  1VQW A;  3L1R A;  5IPY A;  2XDO A;  1LQU A;  3NYF A;  4NTC A;  1TYT A;  4E0V A;  3IHG A;  3UKP A;  5LV9 A;  3NIX A;  4A5L A;  3DGH A;  3EAO A;  1CC6 A;  2WOW A;  4YTP A;  3AD9 B;  4J2W A;  3BHF A;  1QJD A;  2GH5 A;  3PS9 A;  2FJD A;  1MOK A;  3FBS A;  4YSH A;  4NEV A;  1ZK7 A;  3T2K A;  2JB1 A;  2BS3 A;  5HY5 A;  3AEE A;  1EL8 A;  5M10 A;  1D7Y A;  5FS6 A;  2OLN A;  1GAL A;  3BNM A;  1UKV G;  2YR4 A;  3LJP A;  2DKI A;  3M13 A;  4NWZ A;  4YTM A;  1CL0 A;  2BCP A;  5GSN A;  3VRD B;  4A9W A;  5L46 A;  4C3Y A;  1ZOV A;  1ZX9 A;  5C3J A;  1LPF A;  1D4C A;  4GDE A;  2RAB A;  4U2S A;  5FS8 A;  1H7X A;  3AD7 B;  1IUU A;  1IUX A;  1NEK A;  1P2E A;  2XFN A;  2Z5Y A;  2AQJ A;  2H88 A;  3I3L A;  1D4E A;  2XLS A;  3KPF A;  1COY A;  2QA2 A;  3C96 A;  4U8M A;  1RSG A;  3AE3 A;  5C2T A;  2YVG A;  3NLC A;  2Q0K A;  3DJD A;  1B37 A;  2XYO A;  2YLR A;  3KVE A;  3LZX A;  4DNA A;  4H2R A;  1E39 A;  1D7L A;  1F8R A;  4U8N A;  4U8L A;  2RGO A;  3ALJ A;  1Y0P A;  1RYI A;  4ADW A;  4A79 A;  4I58 A;  2VQ7 A;  2XVJ A;  4B1B A;  1IUT A;  1DOB A;  2YLT A;  4GF7 A;  3KKJ A;  1IUW A;  2WDV A;  5GRT A;  4J57 A;  4TM3 A;  3UTF A;  2HQM A;  1QO8 A;  2QA1 A;  3DK9 A;  3NKS A;  3SYI A;  4B66 A;  4BJZ A;  2VOU A;  2V3B A;  3RED A;  4GAV A;  5BUL A;  2X99 A;  2GB0 A;  5JCK A;  1ZP0 A;  2B9X A;  2IID A;  1Q1R A;  3ABV A;  3F8R A;  4IA5 A;  1GRF A;  3LB8 A;  4P9S A;  4APN A;  2VQB A;  2XFP A;  1DOC A;  1H82 A;  1W4X A;  4FK1 A;  1D5T A;  3ALM A;  1TDF A;  2XFU A;  3BI4 A;  3V3N A;  3AE5 A;  4CBQ A;  3CPJ G;  2WEU A;  1KNR A;  4N9X A;  4YKF A;  4C3X A;  3BNU A;  1KFY A;  1NHR A;  3NYE A;  4ZN0 A;  1JEH A;  3AE7 A;  1BGJ A;  2VVL G;  4YWO A;  2GMJ A;  1P2H A;  2Y6R A;  3QVR A;  3HYX A;  3LXD A;  1PHH A;  3T0K A;  3GYJ A;  3AE9 A;  4U2L A;  2OAL A;  1JNR A;  3UOX A;  5EB5 A;  1E1L A;  3OC4 A;  1TDK A;  3P4Q A;  3SZ0 A;  4IVO B;  1GES A;  2GR0 A;  2XVF A;  4RSL A;  2C4C A;  2FJB A;  3AEG A;  4GR1 A;  3II4 A;  4BJY A;  2BS4 A;  3NTA A;  4CY8 A;  1CJ2 A;  4EQS A;  1PS9 A;  2Q7V A;  1Y56 B;  4NNJ A;  1O94 A;  1PBD A;  4JDR A;  5KVI A;  1HYU A;  3EPT A;  4G9K A;  4A6N A;  2BRY A;  1S2Y A;  2B76 A;  1PXB A;  3NG7 X;  3NRN A;  1OJD A;  4Y4N A;  4EMW A;  1S3B A;  1GET A;  1N4U A;  4II3 A;  1X31 B;  4NTD A;  3VQR A;  4H4W A;  1H7W A;  1Z6L A;  1EL9 A;  2B9W A;  3DK8 A;  2GAG B;  2UZZ A;  1QLB A;  4TLZ A;  3AXB A;  4A7A A;  1GRA A;  1OJT A;  3URH A;  1BF3 A;  3EF6 A;  3G5R A;  2E5V A;  3OZ2 A;  3ALL A;  3CNJ A;  3DA1 A;  1GV4 A;  4H4S A;  3QJ4 A;  1H86 A;  3PG6 A;  4B67 A;  1CJC A;  3PVC A;  4KX6 A;  2WET A;  2XFQ A;  2BK3 A;  1B4V A;  4H4P A;  2A87 A;  3AB1 A;  3H8I A;  3Q6J A;  3SM8 A;  2EQ6 A;  1FEB A;  3ITJ A;  3D8X A;  3SGL A;  1L9D A;  2Q6U A;  3E1T A;  3P9U A;  1EL7 A;  3FMW A;  4JNA A;  3SFD A;  3AYI A;  1JRZ A;  4H2P A;  4OPT A;  1GRH A;  2VZ2 A;  3COX A;  2CFY A;  2GMH A;  2YWL A;  3V3O A;  4K7Z A;  1E1N A;  3F8D A;  2YVF A;  3VR9 A;  1BWC A;  5TR3 A;  1H84 A;  5HHF A;  2BC0 A;  2JB3 A;  3T14 A;  3P4R A;  4H4R A;  1H83 A;  4CRT A;  5DBJ A;  2JKC A;  5KMP A;  1CBO A;  3IF9 A;  3QSE A;  2X8C A;  2GRT A;  4LA1 A;  2E1M A;  1PDH A;  2PHH A;  4K22 A;  2YLS A;  3AE8 A;  1ONF A;  4H4Q A;  3ICT A;  2YM1 A;  3GWD A;  4B64 A;  3ISH A;  4FK1 C;  2YG3 A;  2JK6 A;  1BKW A;  2WHD A;  2EQ8 A;  3ADA B;  4H4Y A;  4TM0 A;  2GQW A;  5J7X A;  1H2I A;  3VRB A;  1GND A;  1AOG A;  2EQ9 A;  5KOX A;  3AWI A;  1YQZ A;  4JY3 A;  2C3C A;  3GDN A;  2RGH A;  3M12 A;  3NTD A;  4OPU A;  5EB4 A;  2WPE A;  4UDR A;  2J3N A;  3GMB A;  2GAH B;  2CDU A;  4AOX A;  3DJG X;  3O0H A;  5KXJ A;  2R46 A;  1KF6 A;  3BHK A;  3UOZ A;  3UTE A;  2ACZ A;  4BK1 A;  4YT0 A;  2OLO A;  5U25 A;  2A8X A;  1B5Q A;  3GD4 A;  2FBW A;  1KSS A;  1IJH A;  2BYB A;  2YG5 A;  2AAQ A;  2C66 A;  4X9N A;  4BK3 A;  2QAE A;  4Z44 A;  5BVA A;  3VR8 A;  3FPZ A;  4B63 A;  1EL5 A;  3ATQ A;  2WP6 A;  4Z26 A;  5JCL A;  4OPI A;  1PJ5 A;  2C72 A;  4K5R A;  1GEU A;  1MO9 A;  4BUR A;  1S2Q A;  2X50 A;  3KPK A;  1BZL A;  3F8P A;  2XLP A;  4YKG A;  5KWF A;  1OJ9 A;  2H89 A;  2X3N A;  4AP3 A;  3K7T A;  1XDI A;  1N4V A;  1JOA A;  5FS9 A;  1JNZ A;  3DJE A;  4X4J A;  3UP5 A;  1NDA A;  5KMS A;  2WBA A;  3CGE A;  1GTE A;  1DJQ A;  2YQU A;  3G5Q A;  4OPD A;  1NHP A;  1NAA A;  4EM3 A;  1K0L A;  4B69 A;  3R9U A;  4GRT A;  1PXC A;  3HYV A;  3CMM A;  4UP3 A;  2VVL A;  3AEA A;  4CNK A;  3UTG A;  3GYX A;  3V76 A;  3GRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...