1NPXA

Structure of nadh peroxidase from streptococcus faecalis 10c1 refined at 2.16 angstroms resolution
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NADH peroxidase from Streptococcus faecalis 10C1 refined at 2.16 A resolution.
pubmed rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase(h2o2(a))
molecule keywords NADH PEROXIDASE
total genus 140
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1991-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1npxA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1npxA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1npxA02
4J31A 3ALJA 1COYA 2Z5YA 3UKQA 1K0IA 3ISHA 2CVJA 5JCMA 5FS7A 1W4XA 2R4JA 1Q9IA 5U63A 4Z2TA 4H2NA 4IV9A 1P2EA 1L9EA 4X9MA 4A6NA 5C2TA 3UKPA 5EB4A 1RP0A 1ZMCA 3K7QX 2XVIA 2YLZA 3UCLA 1IUWA 1CL0A 1S2QA 4H4VA 2YLRA 3ADAB 1GRFA 2TPRA 4H2QA 3RP8A 1GRGA 3L8KA 3E1TA 4XXGA 4OPGA 2BABA 3SFDA 3UP4A 5JCKA 1F8RA 1KFYA 1QO8A 4BK3A 1L9DA 5KVHA 5KXJA 3KVEA 3BI5A 4B68A 2WOVA 3AB1A 4EQRA 5GSNA 3G5SA 2ARDA 4UP3A 2F5ZA 1KNRA 4H4SA 3GD3A 3DK4A 3IHMA 4E0VA 3VRBA 1TDNA 3GDNA 2BA9A 5L46A 1GRTA 1OJ9A 3CNDA 4K22A 3IWAA 2J3NA 5JCLA 3AE6A 4CY6A 2AR8A 2IIDA 4FDCB 4YSXA 4BK2A 4JQ9A 3DGZA 1D5TA 3VQRA 3ICRA 1Q1WA 4GCMA 3P4SA 1KF6A 4AP3A 1CJ3A 2A87A 3CGBA 2WDQA 3NNEA 4H4ZA 2WEUA 2E1MA 1N4UA 3CPHG 2ACZA 2DKHA 4EQSA 4U2SA 2WU5A 1NHRA 2GV8A 3FIMB 3NTDA 2WQYA 1GEUA 4YSHA 2GRTA 2YLSA 1DNCA 4CCQA 5IPYA 1PDHA 3II4A 1M6IA 3SM8A 1O5WA 3EF6A 4EQWA 2OA1A 1Y56B 4UDQA 2IVDA 2XYOA 2WOWA 5EB5A 3KD9A 2EQ7A 2OLOA 2XFPA 3CIRA 3NIXA 1ZDLA 1TDEA 3BI4A 4Y4LA 1Q1RA 3NK2X 3IF9A 2XVHA 3AE2A 1VDCA 4EMJA 4YTNA 2FJEA 2C3DA 1ONFA 4CNKA 2XLSA 3ABVA 4U8PA 4A7AA 4NZHA 1JEHA 4UDPA 1KSSA 1L0VA 5GRTA 1LTXR 4EIQA 3LXDA 1NG4A 2WS3A 4OPTA 1D4EA 1ZKQA 2VRLA 5BVAA 3Q9TA 3CN8A 4BK1A 3REDA 4H4WA 4YSYA 3UOXA 4J57A 2QAEA 2WPCA 3GD4A 3AEGA 1IUSA 2EQ6A 1B4VA 3M13A 4U8KA 4YTMA 1XDIA 3LB8A 4TM3A 3AEBA 1KNPA 3UKAA 4JNQA 2E4GA 2JB2A 2YR5A 4DSGA 4N9XA 2X3NA 4Z25A 5M10A 1VG0A 2JB1A 1LJ1A 4IA6A 4EM4A 2GF3A 3BI2A 1DXLA 2R0CA 2IVEA 2WP6A 5KOXA 5KVIA 1GRHA 3GMCA 1UKVG 2B7RA 4OPDA 2BC1A 2GR0A 2B9XA 3DA1A 1OJCA 1P2HA 2XVJA 1LQTA 3UOVA 4C3XA 1D7YA 2C75A 1PN0A 2C64A 2GEWA 2VVMA 2WDRA 5HHFA 1FOHA 1LV0A 3NK1X 1PJ7A 3G5RA 1ZX9A 3GWFA 1E1LA 2B9WA 1YQ4A 2X8CA 1RYIA 1H86A 2YLXA 4K5SA 4CBQA 3ATQA 3M12A 4J34A 1NHQA 1TDFA 4OVIA 3PO7A 2C73A 5CQFA 5HY5A 1GOSA 2FJBA 4Z43A 4EQXA 3NYEA 1PBDA 2ZBWA 1YKJA 3BNMA 3QJ4A 4B63A 1FL2A 1Y56A 4EM3A 2JAEA 2V61A 2ZZCA 2I0ZA 3RP7A 1E39A 2JBVA 4HA6A 2TMDA 1IUVA 4K2XA 2RGOA 4U2TA 4B66A 4P9SA 3AE7A 1ZP0A 4RG4A 5CKUA 1NEKA 1NG3A 2GAHB 1B5QA 1E1KA 2OALA 4RG3A 1KSUA 4YKGA 4GUVA 3KLJA 3K7TA 4AP1A 3NHOX 1QLBA 2B76A 4D04A 1CF3A 3AE5A 3LZXA 1XPQA 5U25A 3DJEA 3KKJA 4DGKA 3DJGX 2R46A 2OAMA 4AOSA 4B65A 2VVLG 1MOKA 4C3YA 4CCRA 4JY2A 1PXBA 4ZN0A 3LJPA 5FS9A 2V6OA 4NTEA 2V3AA 2R4EA 2APGA 3CGDA 3C96A 3NKSA 3RP6A 2A8XA 2FBWA 2GB0A 2VRMA 2GR1A 1DOCA 1MXTA 3AD8B 1F3PA 5FS8A 3UKHA 3FPZA 1GNDA 3AYIA 4A79A 2CDUA 3AEAA 1E1NA 1M64A 2YR4A 4NEVA 2Q6UA 1N4WA 2YAUA 3CNSA 2W0HA 4H7UA 1YQZA 2WU2A 4XWRA 3PS9A 3IHGA 1H83A 4JDRA 1EL7A 3AE8A 5M0ZA 4H2PA 5JCIA 1PBBA 1TRBA 2YWLA 3AE9A 3FMWA 3QSEA 2BACA 3V3OA 4FX9A 4JY3A 4K8DA 1S3EA 2YG4A 1LQUA 5EOWA 4HB9A 4A6NB 4Z26A 5U1OA 3KA7A 1F8WA 4IA5A 1JNZA 1ELIA 1GESA 3RNMA 3CPIG 3DJDA 3LOVA 2H88A 4H4TA 5FMHA 4A99A 1BZLA 1O94A 2C70A 1PXCA 4NTCA 4H2RA 3D1CA 2C65A 4GRTA 3AEDA 3UP5A 3O0HA 1Z6LA 3OC4A 2Q0LA 3NTAA 2V3BA 1NHSA 2BS4A 2E5VA 2WESA 3NH3X 1GTHA 2WP9A 4H50A 4APNA 1JNRA 5DBJA 1B8SA 3CGEA 4NEWA 2YLWA 3AXBA 2XVFA 2XFUA 1LVLA 4H4UA 1FEBA 4I58A 3SFEA 5IQ4A 3HZLA 4GR1A 5LV9A 3UKKA 4KX6A 5ER0A 4YXDA 1PBCA 1REOA 2Q0KA 2GMHA 4BV6A 1GTEA 1ZOYA 2DKIA 2YM1A 1CHUA 3P9UA 1AOGA 3NT6A 1PXAA 4U8JA 2AAQA 2XVEA 4LIIA 2C7GA 5J7XA 1K0LA 1XHCA 2YVGA 3LZWA 1TDOA 1O95A 2C66A 2YVJA 4U2LA 4WCTA 1PBEA 3G5QA 2WOIA 2WPEA 1GETA 3EANA 5BUKA 1VG9A 3F8DA 3CNJA 1ZY8A 2R0PA 3ALMA 2X8HA 2WHDA 1GREA 1JRXA 3DMEA 1ZOVA 3GYIA 4PABA 3QFBA 4TM0A 4C77A 1IUXA 3L1RA 1CC6A 3AD9B 1CC2A 1TYTA 1GRAA 2YVFA 3SQPA 1BF3A 2BYBA 1VQWA 1KDGA 4B67A 3WE0A 1H81A 3FBSA 4A9WA 1F8SA 2JKCA 3AYLA 1SEZA 1VRQB 4YTPA 3KPFA 4B64A 3NYFA 3IC9A 2VVLA 1XANA 1PHHA 1DJQA 3NLCA 5C3JA 1E1MA 4EMWA 2Q7VA 2YLTA 4A65A 4IVMB 3S61A 1GRBA 2WP5A 1H84A 4C74A 1D4DA 4NTDA 3H4KA 4USRA 1FEAA 2XLRA 3LADA 1NENA 2EQ9A 5IQ1A 2GR3A 3AEFA 1EL8A 3VR9A 2ZZBA 4H4QA 4IVOB 1X31B 4BJYA 3ALLA 4AT0A 4X9NA 3BNUA 4LU6A 2C3CA 5TR3A 1EBDA 1CJCA 1PJ5A 4M52A 1Y0PA 4U8OA 3AECA 3UTEA 4A5LA 3GRSA 1JU2A 2RGJA 2WETA 1FCDA 1GALA 3AE4A 4LA1A 4J33A 2VQ7A 2YG5A 3EPTA 4BURA 4H4YA 2Y6QA 4B69A 4Z24A 3AEEA 1E6EA 2QA1A 3CNTA 2BS3A 2X50A 4J36A 1K4QA 1S3BA 2XFNA 4YSZA 1OJAA 1NAAA 4K7ZA 3CNPA 1IUUA 2WBAA 3CGCA 5FS6A 1YY5A 2A89A 1DODA 3DH9A 2FJAA 2R45A 2Y6RA 3K7MX 3NRNA 4GF7A 3ZYXA 2CULA 2R0GA 4PAAA 4WX1A 2VOUA 4J2WA 4K5RA 3B6DA 3UOYA 4CY8A 5KOWA 3P4PA 3NK0X 2C76A 2R9ZA 2RABA 1V59A 2BC0A 3ICSA 4OPCA 4BJZA 1YQ3A 1ZK7A 3D8XA 3QVPA 2BCGG 1H82A 5BULA 1QJDA 3AWIA 4C5OA 2Z5XA 1L9CA 3M0OA 1IJHA 3Q6JA 1H7WA 3ZDNA 4J56A 2X8GA 3DK9A 4CNJA 4ICYA 1CJ2A 2BXRA 5J60A 4U8IA 4Y4MA 2X99A 1PBFA 2QA2A 3ICTA 1JRYA 1GXFA 3F8RA 3VRDB 2UZZA 3UTHA 4OPUA 2YG7A 1MO9A 3NN0X 2XCGA 4D03A 1BGNA 3ITJA 4TLXA 1CC4A 2PYXA 4H4PA 4CRTA 1TYPA 1BGJA 2HQMA 3C4NA 3DGHA 1DOEA 3DK8A 2B7SA 2GAGB 3QFAA 3K30A 4ECHA 2RGHA 1H6VA 3NN6X 4Z44A 3B3RA 1NDAA 4B1BA 3T37A 3AD7B 1OJDA 1LPFA 4USQA 4U8MA 3UKLA 4DSHA 2BXSA 4TLZA 1DOBA 2V60A 3I3LA 4YT0A 3GRTA 2VZ2A 2GQFA 1ZMDA 3GSIA 2OLNA 1BWCA 3BHKA 1D7LA 2FJDA 1CBOA 1FECA 1GSNA 3NYCA 1N1PA 1GERA 2V5ZA 3F8PA 2JK6A 3ATRA 4DNAA 3H8LA 4GDPA 3UTFA 3V76A 5HYMA 2PHHA 3VR8A 1OJTA 4I59A 4OPIA 4TM1A 2WDVA 2XLPA 3C4AA 2BCPA 1E7PA 4ZCCA 5HXIA 2O9ZA 3FG2P 3UKFA 1EL9A 4JN9A 3H8IA 2GR2A 3R9UA 3CPJG 1N4VA 1F6MA 2NPXA 3URHA 4JNAA 1K0JA 4AOXA 2BK5A 2C67A 2JB3A 1H7XA 4FK1C 3SGLA 3PVCA 2YM2A 2YG6A 2YR6A 5KRQA 3AE3A 4YKFA 1S2YA 4H4RA 1CJ4A 1JOAA 4ADWA 2CFYA 3GYJA 4REKA 2XDOA 5EBKA 4MJWA 3P1WA 3QVRA 1GT8A 4FK1A 4O5QA 2B9YA 1GPEA 3AE1A 3GMBA 4TM4A 3KU9A 1NHPA 5KWFA 2GVCA 4YWOA 4EIPA 1NPXA 3I6DA 3P4QA 3P4RA 4X4JA 2YG3A 2YQUA 3AYJA 4GDEA 2GMJA 4KPRA 2H89A 1EL5A 1D4CA 3QSMA 1HYUA 3UOZA 1PS9A 4RSLA 4U8NA 1B37A 1JRZA 2XLUA 3RHAA 2XLTA 4OPLA 2VQBA 2GQWA 3QSSA 2BK3A 2AQJA 3GWDA 3OZ2A 2NVKX 2WPFA 1RSGA 3CTYA 2GH5A 3V3NA 1BKWA 5JCNA 4Y4NA 4ZCDA 4Z2RA 2ZZ0A 1TDKA 1IUTA 4Z2UA 3GDPA 4EMIA 3EAOA 3BHFA 4O5UA 4OCGA 4XWZA 2BK4A 3S5WA 2C72A 3UTGA 5BRTA 4AT2A 3DJJA 2QCUA 4H4XA 4UDRA 2BS2A 1DJNA 3VRAA 2XFOA 3COXA 3NGCX 1PJ6A 2EQ8A 3JSKA 1GV4A 4U8LA 2XFQA 3NG7X
chains in the Genus database with same CATH superfamily
4J31A 1COYA 3ISHA 2CVJA 1W4XA 1Q9IA 4Z2TA 3T2YA 2W3SA 5EB4A 1RP0A 1CL0A 4XXGA 3SFDA 1EC8A 1QO8A 3V5CA 3BI5A 3AB1A 5BOEA 4EQRA 2PMQA 2F5ZA 3IHMA 3GD3A 2BA9A 4CY6A 2IIDA 4FDCB 4BK2A 4JQ9A 1Q1WA 3HW2A 3A7RA 2WDQA 4EQSA 4U2SA 1NHRA 4IL2A 2WQYA 4NNJA 5IPYA 1PDHA 2W3RA 2EQ7A 2OLOA 2XFPA 3CIRA 1TDEA 3NK2X 3IF9A 2FJEA 4CNKA 4A7AA 1JEHA 4UDPA 1KSSA 1L0VA 3UJFA 1LTXR 4EIQA 1NELA 1NG4A 3REDA 3NS1B 1IUSA 4YTMA 1XDIA 3AEBA 1KNPA 2E4GA 4N9XA 5M10A 2JB1A 4EM4A 3A7UA 2GR0A 3DA1A 5JRBA 2XVJA 2C75A 2C64A 3CXOA 5HHFA 1FOHA 2QDDA 3G5RA 1KKOA 4M6UA 2X8CA 1H86A 4K5SA 3ATQA 4J34A 2OFJA 4HNLA 3OZMA 1NHQA 3GD6A 1TDFA 3PO7A 2C73A 1GOSA 4Z43A 2W54A 1E39A 2JBVA 3ES7A 4H19A 4U2TA 1MDLA 4B66A 3R10A 1WUEA 4GYPA 5CKUA 2C4CA 1NEKA 1NG3A 4RG3A 3K7TA 1QLBA 2B76A 3AE5A 4IHCA 3SN0A 1XPQA 4ZCWA 3U4FA 2RDXA 2GGJA 4C3YA 2BRAA 3LJPA 4ZOHB 5FS9A 2V3AA 3CGDA 3C96A 2A8XA 3PK7A 1MXTA 5G5GB 4EWJA 1GNDA 3AYIA 4A79A 3OPSA 1W6TA 3SX6A 1H83A 4H2PA 1JDFA 5JCIA 2BACA 3AMZA 4Z26A 5U1OA 3KA7A 1TKKA 3RNMA 3CPIG 2PU1A 4IL0A 2H88A 2OPJA 5FMHA 4A99A 1BZLA 3CXBA 3ZVHB 3D1CA 4GRTA 3AEDA 3IJIA 3VCNA 4MKSA 1NHSA 3NH3X 1GTHA 2GGEA 2PTXA 5FJUA 1B8SA 2XVFA 3SBFA 1PDYA 1FEBA 3UKKA 4J3ZA 3QLDA 4GIRA 1SJDA 4M0XA 2YM1A 1EBGA 4LIIA 2C7GA 1PBEA 1VG9A 3F8DA 2R0PA 4B65A 2X8HA 2WHDA 1JRXA 1ZOVA 1CC2A 3SQPA 2YVFA 1KDGA 3FBSA 4A9WA 1EBHA 3UJSA 1SEZA 4B64A 3NYFA 3IC9A 3ES8A 2VVLA 5C3JA 2Q7VA 4GGBA 4A65A 2WP5A 1H84A 3S5SA 2XLRA 3LADA 3CAWA 1NENA 2GR3A 1JCTA 5FJOA 3T31A 3BNUA 4GMEA 3UTEA 5TR3A 3S47A 4U8OA 3GRSA 1JU2A 2P88A 2WETA 2QJMA 4HCHA 4J33A 4H4YA 2OZ3A 3GY1A 2BS3A 2X50A 2XFNA 1OJAA 3SXIA 4H83A 5BOFA 3CGCA 2Y6RA 4GF7A 2R45A 3DIPA 3NRNA 3ZYXA 4PAAA 2VOUA 4J2WA 3B6DA 2R9ZA 2BC0A 1YQ3A 3AWIA 3ZDNA 4J56A 4ICYA 3CYJA 4Y4MA 1JRYA 2OQYA 3NN0X 1CC4A 1TE6A 4DX3A 3D47A 2RGHA 3T2KA 1OJDA 4USQA 4U8MA 3I3LA 4YT0A 2OQHA 3GSIA 1BWCA 1CBOA 3UXKA 1FECA 1VDVA 3H8LA 2JK6A 3UTFA 1E7PA 2OZTA 4TVYA 3FV9A 1H7XA 3FXGA 3N4FA 3AE3A 1YEYA 4ADWA 5EBKA 4MJWA 1GT8A 3AE1A 3GMBA 3KU9A 3SYIA 3D46A 1NPXA 2E3TA 2H89A 1EL5A 3UOZA 1JRZA 2VQBA 2BK3A 2AQJA 3MKCA 4E6MA 4ZCDA 3SY4A 2ZZ0A 1TDKA 2XH4A 4O5UA 4OCGA 4G7FA 4AT2A 4UDRA 3HYXA 3PG6A 1PJ6A 1JPDX 1F9CA 3ALJA 3UKQA 1K0IA 5JCMA 2AKZA 1P2EA 4X9MA 5C2TA 3UKPA 3PWGA 3K7QX 4MGGA 1S2QA 4H4VA 3ADAB 1KD0A 2TPRA 3RP8A 3H70A 4OPGA 5JCKA 3VCCA 3KVEA 4A35A 3G5SA 3NVWB 3DK4A 1MDRA 3GDNA 5L46A 3AN1A 1JPMA 3UCCA 3IWAA 3H7VA 1D5TA 4GCMA 3RITA 4AP3A 4H4ZA 2ACZA 2P8BA 4YSHA 2OZ8A 1N62C 4II3A 1DNCA 4CCQA 3II4A 1M6IA 1O5WA 4EQWA 2OA1A 2WOWA 1V97A 1ZDLA 3BI4A 1Q1RA 3ZVHA 3R1ZA 4YTNA 2XLSA 3ABVA 4U8PA 3MUCA 1FFVC 3THUA 5BVAA 2XH2A 4YSYA 3UOXA 2WPCA 5KXJA 2EQ6A 3M13A 4TM3A 3JW7A 2YR5A 2CHRA 1WYGA 4IA6A 1MNSA 3BI2A 2PU0A 3GMCA 2B7RA 2B9XA 1OJCA 2WDRA 2DW6A 2W55A 3DEQA 3Q4DA 3ETRB 1ZX9A 3TQPA 3HRDC 2YLXA 3M12A 3IJLA 4G6HA 5HY5A 4EQXA 3NYEA 1PBDA 2ZBWA 1YKJA 1FL2A 2JAEA 2V61A 2I0ZA 3RP7A 2P3ZA 4RG4A 2PP3A 3NHOX 3LZXA 5U25A 3KKJA 4DGKA 2AL2A 1FHVA 2V6OA 4NTEA 2R4EA 4JN8A 4G9KA 4E4UA 1N5XA 2GR1A 1DOCA 2GGIA 4Z17A 1E1NA 2GSHA 2Q6UA 1ZXIC 3NO1A 2W0HA 4XWRA 3IHGA 4JDRA 3FMWA 3V3OA 2AKMA 5KMPA 1P43A 4K8DA 1S3EA 2YG4A 4HB9A 1JNZA 2QVHA 3DJDA 3UP5A 1Z6LA 4FI4A 3FJ4A 3OC4A 2WP9A 4H50A 4APNA 3CT2A 4K8GA 5DBJA 4ROPA 2ZADA 3AXBA 3NXLA 4DHGA 3IJQA 5IQ4A 5LV9A 4GR1A 1RVKA 3U9IA 2GMHA 2DKIA 4A6GA 3P9UA 1AOGA 2AAQA 5FJTA 5J7XA 3T8QA 2C66A 2WOIA 2WPEA 3P3BA 1N5WC 1ZY8A 3ALMA 3GYIA 3CK5A 3L1RA 1CC6A 3R0KA 2PTZA 1TYTA 1T3QC 3OP2A 2PPGA 2QJNA 4B67A 3WE0A 1F8SA 2JKCA 4GFIA 3KPFA 1DJQA 3HPFA 1E1MA 2GGGA 3FVDA 4C74A 3H4KA 2EQ9A 2ZZBA 4DWDA 1X31B 3ALLA 2AL1A 4AT0A 4X9NA 2C3CA 2PTWA 1EBDA 4GISA 1CJCA 1PJ5A 7ENLA 5IDZA 3T0KA 1GALA 3AE4A 2YG5A 4B69A 3AEEA 2PP1A 1K4QA 1S3BA 1FHUA 1ONEA 3K1GA 1IUUA 3K7MX 1KKRA 3QKEA 3ZVIA 2A89A 3DH9A 4K5RA 3UOYA 3P4PA 2RABA 1V59A 4E5TA 1KN0A 4OPCA 1ZK7A 1QJDA 5J60A 2X99A 1PBFA 2QA2A 3V4BA 3UTHA 3ZLHA 3ENLA 2XCGA 4D03A 1BGNA 4TLXA 1BGJA 3C4NA 3DGHA 3DK8A 3V5FA 1NDAA 3T37A 3AD7B 3UKLA 1DOBA 2E5AA 2VZ2A 2GQFA 1ZMDA 5ENLA 3T9PA 1D7LA 2FJDA 1S7MA 3NYCA 1N1PA 1GERA 2V5ZA 4DNAA 3SZCA 3VR8A 5HXIA 4IZGA 3SZ0A 4G74A 2O9ZA 3FG2P 3PFRA 4JN9A 1PDZA 3CPJG 1N4VA 1F6MA 4JNAA 4FK1C 2C67A 2HNEA 3PVCA 2YM2A 4E4FA 4IP4A 3RCYA 4YKFA 3SSZA 1CJ4A 2GL5A 1KCZA 3QN3A 1NHPA 4YWOA 2QJJA 1D4CA 3QSMA 1HYUA 1ECQA 2GQWA 2WPFA 2PP0A 4YWSA 3V3NA 1IUTA 3BHFA 2BK4A 5BRTA 2C72A 2QCUA 4H4XA 2BS2A 3COXA 4GAVA 2EQ8A 3JSKA 4K1WA 2R4JA 4H2NA 4IV9A 1L9EA 4J1OA 3RRAA 1ZMCA 2XGZA 2ONEA 2XVIA 2YLZA 1IUWA 5KMSA 4H2QA 3E1TA 2BABA 3UP4A 1F8RA 1KFYA 3MZNA 2XH7A 4BK3A 3T14A 3SR6B 2WOVA 4H4SA 4E0VA 3VRBA 1TDNA 3OW1A 1GRTA 1OJ9A 3AE6A 1R6WA 2AL2B 3VQRA 3ICRA 4K2SA 3BOXA 1CJ3A 2A87A 3CPHG 2E1MA 1N4UA 2DKHA 6ENLA 2WU5A 3FIMB 2GRTA 2YLSA 3SM8A 3EF6A 1Y56B 4UDQA 2IVDA 2XYOA 3NIXA 3SZFA 3UJEA 2PSNA 1VDCA 4EMJA 2C3DA 3T2ZA 1ONFA 4H1ZA 1XPYA 3DG7A 3LXDA 3NVZB 1SJCA 2WS3A 4OPTA 3STPA 1EC9A 3I6TA 1N61C 4BK1A 5KMQA 3TJIA 4U8KA 3GYXA 3LB8A 3NVYB 4JNQA 1VG0A 1LJ1A 1DXLA 3R07C 2R0CA 2IVEA 2WP6A 1GRHA 4OPDA 2BC1A 2FYMA 1P2HA 4NWZA 4C3XA 2GEWA 2VVMA 3NK1X 3GWFA 1YQ4A 1RYIA 4A3RA 4OVIA 5CQFA 4E8GA 3BNMA 1Y56A 2ZZCA 1IUVA 2RGOA 4P9SA 2GAHB 1B5QA 2OALA 4YKGA 4GUVA 3KLJA 4AP1A 4D04A 3DJEA 4GYPC 3KUMA 3DJGX 3RO6A 2OAMA 4AOSA 2VVLG 3V3WA 4JY2A 4ZN0A 3NKSA 2FBWA 2GB0A 2VRMA 3TW9A 3DESA 3AEAA 1M64A 4NEVA 4X2PA 1N4WA 3CNSA 2WU2A 3H12A 1EL7A 3AE8A 1TRBA 2YWLA 3FCPA 3MWCA 2P0IA 1IYXA 2POZA 3BJSA 4IA5A 1GESA 3LOVA 1RM6B 4NTCA 1O94A 2C70A 1H2IA 3BSMA 2C65A 3ZLGA 1SJBA 3O0HA 2Q0LA 5G5HB 2O56A 2WESA 3RR1A 2GDQA 2YLWA 2XFUA 1OEPA 3DFYA 4I58A 3SFEA 1E9IA 4KX6A 1MUCA 4YXDA 3R25A 1GTEA 1CHUA 3ZLFA 4HCLA 3VDGA 1PXAA 2XVEA 4U8JA 2OVLA 4Z1YA 1K0LA 3QTPA 1XHCA 2YVGA 1TDOA 1O95A 2YVJA 3MY9A 5FJRA 1GETA 3CNJA 4IT1A 4C77A 3EUB3 4DXKA 1IUXA 4IP5A 3AD9B 2HXUA 1GRAA 2BYBA 1VQWA 1H81A 3AYLA 1VRQB 4YTPA 1XANA 1MRAA 4IVMB 1GRBA 5IQ1A 3AEFA 1EL8A 4H4QA 4IVOB 3I6EA 4BJYA 4LU6A 3NVVB 3AECA 4A5LA 2ZC8A 2RGJA 4DN1A 3GC2A 4LA1A 4ZA0A 2VQ7A 3EPTA 4BURA 2Y6QA 4Z24A 1E6EA 2QA1A 3CNTA 4HN8A 4J36A 4YSZA 2OLAA 3T6CA 1NAAA 3CNPA 4G6GA 2WBAA 3R11A 2R0GA 4WX1A 3NK0X 2C76A 4HYRA 3QVPA 2PODA 2BCGG 1H82A 3JVAA 5BULA 1FIQB 4C5OA 3Q45A 3P0WA 2Z5XA 3D9XA 3M0OA 1H7WA 4CNJA 2OG9A 1GXFA 3SZWA 2UZZA 4DYEA 4OPUA 3ITJA 3N4EA 4H4PA 4CRTA 1TYPA 5KNLA 3K30A 1DOEA 2QQ6A 3QFAA 3RGTA 4G73A 3NN6X 4Z44A 3DERA 3B3RA 4B1BA 1LPFA 2MNRA 4TLZA 2V60A 1XS2A 3PWIA 3CMMA 3BHKA 3ATRA 5HYMA 2PHHA 1X2GA 4TM1A 2BCPA 3SN1A 2FKPA 3UKFA 1EL9A 3NRZB 2GR2A 3MQTA 2NPXA 3URHA 1DTNA 1K0JA 2BK5A 3SGLA 2YG6A 2YR6A 1FO4A 2CFYA 3GYJA 4REKA 2XDOA 4O5QA 2B9YA 4HNCA 1GPEA 4TM4A 2YG3A 3AYJA 4KPRA 1PS9A 3I4KA 4U8NA 1B37A 2XLUA 3RHAA 2XLTA 4OPLA 3QSSA 3OZ2A 3GWDA 3UGVA 1SJAA 3CTYA 1FFUC 2GH5A 1BKWA 4KPLA 4Y4NA 4Z2RA 3OTRA 4Z2UA 3GDPA 4EMIA 3EAOA 4XWZA 1JRPA 1N63C 1DJNA 3VRAA 5FJPA 3NGCX 1GV4A 3SQSA 2Z5YA 4KEMA 2HXTA 5FS7A 5U63A 3UXLA 4A6NA 3UCLA 2YLRA 1GRFA 4II2A 3NZGA 1GRGA 3L5OA 3L8KA 2HZGA 1L9DA 4HCDA 5KVHA 4B68A 5GSNA 2ARDA 4UP3A 3OZYA 3UJ2A 1KNRA 3CNDA 4K22A 2J3NA 5JCLA 3N6JA 2AR8A 4YSXA 3DGZA 3P4SA 1KF6A 4H2HA 3CGBA 4TVWA 3NNEA 2WEUA 2GGHA 2GV8A 2BRYA 3NTDA 1GEUA 1ELSA 3B9JB 2P8CA 5EB5A 3KD9A 3TCSA 3B97A 4Y4LA 1NU5A 2PCEA 3EKGA 2XVHA 3AE2A 4GAPA 4NZHA 2OKTA 1BQGA 5GRTA 5KMRA 1D4EA 1ZKQA 2VRLA 3Q9TA 3CN8A 3EEZA 4H4WA 3SJNA 4FP1A 4J57A 2QAEA 3GD4A 3AEGA 3R9UA 1B4VA 1L8PA 3UKAA 5EU9A 2JB2A 4DSGA 2X3NA 4Z25A 2GF3A 5KOXA 5KVIA 3HYVA 1UKVG 4JHMA 1LQTA 3UOVA 1D7YA 1PN0A 2PA6A 3VFCA 1LV0A 1PJ7A 1E1LA 2B9WA 1N60C 2PGWA 4CBQA 5J04A 4JN7A 3VC6A 2FJBA 1X2HA 3QJ4A 4B63A 2QGYA 4EM3A 4HA6A 2TMDA 4K2XA 3AE7A 1ZP0A 1E1KA 1KSUA 3T4WA 3R0UA 3UJRA 1CF3A 3DG3A 2R46A 1MOKA 4CCRA 1PXBA 2XH0A 3DDMA 2APGA 3RP6A 4GGHA 3AD8B 1F3PA 5FS8A 3UKHA 3FPZA 3GO2A 2CDUA 3TWBA 2OX4A 2YR4A 2YAUA 3A7AA 4H7UA 1YQZA 3PS9A 3KPKA 5M0ZA 1PBBA 3AE9A 3QSEA 4FX9A 2OO6A 4JY3A 1LQUA 4A6NB 5EOWA 1F8WA 1ELIA 3NFUA 4H4TA 1PXCA 4H2RA 2PS2A 3NTAA 2V3BA 2BS4A 2E5VA 1JNRA 3MSYA 3CGEA 4NEWA 1LVLA 4H4UA 3HZLA 5ER0A 1PBCA 1REOA 3DGBA 2Q0KA 3JZUA 4BV6A 1STZA 1ZOYA 3NT6A 3DG6A 4KT2A 3LZWA 4U2LA 4MMWA 4WCTA 3G5QA 3EANA 5BUKA 3DFHA 3DMEA 4TM0A 4PABA 1GREA 4ZCCA 3TTEA 3QFBA 1BF3A 2NQLA 3TWAA 3NLCA 1PHHA 3QPEA 4EMWA 2YLTA 3S61A 1D4DA 4NTDA 4USRA 1FEAA 1VQZA 3VR9A 3AM9A 1JROA 2DW7A 1Y0PA 4M52A 2PTYA 1WUFA 4ENLA 1P48A 1FCDA 2PGEA 4HPNA 1EC7A 4K7ZA 3D8XA 5FS6A 1YY5A 1DODA 2FJAA 3SN4A 2CULA 5KOWA 4KWSA 4CY8A 2QDEA 3IK4A 3ICSA 1R0MA 4BJZA 1L9CA 1IJHA 3Q6JA 2X8GA 3DK9A 3VA8A 1CJ2A 2BXRA 4U8IA 3ICTA 3VRDB 3F8RA 2YG7A 1MO9A 2PYXA 2HQMA 2B7SA 2GAGB 4ECHA 1H6VA 3FYYA 4DSHA 2BXSA 3H8AA 4F4RA 3GRTA 2OLNA 1BKHA 1GSNA 3F8PA 3V76A 4GDPA 1OJTA 4I59A 4OPIA 2WDVA 2XLPA 3C4AA 3CB3A 3UCDA 3H8IA 3HYWA 4AOXA 2JB3A 3VC5A 2I5QA 3TOYA 5KRQA 1S2YA 4H4RA 1JOAA 4G8TA 1SB3B 3P1WA 3QVRA 4FK1A 5KWFA 2GVCA 4EIPA 3I6DA 3P4QA 3P4RA 4X4JA 3N6HA 1TZZA 2YQUA 2MUCA 4GDEA 2GMJA 4RSLA 2NVKX 1RSGA 5JCNA 3UTGA 3S5WA 3DJJA 2XSXA 3P93A 2XFOA 3TJ4A 4U8LA 2XFQA 3NG7X
chains in the Genus database with same CATH topology
4J31A 3ALJA 1COYA 2Z5YA 3UKQA 1K0IA 3ISHA 2CVJA 5JCMA 5FS7A 1W4XA 2R4JA 1Q9IA 5U63A 4Z2TA 4H2NA 4IV9A 3T2YA 1P2EA 1L9EA 4X9MA 4A6NA 5C2TA 3UKPA 5EB4A 1RP0A 1ZMCA 3K7QX 2XVIA 2YLZA 3UCLA 1IUWA 1CL0A 1S2QA 4H4VA 2YLRA 3ADAB 1GRFA 5KMSA 2TPRA 4H2QA 4II2A 3RP8A 1GRGA 3L5OA 3L8KA 3E1TA 4XXGA 4OPGA 2BABA 3SFDA 3UP4A 5JCKA 1F8RA 1KFYA 1QO8A 4BK3A 1L9DA 3T14A 5KVHA 5KXJA 3KVEA 3BI5A 4B68A 2WOVA 3AB1A 4EQRA 5GSNA 3G5SA 2ARDA 4UP3A 2F5ZA 1KNRA 4H4SA 3GD3A 3DK4A 3IHMA 4E0VA 3VRBA 1TDNA 3GDNA 2BA9A 5L46A 1GRTA 1OJ9A 3CNDA 4K22A 3IWAA 2J3NA 5JCLA 3AE6A 4CY6A 2AR8A 2IIDA 4FDCB 4YSXA 4BK2A 4JQ9A 3DGZA 1D5TA 3VQRA 3ICRA 1Q1WA 4GCMA 3P4SA 1KF6A 4AP3A 1CJ3A 2A87A 3CGBA 2WDQA 3NNEA 4H4ZA 2WEUA 2E1MA 1N4UA 3CPHG 2ACZA 2DKHA 4EQSA 4U2SA 2WU5A 1NHRA 2GV8A 2BRYA 3FIMB 3NTDA 2WQYA 4NNJA 1GEUA 4YSHA 2GRTA 2YLSA 4II3A 1DNCA 4CCQA 5IPYA 1PDHA 3II4A 1M6IA 3SM8A 1O5WA 3EF6A 4EQWA 2OA1A 1Y56B 4UDQA 2IVDA 2XYOA 2WOWA 5EB5A 3KD9A 2EQ7A 2OLOA 2XFPA 3CIRA 3NIXA 1ZDLA 1TDEA 3BI4A 4Y4LA 1Q1RA 3NK2X 3SZFA 3IF9A 2XVHA 3AE2A 1VDCA 4EMJA 4YTNA 2FJEA 4GAPA 2C3DA 3T2ZA 1ONFA 4CNKA 2XLSA 3ABVA 4U8PA 4A7AA 4NZHA 1JEHA 4UDPA 1KSSA 1L0VA 5GRTA 1LTXR 4EIQA 3LXDA 5KMRA 1NG4A 2WS3A 4OPTA 1D4EA 1ZKQA 2VRLA 5BVAA 3Q9TA 3CN8A 4BK1A 3REDA 4H4WA 5KMQA 4YSYA 3UOXA 4J57A 2QAEA 2WPCA 3GD4A 3AEGA 1IUSA 2EQ6A 1B4VA 3GYXA 3M13A 4U8KA 1XDIA 3LB8A 4TM3A 4YTMA 3AEBA 1KNPA 3UKAA 4JNQA 2E4GA 2JB2A 2YR5A 4DSGA 4N9XA 2X3NA 4Z25A 5M10A 1VG0A 2JB1A 1LJ1A 4IA6A 4EM4A 2GF3A 3BI2A 1DXLA 2R0CA 2IVEA 2WP6A 5KOXA 5KVIA 1GRHA 3GMCA 3HYVA 1UKVG 2B7RA 4OPDA 2BC1A 2GR0A 2B9XA 3DA1A 1OJCA 1P2HA 5JRBA 2XVJA 1LQTA 3UOVA 4NWZA 4C3XA 1D7YA 2C75A 1PN0A 2C64A 2GEWA 2VVMA 2WDRA 5HHFA 1FOHA 1LV0A 3NK1X 1PJ7A 3G5RA 1ZX9A 3GWFA 1E1LA 2B9WA 1YQ4A 2X8CA 1RYIA 1H86A 2YLXA 4K5SA 4CBQA 3ATQA 3M12A 4J34A 1NHQA 1TDFA 4OVIA 3PO7A 2C73A 4G6HA 5CQFA 5HY5A 1GOSA 2FJBA 4Z43A 4EQXA 3NYEA 1PBDA 2ZBWA 1YKJA 3BNMA 3QJ4A 4B63A 1FL2A 1Y56A 4EM3A 2JAEA 2V61A 2ZZCA 2I0ZA 3RP7A 1E39A 2JBVA 4HA6A 2TMDA 1IUVA 4K2XA 2RGOA 4U2TA 4B66A 4P9SA 3AE7A 1ZP0A 4RG4A 5CKUA 2C4CA 1NEKA 1NG3A 2GAHB 1B5QA 1E1KA 2OALA 4RG3A 1KSUA 4YKGA 4GUVA 3KLJA 3K7TA 4AP1A 3NHOX 1QLBA 2B76A 4D04A 1CF3A 3AE5A 3LZXA 1XPQA 5U25A 3DJEA 3KKJA 4DGKA 3DJGX 2R46A 2OAMA 4AOSA 4B65A 2VVLG 1MOKA 4C3YA 4CCRA 4JY2A 1PXBA 4ZN0A 2BRAA 3LJPA 5FS9A 2V6OA 4NTEA 2V3AA 2R4EA 2APGA 3CGDA 3C96A 3NKSA 4G9KA 2A8XA 2FBWA 2GB0A 3RP6A 2VRMA 2GR1A 1DOCA 1MXTA 3AD8B 1F3PA 5FS8A 3UKHA 3FPZA 1GNDA 3AYIA 4A79A 2CDUA 3AEAA 1E1NA 1M64A 2YR4A 4NEVA 2Q6UA 1N4WA 2YAUA 3CNSA 3SX6A 2W0HA 4H7UA 1YQZA 2WU2A 4XWRA 3PS9A 3IHGA 1H83A 4JDRA 1EL7A 3KPKA 3AE8A 5M0ZA 4H2PA 5JCIA 1PBBA 1TRBA 2YWLA 3AE9A 3FMWA 3QSEA 2BACA 3V3OA 5KMPA 4FX9A 4JY3A 4K8DA 1S3EA 2YG4A 1LQUA 5EOWA 4HB9A 4A6NB 4Z26A 5U1OA 3KA7A 1F8WA 4IA5A 1JNZA 1ELIA 1GESA 3RNMA 3CPIG 3DJDA 3LOVA 2H88A 4H4TA 5FMHA 4A99A 1BZLA 1O94A 2C70A 1PXCA 1H2IA 4NTCA 4H2RA 3D1CA 2C65A 4GRTA 3AEDA 3UP5A 3O0HA 1Z6LA 3OC4A 2Q0LA 3NTAA 2V3BA 1NHSA 2BS4A 2E5VA 2WESA 3NH3X 1GTHA 2WP9A 4H50A 4APNA 1JNRA 5DBJA 1B8SA 3CGEA 4NEWA 2YLWA 3AXBA 2XVFA 2XFUA 1LVLA 4H4UA 1FEBA 4I58A 3SFEA 5IQ4A 3HZLA 4GR1A 5LV9A 3UKKA 4KX6A 5ER0A 4YXDA 1PBCA 1REOA 2Q0KA 2GMHA 4BV6A 1GTEA 1ZOYA 2DKIA 2YM1A 1CHUA 3P9UA 1AOGA 3NT6A 1PXAA 4U8JA 2AAQA 2XVEA 4LIIA 2C7GA 5J7XA 1K0LA 1XHCA 2YVGA 3LZWA 1TDOA 1O95A 2C66A 2YVJA 4U2LA 4WCTA 1PBEA 3G5QA 2WOIA 2WPEA 1GETA 3EANA 5BUKA 1VG9A 3F8DA 4G6GA 3CNJA 1ZY8A 2R0PA 3ALMA 2X8HA 2WHDA 1GREA 1JRXA 3DMEA 1ZOVA 3GYIA 4PABA 3QFBA 4TM0A 4C77A 1IUXA 3L1RA 1CC6A 3AD9B 1CC2A 1TYTA 1GRAA 2YVFA 3SQPA 1BF3A 2BYBA 1VQWA 1KDGA 4B67A 3WE0A 1H81A 3FBSA 4A9WA 1F8SA 2JKCA 3AYLA 1SEZA 1VRQB 4YTPA 3KPFA 4B64A 3NYFA 3IC9A 2VVLA 1XANA 1PHHA 1DJQA 3NLCA 5C3JA 1E1MA 4EMWA 2Q7VA 2YLTA 4A65A 4IVMB 3S61A 1GRBA 2WP5A 1H84A 4C74A 1D4DA 4NTDA 3H4KA 4USRA 1FEAA 2XLRA 3LADA 1NENA 2EQ9A 5IQ1A 2GR3A 3AEFA 1EL8A 3VR9A 2ZZBA 4H4QA 4IVOB 1X31B 4BJYA 3ALLA 3T31A 4AT0A 4X9NA 3BNUA 4LU6A 2C3CA 5TR3A 1EBDA 1CJCA 1PJ5A 4M52A 1Y0PA 4U8OA 3AECA 3UTEA 4A5LA 3GRSA 1JU2A 3T0KA 2RGJA 2WETA 1FCDA 1GALA 3AE4A 4LA1A 4J33A 2VQ7A 2YG5A 3EPTA 4BURA 4H4YA 2Y6QA 4B69A 4Z24A 3AEEA 1E6EA 2QA1A 3CNTA 2BS3A 2X50A 4J36A 1K4QA 1S3BA 2XFNA 4YSZA 1OJAA 3SXIA 1NAAA 4K7ZA 3CNPA 1IUUA 2WBAA 3CGCA 5FS6A 1YY5A 2A89A 1DODA 3DH9A 2FJAA 2R45A 2Y6RA 3K7MX 3NRNA 4GF7A 3ZYXA 2CULA 2R0GA 4PAAA 4WX1A 2VOUA 4J2WA 4K5RA 3B6DA 3UOYA 4CY8A 5KOWA 3P4PA 3NK0X 2C76A 2R9ZA 2RABA 1V59A 1KN0A 2BC0A 3ICSA 4OPCA 4BJZA 1YQ3A 1ZK7A 3D8XA 3QVPA 2BCGG 1H82A 5BULA 1QJDA 3AWIA 4C5OA 2Z5XA 3D9XA 1L9CA 3M0OA 1IJHA 3Q6JA 1H7WA 3ZDNA 4J56A 2X8GA 3DK9A 4CNJA 4ICYA 1CJ2A 2BXRA 5J60A 4U8IA 4Y4MA 2X99A 1PBFA 2QA2A 3ICTA 1JRYA 1GXFA 3F8RA 3VRDB 3SZWA 2UZZA 3UTHA 4OPUA 2YG7A 1MO9A 3NN0X 2XCGA 4D03A 1BGNA 3ITJA 4TLXA 1CC4A 2PYXA 4H4PA 4CRTA 1TYPA 1BGJA 2HQMA 5KNLA 3C4NA 3DGHA 1DOEA 3DK8A 2B7SA 2GAGB 3QFAA 3K30A 4ECHA 2RGHA 1H6VA 4G73A 3NN6X 4Z44A 3B3RA 1NDAA 3T2KA 4B1BA 3T37A 3AD7B 1OJDA 1LPFA 4USQA 4U8MA 3UKLA 4DSHA 2BXSA 4TLZA 1DOBA 2V60A 3I3LA 4YT0A 3GRTA 2VZ2A 2GQFA 1ZMDA 3GSIA 3CMMA 2OLNA 1BWCA 3BHKA 1D7LA 2FJDA 1CBOA 1S7MA 1FECA 1GSNA 3NYCA 1N1PA 1GERA 2V5ZA 3F8PA 2JK6A 3ATRA 4DNAA 3H8LA 4GDPA 3SZCA 3UTFA 3V76A 5HYMA 2PHHA 3VR8A 1OJTA 4I59A 4OPIA 4TM1A 2WDVA 2XLPA 3C4AA 2BCPA 1E7PA 4ZCCA 5HXIA 3SZ0A 4G74A 2O9ZA 3FG2P 3UKFA 1EL9A 4JN9A 3H8IA 3HYWA 2GR2A 3R9UA 3CPJG 1N4VA 1F6MA 2NPXA 3URHA 4JNAA 1K0JA 4AOXA 2BK5A 2C67A 2JB3A 1H7XA 4FK1C 3SGLA 3PVCA 2YM2A 2YG6A 2YR6A 5KRQA 3AE3A 4YKFA 1S2YA 4H4RA 1CJ4A 1JOAA 4ADWA 2CFYA 3GYJA 4REKA 2XDOA 5EBKA 4MJWA 3P1WA 3QVRA 1GT8A 4FK1A 4O5QA 2B9YA 1GPEA 3AE1A 3GMBA 4TM4A 3KU9A 1NHPA 3SYIA 5KWFA 2GVCA 4YWOA 4EIPA 1NPXA 3I6DA 3P4QA 3P4RA 4X4JA 2YG3A 2YQUA 3AYJA 4GDEA 2GMJA 4KPRA 2H89A 1EL5A 1D4CA 3QSMA 1HYUA 3UOZA 1PS9A 4RSLA 4U8NA 1B37A 1JRZA 2XLUA 3RHAA 2XLTA 4OPLA 2VQBA 2GQWA 3QSSA 2BK3A 2AQJA 3GWDA 3OZ2A 2NVKX 2WPFA 1RSGA 3CTYA 2GH5A 3V3NA 1BKWA 5JCNA 4Y4NA 4ZCDA 3SY4A 4Z2RA 2ZZ0A 1TDKA 1IUTA 4Z2UA 3GDPA 4EMIA 3EAOA 3BHFA 4O5UA 4OCGA 4XWZA 2BK4A 3S5WA 2C72A 3UTGA 5BRTA 4AT2A 3DJJA 2QCUA 4H4XA 4UDRA 2BS2A 1DJNA 3VRAA 3HYXA 3PG6A 2XFOA 3COXA 3NGCX 1PJ6A 4GAVA 2EQ8A 3JSKA 1GV4A 4U8LA 2XFQA 3NG7X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J31 A;  3ALJ A;  1COY A;  2Z5Y A;  3UKQ A;  1K0I A;  3ISH A;  2CVJ A;  5JCM A;  5FS7 A;  1W4X A;  2R4J A;  1Q9I A;  5U63 A;  4Z2T A;  4H2N A;  4IV9 A;  1P2E A;  1L9E A;  4X9M A;  4A6N A;  5C2T A;  3UKP A;  5EB4 A;  1RP0 A;  1ZMC A;  3K7Q X;  2XVI A;  2YLZ A;  3UCL A;  1IUW A;  1CL0 A;  1S2Q A;  4H4V A;  2YLR A;  3ADA B;  1GRF A;  2TPR A;  4H2Q A;  3RP8 A;  1GRG A;  3L8K A;  3E1T A;  4XXG A;  4OPG A;  2BAB A;  3SFD A;  3UP4 A;  5JCK A;  1F8R A;  1KFY A;  1QO8 A;  4BK3 A;  1L9D A;  5KVH A;  5KXJ A;  3KVE A;  3BI5 A;  4B68 A;  2WOV A;  3AB1 A;  4EQR A;  5GSN A;  3G5S A;  2ARD A;  4UP3 A;  2F5Z A;  1KNR A;  4H4S A;  3GD3 A;  3DK4 A;  3IHM A;  4E0V A;  3VRB A;  1TDN A;  3GDN A;  2BA9 A;  5L46 A;  1GRT A;  1OJ9 A;  3CND A;  4K22 A;  3IWA A;  2J3N A;  5JCL A;  3AE6 A;  4CY6 A;  2AR8 A;  2IID A;  4FDC B;  4YSX A;  4BK2 A;  4JQ9 A;  3DGZ A;  1D5T A;  3VQR A;  3ICR A;  1Q1W A;  4GCM A;  3P4S A;  1KF6 A;  4AP3 A;  1CJ3 A;  2A87 A;  3CGB A;  2WDQ A;  3NNE A;  4H4Z A;  2WEU A;  2E1M A;  1N4U A;  3CPH G;  2ACZ A;  2DKH A;  4EQS A;  4U2S A;  2WU5 A;  1NHR A;  2GV8 A;  3FIM B;  3NTD A;  2WQY A;  1GEU A;  4YSH A;  2GRT A;  2YLS A;  1DNC A;  4CCQ A;  5IPY A;  1PDH A;  3II4 A;  1M6I A;  3SM8 A;  1O5W A;  3EF6 A;  4EQW A;  2OA1 A;  1Y56 B;  4UDQ A;  2IVD A;  2XYO A;  2WOW A;  5EB5 A;  3KD9 A;  2EQ7 A;  2OLO A;  2XFP A;  3CIR A;  3NIX A;  1ZDL A;  1TDE A;  3BI4 A;  4Y4L A;  1Q1R A;  3NK2 X;  3IF9 A;  2XVH A;  3AE2 A;  1VDC A;  4EMJ A;  4YTN A;  2FJE A;  2C3D A;  1ONF A;  4CNK A;  2XLS A;  3ABV A;  4U8P A;  4A7A A;  4NZH A;  1JEH A;  4UDP A;  1KSS A;  1L0V A;  5GRT A;  1LTX R;  4EIQ A;  3LXD A;  1NG4 A;  2WS3 A;  4OPT A;  1D4E A;  1ZKQ A;  2VRL A;  5BVA A;  3Q9T A;  3CN8 A;  4BK1 A;  3RED A;  4H4W A;  4YSY A;  3UOX A;  4J57 A;  2QAE A;  2WPC A;  3GD4 A;  3AEG A;  1IUS A;  2EQ6 A;  1B4V A;  3M13 A;  4U8K A;  4YTM A;  1XDI A;  3LB8 A;  4TM3 A;  3AEB A;  1KNP A;  3UKA A;  4JNQ A;  2E4G A;  2JB2 A;  2YR5 A;  4DSG A;  4N9X A;  2X3N A;  4Z25 A;  5M10 A;  1VG0 A;  2JB1 A;  1LJ1 A;  4IA6 A;  4EM4 A;  2GF3 A;  3BI2 A;  1DXL A;  2R0C A;  2IVE A;  2WP6 A;  5KOX A;  5KVI A;  1GRH A;  3GMC A;  1UKV G;  2B7R A;  4OPD A;  2BC1 A;  2GR0 A;  2B9X A;  3DA1 A;  1OJC A;  1P2H A;  2XVJ A;  1LQT A;  3UOV A;  4C3X A;  1D7Y A;  2C75 A;  1PN0 A;  2C64 A;  2GEW A;  2VVM A;  2WDR A;  5HHF A;  1FOH A;  1LV0 A;  3NK1 X;  1PJ7 A;  3G5R A;  1ZX9 A;  3GWF A;  1E1L A;  2B9W A;  1YQ4 A;  2X8C A;  1RYI A;  1H86 A;  2YLX A;  4K5S A;  4CBQ A;  3ATQ A;  3M12 A;  4J34 A;  1NHQ A;  1TDF A;  4OVI A;  3PO7 A;  2C73 A;  5CQF A;  5HY5 A;  1GOS A;  2FJB A;  4Z43 A;  4EQX A;  3NYE A;  1PBD A;  2ZBW A;  1YKJ A;  3BNM A;  3QJ4 A;  4B63 A;  1FL2 A;  1Y56 A;  4EM3 A;  2JAE A;  2V61 A;  2ZZC A;  2I0Z A;  3RP7 A;  1E39 A;  2JBV A;  4HA6 A;  2TMD A;  1IUV A;  4K2X A;  2RGO A;  4U2T A;  4B66 A;  4P9S A;  3AE7 A;  1ZP0 A;  4RG4 A;  5CKU A;  1NEK A;  1NG3 A;  2GAH B;  1B5Q A;  1E1K A;  2OAL A;  4RG3 A;  1KSU A;  4YKG A;  4GUV A;  3KLJ A;  3K7T A;  4AP1 A;  3NHO X;  1QLB A;  2B76 A;  4D04 A;  1CF3 A;  3AE5 A;  3LZX A;  1XPQ A;  5U25 A;  3DJE A;  3KKJ A;  4DGK A;  3DJG X;  2R46 A;  2OAM A;  4AOS A;  4B65 A;  2VVL G;  1MOK A;  4C3Y A;  4CCR A;  4JY2 A;  1PXB A;  4ZN0 A;  3LJP A;  5FS9 A;  2V6O A;  4NTE A;  2V3A A;  2R4E A;  2APG A;  3CGD A;  3C96 A;  3NKS A;  3RP6 A;  2A8X A;  2FBW A;  2GB0 A;  2VRM A;  2GR1 A;  1DOC A;  1MXT A;  3AD8 B;  1F3P A;  5FS8 A;  3UKH A;  3FPZ A;  1GND A;  3AYI A;  4A79 A;  2CDU A;  3AEA A;  1E1N A;  1M64 A;  2YR4 A;  4NEV A;  2Q6U A;  1N4W A;  2YAU A;  3CNS A;  2W0H A;  4H7U A;  1YQZ A;  2WU2 A;  4XWR A;  3PS9 A;  3IHG A;  1H83 A;  4JDR A;  1EL7 A;  3AE8 A;  5M0Z A;  4H2P A;  5JCI A;  1PBB A;  1TRB A;  2YWL A;  3AE9 A;  3FMW A;  3QSE A;  2BAC A;  3V3O A;  4FX9 A;  4JY3 A;  4K8D A;  1S3E A;  2YG4 A;  1LQU A;  5EOW A;  4HB9 A;  4A6N B;  4Z26 A;  5U1O A;  3KA7 A;  1F8W A;  4IA5 A;  1JNZ A;  1ELI A;  1GES A;  3RNM A;  3CPI G;  3DJD A;  3LOV A;  2H88 A;  4H4T A;  5FMH A;  4A99 A;  1BZL A;  1O94 A;  2C70 A;  1PXC A;  4NTC A;  4H2R A;  3D1C A;  2C65 A;  4GRT A;  3AED A;  3UP5 A;  3O0H A;  1Z6L A;  3OC4 A;  2Q0L A;  3NTA A;  2V3B A;  1NHS A;  2BS4 A;  2E5V A;  2WES A;  3NH3 X;  1GTH A;  2WP9 A;  4H50 A;  4APN A;  1JNR A;  5DBJ A;  1B8S A;  3CGE A;  4NEW A;  2YLW A;  3AXB A;  2XVF A;  2XFU A;  1LVL A;  4H4U A;  1FEB A;  4I58 A;  3SFE A;  5IQ4 A;  3HZL A;  4GR1 A;  5LV9 A;  3UKK A;  4KX6 A;  5ER0 A;  4YXD A;  1PBC A;  1REO A;  2Q0K A;  2GMH A;  4BV6 A;  1GTE A;  1ZOY A;  2DKI A;  2YM1 A;  1CHU A;  3P9U A;  1AOG A;  3NT6 A;  1PXA A;  4U8J A;  2AAQ A;  2XVE A;  4LII A;  2C7G A;  5J7X A;  1K0L A;  1XHC A;  2YVG A;  3LZW A;  1TDO A;  1O95 A;  2C66 A;  2YVJ A;  4U2L A;  4WCT A;  1PBE A;  3G5Q A;  2WOI A;  2WPE A;  1GET A;  3EAN A;  5BUK A;  1VG9 A;  3F8D A;  3CNJ A;  1ZY8 A;  2R0P A;  3ALM A;  2X8H A;  2WHD A;  1GRE A;  1JRX A;  3DME A;  1ZOV A;  3GYI A;  4PAB A;  3QFB A;  4TM0 A;  4C77 A;  1IUX A;  3L1R A;  1CC6 A;  3AD9 B;  1CC2 A;  1TYT A;  1GRA A;  2YVF A;  3SQP A;  1BF3 A;  2BYB A;  1VQW A;  1KDG A;  4B67 A;  3WE0 A;  1H81 A;  3FBS A;  4A9W A;  1F8S A;  2JKC A;  3AYL A;  1SEZ A;  1VRQ B;  4YTP A;  3KPF A;  4B64 A;  3NYF A;  3IC9 A;  2VVL A;  1XAN A;  1PHH A;  1DJQ A;  3NLC A;  5C3J A;  1E1M A;  4EMW A;  2Q7V A;  2YLT A;  4A65 A;  4IVM B;  3S61 A;  1GRB A;  2WP5 A;  1H84 A;  4C74 A;  1D4D A;  4NTD A;  3H4K A;  4USR A;  1FEA A;  2XLR A;  3LAD A;  1NEN A;  2EQ9 A;  5IQ1 A;  2GR3 A;  3AEF A;  1EL8 A;  3VR9 A;  2ZZB A;  4H4Q A;  4IVO B;  1X31 B;  4BJY A;  3ALL A;  4AT0 A;  4X9N A;  3BNU A;  4LU6 A;  2C3C A;  5TR3 A;  1EBD A;  1CJC A;  1PJ5 A;  4M52 A;  1Y0P A;  4U8O A;  3AEC A;  3UTE A;  4A5L A;  3GRS A;  1JU2 A;  2RGJ A;  2WET A;  1FCD A;  1GAL A;  3AE4 A;  4LA1 A;  4J33 A;  2VQ7 A;  2YG5 A;  3EPT A;  4BUR A;  4H4Y A;  2Y6Q A;  4B69 A;  4Z24 A;  3AEE A;  1E6E A;  2QA1 A;  3CNT A;  2BS3 A;  2X50 A;  4J36 A;  1K4Q A;  1S3B A;  2XFN A;  4YSZ A;  1OJA A;  1NAA A;  4K7Z A;  3CNP A;  1IUU A;  2WBA A;  3CGC A;  5FS6 A;  1YY5 A;  2A89 A;  1DOD A;  3DH9 A;  2FJA A;  2R45 A;  2Y6R A;  3K7M X;  3NRN A;  4GF7 A;  3ZYX A;  2CUL A;  2R0G A;  4PAA A;  4WX1 A;  2VOU A;  4J2W A;  4K5R A;  3B6D A;  3UOY A;  4CY8 A;  5KOW A;  3P4P A;  3NK0 X;  2C76 A;  2R9Z A;  2RAB A;  1V59 A;  2BC0 A;  3ICS A;  4OPC A;  4BJZ A;  1YQ3 A;  1ZK7 A;  3D8X A;  3QVP A;  2BCG G;  1H82 A;  5BUL A;  1QJD A;  3AWI A;  4C5O A;  2Z5X A;  1L9C A;  3M0O A;  1IJH A;  3Q6J A;  1H7W A;  3ZDN A;  4J56 A;  2X8G A;  3DK9 A;  4CNJ A;  4ICY A;  1CJ2 A;  2BXR A;  5J60 A;  4U8I A;  4Y4M A;  2X99 A;  1PBF A;  2QA2 A;  3ICT A;  1JRY A;  1GXF A;  3F8R A;  3VRD B;  2UZZ A;  3UTH A;  4OPU A;  2YG7 A;  1MO9 A;  3NN0 X;  2XCG A;  4D03 A;  1BGN A;  3ITJ A;  4TLX A;  1CC4 A;  2PYX A;  4H4P A;  4CRT A;  1TYP A;  1BGJ A;  2HQM A;  3C4N A;  3DGH A;  1DOE A;  3DK8 A;  2B7S A;  2GAG B;  3QFA A;  3K30 A;  4ECH A;  2RGH A;  1H6V A;  3NN6 X;  4Z44 A;  3B3R A;  1NDA A;  4B1B A;  3T37 A;  3AD7 B;  1OJD A;  1LPF A;  4USQ A;  4U8M A;  3UKL A;  4DSH A;  2BXS A;  4TLZ A;  1DOB A;  2V60 A;  3I3L A;  4YT0 A;  3GRT A;  2VZ2 A;  2GQF A;  1ZMD A;  3GSI A;  2OLN A;  1BWC A;  3BHK A;  1D7L A;  2FJD A;  1CBO A;  1FEC A;  1GSN A;  3NYC A;  1N1P A;  1GER A;  2V5Z A;  3F8P A;  2JK6 A;  3ATR A;  4DNA A;  3H8L A;  4GDP A;  3UTF A;  3V76 A;  5HYM A;  2PHH A;  3VR8 A;  1OJT A;  4I59 A;  4OPI A;  4TM1 A;  2WDV A;  2XLP A;  3C4A A;  2BCP A;  1E7P A;  4ZCC A;  5HXI A;  2O9Z A;  3FG2 P;  3UKF A;  1EL9 A;  4JN9 A;  3H8I A;  2GR2 A;  3R9U A;  3CPJ G;  1N4V A;  1F6M A;  2NPX A;  3URH A;  4JNA A;  1K0J A;  4AOX A;  2BK5 A;  2C67 A;  2JB3 A;  1H7X A;  4FK1 C;  3SGL A;  3PVC A;  2YM2 A;  2YG6 A;  2YR6 A;  5KRQ A;  3AE3 A;  4YKF A;  1S2Y A;  4H4R A;  1CJ4 A;  1JOA A;  4ADW A;  2CFY A;  3GYJ A;  4REK A;  2XDO A;  5EBK A;  4MJW A;  3P1W A;  3QVR A;  1GT8 A;  4FK1 A;  4O5Q A;  2B9Y A;  1GPE A;  3AE1 A;  3GMB A;  4TM4 A;  3KU9 A;  1NHP A;  5KWF A;  2GVC A;  4YWO A;  4EIP A;  1NPX A;  3I6D A;  3P4Q A;  3P4R A;  4X4J A;  2YG3 A;  2YQU A;  3AYJ A;  4GDE A;  2GMJ A;  4KPR A;  2H89 A;  1EL5 A;  1D4C A;  3QSM A;  1HYU A;  3UOZ A;  1PS9 A;  4RSL A;  4U8N A;  1B37 A;  1JRZ A;  2XLU A;  3RHA A;  2XLT A;  4OPL A;  2VQB A;  2GQW A;  3QSS A;  2BK3 A;  2AQJ A;  3GWD A;  3OZ2 A;  2NVK X;  2WPF A;  1RSG A;  3CTY A;  2GH5 A;  3V3N A;  1BKW A;  5JCN A;  4Y4N A;  4ZCD A;  4Z2R A;  2ZZ0 A;  1TDK A;  1IUT A;  4Z2U A;  3GDP A;  4EMI A;  3EAO A;  3BHF A;  4O5U A;  4OCG A;  4XWZ A;  2BK4 A;  3S5W A;  2C72 A;  3UTG A;  5BRT A;  4AT2 A;  3DJJ A;  2QCU A;  4H4X A;  4UDR A;  2BS2 A;  1DJN A;  3VRA A;  2XFO A;  3COX A;  3NGC X;  1PJ6 A;  2EQ8 A;  3JSK A;  1GV4 A;  4U8L A;  2XFQ A;  3NG7 X; 
#chains in the Genus database with same CATH topology
 4J31 A;  1COY A;  3ISH A;  2CVJ A;  1W4X A;  1Q9I A;  4Z2T A;  3T2Y A;  2W3S A;  5EB4 A;  1RP0 A;  1CL0 A;  4XXG A;  3SFD A;  1EC8 A;  1QO8 A;  3V5C A;  3BI5 A;  3AB1 A;  5BOE A;  4EQR A;  2PMQ A;  2F5Z A;  3IHM A;  3GD3 A;  2BA9 A;  4CY6 A;  2IID A;  4FDC B;  4BK2 A;  4JQ9 A;  1Q1W A;  3HW2 A;  3A7R A;  2WDQ A;  4EQS A;  4U2S A;  1NHR A;  4IL2 A;  2WQY A;  4NNJ A;  5IPY A;  1PDH A;  2W3R A;  2EQ7 A;  2OLO A;  2XFP A;  3CIR A;  1TDE A;  3NK2 X;  3IF9 A;  2FJE A;  4CNK A;  4A7A A;  1JEH A;  4UDP A;  1KSS A;  1L0V A;  3UJF A;  1LTX R;  4EIQ A;  1NEL A;  1NG4 A;  3RED A;  3NS1 B;  1IUS A;  4YTM A;  1XDI A;  3AEB A;  1KNP A;  2E4G A;  4N9X A;  5M10 A;  2JB1 A;  4EM4 A;  3A7U A;  2GR0 A;  3DA1 A;  5JRB A;  2XVJ A;  2C75 A;  2C64 A;  3CXO A;  5HHF A;  1FOH A;  2QDD A;  3G5R A;  1KKO A;  4M6U A;  2X8C A;  1H86 A;  4K5S A;  3ATQ A;  4J34 A;  2OFJ A;  4HNL A;  3OZM A;  1NHQ A;  3GD6 A;  1TDF A;  3PO7 A;  2C73 A;  1GOS A;  4Z43 A;  2W54 A;  1E39 A;  2JBV A;  3ES7 A;  4H19 A;  4U2T A;  1MDL A;  4B66 A;  3R10 A;  1WUE A;  4GYP A;  5CKU A;  2C4C A;  1NEK A;  1NG3 A;  4RG3 A;  3K7T A;  1QLB A;  2B76 A;  3AE5 A;  4IHC A;  3SN0 A;  1XPQ A;  4ZCW A;  3U4F A;  2RDX A;  2GGJ A;  4C3Y A;  2BRA A;  3LJP A;  4ZOH B;  5FS9 A;  2V3A A;  3CGD A;  3C96 A;  2A8X A;  3PK7 A;  1MXT A;  5G5G B;  4EWJ A;  1GND A;  3AYI A;  4A79 A;  3OPS A;  1W6T A;  3SX6 A;  1H83 A;  4H2P A;  1JDF A;  5JCI A;  2BAC A;  3AMZ A;  4Z26 A;  5U1O A;  3KA7 A;  1TKK A;  3RNM A;  3CPI G;  2PU1 A;  4IL0 A;  2H88 A;  2OPJ A;  5FMH A;  4A99 A;  1BZL A;  3CXB A;  3ZVH B;  3D1C A;  4GRT A;  3AED A;  3IJI A;  3VCN A;  4MKS A;  1NHS A;  3NH3 X;  1GTH A;  2GGE A;  2PTX A;  5FJU A;  1B8S A;  2XVF A;  3SBF A;  1PDY A;  1FEB A;  3UKK A;  4J3Z A;  3QLD A;  4GIR A;  1SJD A;  4M0X A;  2YM1 A;  1EBG A;  4LII A;  2C7G A;  1PBE A;  1VG9 A;  3F8D A;  2R0P A;  4B65 A;  2X8H A;  2WHD A;  1JRX A;  1ZOV A;  1CC2 A;  3SQP A;  2YVF A;  1KDG A;  3FBS A;  4A9W A;  1EBH A;  3UJS A;  1SEZ A;  4B64 A;  3NYF A;  3IC9 A;  3ES8 A;  2VVL A;  5C3J A;  2Q7V A;  4GGB A;  4A65 A;  2WP5 A;  1H84 A;  3S5S A;  2XLR A;  3LAD A;  3CAW A;  1NEN A;  2GR3 A;  1JCT A;  5FJO A;  3T31 A;  3BNU A;  4GME A;  3UTE A;  5TR3 A;  3S47 A;  4U8O A;  3GRS A;  1JU2 A;  2P88 A;  2WET A;  2QJM A;  4HCH A;  4J33 A;  4H4Y A;  2OZ3 A;  3GY1 A;  2BS3 A;  2X50 A;  2XFN A;  1OJA A;  3SXI A;  4H83 A;  5BOF A;  3CGC A;  2Y6R A;  4GF7 A;  2R45 A;  3DIP A;  3NRN A;  3ZYX A;  4PAA A;  2VOU A;  4J2W A;  3B6D A;  2R9Z A;  2BC0 A;  1YQ3 A;  3AWI A;  3ZDN A;  4J56 A;  4ICY A;  3CYJ A;  4Y4M A;  1JRY A;  2OQY A;  3NN0 X;  1CC4 A;  1TE6 A;  4DX3 A;  3D47 A;  2RGH A;  3T2K A;  1OJD A;  4USQ A;  4U8M A;  3I3L A;  4YT0 A;  2OQH A;  3GSI A;  1BWC A;  1CBO A;  3UXK A;  1FEC A;  1VDV A;  3H8L A;  2JK6 A;  3UTF A;  1E7P A;  2OZT A;  4TVY A;  3FV9 A;  1H7X A;  3FXG A;  3N4F A;  3AE3 A;  1YEY A;  4ADW A;  5EBK A;  4MJW A;  1GT8 A;  3AE1 A;  3GMB A;  3KU9 A;  3SYI A;  3D46 A;  1NPX A;  2E3T A;  2H89 A;  1EL5 A;  3UOZ A;  1JRZ A;  2VQB A;  2BK3 A;  2AQJ A;  3MKC A;  4E6M A;  4ZCD A;  3SY4 A;  2ZZ0 A;  1TDK A;  2XH4 A;  4O5U A;  4OCG A;  4G7F A;  4AT2 A;  4UDR A;  3HYX A;  3PG6 A;  1PJ6 A;  1JPD X;  1F9C A;  3ALJ A;  3UKQ A;  1K0I A;  5JCM A;  2AKZ A;  1P2E A;  4X9M A;  5C2T A;  3UKP A;  3PWG A;  3K7Q X;  4MGG A;  1S2Q A;  4H4V A;  3ADA B;  1KD0 A;  2TPR A;  3RP8 A;  3H70 A;  4OPG A;  5JCK A;  3VCC A;  3KVE A;  4A35 A;  3G5S A;  3NVW B;  3DK4 A;  1MDR A;  3GDN A;  5L46 A;  3AN1 A;  1JPM A;  3UCC A;  3IWA A;  3H7V A;  1D5T A;  4GCM A;  3RIT A;  4AP3 A;  4H4Z A;  2ACZ A;  2P8B A;  4YSH A;  2OZ8 A;  1N62 C;  4II3 A;  1DNC A;  4CCQ A;  3II4 A;  1M6I A;  1O5W A;  4EQW A;  2OA1 A;  2WOW A;  1V97 A;  1ZDL A;  3BI4 A;  1Q1R A;  3ZVH A;  3R1Z A;  4YTN A;  2XLS A;  3ABV A;  4U8P A;  3MUC A;  1FFV C;  3THU A;  5BVA A;  2XH2 A;  4YSY A;  3UOX A;  2WPC A;  5KXJ A;  2EQ6 A;  3M13 A;  4TM3 A;  3JW7 A;  2YR5 A;  2CHR A;  1WYG A;  4IA6 A;  1MNS A;  3BI2 A;  2PU0 A;  3GMC A;  2B7R A;  2B9X A;  1OJC A;  2WDR A;  2DW6 A;  2W55 A;  3DEQ A;  3Q4D A;  3ETR B;  1ZX9 A;  3TQP A;  3HRD C;  2YLX A;  3M12 A;  3IJL A;  4G6H A;  5HY5 A;  4EQX A;  3NYE A;  1PBD A;  2ZBW A;  1YKJ A;  1FL2 A;  2JAE A;  2V61 A;  2I0Z A;  3RP7 A;  2P3Z A;  4RG4 A;  2PP3 A;  3NHO X;  3LZX A;  5U25 A;  3KKJ A;  4DGK A;  2AL2 A;  1FHV A;  2V6O A;  4NTE A;  2R4E A;  4JN8 A;  4G9K A;  4E4U A;  1N5X A;  2GR1 A;  1DOC A;  2GGI A;  4Z17 A;  1E1N A;  2GSH A;  2Q6U A;  1ZXI C;  3NO1 A;  2W0H A;  4XWR A;  3IHG A;  4JDR A;  3FMW A;  3V3O A;  2AKM A;  5KMP A;  1P43 A;  4K8D A;  1S3E A;  2YG4 A;  4HB9 A;  1JNZ A;  2QVH A;  3DJD A;  3UP5 A;  1Z6L A;  4FI4 A;  3FJ4 A;  3OC4 A;  2WP9 A;  4H50 A;  4APN A;  3CT2 A;  4K8G A;  5DBJ A;  4ROP A;  2ZAD A;  3AXB A;  3NXL A;  4DHG A;  3IJQ A;  5IQ4 A;  5LV9 A;  4GR1 A;  1RVK A;  3U9I A;  2GMH A;  2DKI A;  4A6G A;  3P9U A;  1AOG A;  2AAQ A;  5FJT A;  5J7X A;  3T8Q A;  2C66 A;  2WOI A;  2WPE A;  3P3B A;  1N5W C;  1ZY8 A;  3ALM A;  3GYI A;  3CK5 A;  3L1R A;  1CC6 A;  3R0K A;  2PTZ A;  1TYT A;  1T3Q C;  3OP2 A;  2PPG A;  2QJN A;  4B67 A;  3WE0 A;  1F8S A;  2JKC A;  4GFI A;  3KPF A;  1DJQ A;  3HPF A;  1E1M A;  2GGG A;  3FVD A;  4C74 A;  3H4K A;  2EQ9 A;  2ZZB A;  4DWD A;  1X31 B;  3ALL A;  2AL1 A;  4AT0 A;  4X9N A;  2C3C A;  2PTW A;  1EBD A;  4GIS A;  1CJC A;  1PJ5 A;  7ENL A;  5IDZ A;  3T0K A;  1GAL A;  3AE4 A;  2YG5 A;  4B69 A;  3AEE A;  2PP1 A;  1K4Q A;  1S3B A;  1FHU A;  1ONE A;  3K1G A;  1IUU A;  3K7M X;  1KKR A;  3QKE A;  3ZVI A;  2A89 A;  3DH9 A;  4K5R A;  3UOY A;  3P4P A;  2RAB A;  1V59 A;  4E5T A;  1KN0 A;  4OPC A;  1ZK7 A;  1QJD A;  5J60 A;  2X99 A;  1PBF A;  2QA2 A;  3V4B A;  3UTH A;  3ZLH A;  3ENL A;  2XCG A;  4D03 A;  1BGN A;  4TLX A;  1BGJ A;  3C4N A;  3DGH A;  3DK8 A;  3V5F A;  1NDA A;  3T37 A;  3AD7 B;  3UKL A;  1DOB A;  2E5A A;  2VZ2 A;  2GQF A;  1ZMD A;  5ENL A;  3T9P A;  1D7L A;  2FJD A;  1S7M A;  3NYC A;  1N1P A;  1GER A;  2V5Z A;  4DNA A;  3SZC A;  3VR8 A;  5HXI A;  4IZG A;  3SZ0 A;  4G74 A;  2O9Z A;  3FG2 P;  3PFR A;  4JN9 A;  1PDZ A;  3CPJ G;  1N4V A;  1F6M A;  4JNA A;  4FK1 C;  2C67 A;  2HNE A;  3PVC A;  2YM2 A;  4E4F A;  4IP4 A;  3RCY A;  4YKF A;  3SSZ A;  1CJ4 A;  2GL5 A;  1KCZ A;  3QN3 A;  1NHP A;  4YWO A;  2QJJ A;  1D4C A;  3QSM A;  1HYU A;  1ECQ A;  2GQW A;  2WPF A;  2PP0 A;  4YWS A;  3V3N A;  1IUT A;  3BHF A;  2BK4 A;  5BRT A;  2C72 A;  2QCU A;  4H4X A;  2BS2 A;  3COX A;  4GAV A;  2EQ8 A;  3JSK A;  4K1W A;  2R4J A;  4H2N A;  4IV9 A;  1L9E A;  4J1O A;  3RRA A;  1ZMC A;  2XGZ A;  2ONE A;  2XVI A;  2YLZ A;  1IUW A;  5KMS A;  4H2Q A;  3E1T A;  2BAB A;  3UP4 A;  1F8R A;  1KFY A;  3MZN A;  2XH7 A;  4BK3 A;  3T14 A;  3SR6 B;  2WOV A;  4H4S A;  4E0V A;  3VRB A;  1TDN A;  3OW1 A;  1GRT A;  1OJ9 A;  3AE6 A;  1R6W A;  2AL2 B;  3VQR A;  3ICR A;  4K2S A;  3BOX A;  1CJ3 A;  2A87 A;  3CPH G;  2E1M A;  1N4U A;  2DKH A;  6ENL A;  2WU5 A;  3FIM B;  2GRT A;  2YLS A;  3SM8 A;  3EF6 A;  1Y56 B;  4UDQ A;  2IVD A;  2XYO A;  3NIX A;  3SZF A;  3UJE A;  2PSN A;  1VDC A;  4EMJ A;  2C3D A;  3T2Z A;  1ONF A;  4H1Z A;  1XPY A;  3DG7 A;  3LXD A;  3NVZ B;  1SJC A;  2WS3 A;  4OPT A;  3STP A;  1EC9 A;  3I6T A;  1N61 C;  4BK1 A;  5KMQ A;  3TJI A;  4U8K A;  3GYX A;  3LB8 A;  3NVY B;  4JNQ A;  1VG0 A;  1LJ1 A;  1DXL A;  3R07 C;  2R0C A;  2IVE A;  2WP6 A;  1GRH A;  4OPD A;  2BC1 A;  2FYM A;  1P2H A;  4NWZ A;  4C3X A;  2GEW A;  2VVM A;  3NK1 X;  3GWF A;  1YQ4 A;  1RYI A;  4A3R A;  4OVI A;  5CQF A;  4E8G A;  3BNM A;  1Y56 A;  2ZZC A;  1IUV A;  2RGO A;  4P9S A;  2GAH B;  1B5Q A;  2OAL A;  4YKG A;  4GUV A;  3KLJ A;  4AP1 A;  4D04 A;  3DJE A;  4GYP C;  3KUM A;  3DJG X;  3RO6 A;  2OAM A;  4AOS A;  2VVL G;  3V3W A;  4JY2 A;  4ZN0 A;  3NKS A;  2FBW A;  2GB0 A;  2VRM A;  3TW9 A;  3DES A;  3AEA A;  1M64 A;  4NEV A;  4X2P A;  1N4W A;  3CNS A;  2WU2 A;  3H12 A;  1EL7 A;  3AE8 A;  1TRB A;  2YWL A;  3FCP A;  3MWC A;  2P0I A;  1IYX A;  2POZ A;  3BJS A;  4IA5 A;  1GES A;  3LOV A;  1RM6 B;  4NTC A;  1O94 A;  2C70 A;  1H2I A;  3BSM A;  2C65 A;  3ZLG A;  1SJB A;  3O0H A;  2Q0L A;  5G5H B;  2O56 A;  2WES A;  3RR1 A;  2GDQ A;  2YLW A;  2XFU A;  1OEP A;  3DFY A;  4I58 A;  3SFE A;  1E9I A;  4KX6 A;  1MUC A;  4YXD A;  3R25 A;  1GTE A;  1CHU A;  3ZLF A;  4HCL A;  3VDG A;  1PXA A;  2XVE A;  4U8J A;  2OVL A;  4Z1Y A;  1K0L A;  3QTP A;  1XHC A;  2YVG A;  1TDO A;  1O95 A;  2YVJ A;  3MY9 A;  5FJR A;  1GET A;  3CNJ A;  4IT1 A;  4C77 A;  3EUB 3;  4DXK A;  1IUX A;  4IP5 A;  3AD9 B;  2HXU A;  1GRA A;  2BYB A;  1VQW A;  1H81 A;  3AYL A;  1VRQ B;  4YTP A;  1XAN A;  1MRA A;  4IVM B;  1GRB A;  5IQ1 A;  3AEF A;  1EL8 A;  4H4Q A;  4IVO B;  3I6E A;  4BJY A;  4LU6 A;  3NVV B;  3AEC A;  4A5L A;  2ZC8 A;  2RGJ A;  4DN1 A;  3GC2 A;  4LA1 A;  4ZA0 A;  2VQ7 A;  3EPT A;  4BUR A;  2Y6Q A;  4Z24 A;  1E6E A;  2QA1 A;  3CNT A;  4HN8 A;  4J36 A;  4YSZ A;  2OLA A;  3T6C A;  1NAA A;  3CNP A;  4G6G A;  2WBA A;  3R11 A;  2R0G A;  4WX1 A;  3NK0 X;  2C76 A;  4HYR A;  3QVP A;  2POD A;  2BCG G;  1H82 A;  3JVA A;  5BUL A;  1FIQ B;  4C5O A;  3Q45 A;  3P0W A;  2Z5X A;  3D9X A;  3M0O A;  1H7W A;  4CNJ A;  2OG9 A;  1GXF A;  3SZW A;  2UZZ A;  4DYE A;  4OPU A;  3ITJ A;  3N4E A;  4H4P A;  4CRT A;  1TYP A;  5KNL A;  3K30 A;  1DOE A;  2QQ6 A;  3QFA A;  3RGT A;  4G73 A;  3NN6 X;  4Z44 A;  3DER A;  3B3R A;  4B1B A;  1LPF A;  2MNR A;  4TLZ A;  2V60 A;  1XS2 A;  3PWI A;  3CMM A;  3BHK A;  3ATR A;  5HYM A;  2PHH A;  1X2G A;  4TM1 A;  2BCP A;  3SN1 A;  2FKP A;  3UKF A;  1EL9 A;  3NRZ B;  2GR2 A;  3MQT A;  2NPX A;  3URH A;  1DTN A;  1K0J A;  2BK5 A;  3SGL A;  2YG6 A;  2YR6 A;  1FO4 A;  2CFY A;  3GYJ A;  4REK A;  2XDO A;  4O5Q A;  2B9Y A;  4HNC A;  1GPE A;  4TM4 A;  2YG3 A;  3AYJ A;  4KPR A;  1PS9 A;  3I4K A;  4U8N A;  1B37 A;  2XLU A;  3RHA A;  2XLT A;  4OPL A;  3QSS A;  3OZ2 A;  3GWD A;  3UGV A;  1SJA A;  3CTY A;  1FFU C;  2GH5 A;  1BKW A;  4KPL A;  4Y4N A;  4Z2R A;  3OTR A;  4Z2U A;  3GDP A;  4EMI A;  3EAO A;  4XWZ A;  1JRP A;  1N63 C;  1DJN A;  3VRA A;  5FJP A;  3NGC X;  1GV4 A;  3SQS A;  2Z5Y A;  4KEM A;  2HXT A;  5FS7 A;  5U63 A;  3UXL A;  4A6N A;  3UCL A;  2YLR A;  1GRF A;  4II2 A;  3NZG A;  1GRG A;  3L5O A;  3L8K A;  2HZG A;  1L9D A;  4HCD A;  5KVH A;  4B68 A;  5GSN A;  2ARD A;  4UP3 A;  3OZY A;  3UJ2 A;  1KNR A;  3CND A;  4K22 A;  2J3N A;  5JCL A;  3N6J A;  2AR8 A;  4YSX A;  3DGZ A;  3P4S A;  1KF6 A;  4H2H A;  3CGB A;  4TVW A;  3NNE A;  2WEU A;  2GGH A;  2GV8 A;  2BRY A;  3NTD A;  1GEU A;  1ELS A;  3B9J B;  2P8C A;  5EB5 A;  3KD9 A;  3TCS A;  3B97 A;  4Y4L A;  1NU5 A;  2PCE A;  3EKG A;  2XVH A;  3AE2 A;  4GAP A;  4NZH A;  2OKT A;  1BQG A;  5GRT A;  5KMR A;  1D4E A;  1ZKQ A;  2VRL A;  3Q9T A;  3CN8 A;  3EEZ A;  4H4W A;  3SJN A;  4FP1 A;  4J57 A;  2QAE A;  3GD4 A;  3AEG A;  3R9U A;  1B4V A;  1L8P A;  3UKA A;  5EU9 A;  2JB2 A;  4DSG A;  2X3N A;  4Z25 A;  2GF3 A;  5KOX A;  5KVI A;  3HYV A;  1UKV G;  4JHM A;  1LQT A;  3UOV A;  1D7Y A;  1PN0 A;  2PA6 A;  3VFC A;  1LV0 A;  1PJ7 A;  1E1L A;  2B9W A;  1N60 C;  2PGW A;  4CBQ A;  5J04 A;  4JN7 A;  3VC6 A;  2FJB A;  1X2H A;  3QJ4 A;  4B63 A;  2QGY A;  4EM3 A;  4HA6 A;  2TMD A;  4K2X A;  3AE7 A;  1ZP0 A;  1E1K A;  1KSU A;  3T4W A;  3R0U A;  3UJR A;  1CF3 A;  3DG3 A;  2R46 A;  1MOK A;  4CCR A;  1PXB A;  2XH0 A;  3DDM A;  2APG A;  3RP6 A;  4GGH A;  3AD8 B;  1F3P A;  5FS8 A;  3UKH A;  3FPZ A;  3GO2 A;  2CDU A;  3TWB A;  2OX4 A;  2YR4 A;  2YAU A;  3A7A A;  4H7U A;  1YQZ A;  3PS9 A;  3KPK A;  5M0Z A;  1PBB A;  3AE9 A;  3QSE A;  4FX9 A;  2OO6 A;  4JY3 A;  1LQU A;  4A6N B;  5EOW A;  1F8W A;  1ELI A;  3NFU A;  4H4T A;  1PXC A;  4H2R A;  2PS2 A;  3NTA A;  2V3B A;  2BS4 A;  2E5V A;  1JNR A;  3MSY A;  3CGE A;  4NEW A;  1LVL A;  4H4U A;  3HZL A;  5ER0 A;  1PBC A;  1REO A;  3DGB A;  2Q0K A;  3JZU A;  4BV6 A;  1STZ A;  1ZOY A;  3NT6 A;  3DG6 A;  4KT2 A;  3LZW A;  4U2L A;  4MMW A;  4WCT A;  3G5Q A;  3EAN A;  5BUK A;  3DFH A;  3DME A;  4TM0 A;  4PAB A;  1GRE A;  4ZCC A;  3TTE A;  3QFB A;  1BF3 A;  2NQL A;  3TWA A;  3NLC A;  1PHH A;  3QPE A;  4EMW A;  2YLT A;  3S61 A;  1D4D A;  4NTD A;  4USR A;  1FEA A;  1VQZ A;  3VR9 A;  3AM9 A;  1JRO A;  2DW7 A;  1Y0P A;  4M52 A;  2PTY A;  1WUF A;  4ENL A;  1P48 A;  1FCD A;  2PGE A;  4HPN A;  1EC7 A;  4K7Z A;  3D8X A;  5FS6 A;  1YY5 A;  1DOD A;  2FJA A;  3SN4 A;  2CUL A;  5KOW A;  4KWS A;  4CY8 A;  2QDE A;  3IK4 A;  3ICS A;  1R0M A;  4BJZ A;  1L9C A;  1IJH A;  3Q6J A;  2X8G A;  3DK9 A;  3VA8 A;  1CJ2 A;  2BXR A;  4U8I A;  3ICT A;  3VRD B;  3F8R A;  2YG7 A;  1MO9 A;  2PYX A;  2HQM A;  2B7S A;  2GAG B;  4ECH A;  1H6V A;  3FYY A;  4DSH A;  2BXS A;  3H8A A;  4F4R A;  3GRT A;  2OLN A;  1BKH A;  1GSN A;  3F8P A;  3V76 A;  4GDP A;  1OJT A;  4I59 A;  4OPI A;  2WDV A;  2XLP A;  3C4A A;  3CB3 A;  3UCD A;  3H8I A;  3HYW A;  4AOX A;  2JB3 A;  3VC5 A;  2I5Q A;  3TOY A;  5KRQ A;  1S2Y A;  4H4R A;  1JOA A;  4G8T A;  1SB3 B;  3P1W A;  3QVR A;  4FK1 A;  5KWF A;  2GVC A;  4EIP A;  3I6D A;  3P4Q A;  3P4R A;  4X4J A;  3N6H A;  1TZZ A;  2YQU A;  2MUC A;  4GDE A;  2GMJ A;  4RSL A;  2NVK X;  1RSG A;  5JCN A;  3UTG A;  3S5W A;  3DJJ A;  2XSX A;  3P93 A;  2XFO A;  3TJ4 A;  4U8L A;  2XFQ A;  3NG7 X; 
#chains in the Genus database with same CATH homology
 4J31 A;  3ALJ A;  1COY A;  2Z5Y A;  3UKQ A;  1K0I A;  3ISH A;  2CVJ A;  5JCM A;  5FS7 A;  1W4X A;  2R4J A;  1Q9I A;  5U63 A;  4Z2T A;  4H2N A;  4IV9 A;  3T2Y A;  1P2E A;  1L9E A;  4X9M A;  4A6N A;  5C2T A;  3UKP A;  5EB4 A;  1RP0 A;  1ZMC A;  3K7Q X;  2XVI A;  2YLZ A;  3UCL A;  1IUW A;  1CL0 A;  1S2Q A;  4H4V A;  2YLR A;  3ADA B;  1GRF A;  5KMS A;  2TPR A;  4H2Q A;  4II2 A;  3RP8 A;  1GRG A;  3L5O A;  3L8K A;  3E1T A;  4XXG A;  4OPG A;  2BAB A;  3SFD A;  3UP4 A;  5JCK A;  1F8R A;  1KFY A;  1QO8 A;  4BK3 A;  1L9D A;  3T14 A;  5KVH A;  5KXJ A;  3KVE A;  3BI5 A;  4B68 A;  2WOV A;  3AB1 A;  4EQR A;  5GSN A;  3G5S A;  2ARD A;  4UP3 A;  2F5Z A;  1KNR A;  4H4S A;  3GD3 A;  3DK4 A;  3IHM A;  4E0V A;  3VRB A;  1TDN A;  3GDN A;  2BA9 A;  5L46 A;  1GRT A;  1OJ9 A;  3CND A;  4K22 A;  3IWA A;  2J3N A;  5JCL A;  3AE6 A;  4CY6 A;  2AR8 A;  2IID A;  4FDC B;  4YSX A;  4BK2 A;  4JQ9 A;  3DGZ A;  1D5T A;  3VQR A;  3ICR A;  1Q1W A;  4GCM A;  3P4S A;  1KF6 A;  4AP3 A;  1CJ3 A;  2A87 A;  3CGB A;  2WDQ A;  3NNE A;  4H4Z A;  2WEU A;  2E1M A;  1N4U A;  3CPH G;  2ACZ A;  2DKH A;  4EQS A;  4U2S A;  2WU5 A;  1NHR A;  2GV8 A;  2BRY A;  3FIM B;  3NTD A;  2WQY A;  4NNJ A;  1GEU A;  4YSH A;  2GRT A;  2YLS A;  4II3 A;  1DNC A;  4CCQ A;  5IPY A;  1PDH A;  3II4 A;  1M6I A;  3SM8 A;  1O5W A;  3EF6 A;  4EQW A;  2OA1 A;  1Y56 B;  4UDQ A;  2IVD A;  2XYO A;  2WOW A;  5EB5 A;  3KD9 A;  2EQ7 A;  2OLO A;  2XFP A;  3CIR A;  3NIX A;  1ZDL A;  1TDE A;  3BI4 A;  4Y4L A;  1Q1R A;  3NK2 X;  3SZF A;  3IF9 A;  2XVH A;  3AE2 A;  1VDC A;  4EMJ A;  4YTN A;  2FJE A;  4GAP A;  2C3D A;  3T2Z A;  1ONF A;  4CNK A;  2XLS A;  3ABV A;  4U8P A;  4A7A A;  4NZH A;  1JEH A;  4UDP A;  1KSS A;  1L0V A;  5GRT A;  1LTX R;  4EIQ A;  3LXD A;  5KMR A;  1NG4 A;  2WS3 A;  4OPT A;  1D4E A;  1ZKQ A;  2VRL A;  5BVA A;  3Q9T A;  3CN8 A;  4BK1 A;  3RED A;  4H4W A;  5KMQ A;  4YSY A;  3UOX A;  4J57 A;  2QAE A;  2WPC A;  3GD4 A;  3AEG A;  1IUS A;  2EQ6 A;  1B4V A;  3GYX A;  3M13 A;  4U8K A;  1XDI A;  3LB8 A;  4TM3 A;  4YTM A;  3AEB A;  1KNP A;  3UKA A;  4JNQ A;  2E4G A;  2JB2 A;  2YR5 A;  4DSG A;  4N9X A;  2X3N A;  4Z25 A;  5M10 A;  1VG0 A;  2JB1 A;  1LJ1 A;  4IA6 A;  4EM4 A;  2GF3 A;  3BI2 A;  1DXL A;  2R0C A;  2IVE A;  2WP6 A;  5KOX A;  5KVI A;  1GRH A;  3GMC A;  3HYV A;  1UKV G;  2B7R A;  4OPD A;  2BC1 A;  2GR0 A;  2B9X A;  3DA1 A;  1OJC A;  1P2H A;  5JRB A;  2XVJ A;  1LQT A;  3UOV A;  4NWZ A;  4C3X A;  1D7Y A;  2C75 A;  1PN0 A;  2C64 A;  2GEW A;  2VVM A;  2WDR A;  5HHF A;  1FOH A;  1LV0 A;  3NK1 X;  1PJ7 A;  3G5R A;  1ZX9 A;  3GWF A;  1E1L A;  2B9W A;  1YQ4 A;  2X8C A;  1RYI A;  1H86 A;  2YLX A;  4K5S A;  4CBQ A;  3ATQ A;  3M12 A;  4J34 A;  1NHQ A;  1TDF A;  4OVI A;  3PO7 A;  2C73 A;  4G6H A;  5CQF A;  5HY5 A;  1GOS A;  2FJB A;  4Z43 A;  4EQX A;  3NYE A;  1PBD A;  2ZBW A;  1YKJ A;  3BNM A;  3QJ4 A;  4B63 A;  1FL2 A;  1Y56 A;  4EM3 A;  2JAE A;  2V61 A;  2ZZC A;  2I0Z A;  3RP7 A;  1E39 A;  2JBV A;  4HA6 A;  2TMD A;  1IUV A;  4K2X A;  2RGO A;  4U2T A;  4B66 A;  4P9S A;  3AE7 A;  1ZP0 A;  4RG4 A;  5CKU A;  2C4C A;  1NEK A;  1NG3 A;  2GAH B;  1B5Q A;  1E1K A;  2OAL A;  4RG3 A;  1KSU A;  4YKG A;  4GUV A;  3KLJ A;  3K7T A;  4AP1 A;  3NHO X;  1QLB A;  2B76 A;  4D04 A;  1CF3 A;  3AE5 A;  3LZX A;  1XPQ A;  5U25 A;  3DJE A;  3KKJ A;  4DGK A;  3DJG X;  2R46 A;  2OAM A;  4AOS A;  4B65 A;  2VVL G;  1MOK A;  4C3Y A;  4CCR A;  4JY2 A;  1PXB A;  4ZN0 A;  2BRA A;  3LJP A;  5FS9 A;  2V6O A;  4NTE A;  2V3A A;  2R4E A;  2APG A;  3CGD A;  3C96 A;  3NKS A;  4G9K A;  2A8X A;  2FBW A;  2GB0 A;  3RP6 A;  2VRM A;  2GR1 A;  1DOC A;  1MXT A;  3AD8 B;  1F3P A;  5FS8 A;  3UKH A;  3FPZ A;  1GND A;  3AYI A;  4A79 A;  2CDU A;  3AEA A;  1E1N A;  1M64 A;  2YR4 A;  4NEV A;  2Q6U A;  1N4W A;  2YAU A;  3CNS A;  3SX6 A;  2W0H A;  4H7U A;  1YQZ A;  2WU2 A;  4XWR A;  3PS9 A;  3IHG A;  1H83 A;  4JDR A;  1EL7 A;  3KPK A;  3AE8 A;  5M0Z A;  4H2P A;  5JCI A;  1PBB A;  1TRB A;  2YWL A;  3AE9 A;  3FMW A;  3QSE A;  2BAC A;  3V3O A;  5KMP A;  4FX9 A;  4JY3 A;  4K8D A;  1S3E A;  2YG4 A;  1LQU A;  5EOW A;  4HB9 A;  4A6N B;  4Z26 A;  5U1O A;  3KA7 A;  1F8W A;  4IA5 A;  1JNZ A;  1ELI A;  1GES A;  3RNM A;  3CPI G;  3DJD A;  3LOV A;  2H88 A;  4H4T A;  5FMH A;  4A99 A;  1BZL A;  1O94 A;  2C70 A;  1PXC A;  1H2I A;  4NTC A;  4H2R A;  3D1C A;  2C65 A;  4GRT A;  3AED A;  3UP5 A;  3O0H A;  1Z6L A;  3OC4 A;  2Q0L A;  3NTA A;  2V3B A;  1NHS A;  2BS4 A;  2E5V A;  2WES A;  3NH3 X;  1GTH A;  2WP9 A;  4H50 A;  4APN A;  1JNR A;  5DBJ A;  1B8S A;  3CGE A;  4NEW A;  2YLW A;  3AXB A;  2XVF A;  2XFU A;  1LVL A;  4H4U A;  1FEB A;  4I58 A;  3SFE A;  5IQ4 A;  3HZL A;  4GR1 A;  5LV9 A;  3UKK A;  4KX6 A;  5ER0 A;  4YXD A;  1PBC A;  1REO A;  2Q0K A;  2GMH A;  4BV6 A;  1GTE A;  1ZOY A;  2DKI A;  2YM1 A;  1CHU A;  3P9U A;  1AOG A;  3NT6 A;  1PXA A;  4U8J A;  2AAQ A;  2XVE A;  4LII A;  2C7G A;  5J7X A;  1K0L A;  1XHC A;  2YVG A;  3LZW A;  1TDO A;  1O95 A;  2C66 A;  2YVJ A;  4U2L A;  4WCT A;  1PBE A;  3G5Q A;  2WOI A;  2WPE A;  1GET A;  3EAN A;  5BUK A;  1VG9 A;  3F8D A;  4G6G A;  3CNJ A;  1ZY8 A;  2R0P A;  3ALM A;  2X8H A;  2WHD A;  1GRE A;  1JRX A;  3DME A;  1ZOV A;  3GYI A;  4PAB A;  3QFB A;  4TM0 A;  4C77 A;  1IUX A;  3L1R A;  1CC6 A;  3AD9 B;  1CC2 A;  1TYT A;  1GRA A;  2YVF A;  3SQP A;  1BF3 A;  2BYB A;  1VQW A;  1KDG A;  4B67 A;  3WE0 A;  1H81 A;  3FBS A;  4A9W A;  1F8S A;  2JKC A;  3AYL A;  1SEZ A;  1VRQ B;  4YTP A;  3KPF A;  4B64 A;  3NYF A;  3IC9 A;  2VVL A;  1XAN A;  1PHH A;  1DJQ A;  3NLC A;  5C3J A;  1E1M A;  4EMW A;  2Q7V A;  2YLT A;  4A65 A;  4IVM B;  3S61 A;  1GRB A;  2WP5 A;  1H84 A;  4C74 A;  1D4D A;  4NTD A;  3H4K A;  4USR A;  1FEA A;  2XLR A;  3LAD A;  1NEN A;  2EQ9 A;  5IQ1 A;  2GR3 A;  3AEF A;  1EL8 A;  3VR9 A;  2ZZB A;  4H4Q A;  4IVO B;  1X31 B;  4BJY A;  3ALL A;  3T31 A;  4AT0 A;  4X9N A;  3BNU A;  4LU6 A;  2C3C A;  5TR3 A;  1EBD A;  1CJC A;  1PJ5 A;  4M52 A;  1Y0P A;  4U8O A;  3AEC A;  3UTE A;  4A5L A;  3GRS A;  1JU2 A;  3T0K A;  2RGJ A;  2WET A;  1FCD A;  1GAL A;  3AE4 A;  4LA1 A;  4J33 A;  2VQ7 A;  2YG5 A;  3EPT A;  4BUR A;  4H4Y A;  2Y6Q A;  4B69 A;  4Z24 A;  3AEE A;  1E6E A;  2QA1 A;  3CNT A;  2BS3 A;  2X50 A;  4J36 A;  1K4Q A;  1S3B A;  2XFN A;  4YSZ A;  1OJA A;  3SXI A;  1NAA A;  4K7Z A;  3CNP A;  1IUU A;  2WBA A;  3CGC A;  5FS6 A;  1YY5 A;  2A89 A;  1DOD A;  3DH9 A;  2FJA A;  2R45 A;  2Y6R A;  3K7M X;  3NRN A;  4GF7 A;  3ZYX A;  2CUL A;  2R0G A;  4PAA A;  4WX1 A;  2VOU A;  4J2W A;  4K5R A;  3B6D A;  3UOY A;  4CY8 A;  5KOW A;  3P4P A;  3NK0 X;  2C76 A;  2R9Z A;  2RAB A;  1V59 A;  1KN0 A;  2BC0 A;  3ICS A;  4OPC A;  4BJZ A;  1YQ3 A;  1ZK7 A;  3D8X A;  3QVP A;  2BCG G;  1H82 A;  5BUL A;  1QJD A;  3AWI A;  4C5O A;  2Z5X A;  3D9X A;  1L9C A;  3M0O A;  1IJH A;  3Q6J A;  1H7W A;  3ZDN A;  4J56 A;  2X8G A;  3DK9 A;  4CNJ A;  4ICY A;  1CJ2 A;  2BXR A;  5J60 A;  4U8I A;  4Y4M A;  2X99 A;  1PBF A;  2QA2 A;  3ICT A;  1JRY A;  1GXF A;  3F8R A;  3VRD B;  3SZW A;  2UZZ A;  3UTH A;  4OPU A;  2YG7 A;  1MO9 A;  3NN0 X;  2XCG A;  4D03 A;  1BGN A;  3ITJ A;  4TLX A;  1CC4 A;  2PYX A;  4H4P A;  4CRT A;  1TYP A;  1BGJ A;  2HQM A;  5KNL A;  3C4N A;  3DGH A;  1DOE A;  3DK8 A;  2B7S A;  2GAG B;  3QFA A;  3K30 A;  4ECH A;  2RGH A;  1H6V A;  4G73 A;  3NN6 X;  4Z44 A;  3B3R A;  1NDA A;  3T2K A;  4B1B A;  3T37 A;  3AD7 B;  1OJD A;  1LPF A;  4USQ A;  4U8M A;  3UKL A;  4DSH A;  2BXS A;  4TLZ A;  1DOB A;  2V60 A;  3I3L A;  4YT0 A;  3GRT A;  2VZ2 A;  2GQF A;  1ZMD A;  3GSI A;  3CMM A;  2OLN A;  1BWC A;  3BHK A;  1D7L A;  2FJD A;  1CBO A;  1S7M A;  1FEC A;  1GSN A;  3NYC A;  1N1P A;  1GER A;  2V5Z A;  3F8P A;  2JK6 A;  3ATR A;  4DNA A;  3H8L A;  4GDP A;  3SZC A;  3UTF A;  3V76 A;  5HYM A;  2PHH A;  3VR8 A;  1OJT A;  4I59 A;  4OPI A;  4TM1 A;  2WDV A;  2XLP A;  3C4A A;  2BCP A;  1E7P A;  4ZCC A;  5HXI A;  3SZ0 A;  4G74 A;  2O9Z A;  3FG2 P;  3UKF A;  1EL9 A;  4JN9 A;  3H8I A;  3HYW A;  2GR2 A;  3R9U A;  3CPJ G;  1N4V A;  1F6M A;  2NPX A;  3URH A;  4JNA A;  1K0J A;  4AOX A;  2BK5 A;  2C67 A;  2JB3 A;  1H7X A;  4FK1 C;  3SGL A;  3PVC A;  2YM2 A;  2YG6 A;  2YR6 A;  5KRQ A;  3AE3 A;  4YKF A;  1S2Y A;  4H4R A;  1CJ4 A;  1JOA A;  4ADW A;  2CFY A;  3GYJ A;  4REK A;  2XDO A;  5EBK A;  4MJW A;  3P1W A;  3QVR A;  1GT8 A;  4FK1 A;  4O5Q A;  2B9Y A;  1GPE A;  3AE1 A;  3GMB A;  4TM4 A;  3KU9 A;  1NHP A;  3SYI A;  5KWF A;  2GVC A;  4YWO A;  4EIP A;  1NPX A;  3I6D A;  3P4Q A;  3P4R A;  4X4J A;  2YG3 A;  2YQU A;  3AYJ A;  4GDE A;  2GMJ A;  4KPR A;  2H89 A;  1EL5 A;  1D4C A;  3QSM A;  1HYU A;  3UOZ A;  1PS9 A;  4RSL A;  4U8N A;  1B37 A;  1JRZ A;  2XLU A;  3RHA A;  2XLT A;  4OPL A;  2VQB A;  2GQW A;  3QSS A;  2BK3 A;  2AQJ A;  3GWD A;  3OZ2 A;  2NVK X;  2WPF A;  1RSG A;  3CTY A;  2GH5 A;  3V3N A;  1BKW A;  5JCN A;  4Y4N A;  4ZCD A;  3SY4 A;  4Z2R A;  2ZZ0 A;  1TDK A;  1IUT A;  4Z2U A;  3GDP A;  4EMI A;  3EAO A;  3BHF A;  4O5U A;  4OCG A;  4XWZ A;  2BK4 A;  3S5W A;  2C72 A;  3UTG A;  5BRT A;  4AT2 A;  3DJJ A;  2QCU A;  4H4X A;  4UDR A;  2BS2 A;  1DJN A;  3VRA A;  3HYX A;  3PG6 A;  2XFO A;  3COX A;  3NGC X;  1PJ6 A;  4GAV A;  2EQ8 A;  3JSK A;  1GV4 A;  4U8L A;  2XFQ A;  3NG7 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...