1NPXA

Structure of nadh peroxidase from streptococcus faecalis 10c1 refined at 2.16 angstroms resolution
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title Structure of NADH peroxidase from Streptococcus faecalis 10C1 refined at 2.16 A resolution.
pubmed rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase(h2o2(a))
total genus 140
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1991-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1npxA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1npxA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1npxA02
2Y6QA 2R45A 2ZBWA 5C2TA 2WEUA 2YAUA 3NKSA 3GD3A 5FS7A 1PDHA 2FBWA 3C96A 3NN0X 4UDQA 1F8SA 4B68A 4N9XA 2BXSA 1N4VA 5JCIA 1L0VA 3O0HA 4Z44A 4A9WA 1DOBA 1FL2A 2E4GA 2BABA 1CJ4A 3LXDA 4K7ZA 2XFQA 3KPFA 4H2RA 3NHOX 4NTDA 3V3NA 2JK6A 4J33A 4O5UA 1NG4A 3BNMA 1CC6A 4H2NA 3DJEA 4IA5A 1DJQA 2Q0LA 3P9UA 3D8XA 4ECHA 1BKWA 3RP6A 1GOSA 3QSSA 2GMHA 2QCUA 1JRZA 3P4PA 2Z5YA 4A99A 3CNPA 2FJBA 4LA1A 3AEAA 1SEZA 4DSGA 2BYBA 4H4TA 4YTPA 1TDNA 2GMJA 3CGEA 4EM3A 2EQ7A 4GDPA 5FS9A 2FJAA 4HB9A 4EIQA 3T37A 4RSLA 1XPQA 2QA1A 1GRTA 4WX1A 1E1LA 4XXGA 1FEBA 3GWFA 1L9DA 1ZK7A 4Z2RA 1D4EA 4GCMA 4CRTA 5GSNA 3VRAA 3UTHA 3FG2P 4MJWA 4OCGA 2C67A 3E1TA 1B37A 4FX9A 4I58A 1O5WA 1PBCA 4OVIA 1PN0A 1NDAA 5ER0A 2CVJA 2GAGB 4LU6A 3ZYXA 2V6OA 3D1CA 1GXFA 4APNA 3VR9A 2YM1A 3AE1A 4UDPA 3UOVA 2X8CA 4GR1A 3VRBA 4IV9A 4X9MA 1ZMDA 3DJJA 2ZZ0A 3AE8A 3NIXA 4H4RA 2JKCA 1PXBA 4O5QA 1XDIA 1KSSA 3SFEA 3GSIA 1PJ7A 3NYEA 4UDRA 4BJYA 3GMBA 4TM4A 1CC2A 3SGLA 3QFAA 1CJ3A 4HA6A 2ACZA 1JOAA 3FBSA 4OPDA 1X31B 4BK3A 3P4SA 1EL9A 3CGCA 3H4KA 1S3BA 2OAMA 1NAAA 3QVPA 3QVRA 4GUVA 4IVMB 5C3JA 2B9WA 3OZ2A 4CY8A 4EQSA 1KNRA 3KLJA 2ARDA 3DK8A 1CBOA 2BCPA 1L9EA 3CN8A 3LZWA 2ZZBA 2GV8A 1GRBA 3NGCX 1E1MA 1KDGA 1CHUA 2CDUA 3II4A 2E5VA 3IF9A 4YSYA 4NTCA 1JU2A 4CCQA 1B8SA 3AE7A 1YKJA 3JSKA 1GETA 4Y4NA 2WP5A 1ELIA 1H84A 3SM8A 2F5ZA 4H2QA 1F8WA 2XCGA 2WHDA 5EB5A 4AT0A 2OALA 1PS9A 1YQ4A 1NHPA 5EBKA 1IUSA 4A5LA 1Q1RA 3ICTA 1GPEA 1MO9A 2BS3A 2YG4A 3GWDA 3UKAA 1TDEA 3NYCA 1O95A 1PHHA 3QSEA 2Q0KA 3CNTA 3AD8B 1PXCA 3NRNA 4TM0A 3QFBA 2XDOA 4EMWA 2IIDA 2WP9A 1Q1WA 1DOEA 4TM3A 4YKFA 5TR3A 4Y4LA 3ZDNA 3UKKA 3FMWA 1H7WA 3NK0X 1M6IA 3AXBA 2Q6UA 4A65A 2X50A 4H4SA 3ATRA 1IUVA 5HYMA 4JDRA 2RGHA 2WDVA 3GD4A 4M52A 1OJDA 2BXRA 4OPLA 1ZMCA 2VVLG 2UZZA 4Z24A 1NHSA 2WESA 2C64A 4XWRA 2YG5A 2CULA 2Z5XA 1YY5A 1H7XA 4YWOA 1CC4A 3NH3X 4I59A 3R9UA 1NPXA 2GH5A 3G5QA 1FCDA 1PBFA 2RGJA 3IWAA 4K22A 2B9YA 2XYOA 4RG3A 2YLZA 2GR3A 2GQWA 3GRSA 1IUWA 2WU5A 3F8DA 1LVLA 1IUUA 3G5RA 3VR8A 3WE0A 4H4VA 2TPRA 1VRQB 2V61A 1IUXA 5KOWA 3UOXA 3GDPA 3AECA 3I6DA 2X8GA 2YR6A 1CF3A 4NEVA 3F8RA 2YLSA 2VRMA 4EQXA 3UKPA 4YKGA 4EQRA 2AR8A 2WQYA 5IQ4A 2R0PA 4WCTA 4U8LA 3LADA 5BULA 2DKIA 2VVMA 2VZ2A 2XFPA 4U8MA 5J60A 2DKHA 2J3NA 2XFNA 2Y6RA 2BC1A 5JCLA 4PAAA 1KSUA 3ATQA 3UP5A 4H2PA 1BWCA 3BI5A 4EMJA 1B4VA 4YTMA 3ADAB 5BRTA 4CY6A 2B7RA 4U8OA 1BGJA 4U8JA 1BF3A 2A89A 4EM4A 5L46A 3AEDA 3GRTA 1NENA 2R4EA 3PVCA 3CPHG 3RP8A 1JRYA 1MOKA 4DSHA 2WPCA 2AQJA 3H8IA 1LJ1A 3DK4A 1QJDA 3RNMA 4GF7A 1DNCA 5DBJA 3DK9A 4YSHA 1GT8A 1IUTA 4H4YA 2IVEA 4NTEA 4CCRA 3UOZA 2BACA 3AE3A 4J31A 1MXTA 2V3BA 1EL5A 3P4RA 4OPGA 4C5OA 1K4QA 2VRLA 3ALJA 2R46A 2XLRA 2YG3A 3IHMA 3COXA 1GALA 4ZCCA 4C3YA 1DXLA 1GRGA 1BGNA 3C4AA 4TLXA 1VDCA 2JB2A 3DH9A 3B6DA 4OPUA 3UTFA 1RP0A 2R0CA 5KVIA 3Q9TA 4PABA 4AT2A 4B67A 1F3PA 2HQMA 4JY2A 3V3OA 2XVJA 3REDA 1S3EA 3VRDB 2FJDA 1E1NA 1TDKA 3EAOA 2QA2A 1H86A 2XVEA 4IA6A 4ZCDA 2RABA 4U2SA 1B5QA 1D7LA 1N4UA 3CPIG 2YLWA 2XFOA 5JCNA 3H8LA 5M10A 3QJ4A 1K0LA 1TYTA 1TDFA 3ALLA 5U63A 3SQPA 2NVKX 4DNAA 3L1RA 3NT6A 3M12A 2PHHA 4YXDA 1GRAA 3NNEA 2EQ9A 1TYPA 1H6VA 4CNKA 2GQFA 1H83A 1S2YA 2BK4A 3AEFA 3CNJA 2BCGG 1ZX9A 4EQWA 4C74A 4X4JA 2XLUA 1FEAA 1ZOYA 1N4WA 1OJAA 4GDEA 4C77A 2VOUA 3K7QX 4BK2A 3DGHA 3BNUA 2C66A 5M0ZA 1IJHA 1DOCA 2GR1A 3EF6A 1JNRA 1ZOVA 4U2TA 2YVJA 3PO7A 3S5WA 3M13A 2YQUA 4B64A 4YSZA 4REKA 2R0GA 5KOXA 4Z43A 4E0VA 2V5ZA 1FOHA 1L9CA 1XANA 1RSGA 5BUKA 4D04A 4YSXA 5BVAA 1EL8A 1PBDA 2V3AA 3AYJA 4BURA 4CNJA 3CNDA 4Z2UA 4NZHA 1QLBA 5U1OA 2APGA 4KPRA 2B9XA 2RGOA 2YLXA 2WOIA 3AD7B 3UTEA 2Q7VA 2TMDA 4J2WA 3ABVA 5CQFA 2YR4A 1GNDA 1NHQA 2NPXA 5LV9A 2OA1A 5JCKA 3P1WA 1KF6A 4ICYA 4H4QA 4K8DA 1RYIA 2VQ7A 3S61A 1ZDLA 2C7GA 4YTNA 4H4ZA 2EQ8A 4Z2TA 2C70A 2AAQA 1XHCA 3AEBA 4A6NA 3UP4A 2OLOA 1GRFA 2GB0A 1W4XA 2WBAA 2XVFA 2GRTA 2CFYA 4BJZA 2BC0A 3LOVA 1AOGA 1DODA 1JRXA 4J57A 2XVHA 2YM2A 3HZLA 1PJ6A 4TLZA 3UKHA 2B7SA 5HXIA 3UKQA 2JAEA 3CIRA 3QSMA 1GERA 2WPFA 4H4PA 4BV6A 1CJCA 1REOA 3GDNA 2YR5A 3DMEA 1GV4A 3BHKA 2YVFA 4JNQA 2R9ZA 2BK5A 3GYJA 1TDOA 3UCLA 4K5RA 3P4QA 1H82A 1LQTA 1H81A 3NTAA 3K30A 2O9ZA 4B65A 2I0ZA 2A8XA 1K0IA 2WETA 5JCMA 1GTEA 1Y56A 1D5TA 3I3LA 3UOYA 4U8NA 4BK1A 1EL7A 4J36A 3EANA 1PBEA 1OJTA 4OPTA 2C73A 4U8PA 3B3RA 1YQZA 2JB1A 1ZP0A 1ZKQA 2R4JA 3AEEA 4H7UA 5FS8A 2C75A 1Y0PA 5IPYA 4CBQA 2H88A 3CTYA 3K7TA 3AYIA 4DGKA 4B66A 5KWFA 4FDCB 4H4UA 3Q6JA 1OJCA 3AD9B 3KKJA 3KU9A 1LPFA 1ZY8A 4AP3A 5HY5A 4EMIA 2OLNA 2ZZCA 3KA7A 4ADWA 3C4NA 3NTDA 1F8RA 3GMCA 3LZXA 5J7XA 1PJ5A 4U2LA 3AE2A 4Z26A 3OC4A 2GAHB 1GREA 2YG6A 2C72A 4UP3A 1GTHA 3IHGA 3NK1X 3EPTA 3F8PA 5EB4A 1PBBA 1VG0A 2BA9A 3AYLA 5U25A 1KFYA 3AWIA 4P9SA 2GR2A 4USRA 4JQ9A 2WOVA 5KXJA 2PYXA 4A6NB 2BS2A 3FPZA 2C65A 2XLPA 2YLTA 2C3CA 3KVEA 3GYIA 4B63A 4D03A 3G5SA 1NHRA 1DJNA 4Y4MA 2BK3A 4B69A 3LB8A 5KRQA 2W0HA 3NN6X 3IC9A 1LTXR 4U8KA 4AOXA 2WOWA 1O94A 2GF3A 3BHFA 2WDQA 4JY3A 1Q9IA 1JEHA 1HYUA 1CL0A 1VQWA 4K2XA 2BS4A 3KD9A 1D4CA 1COYA 1E1KA 3AE5A 2WDRA 1N1PA 1UKVG 4JNAA 1E6EA 4EIPA 3AE6A 2FJEA 2A87A 4J56A 3FIMB 4C3XA 1K0JA 3AEGA 4ZN0A 2YLRA 4AOSA 5FS6A 3VQRA 3AE9A 3NLCA 3RP7A 1BZLA 5CKUA 3PS9A 4A7AA 1ONFA 3AB1A 4OPCA 3L8KA 2GEWA 3RHAA 1GRHA 2YVGA 1LV0A 4JN9A 4U8IA 3M0OA 5FMHA 2E1MA 1P2HA 3UKFA 1Y56B 1PXAA 1FECA 1GESA 1YQ3A 1F6MA 3BI2A 1CJ2A 1V59A 3AE4A 1NEKA 5GRTA 2H89A 2WPEA 3LJPA 3K7MX 5IQ1A 4B1BA 2WU2A 2YWLA 3SFDA 4USQA 4XWZA 2C76A 4GRTA 2JB3A 4FK1A 2VQBA 4Z25A 3DA1A 2X8HA 1VG9A 3CGBA 3CGDA 3CPJG 4KX6A 2XFUA 3DGZA 5EOWA 1QO8A 3ICSA 5KVHA 1LQUA 1D4DA 2WS3A 2IVDA 2XVIA 1OJ9A 3ALMA 4J34A 4H4XA 2GVCA 2XLTA 3CNSA 4RG4A 3UKLA 3DJGX 3UTGA 1D7YA 4K5SA 1GSNA 2QAEA 1EBDA 1E39A 1KNPA 2XLSA 4OPIA 5HHFA 3ITJA 4YT0A 2V60A 3NYFA 3ISHA 3NK2X 4IVOB 2EQ6A 3ICRA 3DJDA 1NG3A 2VVLA 2YG7A 4FK1C 4H4WA 1TRBA 3URHA 2X99A 3NG7X 3V76A 2X3NA 4A79A 1S2QA 2C3DA 1JNZA 4TM1A 4AP1A 1Z6LA 2B76A 2GR0A 4X9NA 4H50A 1P2EA 1GEUA 4LIIA 1E7PA 2JBVA 3BI4A 1M64A 4NEWA 2WP6A
chains in the Genus database with same CATH superfamily
4ZA0A 2ZBWA 5C2TA 3NKSA 2FBWA 1RM6B 3NN0X 1F8SA 4B68A 1JRPA 1N4VA 4IHCA 3UJEA 2E4GA 4K7ZA 4KWSA 3KPFA 3B9JB 4HCDA 3BNMA 3DJEA 3P9UA 2OLAA 3R10A 3RP6A 1JRZA 2C4CA 3TCSA 4A99A 3CNPA 1SEZA 3I6EA 2GMJA 2GGIA 2EQ7A 5FS9A 3DFHA 4HB9A 1X2HA 2XH2A 2QA1A 1FEBA 3GWFA 1L9DA 4DHGA 4Z2RA 4OCGA 2C67A 1O5WA 2PPGA 4OVIA 1NDAA 2GAGB 4H2HA 3ZVHB 3D1CA 3VRBA 3DJJA 1JDFA 4H4RA 3DG6A 1XDIA 1KSSA 3GSIA 4UDRA 4BJYA 3RITA 1CJ3A 2ACZA 2P3ZA 3FBSA 1EC9A 4TVYA 1X31B 2OAMA 4GUVA 1EBGA 2B9WA 4CY8A 1KNRA 3KLJA 1L9EA 3MZNA 3II4A 1JU2A 3AE7A 1YKJA 2WP5A 2F5ZA 2XCGA 2WHDA 1YQ4A 1GPEA 1MO9A 3UCDA 2BS3A 4NWZA 1PHHA 3AD8B 2ZC8A 3QFBA 2QGYA 2OPJA 3THUA 3CK5A 1NU5A 3FMWA 5G5HB 3GO2A 3SN1A 3KPKA 1IUVA 5HYMA 4JDRA 4HPNA 1FHVA 4Z24A 2YG5A 1YY5A 3UGVA 3R9UA 1NPXA 2RGJA 4K22A 2XYOA 2YLZA 2GR3A 3GRSA 3VR8A 2WU5A 4H4VA 4E4UA 1VRQB 2V61A 3BSMA 3SSZA 1CF3A 3F8RA 4EWJA 3FCPA 4E4FA 2VVMA 2VZ2A 3IK4A 3CT2A 2DKHA 2J3NA 2XFNA 2Y6RA 2BC1A 4PAAA 4H2PA 3BI5A 1PDYA 3UXLA 4EMJA 1B4VA 3ADAB 3DERA 4CY6A 2B7RA 1BGJA 3T9PA 2A89A 3AEDA 3CPHG 1MOKA 3UJRA 1LJ1A 3RNMA 4HN8A 4YSHA 1GT8A 1IUTA 4CCRA 3UOZA 4YWSA 2V3BA 1KCZA 3HYXA 4C5OA 2CHRA 2XLRA 2YG3A 3COXA 4TLXA 1VDCA 3DH9A 3UTFA 1RP0A 3Q9TA 3NVWB 4AT2A 2W3RA 1TDKA 2RABA 1N4UA 2I5QA 2YLWA 3GD6A 3QJ4A 1K0LA 3GYXA 5U63A 4CNKA 2BK4A 1ZOYA 4NNJA 2C66A 5M0ZA 4REKA 2R0GA 5KOXA 3PG6A 5BVAA 3AYJA 4BURA 4CNJA 3T2KA 2B9XA 2APGA 5FJPA 3EKGA 2WOIA 2Q7VA 2TMDA 1EC7A 2QDEA 2YR4A 1KN0A 2OA1A 3DG3A 3P1WA 1JPMA 1KF6A 1VDVA 4YTNA 2C7GA 2EQ8A 2XSXA 2C70A 2AAQA 4A6NA 3UP4A 1W4XA 3Q45A 2PTXA 1AOGA 4TLZA 1JRXA 2YM2A 2XH4A 3UKHA 4DX3A 1PJ6A 3QSMA 4BV6A 1CJCA 2YR5A 4E8GA 3UCLA 1LQTA 1H81A 5BOFA 1BKHA 4B65A 1EC8A 3JW7A 1L8PA 3V3WA 3P0WA 3T6CA 1D5TA 3I3LA 4U8NA 4BK1A 2FYMA 1EL7A 4HNCA 1PBEA 4U8PA 3B3RA 1YQZA 2E5AA 3CMMA 3N6HA 2R4JA 4H7UA 5FS8A 3AMZA 2C75A 5IPYA 4FP1A 4DGKA 3A7RA 4B66A 2PSNA 4GIRA 4FDCB 4H4UA 3KU9A 3VCNA 1F8RA 1GTHA 3IHGA 1KKRA 2P88A 3A7AA 3AWIA 4P9SA 4USRA 2WOVA 2BS2A 3R25A 2C65A 3SBFA 1R6WA 3NN6X 1O94A 3BHFA 4JY3A 3H70A 1JEHA 2MUCA 1E6EA 5KNLA 3CB3A 1FFVC 1K0JA 4ZN0A 2YLRA 3VQRA 3AE9A 3NLCA 1BZLA 3UXKA 4OPCA 3ZLFA 2GEWA 1GRHA 2YVGA 4IL2A 6ENLA 3AM9A 1OEPA 2PMQA 2YWLA 3SFDA 2C76A 4GRTA 4ENLA 7ENLA 3SZCA 3ZVHA 5EOWA 3ICSA 5ENLA 3R1ZA 4RG4A 3UKLA 1GSNA 4OPIA 4K1WA 4JHMA 3VA8A 3NYFA 4IVOB 3ES8A 2EQ6A 3ICRA 4GMEA 4ZCWA 4TM1A 1JNZA 2GR0A 1GEUA 4LIIA 1E7PA 3BI4A 1M64A 4NEWA 2R45A 1PDHA 3C96A 4N9XA 2BXSA 3O0HA 4KPLA 3RR1A 3UJ2A 4A9WA 2OQYA 3TTEA 1CJ4A 4GISA 3V3NA 2JK6A 4J33A 1NG4A 3OPSA 1DJQA 2Q0LA 3UCCA 4ECHA 3IJIA 4MGGA 4LA1A 3T31A 4DSGA 3P3BA 2BYBA 4YTPA 1TDNA 4A35A 4EM3A 4GDPA 1GRTA 4ROPA 1E1LA 4H83A 4IL0A 1D4EA 5GSNA 3FXGA 3VRAA 1ZXIC 2PCEA 5ER0A 3K1GA 4FI4A 3L5OA 1GXFA 4APNA 3VR9A 3NO1A 4UDPA 3QN3A 4GR1A 4X9MA 1ZMDA 3FV9A 3NIXA 1PXBA 3GMBA 3QFAA 4HA6A 1KKOA 1EL9A 3QVPA 3QVRA 4IVMB 3RRAA 3OZ2A 3OTRA 4EQSA 1FO4A 3DK8A 1CBOA 3CN8A 3LZWA 3NGCX 1E1MA 2CDUA 4YSYA 4NTCA 3JSKA 1GETA 1ELIA 1H84A 3SM8A 2GGEA 4H2QA 1F8WA 2HXUA 5EB5A 1IUSA 1TDEA 3NYCA 2Q0KA 3R07C 2IIDA 3BOXA 4YKFA 2W55A 1WYGA 2Q6UA 2X50A 2PGWA 2OO6A 1OJDA 1JPDX 4OPLA 2UZZA 1NHSA 4XWRA 2Z5XA 3N4EA 3WE0A 2DW7A 2TPRA 3UOXA 2HZGA 2YR6A 4NEVA 2YLSA 4EQXA 3I4KA 4EQRA 4WCTA 3MUCA 4Z17A 3LADA 2BRAA 5BULA 1H2IA 3T2YA 5J60A 5JCLA 3HRDC 3P93A 4YTMA 3H12A 3OW1A 3HYWA 4IP5A 5L46A 2R4EA 3PVCA 1JRYA 2WPCA 1QJDA 4GF7A 1DNCA 2IVEA 4NTEA 3AN1A 2BACA 3DESA 4J31A 1EL5A 2PODA 3NFUA 2R46A 4ZCCA 3EUB3 5KVIA 3QKEA 4B67A 2HQMA 3REDA 2FJDA 1E1NA 2QA2A 2XVEA 3TWAA 1H86A 1D7LA 1JROA 2XFOA 3H8LA 5M10A 1TYTA 4DNAA 3NT6A 4YXDA 1GRAA 3NNEA 5FJTA 5KMSA 4C74A 4X4JA 2XLUA 3T14A 3DFYA 4GDEA 4C77A 4BK2A 3OZYA 2GR1A 3EF6A 1JNRA 2YVJA 1MDLA 4B64A 4YSZA 2PTZA 2V5ZA 3S5SA 1L9CA 1XANA 4D04A 4YSXA 1EL8A 3SYIA 1QLBA 5U1OA 2RGOA 4KPRA 3ABVA 4K2SA 5J04A 3IJQA 4K8DA 1RYIA 2VQ7A 3S61A 1ZDLA 4H4ZA 2PU1A 3NVZB 1GRFA 2WBAA 3T8QA 2XVFA 3VC5A 4G73A 3VCCA 3HPFA 1DODA 2XVHA 3ETRB 2JAEA 3CIRA 2WPFA 1REOA 3BJSA 3BHKA 2QDDA 3GYJA 4K5RA 2OVLA 4Z1YA 2GL5A 1K0IA 5KMQA 5JCMA 4H19A 5FJRA 3UOYA 1KD0A 3NVYB 1STZA 2P0IA 1ZKQA 3TJ4A 4CBQA 3CTYA 1MUCA 1DTNA 3K7TA 3AYIA 3DGBA 3KKJA 4MKSA 4AP3A 1LPFA 1ZY8A 2OLNA 2ZZCA 3NTDA 3GMCA 3LZXA 2POZA 5J7XA 3AE2A 4GAVA 3OC4A 1SJBA 2YG6A 2C72A 3F8PA 3DDMA 4JN7A 1PBBA 2BA9A 3PFRA 2PYXA 2XLPA 3KVEA 2C3CA 4Y4MA 1N5WC 4B69A 5KRQA 2W0HA 1LTXR 2WDQA 1HYUA 1CL0A 3ZLHA 2AL2A 1E1KA 1UKVG 4JNAA 4J1OA 1SJCA 2A87A 4J56A 4C3XA 5CKUA 3PS9A 1ONFA 3AB1A 2QJJA 1W6TA 3RHAA 4GYPC 2GSHA 4U8IA 2E1MA 1P2HA 1Y56B 1PXAA 3BI2A 1CJ2A 1NEKA 2H89A 3ENLA 2WPEA 3LJPA 3K7MX 3V5CA 3CPJG 2XFUA 5KVHA 1S7MA 4K8GA 4H4XA 4J3ZA 1D7YA 2GDQA 1KNPA 5HHFA 2XLSA 3ITJA 3NK2X 3DJDA 4FK1C 4H4WA 1TRBA 2X99A 4A79A 2X3NA 3FVDA 4MMWA 1S2QA 2RDXA 2B76A 4X9NA 4H50A 2JBVA 4KX6A 2Y6QA 2YAUA 3GD3A 4A6GA 1IYXA 1E9IA 1DOBA 2XFQA 3LXDA 4H2RA 4NTDA 4O5UA 4H2NA 1GOSA 2XH7A 1MRAA 2GMHA 3HYVA 2Z5YA 2FJBA 4HYRA 4H4TA 3SZ0A 3CGEA 1SJDA 3IJLA 1XPQA 4G6HA 4WX1A 2GGGA 3FYYA 4CRTA 3UTHA 3SZWA 4I58A 3MKCA 4FX9A 4X2PA 3E1TA 3NXLA 1PN0A 2PP1A 4LU6A 3U9IA 3AE1A 3T2ZA 1XS2A 1PDZA 4O5QA 2OQHA 4TM4A 4GGHA 3SGLA 3SR6B 1JOAA 4OPDA 4BK3A 3P4SA 1S3BA 5C3JA 1NAAA 2ARDA 2ZZBA 3RGTA 3IF9A 4CCQA 1B8SA 3B97A 2O56A 4AT0A 2OALA 1VQZA 1FHUA 1P43A 3UJSA 4A5LA 1NHPA 1Q1RA 3ICTA 3PWIA 2YG4A 1NELA 1PXCA 2XDOA 1DOEA 2OKTA 4Y4LA 2XGZA 2OZ3A 3QTPA 3UKKA 2OG9A 1H7WA 3HW2A 3NK0X 1M6IA 3AXBA 3ATRA 2RGHA 3GD4A 4M52A 4G8TA 1ZMCA 2FKPA 1FFUC 2WESA 2C64A 5KMRA 3SZFA 1PBFA 3ZVIA 1LVLA 3G5RA 3SY4A 2OZ8A 3GDPA 3AECA 2X8GA 4YKGA 3UKPA 2AL2B 4M6UA 5IQ4A 3D46A 1N5XA 2DKIA 2XFPA 3D47A 3QLDA 1KSUA 3ATQA 3UP5A 4IT1A 2GGHA 4U8OA 2AL1A 4A3RA 1RVKA 5IDZA 1NENA 3CXBA 3H8IA 1JCTA 5DBJA 3TOYA 1V97A 3AE3A 1MXTA 3Q4DA 3P4RA 4OPGA 3ALJA 2PA6A 4Z26A 4C3YA 3IHMA 1DXLA 1GRGA 2JB2A 3B6DA 2R0CA 4JY2A 2XVJA 3VRDB 4IA6A 4ZCDA 4HCHA 4U2SA 3CPIG 5JCNA 3MY9A 3OP2A 3M12A 2GQFA 1ECQA 3CNJA 3AEFA 4EQWA 1FEAA 1OJAA 3FJ4A 1X2GA 2VOUA 3BNUA 4DN1A 1IJHA 4U2TA 3S5WA 3PO7A 3M13A 2YQUA 3SXIA 2PS2A 3N6JA 1FOHA 5BUKA 1PBDA 2OX4A 2V3AA 3T0KA 4Z2UA 2YLXA 1YEYA 3UTEA 4J2WA 1GNDA 1R0MA 4ICYA 1XHCA 3AEBA 2OLOA 2GB0A 2P8BA 1F9CA 4BJZA 2BC0A 4J57A 5HXIA 4TVWA 4H4PA 2NQLA 3DMEA 4KT2A 2R9ZA 2BK5A 1H82A 3NTAA 3K30A 2O9ZA 2I0ZA 1N60C 1GTEA 1Y56A 3SJNA 3EANA 1OJTA 2C73A 3GC2A 3TWBA 3NS1B 3Q6JA 1OJCA 5HY5A 3KA7A 4ADWA 2GAHB 1GREA 3NZGA 4UP3A 3NK1X 2GGJA 3DEQA 3AYLA 2GR2A 5KXJA 2OFJA 2YLTA 4B63A 4D03A 1NHRA 4KEMA 2BK3A 3IC9A 4U8KA 3DG7A 2WOWA 4GYPA 1VQWA 3AE5A 2WDRA 3SX6A 1N1PA 3AE6A 2FJEA 2HNEA 2MNRA 3AEGA 3SN0A 4AOSA 5FS6A 5FJUA 5FMHA 3UKFA 1YQ3A 3AE4A 3R11A 4FK1A 2JB3A 2VQBA 2X8HA 1VG9A 3CGBA 3CGDA 3PWGA 3DGZA 2WS3A 3ALMA 1SB3B 3CNSA 3TW9A 3V4BA 1EBDA 3OZMA 3H8AA 2VVLA 3URHA 3V76A 4AP1A 4G9KA 2HXTA 5EU9A 3D9XA 1P2EA 2QJMA 3MWCA 5JRBA 2WEUA 5FS7A 4UDQA 5JCIA 1L0VA 4DWDA 4Z44A 1FL2A 2BABA 3VFCA 3NHOX 1CC6A 4IA5A 1FIQB 3D8XA 1BKWA 3H7VA 3QSSA 2QCUA 3P4PA 3AEAA 2QJNA 3VDGA 2PU0A 3JVAA 2FJAA 4EIQA 3T37A 4RSLA 4II3A 4XXGA 1ZK7A 4GCMA 3FG2P 4MJWA 3DIPA 1B37A 1PBCA 2CVJA 3ZYXA 2V6OA 2YM1A 3UOVA 2X8CA 4IV9A 2ZZ0A 3AE8A 3N4FA 3PK7A 2JKCA 3SFEA 1PJ7A 3NYEA 1CC2A 3CGCA 3H4KA 2BCPA 2GV8A 1GRBA 1KDGA 1CHUA 4II2A 3S47A 2E5VA 4GGBA 3STPA 3V5FA 4Y4NA 2PGEA 4E6MA 3VC6A 4ZOHB 1PS9A 5EBKA 2ZADA 4HCLA 2PTWA 3GWDA 3UKAA 3MQTA 1MDRA 1O95A 3QSEA 3CNTA 3NRNA 4TM0A 2ONEA 3QPEA 2E3TA 4EMWA 2WP9A 1Q1WA 4TM3A 2DW6A 5TR3A 3ZDNA 3SQSA 2PTYA 4A65A 4H4SA 2WDVA 2BXRA 3NRZB 2VVLG 5KMPA 4DYEA 4JN8A 2CULA 1H7XA 4YWOA 1CC4A 3NH3X 4I59A 2GH5A 3G5QA 1FCDA 3IWAA 2B9YA 4RG3A 2PP0A 2GQWA 3MSYA 1IUWA 3F8DA 1IUUA 1MNSA 1N62C 3I6TA 1IUXA 5KOWA 3I6DA 2VRMA 3UJFA 3EEZA 2AR8A 2WQYA 2R0PA 4U8LA 2WP6A 4U8MA 1ONEA 1BWCA 5BRTA 4IP4A 3NVVB 4U8JA 1BF3A 4EM4A 3GRTA 2P8CA 3RP8A 4DSHA 2AQJA 3DK4A 2AKZA 3DK9A 4H4YA 1K4QA 2VRLA 4G6GA 1GALA 3CXOA 3RO6A 1BGNA 2W54A 3C4AA 4OPUA 2QVHA 4PABA 1F3PA 3V3OA 1S3EA 3EAOA 1B5QA 1TDFA 3ALLA 3SQPA 2NVKX 3TJIA 3L1RA 1XPYA 2PHHA 5FJOA 2EQ9A 1TYPA 1H6VA 1H83A 1S2YA 2BCGG 1ZX9A 4DXKA 1N4WA 3K7QX 3DGHA 3SN4A 1DOCA 1ZOVA 4GAPA 2XH0A 4GFIA 4Z43A 4E0VA 1RSGA 3CNDA 4NZHA 1SJAA 3AD7B 4H1ZA 5CQFA 1NHQA 2NPXA 1ELSA 5LV9A 5JCKA 4H4QA 2BRYA 2AKMA 1EBHA 4Z2TA 1TKKA 5BOEA 2GRTA 2PP3A 2CFYA 3LOVA 3HZLA 2B7SA 3UKQA 3KUMA 1GERA 3ES7A 1BQGA 4G7FA 3GDNA 1GV4A 2YVFA 4JNQA 3U4FA 1TDOA 3P4QA 3CAWA 2A8XA 2WETA 3R0KA 4J36A 4OPTA 2JB1A 1ZP0A 3AEEA 1Y0PA 2H88A 1WUFA 5KWFA 3AD9B 4EMIA 3C4NA 1PJ5A 1N61C 4U2LA 2QQ6A 3EPTA 5EB4A 3GY1A 1TZZA 1VG0A 5U25A 1KFYA 4JQ9A 4A6NB 3FPZA 3GYIA 1TE6A 3G5SA 1DJNA 3LB8A 4AOXA 2GF3A 1Q9IA 4G74A 3A7UA 4K2XA 2BS4A 3KD9A 1D4CA 1COYA 3RCYA 4EIPA 3FIMB 1T3QC 3RP7A 4M0XA 4A7AA 5G5GB 3R0UA 3L8KA 4E5TA 1LV0A 4JN9A 3M0OA 1FECA 1GESA 1F6MA 1V59A 5IQ1A 2W3SA 5GRTA 4B1BA 4HNLA 2WU2A 4USQA 4XWZA 4Z25A 3DA1A 1P48A 1QO8A 1LQUA 1D4DA 2IVDA 2XVIA 1OJ9A 4J34A 2GVCA 2XLTA 3T4WA 3DJGX 3UTGA 4K5SA 2QAEA 1WUEA 1E39A 3TQPA 4YT0A 3ZLGA 2V60A 3ISHA 3JZUA 1NG3A 2YG7A 1N63C 3CYJA 3NG7X 2C3DA 1Z6LA 4IZGA 2OZTA 4F4RA
chains in the Genus database with same CATH topology
2Y6QA 5JRBA 2R45A 2ZBWA 5C2TA 2WEUA 2YAUA 3NKSA 3GD3A 5FS7A 1PDHA 2FBWA 3C96A 3NN0X 4UDQA 1F8SA 4B68A 4N9XA 2BXSA 1N4VA 5JCIA 1L0VA 3O0HA 4Z44A 4A9WA 1DOBA 1FL2A 2E4GA 2BABA 1CJ4A 3LXDA 4K7ZA 2XFQA 3KPFA 4H2RA 3NHOX 4NTDA 3V3NA 2JK6A 4J33A 4O5UA 1NG4A 3BNMA 1CC6A 4H2NA 3DJEA 4IA5A 1DJQA 2Q0LA 3P9UA 3D8XA 4ECHA 1BKWA 3RP6A 1GOSA 3QSSA 2GMHA 2QCUA 1JRZA 2C4CA 3HYVA 3P4PA 2Z5YA 4A99A 3CNPA 2FJBA 4LA1A 3AEAA 3T31A 1SEZA 4DSGA 2BYBA 4H4TA 4YTPA 1TDNA 2GMJA 3SZ0A 3CGEA 4EM3A 2EQ7A 4GDPA 5FS9A 2FJAA 4HB9A 4EIQA 3T37A 4RSLA 1XPQA 2QA1A 1GRTA 4G6HA 4WX1A 1E1LA 4II3A 4XXGA 1FEBA 3GWFA 1L9DA 1ZK7A 4Z2RA 1D4EA 4GCMA 4CRTA 5GSNA 3VRAA 3UTHA 3FG2P 3SZWA 4MJWA 4OCGA 2C67A 3E1TA 1B37A 4FX9A 4I58A 1O5WA 1PBCA 4OVIA 1PN0A 1NDAA 5ER0A 2CVJA 2GAGB 4LU6A 3ZYXA 2V6OA 3L5OA 3D1CA 1GXFA 4APNA 3VR9A 2YM1A 3AE1A 4UDPA 3UOVA 2X8CA 4GR1A 3VRBA 4IV9A 4X9MA 1ZMDA 3DJJA 2ZZ0A 3AE8A 3NIXA 3T2ZA 4H4RA 2JKCA 1PXBA 4O5QA 1XDIA 1KSSA 3SFEA 3GSIA 1PJ7A 3NYEA 4UDRA 4BJYA 3GMBA 4TM4A 1CC2A 3SGLA 3QFAA 1CJ3A 4HA6A 2ACZA 1JOAA 3FBSA 4OPDA 1X31B 4BK3A 3P4SA 1EL9A 3CGCA 3H4KA 1S3BA 2OAMA 1NAAA 3QVPA 3QVRA 4GUVA 4IVMB 5C3JA 2B9WA 3OZ2A 4CY8A 4EQSA 1KNRA 3KLJA 2ARDA 3DK8A 1CBOA 2BCPA 1L9EA 3CN8A 3LZWA 2ZZBA 2GV8A 1GRBA 3NGCX 1E1MA 1KDGA 1CHUA 2CDUA 3II4A 4II2A 2E5VA 3IF9A 4YSYA 4NTCA 1JU2A 4CCQA 1B8SA 3AE7A 1YKJA 3JSKA 1GETA 4Y4NA 2WP5A 1ELIA 1H84A 3SM8A 2F5ZA 4H2QA 1F8WA 2XCGA 2WHDA 5EB5A 4AT0A 2OALA 1PS9A 1YQ4A 1NHPA 5EBKA 1IUSA 4A5LA 1Q1RA 3ICTA 1GPEA 1MO9A 2BS3A 2YG4A 3GWDA 3UKAA 1TDEA 3NYCA 4NWZA 1O95A 1PHHA 3QSEA 2Q0KA 3CNTA 3AD8B 1PXCA 3NRNA 4TM0A 3QFBA 2XDOA 4EMWA 2IIDA 2WP9A 1Q1WA 1DOEA 4TM3A 4YKFA 5TR3A 4Y4LA 3ZDNA 3UKKA 3FMWA 1H7WA 3NK0X 1M6IA 3AXBA 2Q6UA 4A65A 3KPKA 2X50A 4H4SA 3ATRA 1IUVA 5HYMA 4JDRA 2RGHA 2WDVA 3GD4A 4M52A 1OJDA 2BXRA 4OPLA 1ZMCA 2VVLG 2UZZA 4Z24A 1NHSA 2WESA 5KMPA 2C64A 4XWRA 5KMRA 2YG5A 2CULA 2Z5XA 1YY5A 1H7XA 4YWOA 1CC4A 3NH3X 4I59A 3R9UA 1NPXA 2GH5A 3G5QA 1FCDA 1PBFA 2RGJA 3IWAA 4K22A 3SZFA 2B9YA 2XYOA 4RG3A 2YLZA 2GR3A 2GQWA 3GRSA 1IUWA 2WU5A 3F8DA 1LVLA 1IUUA 3G5RA 3VR8A 3WE0A 3SY4A 4H4VA 2TPRA 1VRQB 2V61A 1IUXA 5KOWA 3UOXA 3GDPA 3AECA 3I6DA 2X8GA 2YR6A 1CF3A 4NEVA 3F8RA 2YLSA 2VRMA 4EQXA 3UKPA 4YKGA 4EQRA 2AR8A 2WQYA 5IQ4A 2R0PA 4WCTA 4U8LA 2BRAA 3LADA 5BULA 2DKIA 2VVMA 2VZ2A 1H2IA 2XFPA 4U8MA 3T2YA 5J60A 2DKHA 2J3NA 2XFNA 2Y6RA 2BC1A 5JCLA 4PAAA 1KSUA 3ATQA 3UP5A 4H2PA 1BWCA 3BI5A 4EMJA 1B4VA 4YTMA 3ADAB 5BRTA 4CY6A 2B7RA 4U8OA 1BGJA 4U8JA 1BF3A 2A89A 4EM4A 3HYWA 5L46A 3AEDA 3GRTA 1NENA 2R4EA 3PVCA 3CPHG 3RP8A 1JRYA 1MOKA 4DSHA 2WPCA 2AQJA 3H8IA 1LJ1A 3DK4A 1QJDA 3RNMA 4GF7A 1DNCA 5DBJA 3DK9A 4YSHA 1GT8A 1IUTA 4H4YA 2IVEA 4NTEA 4CCRA 3UOZA 2BACA 3AE3A 4J31A 2V3BA 1MXTA 1EL5A 3HYXA 3P4RA 4OPGA 4C5OA 1K4QA 2VRLA 3ALJA 2R46A 2XLRA 2YG3A 3IHMA 3COXA 1GALA 4G6GA 4ZCCA 1DXLA 4C3YA 1GRGA 1BGNA 3C4AA 4TLXA 1VDCA 2JB2A 3DH9A 3B6DA 4OPUA 3UTFA 1RP0A 2R0CA 5KVIA 3Q9TA 4PABA 4AT2A 4B67A 1F3PA 2HQMA 4JY2A 3V3OA 2XVJA 3REDA 1S3EA 3VRDB 2FJDA 1E1NA 1TDKA 3EAOA 2QA2A 1H86A 2XVEA 4IA6A 4ZCDA 2RABA 4U2SA 1B5QA 1D7LA 1N4UA 3CPIG 2YLWA 2XFOA 5JCNA 3H8LA 5M10A 3QJ4A 1K0LA 3GYXA 1TYTA 1TDFA 3ALLA 5U63A 3SQPA 2NVKX 4DNAA 3L1RA 3NT6A 3M12A 2PHHA 4YXDA 1GRAA 3NNEA 2EQ9A 1TYPA 1H6VA 4CNKA 2GQFA 1H83A 1S2YA 2BK4A 3AEFA 3CNJA 5KMSA 2BCGG 1ZX9A 4EQWA 4C74A 4X4JA 2XLUA 1FEAA 1ZOYA 1N4WA 1OJAA 3T14A 4GDEA 4C77A 2VOUA 3K7QX 4BK2A 3DGHA 3BNUA 2C66A 4NNJA 5M0ZA 1IJHA 1DOCA 2GR1A 3EF6A 1JNRA 1ZOVA 4GAPA 2YVJA 3PO7A 4U2TA 3M13A 2YQUA 3S5WA 3SXIA 4B64A 4YSZA 4REKA 2R0GA 5KOXA 4Z43A 4E0VA 2V5ZA 1FOHA 1L9CA 1XANA 3PG6A 1RSGA 5BUKA 4D04A 4YSXA 5BVAA 1EL8A 1PBDA 2V3AA 3AYJA 4BURA 3T0KA 3CNDA 4CNJA 4Z2UA 4NZHA 3SYIA 1QLBA 3T2KA 5U1OA 2APGA 4KPRA 2B9XA 2RGOA 2YLXA 2WOIA 3AD7B 3UTEA 2Q7VA 2TMDA 4J2WA 3ABVA 5CQFA 2YR4A 1GNDA 1NHQA 2NPXA 5LV9A 1KN0A 2OA1A 5JCKA 3P1WA 1KF6A 4ICYA 4H4QA 2BRYA 4K8DA 1RYIA 2VQ7A 3S61A 1ZDLA 2C7GA 4YTNA 4H4ZA 2EQ8A 4Z2TA 2C70A 2AAQA 1XHCA 3AEBA 4A6NA 3UP4A 2OLOA 1GRFA 2GB0A 1W4XA 2WBAA 2XVFA 2GRTA 2CFYA 4BJZA 2BC0A 3LOVA 1AOGA 4G73A 1DODA 1JRXA 4J57A 2XVHA 2YM2A 3HZLA 1PJ6A 4TLZA 3UKHA 2B7SA 5HXIA 3UKQA 2JAEA 3CIRA 3QSMA 1GERA 2WPFA 4H4PA 4BV6A 1CJCA 1REOA 3GDNA 2YR5A 3DMEA 1GV4A 3BHKA 2YVFA 4JNQA 2R9ZA 2BK5A 3GYJA 1TDOA 3UCLA 4K5RA 3P4QA 1H82A 1LQTA 1H81A 3NTAA 3K30A 2O9ZA 4B65A 2I0ZA 2A8XA 1K0IA 5KMQA 2WETA 5JCMA 1GTEA 1Y56A 1D5TA 3I3LA 3UOYA 4U8NA 4BK1A 1EL7A 4J36A 3EANA 1PBEA 1OJTA 4OPTA 2C73A 4U8PA 3B3RA 1YQZA 3CMMA 2JB1A 1ZP0A 1ZKQA 2R4JA 3AEEA 4H7UA 5FS8A 2C75A 1Y0PA 5IPYA 4CBQA 2H88A 3CTYA 3K7TA 3AYIA 4DGKA 4B66A 5KWFA 4FDCB 4H4UA 3Q6JA 1OJCA 3AD9B 3KKJA 3KU9A 1LPFA 1ZY8A 4AP3A 5HY5A 4EMIA 2OLNA 2ZZCA 3KA7A 4ADWA 3C4NA 3NTDA 1F8RA 3GMCA 3LZXA 5J7XA 1PJ5A 4U2LA 3AE2A 4GAVA 4Z26A 3OC4A 2GAHB 1GREA 2YG6A 2C72A 4UP3A 1GTHA 3IHGA 3NK1X 3EPTA 3F8PA 5EB4A 1PBBA 1VG0A 2BA9A 3AYLA 5U25A 1KFYA 3AWIA 4P9SA 2GR2A 4USRA 4JQ9A 2WOVA 5KXJA 2PYXA 4A6NB 2BS2A 3FPZA 2C65A 2XLPA 2YLTA 2C3CA 3KVEA 3GYIA 4B63A 4D03A 3G5SA 1NHRA 1DJNA 4Y4MA 2BK3A 4B69A 3LB8A 5KRQA 2W0HA 3NN6X 3IC9A 1LTXR 4U8KA 4AOXA 2WOWA 1O94A 2GF3A 3BHFA 2WDQA 4JY3A 1Q9IA 4G74A 1JEHA 1HYUA 1CL0A 1VQWA 4K2XA 2BS4A 3KD9A 1D4CA 1COYA 1E1KA 3AE5A 2WDRA 3SX6A 1N1PA 1UKVG 4JNAA 1E6EA 4EIPA 3AE6A 2FJEA 5KNLA 2A87A 4J56A 3FIMB 4C3XA 1K0JA 3AEGA 4ZN0A 2YLRA 4AOSA 5FS6A 3VQRA 3AE9A 3NLCA 3RP7A 1BZLA 5CKUA 3PS9A 4A7AA 1ONFA 3AB1A 4OPCA 3L8KA 2GEWA 3RHAA 1GRHA 2YVGA 1LV0A 4JN9A 4U8IA 3M0OA 5FMHA 2E1MA 1P2HA 3UKFA 1Y56B 1PXAA 1FECA 1GESA 1YQ3A 1F6MA 3BI2A 1CJ2A 1V59A 3AE4A 1NEKA 5GRTA 2H89A 2WPEA 3LJPA 3K7MX 5IQ1A 4B1BA 2WU2A 2YWLA 3SFDA 4USQA 4XWZA 2C76A 4GRTA 2JB3A 4FK1A 2VQBA 4Z25A 3SZCA 3DA1A 2X8HA 1VG9A 3CGBA 3CGDA 3CPJG 4KX6A 2XFUA 3DGZA 5EOWA 1QO8A 3ICSA 5KVHA 1LQUA 1D4DA 1S7MA 2WS3A 2IVDA 2XVIA 1OJ9A 3ALMA 4J34A 4H4XA 2GVCA 2XLTA 3CNSA 4RG4A 3UKLA 3DJGX 3UTGA 1D7YA 4K5SA 1GSNA 2QAEA 1EBDA 1E39A 1KNPA 2XLSA 4OPIA 5HHFA 3ITJA 4YT0A 2V60A 3NYFA 3ISHA 3NK2X 4IVOB 2EQ6A 3ICRA 3DJDA 1NG3A 2VVLA 2YG7A 4FK1C 4H4WA 1TRBA 3URHA 2X99A 3NG7X 3V76A 2X3NA 4A79A 1S2QA 2C3DA 1JNZA 4TM1A 4AP1A 1Z6LA 2B76A 2GR0A 4G9KA 4X9NA 3D9XA 4H50A 1P2EA 1GEUA 4LIIA 1E7PA 2JBVA 3BI4A 1M64A 4NEWA 2WP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y6Q A;  2R45 A;  2ZBW A;  5C2T A;  2WEU A;  2YAU A;  3NKS A;  3GD3 A;  5FS7 A;  1PDH A;  2FBW A;  3C96 A;  3NN0 X;  4UDQ A;  1F8S A;  4B68 A;  4N9X A;  2BXS A;  1N4V A;  5JCI A;  1L0V A;  3O0H A;  4Z44 A;  4A9W A;  1DOB A;  1FL2 A;  2E4G A;  2BAB A;  1CJ4 A;  3LXD A;  4K7Z A;  2XFQ A;  3KPF A;  4H2R A;  3NHO X;  4NTD A;  3V3N A;  2JK6 A;  4J33 A;  4O5U A;  1NG4 A;  3BNM A;  1CC6 A;  4H2N A;  3DJE A;  4IA5 A;  1DJQ A;  2Q0L A;  3P9U A;  3D8X A;  4ECH A;  1BKW A;  3RP6 A;  1GOS A;  3QSS A;  2GMH A;  2QCU A;  1JRZ A;  3P4P A;  2Z5Y A;  4A99 A;  3CNP A;  2FJB A;  4LA1 A;  3AEA A;  1SEZ A;  4DSG A;  2BYB A;  4H4T A;  4YTP A;  1TDN A;  2GMJ A;  3CGE A;  4EM3 A;  2EQ7 A;  4GDP A;  5FS9 A;  2FJA A;  4HB9 A;  4EIQ A;  3T37 A;  4RSL A;  1XPQ A;  2QA1 A;  1GRT A;  4WX1 A;  1E1L A;  4XXG A;  1FEB A;  3GWF A;  1L9D A;  1ZK7 A;  4Z2R A;  1D4E A;  4GCM A;  4CRT A;  5GSN A;  3VRA A;  3UTH A;  3FG2 P;  4MJW A;  4OCG A;  2C67 A;  3E1T A;  1B37 A;  4FX9 A;  4I58 A;  1O5W A;  1PBC A;  4OVI A;  1PN0 A;  1NDA A;  5ER0 A;  2CVJ A;  2GAG B;  4LU6 A;  3ZYX A;  2V6O A;  3D1C A;  1GXF A;  4APN A;  3VR9 A;  2YM1 A;  3AE1 A;  4UDP A;  3UOV A;  2X8C A;  4GR1 A;  3VRB A;  4IV9 A;  4X9M A;  1ZMD A;  3DJJ A;  2ZZ0 A;  3AE8 A;  3NIX A;  4H4R A;  2JKC A;  1PXB A;  4O5Q A;  1XDI A;  1KSS A;  3SFE A;  3GSI A;  1PJ7 A;  3NYE A;  4UDR A;  4BJY A;  3GMB A;  4TM4 A;  1CC2 A;  3SGL A;  3QFA A;  1CJ3 A;  4HA6 A;  2ACZ A;  1JOA A;  3FBS A;  4OPD A;  1X31 B;  4BK3 A;  3P4S A;  1EL9 A;  3CGC A;  3H4K A;  1S3B A;  2OAM A;  1NAA A;  3QVP A;  3QVR A;  4GUV A;  4IVM B;  5C3J A;  2B9W A;  3OZ2 A;  4CY8 A;  4EQS A;  1KNR A;  3KLJ A;  2ARD A;  3DK8 A;  1CBO A;  2BCP A;  1L9E A;  3CN8 A;  3LZW A;  2ZZB A;  2GV8 A;  1GRB A;  3NGC X;  1E1M A;  1KDG A;  1CHU A;  2CDU A;  3II4 A;  2E5V A;  3IF9 A;  4YSY A;  4NTC A;  1JU2 A;  4CCQ A;  1B8S A;  3AE7 A;  1YKJ A;  3JSK A;  1GET A;  4Y4N A;  2WP5 A;  1ELI A;  1H84 A;  3SM8 A;  2F5Z A;  4H2Q A;  1F8W A;  2XCG A;  2WHD A;  5EB5 A;  4AT0 A;  2OAL A;  1PS9 A;  1YQ4 A;  1NHP A;  5EBK A;  1IUS A;  4A5L A;  1Q1R A;  3ICT A;  1GPE A;  1MO9 A;  2BS3 A;  2YG4 A;  3GWD A;  3UKA A;  1TDE A;  3NYC A;  1O95 A;  1PHH A;  3QSE A;  2Q0K A;  3CNT A;  3AD8 B;  1PXC A;  3NRN A;  4TM0 A;  3QFB A;  2XDO A;  4EMW A;  2IID A;  2WP9 A;  1Q1W A;  1DOE A;  4TM3 A;  4YKF A;  5TR3 A;  4Y4L A;  3ZDN A;  3UKK A;  3FMW A;  1H7W A;  3NK0 X;  1M6I A;  3AXB A;  2Q6U A;  4A65 A;  2X50 A;  4H4S A;  3ATR A;  1IUV A;  5HYM A;  4JDR A;  2RGH A;  2WDV A;  3GD4 A;  4M52 A;  1OJD A;  2BXR A;  4OPL A;  1ZMC A;  2VVL G;  2UZZ A;  4Z24 A;  1NHS A;  2WES A;  2C64 A;  4XWR A;  2YG5 A;  2CUL A;  2Z5X A;  1YY5 A;  1H7X A;  4YWO A;  1CC4 A;  3NH3 X;  4I59 A;  3R9U A;  1NPX A;  2GH5 A;  3G5Q A;  1FCD A;  1PBF A;  2RGJ A;  3IWA A;  4K22 A;  2B9Y A;  2XYO A;  4RG3 A;  2YLZ A;  2GR3 A;  2GQW A;  3GRS A;  1IUW A;  2WU5 A;  3F8D A;  1LVL A;  1IUU A;  3G5R A;  3VR8 A;  3WE0 A;  4H4V A;  2TPR A;  1VRQ B;  2V61 A;  1IUX A;  5KOW A;  3UOX A;  3GDP A;  3AEC A;  3I6D A;  2X8G A;  2YR6 A;  1CF3 A;  4NEV A;  3F8R A;  2YLS A;  2VRM A;  4EQX A;  3UKP A;  4YKG A;  4EQR A;  2AR8 A;  2WQY A;  5IQ4 A;  2R0P A;  4WCT A;  4U8L A;  3LAD A;  5BUL A;  2DKI A;  2VVM A;  2VZ2 A;  2XFP A;  4U8M A;  5J60 A;  2DKH A;  2J3N A;  2XFN A;  2Y6R A;  2BC1 A;  5JCL A;  4PAA A;  1KSU A;  3ATQ A;  3UP5 A;  4H2P A;  1BWC A;  3BI5 A;  4EMJ A;  1B4V A;  4YTM A;  3ADA B;  5BRT A;  4CY6 A;  2B7R A;  4U8O A;  1BGJ A;  4U8J A;  1BF3 A;  2A89 A;  4EM4 A;  5L46 A;  3AED A;  3GRT A;  1NEN A;  2R4E A;  3PVC A;  3CPH G;  3RP8 A;  1JRY A;  1MOK A;  4DSH A;  2WPC A;  2AQJ A;  3H8I A;  1LJ1 A;  3DK4 A;  1QJD A;  3RNM A;  4GF7 A;  1DNC A;  5DBJ A;  3DK9 A;  4YSH A;  1GT8 A;  1IUT A;  4H4Y A;  2IVE A;  4NTE A;  4CCR A;  3UOZ A;  2BAC A;  3AE3 A;  4J31 A;  1MXT A;  2V3B A;  1EL5 A;  3P4R A;  4OPG A;  4C5O A;  1K4Q A;  2VRL A;  3ALJ A;  2R46 A;  2XLR A;  2YG3 A;  3IHM A;  3COX A;  1GAL A;  4ZCC A;  4C3Y A;  1DXL A;  1GRG A;  1BGN A;  3C4A A;  4TLX A;  1VDC A;  2JB2 A;  3DH9 A;  3B6D A;  4OPU A;  3UTF A;  1RP0 A;  2R0C A;  5KVI A;  3Q9T A;  4PAB A;  4AT2 A;  4B67 A;  1F3P A;  2HQM A;  4JY2 A;  3V3O A;  2XVJ A;  3RED A;  1S3E A;  3VRD B;  2FJD A;  1E1N A;  1TDK A;  3EAO A;  2QA2 A;  1H86 A;  2XVE A;  4IA6 A;  4ZCD A;  2RAB A;  4U2S A;  1B5Q A;  1D7L A;  1N4U A;  3CPI G;  2YLW A;  2XFO A;  5JCN A;  3H8L A;  5M10 A;  3QJ4 A;  1K0L A;  1TYT A;  1TDF A;  3ALL A;  5U63 A;  3SQP A;  2NVK X;  4DNA A;  3L1R A;  3NT6 A;  3M12 A;  2PHH A;  4YXD A;  1GRA A;  3NNE A;  2EQ9 A;  1TYP A;  1H6V A;  4CNK A;  2GQF A;  1H83 A;  1S2Y A;  2BK4 A;  3AEF A;  3CNJ A;  2BCG G;  1ZX9 A;  4EQW A;  4C74 A;  4X4J A;  2XLU A;  1FEA A;  1ZOY A;  1N4W A;  1OJA A;  4GDE A;  4C77 A;  2VOU A;  3K7Q X;  4BK2 A;  3DGH A;  3BNU A;  2C66 A;  5M0Z A;  1IJH A;  1DOC A;  2GR1 A;  3EF6 A;  1JNR A;  1ZOV A;  4U2T A;  2YVJ A;  3PO7 A;  3S5W A;  3M13 A;  2YQU A;  4B64 A;  4YSZ A;  4REK A;  2R0G A;  5KOX A;  4Z43 A;  4E0V A;  2V5Z A;  1FOH A;  1L9C A;  1XAN A;  1RSG A;  5BUK A;  4D04 A;  4YSX A;  5BVA A;  1EL8 A;  1PBD A;  2V3A A;  3AYJ A;  4BUR A;  4CNJ A;  3CND A;  4Z2U A;  4NZH A;  1QLB A;  5U1O A;  2APG A;  4KPR A;  2B9X A;  2RGO A;  2YLX A;  2WOI A;  3AD7 B;  3UTE A;  2Q7V A;  2TMD A;  4J2W A;  3ABV A;  5CQF A;  2YR4 A;  1GND A;  1NHQ A;  2NPX A;  5LV9 A;  2OA1 A;  5JCK A;  3P1W A;  1KF6 A;  4ICY A;  4H4Q A;  4K8D A;  1RYI A;  2VQ7 A;  3S61 A;  1ZDL A;  2C7G A;  4YTN A;  4H4Z A;  2EQ8 A;  4Z2T A;  2C70 A;  2AAQ A;  1XHC A;  3AEB A;  4A6N A;  3UP4 A;  2OLO A;  1GRF A;  2GB0 A;  1W4X A;  2WBA A;  2XVF A;  2GRT A;  2CFY A;  4BJZ A;  2BC0 A;  3LOV A;  1AOG A;  1DOD A;  1JRX A;  4J57 A;  2XVH A;  2YM2 A;  3HZL A;  1PJ6 A;  4TLZ A;  3UKH A;  2B7S A;  5HXI A;  3UKQ A;  2JAE A;  3CIR A;  3QSM A;  1GER A;  2WPF A;  4H4P A;  4BV6 A;  1CJC A;  1REO A;  3GDN A;  2YR5 A;  3DME A;  1GV4 A;  3BHK A;  2YVF A;  4JNQ A;  2R9Z A;  2BK5 A;  3GYJ A;  1TDO A;  3UCL A;  4K5R A;  3P4Q A;  1H82 A;  1LQT A;  1H81 A;  3NTA A;  3K30 A;  2O9Z A;  4B65 A;  2I0Z A;  2A8X A;  1K0I A;  2WET A;  5JCM A;  1GTE A;  1Y56 A;  1D5T A;  3I3L A;  3UOY A;  4U8N A;  4BK1 A;  1EL7 A;  4J36 A;  3EAN A;  1PBE A;  1OJT A;  4OPT A;  2C73 A;  4U8P A;  3B3R A;  1YQZ A;  2JB1 A;  1ZP0 A;  1ZKQ A;  2R4J A;  3AEE A;  4H7U A;  5FS8 A;  2C75 A;  1Y0P A;  5IPY A;  4CBQ A;  2H88 A;  3CTY A;  3K7T A;  3AYI A;  4DGK A;  4B66 A;  5KWF A;  4FDC B;  4H4U A;  3Q6J A;  1OJC A;  3AD9 B;  3KKJ A;  3KU9 A;  1LPF A;  1ZY8 A;  4AP3 A;  5HY5 A;  4EMI A;  2OLN A;  2ZZC A;  3KA7 A;  4ADW A;  3C4N A;  3NTD A;  1F8R A;  3GMC A;  3LZX A;  5J7X A;  1PJ5 A;  4U2L A;  3AE2 A;  4Z26 A;  3OC4 A;  2GAH B;  1GRE A;  2YG6 A;  2C72 A;  4UP3 A;  1GTH A;  3IHG A;  3NK1 X;  3EPT A;  3F8P A;  5EB4 A;  1PBB A;  1VG0 A;  2BA9 A;  3AYL A;  5U25 A;  1KFY A;  3AWI A;  4P9S A;  2GR2 A;  4USR A;  4JQ9 A;  2WOV A;  5KXJ A;  2PYX A;  4A6N B;  2BS2 A;  3FPZ A;  2C65 A;  2XLP A;  2YLT A;  2C3C A;  3KVE A;  3GYI A;  4B63 A;  4D03 A;  3G5S A;  1NHR A;  1DJN A;  4Y4M A;  2BK3 A;  4B69 A;  3LB8 A;  5KRQ A;  2W0H A;  3NN6 X;  3IC9 A;  1LTX R;  4U8K A;  4AOX A;  2WOW A;  1O94 A;  2GF3 A;  3BHF A;  2WDQ A;  4JY3 A;  1Q9I A;  1JEH A;  1HYU A;  1CL0 A;  1VQW A;  4K2X A;  2BS4 A;  3KD9 A;  1D4C A;  1COY A;  1E1K A;  3AE5 A;  2WDR A;  1N1P A;  1UKV G;  4JNA A;  1E6E A;  4EIP A;  3AE6 A;  2FJE A;  2A87 A;  4J56 A;  3FIM B;  4C3X A;  1K0J A;  3AEG A;  4ZN0 A;  2YLR A;  4AOS A;  5FS6 A;  3VQR A;  3AE9 A;  3NLC A;  3RP7 A;  1BZL A;  5CKU A;  3PS9 A;  4A7A A;  1ONF A;  3AB1 A;  4OPC A;  3L8K A;  2GEW A;  3RHA A;  1GRH A;  2YVG A;  1LV0 A;  4JN9 A;  4U8I A;  3M0O A;  5FMH A;  2E1M A;  1P2H A;  3UKF A;  1Y56 B;  1PXA A;  1FEC A;  1GES A;  1YQ3 A;  1F6M A;  3BI2 A;  1CJ2 A;  1V59 A;  3AE4 A;  1NEK A;  5GRT A;  2H89 A;  2WPE A;  3LJP A;  3K7M X;  5IQ1 A;  4B1B A;  2WU2 A;  2YWL A;  3SFD A;  4USQ A;  4XWZ A;  2C76 A;  4GRT A;  2JB3 A;  4FK1 A;  2VQB A;  4Z25 A;  3DA1 A;  2X8H A;  1VG9 A;  3CGB A;  3CGD A;  3CPJ G;  4KX6 A;  2XFU A;  3DGZ A;  5EOW A;  1QO8 A;  3ICS A;  5KVH A;  1LQU A;  1D4D A;  2WS3 A;  2IVD A;  2XVI A;  1OJ9 A;  3ALM A;  4J34 A;  4H4X A;  2GVC A;  2XLT A;  3CNS A;  4RG4 A;  3UKL A;  3DJG X;  3UTG A;  1D7Y A;  4K5S A;  1GSN A;  2QAE A;  1EBD A;  1E39 A;  1KNP A;  2XLS A;  4OPI A;  5HHF A;  3ITJ A;  4YT0 A;  2V60 A;  3NYF A;  3ISH A;  3NK2 X;  4IVO B;  2EQ6 A;  3ICR A;  3DJD A;  1NG3 A;  2VVL A;  2YG7 A;  4FK1 C;  4H4W A;  1TRB A;  3URH A;  2X99 A;  3NG7 X;  3V76 A;  2X3N A;  4A79 A;  1S2Q A;  2C3D A;  1JNZ A;  4TM1 A;  4AP1 A;  1Z6L A;  2B76 A;  2GR0 A;  4X9N A;  4H50 A;  1P2E A;  1GEU A;  4LII A;  1E7P A;  2JBV A;  3BI4 A;  1M64 A;  4NEW A;  2WP6 A; 
#chains in the Genus database with same CATH topology
 4ZA0 A;  2ZBW A;  5C2T A;  3NKS A;  2FBW A;  1RM6 B;  3NN0 X;  1F8S A;  4B68 A;  1JRP A;  1N4V A;  4IHC A;  3UJE A;  2E4G A;  4K7Z A;  4KWS A;  3KPF A;  3B9J B;  4HCD A;  3BNM A;  3DJE A;  3P9U A;  2OLA A;  3R10 A;  3RP6 A;  1JRZ A;  2C4C A;  3TCS A;  4A99 A;  3CNP A;  1SEZ A;  3I6E A;  2GMJ A;  2GGI A;  2EQ7 A;  5FS9 A;  3DFH A;  4HB9 A;  1X2H A;  2XH2 A;  2QA1 A;  1FEB A;  3GWF A;  1L9D A;  4DHG A;  4Z2R A;  4OCG A;  2C67 A;  1O5W A;  2PPG A;  4OVI A;  1NDA A;  2GAG B;  4H2H A;  3ZVH B;  3D1C A;  3VRB A;  3DJJ A;  1JDF A;  4H4R A;  3DG6 A;  1XDI A;  1KSS A;  3GSI A;  4UDR A;  4BJY A;  3RIT A;  1CJ3 A;  2ACZ A;  2P3Z A;  3FBS A;  1EC9 A;  4TVY A;  1X31 B;  2OAM A;  4GUV A;  1EBG A;  2B9W A;  4CY8 A;  1KNR A;  3KLJ A;  1L9E A;  3MZN A;  3II4 A;  1JU2 A;  3AE7 A;  1YKJ A;  2WP5 A;  2F5Z A;  2XCG A;  2WHD A;  1YQ4 A;  1GPE A;  1MO9 A;  3UCD A;  2BS3 A;  4NWZ A;  1PHH A;  3AD8 B;  2ZC8 A;  3QFB A;  2QGY A;  2OPJ A;  3THU A;  3CK5 A;  1NU5 A;  3FMW A;  5G5H B;  3GO2 A;  3SN1 A;  3KPK A;  1IUV A;  5HYM A;  4JDR A;  4HPN A;  1FHV A;  4Z24 A;  2YG5 A;  1YY5 A;  3UGV A;  3R9U A;  1NPX A;  2RGJ A;  4K22 A;  2XYO A;  2YLZ A;  2GR3 A;  3GRS A;  3VR8 A;  2WU5 A;  4H4V A;  4E4U A;  1VRQ B;  2V61 A;  3BSM A;  3SSZ A;  1CF3 A;  3F8R A;  4EWJ A;  3FCP A;  4E4F A;  2VVM A;  2VZ2 A;  3IK4 A;  3CT2 A;  2DKH A;  2J3N A;  2XFN A;  2Y6R A;  2BC1 A;  4PAA A;  4H2P A;  3BI5 A;  1PDY A;  3UXL A;  4EMJ A;  1B4V A;  3ADA B;  3DER A;  4CY6 A;  2B7R A;  1BGJ A;  3T9P A;  2A89 A;  3AED A;  3CPH G;  1MOK A;  3UJR A;  1LJ1 A;  3RNM A;  4HN8 A;  4YSH A;  1GT8 A;  1IUT A;  4CCR A;  3UOZ A;  4YWS A;  2V3B A;  1KCZ A;  3HYX A;  4C5O A;  2CHR A;  2XLR A;  2YG3 A;  3COX A;  4TLX A;  1VDC A;  3DH9 A;  3UTF A;  1RP0 A;  3Q9T A;  3NVW B;  4AT2 A;  2W3R A;  1TDK A;  2RAB A;  1N4U A;  2I5Q A;  2YLW A;  3GD6 A;  3QJ4 A;  1K0L A;  3GYX A;  5U63 A;  4CNK A;  2BK4 A;  1ZOY A;  4NNJ A;  2C66 A;  5M0Z A;  4REK A;  2R0G A;  5KOX A;  3PG6 A;  5BVA A;  3AYJ A;  4BUR A;  4CNJ A;  3T2K A;  2B9X A;  2APG A;  5FJP A;  3EKG A;  2WOI A;  2Q7V A;  2TMD A;  1EC7 A;  2QDE A;  2YR4 A;  1KN0 A;  2OA1 A;  3DG3 A;  3P1W A;  1JPM A;  1KF6 A;  1VDV A;  4YTN A;  2C7G A;  2EQ8 A;  2XSX A;  2C70 A;  2AAQ A;  4A6N A;  3UP4 A;  1W4X A;  3Q45 A;  2PTX A;  1AOG A;  4TLZ A;  1JRX A;  2YM2 A;  2XH4 A;  3UKH A;  4DX3 A;  1PJ6 A;  3QSM A;  4BV6 A;  1CJC A;  2YR5 A;  4E8G A;  3UCL A;  1LQT A;  1H81 A;  5BOF A;  1BKH A;  4B65 A;  1EC8 A;  3JW7 A;  1L8P A;  3V3W A;  3P0W A;  3T6C A;  1D5T A;  3I3L A;  4U8N A;  4BK1 A;  2FYM A;  1EL7 A;  4HNC A;  1PBE A;  4U8P A;  3B3R A;  1YQZ A;  2E5A A;  3CMM A;  3N6H A;  2R4J A;  4H7U A;  5FS8 A;  3AMZ A;  2C75 A;  5IPY A;  4FP1 A;  4DGK A;  3A7R A;  4B66 A;  2PSN A;  4GIR A;  4FDC B;  4H4U A;  3KU9 A;  3VCN A;  1F8R A;  1GTH A;  3IHG A;  1KKR A;  2P88 A;  3A7A A;  3AWI A;  4P9S A;  4USR A;  2WOV A;  2BS2 A;  3R25 A;  2C65 A;  3SBF A;  1R6W A;  3NN6 X;  1O94 A;  3BHF A;  4JY3 A;  3H70 A;  1JEH A;  2MUC A;  1E6E A;  5KNL A;  3CB3 A;  1FFV C;  1K0J A;  4ZN0 A;  2YLR A;  3VQR A;  3AE9 A;  3NLC A;  1BZL A;  3UXK A;  4OPC A;  3ZLF A;  2GEW A;  1GRH A;  2YVG A;  4IL2 A;  6ENL A;  3AM9 A;  1OEP A;  2PMQ A;  2YWL A;  3SFD A;  2C76 A;  4GRT A;  4ENL A;  7ENL A;  3SZC A;  3ZVH A;  5EOW A;  3ICS A;  5ENL A;  3R1Z A;  4RG4 A;  3UKL A;  1GSN A;  4OPI A;  4K1W A;  4JHM A;  3VA8 A;  3NYF A;  4IVO B;  3ES8 A;  2EQ6 A;  3ICR A;  4GME A;  4ZCW A;  4TM1 A;  1JNZ A;  2GR0 A;  1GEU A;  4LII A;  1E7P A;  3BI4 A;  1M64 A;  4NEW A;  2R45 A;  1PDH A;  3C96 A;  4N9X A;  2BXS A;  3O0H A;  4KPL A;  3RR1 A;  3UJ2 A;  4A9W A;  2OQY A;  3TTE A;  1CJ4 A;  4GIS A;  3V3N A;  2JK6 A;  4J33 A;  1NG4 A;  3OPS A;  1DJQ A;  2Q0L A;  3UCC A;  4ECH A;  3IJI A;  4MGG A;  4LA1 A;  3T31 A;  4DSG A;  3P3B A;  2BYB A;  4YTP A;  1TDN A;  4A35 A;  4EM3 A;  4GDP A;  1GRT A;  4ROP A;  1E1L A;  4H83 A;  4IL0 A;  1D4E A;  5GSN A;  3FXG A;  3VRA A;  1ZXI C;  2PCE A;  5ER0 A;  3K1G A;  4FI4 A;  3L5O A;  1GXF A;  4APN A;  3VR9 A;  3NO1 A;  4UDP A;  3QN3 A;  4GR1 A;  4X9M A;  1ZMD A;  3FV9 A;  3NIX A;  1PXB A;  3GMB A;  3QFA A;  4HA6 A;  1KKO A;  1EL9 A;  3QVP A;  3QVR A;  4IVM B;  3RRA A;  3OZ2 A;  3OTR A;  4EQS A;  1FO4 A;  3DK8 A;  1CBO A;  3CN8 A;  3LZW A;  3NGC X;  1E1M A;  2CDU A;  4YSY A;  4NTC A;  3JSK A;  1GET A;  1ELI A;  1H84 A;  3SM8 A;  2GGE A;  4H2Q A;  1F8W A;  2HXU A;  5EB5 A;  1IUS A;  1TDE A;  3NYC A;  2Q0K A;  3R07 C;  2IID A;  3BOX A;  4YKF A;  2W55 A;  1WYG A;  2Q6U A;  2X50 A;  2PGW A;  2OO6 A;  1OJD A;  1JPD X;  4OPL A;  2UZZ A;  1NHS A;  4XWR A;  2Z5X A;  3N4E A;  3WE0 A;  2DW7 A;  2TPR A;  3UOX A;  2HZG A;  2YR6 A;  4NEV A;  2YLS A;  4EQX A;  3I4K A;  4EQR A;  4WCT A;  3MUC A;  4Z17 A;  3LAD A;  2BRA A;  5BUL A;  1H2I A;  3T2Y A;  5J60 A;  5JCL A;  3HRD C;  3P93 A;  4YTM A;  3H12 A;  3OW1 A;  3HYW A;  4IP5 A;  5L46 A;  2R4E A;  3PVC A;  1JRY A;  2WPC A;  1QJD A;  4GF7 A;  1DNC A;  2IVE A;  4NTE A;  3AN1 A;  2BAC A;  3DES A;  4J31 A;  1EL5 A;  2POD A;  3NFU A;  2R46 A;  4ZCC A;  3EUB 3;  5KVI A;  3QKE A;  4B67 A;  2HQM A;  3RED A;  2FJD A;  1E1N A;  2QA2 A;  2XVE A;  3TWA A;  1H86 A;  1D7L A;  1JRO A;  2XFO A;  3H8L A;  5M10 A;  1TYT A;  4DNA A;  3NT6 A;  4YXD A;  1GRA A;  3NNE A;  5FJT A;  5KMS A;  4C74 A;  4X4J A;  2XLU A;  3T14 A;  3DFY A;  4GDE A;  4C77 A;  4BK2 A;  3OZY A;  2GR1 A;  3EF6 A;  1JNR A;  2YVJ A;  1MDL A;  4B64 A;  4YSZ A;  2PTZ A;  2V5Z A;  3S5S A;  1L9C A;  1XAN A;  4D04 A;  4YSX A;  1EL8 A;  3SYI A;  1QLB A;  5U1O A;  2RGO A;  4KPR A;  3ABV A;  4K2S A;  5J04 A;  3IJQ A;  4K8D A;  1RYI A;  2VQ7 A;  3S61 A;  1ZDL A;  4H4Z A;  2PU1 A;  3NVZ B;  1GRF A;  2WBA A;  3T8Q A;  2XVF A;  3VC5 A;  4G73 A;  3VCC A;  3HPF A;  1DOD A;  2XVH A;  3ETR B;  2JAE A;  3CIR A;  2WPF A;  1REO A;  3BJS A;  3BHK A;  2QDD A;  3GYJ A;  4K5R A;  2OVL A;  4Z1Y A;  2GL5 A;  1K0I A;  5KMQ A;  5JCM A;  4H19 A;  5FJR A;  3UOY A;  1KD0 A;  3NVY B;  1STZ A;  2P0I A;  1ZKQ A;  3TJ4 A;  4CBQ A;  3CTY A;  1MUC A;  1DTN A;  3K7T A;  3AYI A;  3DGB A;  3KKJ A;  4MKS A;  4AP3 A;  1LPF A;  1ZY8 A;  2OLN A;  2ZZC A;  3NTD A;  3GMC A;  3LZX A;  2POZ A;  5J7X A;  3AE2 A;  4GAV A;  3OC4 A;  1SJB A;  2YG6 A;  2C72 A;  3F8P A;  3DDM A;  4JN7 A;  1PBB A;  2BA9 A;  3PFR A;  2PYX A;  2XLP A;  3KVE A;  2C3C A;  4Y4M A;  1N5W C;  4B69 A;  5KRQ A;  2W0H A;  1LTX R;  2WDQ A;  1HYU A;  1CL0 A;  3ZLH A;  2AL2 A;  1E1K A;  1UKV G;  4JNA A;  4J1O A;  1SJC A;  2A87 A;  4J56 A;  4C3X A;  5CKU A;  3PS9 A;  1ONF A;  3AB1 A;  2QJJ A;  1W6T A;  3RHA A;  4GYP C;  2GSH A;  4U8I A;  2E1M A;  1P2H A;  1Y56 B;  1PXA A;  3BI2 A;  1CJ2 A;  1NEK A;  2H89 A;  3ENL A;  2WPE A;  3LJP A;  3K7M X;  3V5C A;  3CPJ G;  2XFU A;  5KVH A;  1S7M A;  4K8G A;  4H4X A;  4J3Z A;  1D7Y A;  2GDQ A;  1KNP A;  5HHF A;  2XLS A;  3ITJ A;  3NK2 X;  3DJD A;  4FK1 C;  4H4W A;  1TRB A;  2X99 A;  4A79 A;  2X3N A;  3FVD A;  4MMW A;  1S2Q A;  2RDX A;  2B76 A;  4X9N A;  4H50 A;  2JBV A;  4KX6 A;  2Y6Q A;  2YAU A;  3GD3 A;  4A6G A;  1IYX A;  1E9I A;  1DOB A;  2XFQ A;  3LXD A;  4H2R A;  4NTD A;  4O5U A;  4H2N A;  1GOS A;  2XH7 A;  1MRA A;  2GMH A;  3HYV A;  2Z5Y A;  2FJB A;  4HYR A;  4H4T A;  3SZ0 A;  3CGE A;  1SJD A;  3IJL A;  1XPQ A;  4G6H A;  4WX1 A;  2GGG A;  3FYY A;  4CRT A;  3UTH A;  3SZW A;  4I58 A;  3MKC A;  4FX9 A;  4X2P A;  3E1T A;  3NXL A;  1PN0 A;  2PP1 A;  4LU6 A;  3U9I A;  3AE1 A;  3T2Z A;  1XS2 A;  1PDZ A;  4O5Q A;  2OQH A;  4TM4 A;  4GGH A;  3SGL A;  3SR6 B;  1JOA A;  4OPD A;  4BK3 A;  3P4S A;  1S3B A;  5C3J A;  1NAA A;  2ARD A;  2ZZB A;  3RGT A;  3IF9 A;  4CCQ A;  1B8S A;  3B97 A;  2O56 A;  4AT0 A;  2OAL A;  1VQZ A;  1FHU A;  1P43 A;  3UJS A;  4A5L A;  1NHP A;  1Q1R A;  3ICT A;  3PWI A;  2YG4 A;  1NEL A;  1PXC A;  2XDO A;  1DOE A;  2OKT A;  4Y4L A;  2XGZ A;  2OZ3 A;  3QTP A;  3UKK A;  2OG9 A;  1H7W A;  3HW2 A;  3NK0 X;  1M6I A;  3AXB A;  3ATR A;  2RGH A;  3GD4 A;  4M52 A;  4G8T A;  1ZMC A;  2FKP A;  1FFU C;  2WES A;  2C64 A;  5KMR A;  3SZF A;  1PBF A;  3ZVI A;  1LVL A;  3G5R A;  3SY4 A;  2OZ8 A;  3GDP A;  3AEC A;  2X8G A;  4YKG A;  3UKP A;  2AL2 B;  4M6U A;  5IQ4 A;  3D46 A;  1N5X A;  2DKI A;  2XFP A;  3D47 A;  3QLD A;  1KSU A;  3ATQ A;  3UP5 A;  4IT1 A;  2GGH A;  4U8O A;  2AL1 A;  4A3R A;  1RVK A;  5IDZ A;  1NEN A;  3CXB A;  3H8I A;  1JCT A;  5DBJ A;  3TOY A;  1V97 A;  3AE3 A;  1MXT A;  3Q4D A;  3P4R A;  4OPG A;  3ALJ A;  2PA6 A;  4Z26 A;  4C3Y A;  3IHM A;  1DXL A;  1GRG A;  2JB2 A;  3B6D A;  2R0C A;  4JY2 A;  2XVJ A;  3VRD B;  4IA6 A;  4ZCD A;  4HCH A;  4U2S A;  3CPI G;  5JCN A;  3MY9 A;  3OP2 A;  3M12 A;  2GQF A;  1ECQ A;  3CNJ A;  3AEF A;  4EQW A;  1FEA A;  1OJA A;  3FJ4 A;  1X2G A;  2VOU A;  3BNU A;  4DN1 A;  1IJH A;  4U2T A;  3S5W A;  3PO7 A;  3M13 A;  2YQU A;  3SXI A;  2PS2 A;  3N6J A;  1FOH A;  5BUK A;  1PBD A;  2OX4 A;  2V3A A;  3T0K A;  4Z2U A;  2YLX A;  1YEY A;  3UTE A;  4J2W A;  1GND A;  1R0M A;  4ICY A;  1XHC A;  3AEB A;  2OLO A;  2GB0 A;  2P8B A;  1F9C A;  4BJZ A;  2BC0 A;  4J57 A;  5HXI A;  4TVW A;  4H4P A;  2NQL A;  3DME A;  4KT2 A;  2R9Z A;  2BK5 A;  1H82 A;  3NTA A;  3K30 A;  2O9Z A;  2I0Z A;  1N60 C;  1GTE A;  1Y56 A;  3SJN A;  3EAN A;  1OJT A;  2C73 A;  3GC2 A;  3TWB A;  3NS1 B;  3Q6J A;  1OJC A;  5HY5 A;  3KA7 A;  4ADW A;  2GAH B;  1GRE A;  3NZG A;  4UP3 A;  3NK1 X;  2GGJ A;  3DEQ A;  3AYL A;  2GR2 A;  5KXJ A;  2OFJ A;  2YLT A;  4B63 A;  4D03 A;  1NHR A;  4KEM A;  2BK3 A;  3IC9 A;  4U8K A;  3DG7 A;  2WOW A;  4GYP A;  1VQW A;  3AE5 A;  2WDR A;  3SX6 A;  1N1P A;  3AE6 A;  2FJE A;  2HNE A;  2MNR A;  3AEG A;  3SN0 A;  4AOS A;  5FS6 A;  5FJU A;  5FMH A;  3UKF A;  1YQ3 A;  3AE4 A;  3R11 A;  4FK1 A;  2JB3 A;  2VQB A;  2X8H A;  1VG9 A;  3CGB A;  3CGD A;  3PWG A;  3DGZ A;  2WS3 A;  3ALM A;  1SB3 B;  3CNS A;  3TW9 A;  3V4B A;  1EBD A;  3OZM A;  3H8A A;  2VVL A;  3URH A;  3V76 A;  4AP1 A;  4G9K A;  2HXT A;  5EU9 A;  3D9X A;  1P2E A;  2QJM A;  3MWC A;  5JRB A;  2WEU A;  5FS7 A;  4UDQ A;  5JCI A;  1L0V A;  4DWD A;  4Z44 A;  1FL2 A;  2BAB A;  3VFC A;  3NHO X;  1CC6 A;  4IA5 A;  1FIQ B;  3D8X A;  1BKW A;  3H7V A;  3QSS A;  2QCU A;  3P4P A;  3AEA A;  2QJN A;  3VDG A;  2PU0 A;  3JVA A;  2FJA A;  4EIQ A;  3T37 A;  4RSL A;  4II3 A;  4XXG A;  1ZK7 A;  4GCM A;  3FG2 P;  4MJW A;  3DIP A;  1B37 A;  1PBC A;  2CVJ A;  3ZYX A;  2V6O A;  2YM1 A;  3UOV A;  2X8C A;  4IV9 A;  2ZZ0 A;  3AE8 A;  3N4F A;  3PK7 A;  2JKC A;  3SFE A;  1PJ7 A;  3NYE A;  1CC2 A;  3CGC A;  3H4K A;  2BCP A;  2GV8 A;  1GRB A;  1KDG A;  1CHU A;  4II2 A;  3S47 A;  2E5V A;  4GGB A;  3STP A;  3V5F A;  4Y4N A;  2PGE A;  4E6M A;  3VC6 A;  4ZOH B;  1PS9 A;  5EBK A;  2ZAD A;  4HCL A;  2PTW A;  3GWD A;  3UKA A;  3MQT A;  1MDR A;  1O95 A;  3QSE A;  3CNT A;  3NRN A;  4TM0 A;  2ONE A;  3QPE A;  2E3T A;  4EMW A;  2WP9 A;  1Q1W A;  4TM3 A;  2DW6 A;  5TR3 A;  3ZDN A;  3SQS A;  2PTY A;  4A65 A;  4H4S A;  2WDV A;  2BXR A;  3NRZ B;  2VVL G;  5KMP A;  4DYE A;  4JN8 A;  2CUL A;  1H7X A;  4YWO A;  1CC4 A;  3NH3 X;  4I59 A;  2GH5 A;  3G5Q A;  1FCD A;  3IWA A;  2B9Y A;  4RG3 A;  2PP0 A;  2GQW A;  3MSY A;  1IUW A;  3F8D A;  1IUU A;  1MNS A;  1N62 C;  3I6T A;  1IUX A;  5KOW A;  3I6D A;  2VRM A;  3UJF A;  3EEZ A;  2AR8 A;  2WQY A;  2R0P A;  4U8L A;  2WP6 A;  4U8M A;  1ONE A;  1BWC A;  5BRT A;  4IP4 A;  3NVV B;  4U8J A;  1BF3 A;  4EM4 A;  3GRT A;  2P8C A;  3RP8 A;  4DSH A;  2AQJ A;  3DK4 A;  2AKZ A;  3DK9 A;  4H4Y A;  1K4Q A;  2VRL A;  4G6G A;  1GAL A;  3CXO A;  3RO6 A;  1BGN A;  2W54 A;  3C4A A;  4OPU A;  2QVH A;  4PAB A;  1F3P A;  3V3O A;  1S3E A;  3EAO A;  1B5Q A;  1TDF A;  3ALL A;  3SQP A;  2NVK X;  3TJI A;  3L1R A;  1XPY A;  2PHH A;  5FJO A;  2EQ9 A;  1TYP A;  1H6V A;  1H83 A;  1S2Y A;  2BCG G;  1ZX9 A;  4DXK A;  1N4W A;  3K7Q X;  3DGH A;  3SN4 A;  1DOC A;  1ZOV A;  4GAP A;  2XH0 A;  4GFI A;  4Z43 A;  4E0V A;  1RSG A;  3CND A;  4NZH A;  1SJA A;  3AD7 B;  4H1Z A;  5CQF A;  1NHQ A;  2NPX A;  1ELS A;  5LV9 A;  5JCK A;  4H4Q A;  2BRY A;  2AKM A;  1EBH A;  4Z2T A;  1TKK A;  5BOE A;  2GRT A;  2PP3 A;  2CFY A;  3LOV A;  3HZL A;  2B7S A;  3UKQ A;  3KUM A;  1GER A;  3ES7 A;  1BQG A;  4G7F A;  3GDN A;  1GV4 A;  2YVF A;  4JNQ A;  3U4F A;  1TDO A;  3P4Q A;  3CAW A;  2A8X A;  2WET A;  3R0K A;  4J36 A;  4OPT A;  2JB1 A;  1ZP0 A;  3AEE A;  1Y0P A;  2H88 A;  1WUF A;  5KWF A;  3AD9 B;  4EMI A;  3C4N A;  1PJ5 A;  1N61 C;  4U2L A;  2QQ6 A;  3EPT A;  5EB4 A;  3GY1 A;  1TZZ A;  1VG0 A;  5U25 A;  1KFY A;  4JQ9 A;  4A6N B;  3FPZ A;  3GYI A;  1TE6 A;  3G5S A;  1DJN A;  3LB8 A;  4AOX A;  2GF3 A;  1Q9I A;  4G74 A;  3A7U A;  4K2X A;  2BS4 A;  3KD9 A;  1D4C A;  1COY A;  3RCY A;  4EIP A;  3FIM B;  1T3Q C;  3RP7 A;  4M0X A;  4A7A A;  5G5G B;  3R0U A;  3L8K A;  4E5T A;  1LV0 A;  4JN9 A;  3M0O A;  1FEC A;  1GES A;  1F6M A;  1V59 A;  5IQ1 A;  2W3S A;  5GRT A;  4B1B A;  4HNL A;  2WU2 A;  4USQ A;  4XWZ A;  4Z25 A;  3DA1 A;  1P48 A;  1QO8 A;  1LQU A;  1D4D A;  2IVD A;  2XVI A;  1OJ9 A;  4J34 A;  2GVC A;  2XLT A;  3T4W A;  3DJG X;  3UTG A;  4K5S A;  2QAE A;  1WUE A;  1E39 A;  3TQP A;  4YT0 A;  3ZLG A;  2V60 A;  3ISH A;  3JZU A;  1NG3 A;  2YG7 A;  1N63 C;  3CYJ A;  3NG7 X;  2C3D A;  1Z6L A;  4IZG A;  2OZT A;  4F4R A; 
#chains in the Genus database with same CATH homology
 2Y6Q A;  5JRB A;  2R45 A;  2ZBW A;  5C2T A;  2WEU A;  2YAU A;  3NKS A;  3GD3 A;  5FS7 A;  1PDH A;  2FBW A;  3C96 A;  3NN0 X;  4UDQ A;  1F8S A;  4B68 A;  4N9X A;  2BXS A;  1N4V A;  5JCI A;  1L0V A;  3O0H A;  4Z44 A;  4A9W A;  1DOB A;  1FL2 A;  2E4G A;  2BAB A;  1CJ4 A;  3LXD A;  4K7Z A;  2XFQ A;  3KPF A;  4H2R A;  3NHO X;  4NTD A;  3V3N A;  2JK6 A;  4J33 A;  4O5U A;  1NG4 A;  3BNM A;  1CC6 A;  4H2N A;  3DJE A;  4IA5 A;  1DJQ A;  2Q0L A;  3P9U A;  3D8X A;  4ECH A;  1BKW A;  3RP6 A;  1GOS A;  3QSS A;  2GMH A;  2QCU A;  1JRZ A;  2C4C A;  3HYV A;  3P4P A;  2Z5Y A;  4A99 A;  3CNP A;  2FJB A;  4LA1 A;  3AEA A;  3T31 A;  1SEZ A;  4DSG A;  2BYB A;  4H4T A;  4YTP A;  1TDN A;  2GMJ A;  3SZ0 A;  3CGE A;  4EM3 A;  2EQ7 A;  4GDP A;  5FS9 A;  2FJA A;  4HB9 A;  4EIQ A;  3T37 A;  4RSL A;  1XPQ A;  2QA1 A;  1GRT A;  4G6H A;  4WX1 A;  1E1L A;  4II3 A;  4XXG A;  1FEB A;  3GWF A;  1L9D A;  1ZK7 A;  4Z2R A;  1D4E A;  4GCM A;  4CRT A;  5GSN A;  3VRA A;  3UTH A;  3FG2 P;  3SZW A;  4MJW A;  4OCG A;  2C67 A;  3E1T A;  1B37 A;  4FX9 A;  4I58 A;  1O5W A;  1PBC A;  4OVI A;  1PN0 A;  1NDA A;  5ER0 A;  2CVJ A;  2GAG B;  4LU6 A;  3ZYX A;  2V6O A;  3L5O A;  3D1C A;  1GXF A;  4APN A;  3VR9 A;  2YM1 A;  3AE1 A;  4UDP A;  3UOV A;  2X8C A;  4GR1 A;  3VRB A;  4IV9 A;  4X9M A;  1ZMD A;  3DJJ A;  2ZZ0 A;  3AE8 A;  3NIX A;  3T2Z A;  4H4R A;  2JKC A;  1PXB A;  4O5Q A;  1XDI A;  1KSS A;  3SFE A;  3GSI A;  1PJ7 A;  3NYE A;  4UDR A;  4BJY A;  3GMB A;  4TM4 A;  1CC2 A;  3SGL A;  3QFA A;  1CJ3 A;  4HA6 A;  2ACZ A;  1JOA A;  3FBS A;  4OPD A;  1X31 B;  4BK3 A;  3P4S A;  1EL9 A;  3CGC A;  3H4K A;  1S3B A;  2OAM A;  1NAA A;  3QVP A;  3QVR A;  4GUV A;  4IVM B;  5C3J A;  2B9W A;  3OZ2 A;  4CY8 A;  4EQS A;  1KNR A;  3KLJ A;  2ARD A;  3DK8 A;  1CBO A;  2BCP A;  1L9E A;  3CN8 A;  3LZW A;  2ZZB A;  2GV8 A;  1GRB A;  3NGC X;  1E1M A;  1KDG A;  1CHU A;  2CDU A;  3II4 A;  4II2 A;  2E5V A;  3IF9 A;  4YSY A;  4NTC A;  1JU2 A;  4CCQ A;  1B8S A;  3AE7 A;  1YKJ A;  3JSK A;  1GET A;  4Y4N A;  2WP5 A;  1ELI A;  1H84 A;  3SM8 A;  2F5Z A;  4H2Q A;  1F8W A;  2XCG A;  2WHD A;  5EB5 A;  4AT0 A;  2OAL A;  1PS9 A;  1YQ4 A;  1NHP A;  5EBK A;  1IUS A;  4A5L A;  1Q1R A;  3ICT A;  1GPE A;  1MO9 A;  2BS3 A;  2YG4 A;  3GWD A;  3UKA A;  1TDE A;  3NYC A;  4NWZ A;  1O95 A;  1PHH A;  3QSE A;  2Q0K A;  3CNT A;  3AD8 B;  1PXC A;  3NRN A;  4TM0 A;  3QFB A;  2XDO A;  4EMW A;  2IID A;  2WP9 A;  1Q1W A;  1DOE A;  4TM3 A;  4YKF A;  5TR3 A;  4Y4L A;  3ZDN A;  3UKK A;  3FMW A;  1H7W A;  3NK0 X;  1M6I A;  3AXB A;  2Q6U A;  4A65 A;  3KPK A;  2X50 A;  4H4S A;  3ATR A;  1IUV A;  5HYM A;  4JDR A;  2RGH A;  2WDV A;  3GD4 A;  4M52 A;  1OJD A;  2BXR A;  4OPL A;  1ZMC A;  2VVL G;  2UZZ A;  4Z24 A;  1NHS A;  2WES A;  5KMP A;  2C64 A;  4XWR A;  5KMR A;  2YG5 A;  2CUL A;  2Z5X A;  1YY5 A;  1H7X A;  4YWO A;  1CC4 A;  3NH3 X;  4I59 A;  3R9U A;  1NPX A;  2GH5 A;  3G5Q A;  1FCD A;  1PBF A;  2RGJ A;  3IWA A;  4K22 A;  3SZF A;  2B9Y A;  2XYO A;  4RG3 A;  2YLZ A;  2GR3 A;  2GQW A;  3GRS A;  1IUW A;  2WU5 A;  3F8D A;  1LVL A;  1IUU A;  3G5R A;  3VR8 A;  3WE0 A;  3SY4 A;  4H4V A;  2TPR A;  1VRQ B;  2V61 A;  1IUX A;  5KOW A;  3UOX A;  3GDP A;  3AEC A;  3I6D A;  2X8G A;  2YR6 A;  1CF3 A;  4NEV A;  3F8R A;  2YLS A;  2VRM A;  4EQX A;  3UKP A;  4YKG A;  4EQR A;  2AR8 A;  2WQY A;  5IQ4 A;  2R0P A;  4WCT A;  4U8L A;  2BRA A;  3LAD A;  5BUL A;  2DKI A;  2VVM A;  2VZ2 A;  1H2I A;  2XFP A;  4U8M A;  3T2Y A;  5J60 A;  2DKH A;  2J3N A;  2XFN A;  2Y6R A;  2BC1 A;  5JCL A;  4PAA A;  1KSU A;  3ATQ A;  3UP5 A;  4H2P A;  1BWC A;  3BI5 A;  4EMJ A;  1B4V A;  4YTM A;  3ADA B;  5BRT A;  4CY6 A;  2B7R A;  4U8O A;  1BGJ A;  4U8J A;  1BF3 A;  2A89 A;  4EM4 A;  3HYW A;  5L46 A;  3AED A;  3GRT A;  1NEN A;  2R4E A;  3PVC A;  3CPH G;  3RP8 A;  1JRY A;  1MOK A;  4DSH A;  2WPC A;  2AQJ A;  3H8I A;  1LJ1 A;  3DK4 A;  1QJD A;  3RNM A;  4GF7 A;  1DNC A;  5DBJ A;  3DK9 A;  4YSH A;  1GT8 A;  1IUT A;  4H4Y A;  2IVE A;  4NTE A;  4CCR A;  3UOZ A;  2BAC A;  3AE3 A;  4J31 A;  2V3B A;  1MXT A;  1EL5 A;  3HYX A;  3P4R A;  4OPG A;  4C5O A;  1K4Q A;  2VRL A;  3ALJ A;  2R46 A;  2XLR A;  2YG3 A;  3IHM A;  3COX A;  1GAL A;  4G6G A;  4ZCC A;  1DXL A;  4C3Y A;  1GRG A;  1BGN A;  3C4A A;  4TLX A;  1VDC A;  2JB2 A;  3DH9 A;  3B6D A;  4OPU A;  3UTF A;  1RP0 A;  2R0C A;  5KVI A;  3Q9T A;  4PAB A;  4AT2 A;  4B67 A;  1F3P A;  2HQM A;  4JY2 A;  3V3O A;  2XVJ A;  3RED A;  1S3E A;  3VRD B;  2FJD A;  1E1N A;  1TDK A;  3EAO A;  2QA2 A;  1H86 A;  2XVE A;  4IA6 A;  4ZCD A;  2RAB A;  4U2S A;  1B5Q A;  1D7L A;  1N4U A;  3CPI G;  2YLW A;  2XFO A;  5JCN A;  3H8L A;  5M10 A;  3QJ4 A;  1K0L A;  3GYX A;  1TYT A;  1TDF A;  3ALL A;  5U63 A;  3SQP A;  2NVK X;  4DNA A;  3L1R A;  3NT6 A;  3M12 A;  2PHH A;  4YXD A;  1GRA A;  3NNE A;  2EQ9 A;  1TYP A;  1H6V A;  4CNK A;  2GQF A;  1H83 A;  1S2Y A;  2BK4 A;  3AEF A;  3CNJ A;  5KMS A;  2BCG G;  1ZX9 A;  4EQW A;  4C74 A;  4X4J A;  2XLU A;  1FEA A;  1ZOY A;  1N4W A;  1OJA A;  3T14 A;  4GDE A;  4C77 A;  2VOU A;  3K7Q X;  4BK2 A;  3DGH A;  3BNU A;  2C66 A;  4NNJ A;  5M0Z A;  1IJH A;  1DOC A;  2GR1 A;  3EF6 A;  1JNR A;  1ZOV A;  4GAP A;  2YVJ A;  3PO7 A;  4U2T A;  3M13 A;  2YQU A;  3S5W A;  3SXI A;  4B64 A;  4YSZ A;  4REK A;  2R0G A;  5KOX A;  4Z43 A;  4E0V A;  2V5Z A;  1FOH A;  1L9C A;  1XAN A;  3PG6 A;  1RSG A;  5BUK A;  4D04 A;  4YSX A;  5BVA A;  1EL8 A;  1PBD A;  2V3A A;  3AYJ A;  4BUR A;  3T0K A;  3CND A;  4CNJ A;  4Z2U A;  4NZH A;  3SYI A;  1QLB A;  3T2K A;  5U1O A;  2APG A;  4KPR A;  2B9X A;  2RGO A;  2YLX A;  2WOI A;  3AD7 B;  3UTE A;  2Q7V A;  2TMD A;  4J2W A;  3ABV A;  5CQF A;  2YR4 A;  1GND A;  1NHQ A;  2NPX A;  5LV9 A;  1KN0 A;  2OA1 A;  5JCK A;  3P1W A;  1KF6 A;  4ICY A;  4H4Q A;  2BRY A;  4K8D A;  1RYI A;  2VQ7 A;  3S61 A;  1ZDL A;  2C7G A;  4YTN A;  4H4Z A;  2EQ8 A;  4Z2T A;  2C70 A;  2AAQ A;  1XHC A;  3AEB A;  4A6N A;  3UP4 A;  2OLO A;  1GRF A;  2GB0 A;  1W4X A;  2WBA A;  2XVF A;  2GRT A;  2CFY A;  4BJZ A;  2BC0 A;  3LOV A;  1AOG A;  4G73 A;  1DOD A;  1JRX A;  4J57 A;  2XVH A;  2YM2 A;  3HZL A;  1PJ6 A;  4TLZ A;  3UKH A;  2B7S A;  5HXI A;  3UKQ A;  2JAE A;  3CIR A;  3QSM A;  1GER A;  2WPF A;  4H4P A;  4BV6 A;  1CJC A;  1REO A;  3GDN A;  2YR5 A;  3DME A;  1GV4 A;  3BHK A;  2YVF A;  4JNQ A;  2R9Z A;  2BK5 A;  3GYJ A;  1TDO A;  3UCL A;  4K5R A;  3P4Q A;  1H82 A;  1LQT A;  1H81 A;  3NTA A;  3K30 A;  2O9Z A;  4B65 A;  2I0Z A;  2A8X A;  1K0I A;  5KMQ A;  2WET A;  5JCM A;  1GTE A;  1Y56 A;  1D5T A;  3I3L A;  3UOY A;  4U8N A;  4BK1 A;  1EL7 A;  4J36 A;  3EAN A;  1PBE A;  1OJT A;  4OPT A;  2C73 A;  4U8P A;  3B3R A;  1YQZ A;  3CMM A;  2JB1 A;  1ZP0 A;  1ZKQ A;  2R4J A;  3AEE A;  4H7U A;  5FS8 A;  2C75 A;  1Y0P A;  5IPY A;  4CBQ A;  2H88 A;  3CTY A;  3K7T A;  3AYI A;  4DGK A;  4B66 A;  5KWF A;  4FDC B;  4H4U A;  3Q6J A;  1OJC A;  3AD9 B;  3KKJ A;  3KU9 A;  1LPF A;  1ZY8 A;  4AP3 A;  5HY5 A;  4EMI A;  2OLN A;  2ZZC A;  3KA7 A;  4ADW A;  3C4N A;  3NTD A;  1F8R A;  3GMC A;  3LZX A;  5J7X A;  1PJ5 A;  4U2L A;  3AE2 A;  4GAV A;  4Z26 A;  3OC4 A;  2GAH B;  1GRE A;  2YG6 A;  2C72 A;  4UP3 A;  1GTH A;  3IHG A;  3NK1 X;  3EPT A;  3F8P A;  5EB4 A;  1PBB A;  1VG0 A;  2BA9 A;  3AYL A;  5U25 A;  1KFY A;  3AWI A;  4P9S A;  2GR2 A;  4USR A;  4JQ9 A;  2WOV A;  5KXJ A;  2PYX A;  4A6N B;  2BS2 A;  3FPZ A;  2C65 A;  2XLP A;  2YLT A;  2C3C A;  3KVE A;  3GYI A;  4B63 A;  4D03 A;  3G5S A;  1NHR A;  1DJN A;  4Y4M A;  2BK3 A;  4B69 A;  3LB8 A;  5KRQ A;  2W0H A;  3NN6 X;  3IC9 A;  1LTX R;  4U8K A;  4AOX A;  2WOW A;  1O94 A;  2GF3 A;  3BHF A;  2WDQ A;  4JY3 A;  1Q9I A;  4G74 A;  1JEH A;  1HYU A;  1CL0 A;  1VQW A;  4K2X A;  2BS4 A;  3KD9 A;  1D4C A;  1COY A;  1E1K A;  3AE5 A;  2WDR A;  3SX6 A;  1N1P A;  1UKV G;  4JNA A;  1E6E A;  4EIP A;  3AE6 A;  2FJE A;  5KNL A;  2A87 A;  4J56 A;  3FIM B;  4C3X A;  1K0J A;  3AEG A;  4ZN0 A;  2YLR A;  4AOS A;  5FS6 A;  3VQR A;  3AE9 A;  3NLC A;  3RP7 A;  1BZL A;  5CKU A;  3PS9 A;  4A7A A;  1ONF A;  3AB1 A;  4OPC A;  3L8K A;  2GEW A;  3RHA A;  1GRH A;  2YVG A;  1LV0 A;  4JN9 A;  4U8I A;  3M0O A;  5FMH A;  2E1M A;  1P2H A;  3UKF A;  1Y56 B;  1PXA A;  1FEC A;  1GES A;  1YQ3 A;  1F6M A;  3BI2 A;  1CJ2 A;  1V59 A;  3AE4 A;  1NEK A;  5GRT A;  2H89 A;  2WPE A;  3LJP A;  3K7M X;  5IQ1 A;  4B1B A;  2WU2 A;  2YWL A;  3SFD A;  4USQ A;  4XWZ A;  2C76 A;  4GRT A;  2JB3 A;  4FK1 A;  2VQB A;  4Z25 A;  3SZC A;  3DA1 A;  2X8H A;  1VG9 A;  3CGB A;  3CGD A;  3CPJ G;  4KX6 A;  2XFU A;  3DGZ A;  5EOW A;  1QO8 A;  3ICS A;  5KVH A;  1LQU A;  1D4D A;  1S7M A;  2WS3 A;  2IVD A;  2XVI A;  1OJ9 A;  3ALM A;  4J34 A;  4H4X A;  2GVC A;  2XLT A;  3CNS A;  4RG4 A;  3UKL A;  3DJG X;  3UTG A;  1D7Y A;  4K5S A;  1GSN A;  2QAE A;  1EBD A;  1E39 A;  1KNP A;  2XLS A;  4OPI A;  5HHF A;  3ITJ A;  4YT0 A;  2V60 A;  3NYF A;  3ISH A;  3NK2 X;  4IVO B;  2EQ6 A;  3ICR A;  3DJD A;  1NG3 A;  2VVL A;  2YG7 A;  4FK1 C;  4H4W A;  1TRB A;  3URH A;  2X99 A;  3NG7 X;  3V76 A;  2X3N A;  4A79 A;  1S2Q A;  2C3D A;  1JNZ A;  4TM1 A;  4AP1 A;  1Z6L A;  2B76 A;  2GR0 A;  4G9K A;  4X9N A;  3D9X A;  4H50 A;  1P2E A;  1GEU A;  4LII A;  1E7P A;  2JBV A;  3BI4 A;  1M64 A;  4NEW A;  2WP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...