1NPXA

Structure of nadh peroxidase from streptococcus faecalis 10c1 refined at 2.16 angstroms resolution
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
447
structure length
446
Chain Sequence
b'MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH PEROXIDASE
publication title Structure of NADH peroxidase from Streptococcus faecalis 10C1 refined at 2.16 A resolution.
pubmed rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase(h2o2(a))
total genus 140
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1991-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1npxA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1npxA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1npxA02
1NDAA 4H4TA 2XVFA 3AEEA 4EIPA 2WDRA 1GERA 1D5TA 2GQWA 2ZBWA 3NRNA 1DOEA 4K2XA 1DJQA 3GMCA 5C2TA 2YG5A 4CCRA 3NGCX 1GRHA 4U8PA 1QJDA 2OALA 3KLJA 3NLCA 3DJJA 3M12A 4CY8A 3NKSA 2VZ2A 1KF6A 5BULA 2CDUA 1ZOYA 4OPLA 1DJNA 2BC1A 3REDA 3VRAA 4I58A 3EF6A 4B1BA 2C70A 1RYIA 1YQ4A 1EL8A 2O9ZA 2YVGA 5BUKA 3CNTA 1L9DA 1GOSA 4XXGA 1KDGA 2Q0LA 3RHAA 4CNJA 1YQ3A 1AOGA 2C72A 3NT6A 3NYCA 3II4A 3NTAA 1GREA 3AE6A 1GPEA 3JSKA 2QA1A 4IV9A 3NK1X 4Y4MA 5IQ1A 4E0VA 5J60A 1IUUA 2TPRA 4NTCA 1ZK7A 1OJAA 5LV9A 3CGBA 2VRMA 2GAHB 4YKGA 2XVEA 5FS7A 1GEUA 4C5OA 4LA1A 4Z24A 2Y6QA 1GSNA 3IC9A 3NH3X 3DH9A 3COXA 3FMWA 1ZDLA 2WP9A 3ALLA 3FPZA 2RGOA 3P4QA 5EBKA 3UKPA 2EQ8A 4CBQA 3CNDA 4U2TA 1NG4A 5JCIA 2GVCA 1H84A 1UKVG 3QJ4A 4CCQA 5KWFA 5DBJA 3UOZA 4U8KA 4GF7A 1Y56A 1ELIA 4IA5A 1E1MA 3H8IA 2GH5A 1IUVA 2V60A 2VVMA 3SFEA 1LV0A 2GMJA 3SM8A 4H4VA 3E1TA 2QCUA 1DOCA 3QSMA 4USQA 3DK9A 5JCNA 2WDVA 4YSYA 3H4KA 2GRTA 1FL2A 1H83A 1QLBA 4OCGA 2VOUA 2WU2A 4UP3A 1OJDA 3KVEA 4J56A 1S3BA 1KFYA 2BXSA 4TLZA 4BK2A 4U2SA 5ER0A 2IIDA 5JCKA 1ZX9A 1D4EA 2GR2A 2X8HA 2EQ6A 3BI5A 3AE5A 2GEWA 3IF9A 3M13A 4U8OA 4B66A 1H7XA 1ZMCA 4REKA 4CNKA 3KD9A 1EL9A 3URHA 3AE7A 3CGDA 1ZOVA 2H88A 2WESA 2YM2A 4JY2A 4Y4LA 1H86A 3RNMA 1P2EA 3NG7X 5KOWA 3BHKA 4YWOA 2H89A 4APNA 4DGKA 4ICYA 2BS3A 3UTEA 3ITJA 3NK0X 3Q9TA 2JK6A 1JOAA 3PS9A 4RG3A 2YLXA 3K30A 3GWFA 4H4WA 2QA2A 1E1LA 1TDEA 1E7PA 1XDIA 2XDOA 1N4VA 1DODA 3F8PA 4TM4A 2NVKX 2VVLG 3ABVA 1LJ1A 1PBEA 1M6IA 1GNDA 3I3LA 4OVIA 2B7SA 1PXBA 3RP8A 4YTNA 4BURA 4EM3A 4J34A 1RSGA 1K4QA 5EOWA 3K7QX 3BNUA 3D8XA 2E1MA 4X4JA 1CJ3A 3QVPA 1XANA 4N9XA 1E6EA 3IHMA 1FCDA 2YLSA 3ALMA 4XWRA 3AE1A 2WOIA 1DNCA 1CC6A 3P9UA 4UDQA 4BK3A 1B4VA 3LZXA 3QVRA 3CN8A 4YXDA 2XVHA 1L0VA 4BK1A 4JQ9A 2JKCA 5FMHA 3G5RA 1NHRA 1O5WA 2JBVA 4K5RA 4USRA 5U25A 1E1KA 4TM3A 2A8XA 2WP5A 2VRLA 2XFNA 5J7XA 2OAMA 2C66A 2E5VA 5CKUA 4RG4A 1F8SA 3DGZA 4HA6A 1ONFA 1DOBA 2FJBA 1MO9A 1TYPA 2I0ZA 3UP4A 3P1WA 1ZKQA 1NG3A 1EL7A 4H7UA 1Q1RA 1GV4A 3S61A 3C4NA 2YM1A 4H4YA 1N1PA 4H4ZA 4EMJA 2C65A 2V61A 3C4AA 3GYJA 3IHGA 4EQWA 4A99A 4NTEA 4BV6A 3V76A 4B65A 2X99A 2BXRA 2WOWA 4A6NA 1NHPA 1BGJA 4H4XA 3PO7A 1VRQB 4H2NA 4BJZA 2XVIA 4Z26A 1O95A 3R9UA 4JNQA 3RP7A 1NAAA 1GETA 4ADWA 2RGJA 3GDNA 3ISHA 4H2QA 2B7RA 4GUVA 2YR4A 2C64A 2BACA 1GALA 3LADA 2YLZA 2YR6A 1KSSA 4I59A 1LQUA 3AB1A 1GTHA 1JRXA 4EQXA 3GRTA 3UOXA 4Z2UA 4U8IA 1B5QA 2X50A 4O5UA 3LOVA 3UKKA 2X8CA 4OPIA 3VR8A 3FG2P 3CNJA 2YLTA 2YR5A 1XHCA 3NK2X 2XVJA 3O0HA 2X8GA 4FX9A 1S2QA 1Y0PA 2YG4A 4U8JA 3UTGA 2XLTA 2GMHA 3DJEA 3AD8B 1CJ2A 1LQTA 1L9CA 2A87A 4EIQA 1NHSA 5U63A 1CJCA 1IUWA 1GRAA 1KNPA 4FDCB 2V5ZA 5GSNA 2R45A 4A79A 4NEWA 2YQUA 3BI2A 2YG3A 3UOVA 2V6OA 2QAEA 3NIXA 2EQ7A 1BGNA 3AE3A 4UDRA 1TDNA 2WOVA 2BA9A 1FEBA 2R46A 4OPTA 2GV8A 3SGLA 4H4PA 4OPDA 5IQ4A 2BYBA 1OJ9A 1NEKA 3G5SA 3AD9B 1JU2A 4U8MA 1VQWA 2GR1A 4X9NA 4IA6A 1GRTA 1B37A 2Q7VA 2V3BA 3DA1A 4IVOB 5KRQA 4B69A 3EPTA 4CRTA 1YQZA 2BK5A 2RABA 1OJCA 1N4WA 3CIRA 4D03A 2E4GA 3AYLA 3OZ2A 1CC4A 1IUTA 2XLUA 1COYA 3ADAB 5CQFA 1V59A 1TYTA 4TM1A 2YLWA 3CGEA 5EB4A 3DMEA 2C67A 2ZZBA 1EL5A 2PYXA 4EMWA 4BJYA 3UKHA 3AE2A 1XPQA 1MOKA 3KKJA 1E1NA 4AP3A 4H4UA 3UKFA 4ZCDA 3VQRA 4YT0A 4NZHA 1D4CA 5IPYA 4K7ZA 2ARDA 1F6MA 3KA7A 2R4EA 1PN0A 1D7YA 4K8DA 3FBSA 3UTFA 4DNAA 2YG6A 3B3RA 1JNZA 2WS3A 2FBWA 1ZP0A 4Z2TA 3KU9A 1Y56B 2HQMA 2Z5YA 1K0LA 2DKIA 1KNRA 3V3OA 2GQFA 4FK1A 1PJ6A 2OLNA 1F8RA 4H2RA 2BC0A 2A89A 4YSHA 2YVFA 2B9YA 5M0ZA 2VVLA 1K0IA 2ACZA 2JB2A 1BF3A 3AEAA 3UCLA 4C74A 3ICTA 3UOYA 4KPRA 4JN9A 1TRBA 2C73A 2R0PA 4C77A 1GRBA 3CPIG 1M64A 4LIIA 3K7TA 4Z25A 1PDHA 4H4QA 3KPFA 2FJAA 1PJ7A 4AOXA 3AEDA 1CF3A 3Q6JA 1ZMDA 2C3CA 3FIMB 4JDRA 1S2YA 3M0OA 2R0CA 4GCMA 4JNAA 2ZZCA 4H50A 1EBDA 2APGA 1DXLA 1CHUA 2FJDA 4B63A 2CFYA 2Q0KA 3WE0A 4YKFA 1F3PA 2Q6UA 3H8LA 1E39A 3DK8A 3P4PA 2XCGA 4WX1A 1L9EA 1LTXR 2R9ZA 4OPGA 4C3XA 3NHOX 2B9WA 4H4SA 5KXJA 1PXCA 3AD7B 4TLXA 1VG0A 4UDPA 4A5LA 1CJ4A 4C3YA 4YTPA 1H81A 4YSXA 2XLPA 3ICSA 1KSUA 4FK1C 2CULA 1PJ5A 1Z6LA 3ATRA 3CPJG 4H2PA 3ZDNA 3DK4A 5JCLA 1H6VA 1PBBA 3AYJA 4B64A 2WEUA 3VRBA 2FJEA 2WDQA 3QSEA 4AT2A 1YY5A 3L1RA 2X3NA 2YG7A 4TM0A 3CGCA 3CTYA 1GTEA 3LB8A 4J36A 4GR1A 1JEHA 4AT0A 3LJPA 1PBFA 4PAAA 2BS2A 5C3JA 2YLRA 1BWCA 3AYIA 1F8WA 1JRZA 3V3NA 2WPEA 2B76A 2BK4A 5TR3A 1LPFA 2WU5A 3C96A 4GDPA 2BCPA 3AEGA 4Z2RA 3AWIA 3GYIA 1GRFA 3DGHA 4J31A 5EB5A 4ECHA 2BCGG 3NNEA 3OC4A 2J3NA 2OA1A 2IVDA 3VRDB 3NYEA 3P4RA 3UP5A 1GRGA 4AP1A 2WETA 4GRTA 2C75A 1GXFA 1TDKA 1FEAA 4U8LA 1PXAA 3RP6A 1H82A 2PHHA 2XFQA 4EM4A 2B9XA 4RSLA 5HHFA 1H7WA 5BVAA 3GRSA 4D04A 1CL0A 2UZZA 3UTHA 1X31B 5KVHA 4PABA 4KX6A 2NPXA 3EANA 5JCMA 3BNMA 5HXIA 2AR8A 1IUXA 2WHDA 5HY5A 1S3EA 4OPCA 2GB0A 1PBDA 3SFDA 4AOSA 2C7GA 4YSZA 4YTMA 4Y4NA 1B8SA 3B6DA 2GR0A 3IWAA 2F5ZA 4ZN0A 4WCTA 3GSIA 4JY3A 4A6NB 4DSHA 3DJGX 1BZLA 3SQPA 1GESA 2WQYA 3AE4A 3P4SA 3ALJA 3UKAA 1K0JA 2AQJA 1O94A 3G5QA 2BS4A 4EQRA 2GF3A 3CNPA 2R0GA 3NN0X 4HB9A 1JNRA 4ZCCA 3GWDA 1IJHA 5BRTA 2TMDA 4X9MA 3QFBA 2XFOA 4Z43A 2XYOA 3GMBA 3F8RA 2R4JA 3F8DA 2JB1A 4OPUA 4H4RA 2XFUA 4B67A 2WPFA 1MXTA 2VQ7A 3NYFA 4MJWA 4XWZA 3QSSA 2CVJA 2YWLA 2BABA 3AE9A 4NTDA 2W0HA 3S5WA 3QFAA 2VQBA 3EAOA 5HYMA 4EQSA 4O5QA 1YKJA 4A9WA 5M10A 4EMIA 3K7MX 4A65A 2YAUA 3BHFA 1TDFA 3AEFA 4DSGA 3NN6X 2Z5XA 1FECA 1P2HA 1OJTA 4LU6A 5KVIA 4J57A 4J2WA 3ZYXA 1VDCA 2ZZ0A 2XFPA 2YVJA 2WPCA 3D1CA 1ZY8A 1D4DA 5KOXA 3GD4A 3AECA 5U1OA 2JAEA 3GD3A 2AAQA 1RP0A 4B68A 1W4XA 1NENA 1Q1WA 3ATQA 3AXBA 5GRTA 1BKWA 1PHHA 5FS8A 1REOA 2WBAA 4K22A 5L46A 4CY6A 3LXDA 2OLOA 4A7AA 1IUSA 4NEVA 4K5SA 1N4UA 4P9SA 2BK3A 3T37A 4U8NA 3PVCA 5FS6A 1CBOA 3AE8A 3AEBA 3ICRA 3LZWA 3CNSA 1D7LA 3VR9A 4M52A 4GDEA 3BI4A 3UKQA 3DJDA 2EQ9A 1QO8A 3I6DA 2DKHA 1NPXA 2XLSA 3HZLA 2GR3A 5FS9A 4IVMB 2JB3A 2RGHA 2Y6RA 1LVLA 3NTDA 2XLRA 2GAGB 1NHQA 1GT8A 2C3DA 1VG9A 2IVEA 4J33A 1SEZA 2WP6A 1CC2A 3CPHG 2C76A 3L8KA 1FOHA 3GDPA 2V3AA 1JRYA 4U2LA 1PS9A 3UKLA 4Z44A 1PBCA 1Q9IA 1HYUA 1TDOA
chains in the Genus database with same CATH superfamily
1NDAA 4EIPA 1D5TA 3CAWA 2GQWA 1DOEA 3FYYA 3NGCX 5FJTA 1KF6A 2CDUA 3DFYA 3SN4A 1DJNA 3REDA 3VRAA 4DX3A 2C70A 1RYIA 1EL8A 5BUKA 3RHAA 3CK5A 1AOGA 3NYCA 1EBHA 3PWGA 1GREA 3AE6A 1GPEA 4Y4MA 2PTWA 2TPRA 1ZK7A 2GAHB 4LA1A 2PODA 1XPYA 4YWSA 3FMWA 3UKPA 4CBQA 5JCIA 2GVCA 4CCQA 1UKVG 3QJ4A 3TW9A 3UJRA 4GF7A 1Y56A 3H8IA 1IUVA 2AL1A 2GMJA 4H83A 2W3RA 3DK9A 2WDVA 2GRTA 3AM9A 1OJDA 1S3BA 2BXSA 3EKGA 2IIDA 3MWCA 3M13A 3IF9A 4CNKA 2WESA 4Y4LA 3PG6A 1P2EA 3BHKA 4KT2A 1JROA 4ROPA 4Z1YA 4II3A 4E6MA 2BS3A 3Q9TA 3K30A 1TDEA 1E7PA 2XDOA 1N4VA 1STZA 3QLDA 1LJ1A 1PBEA 3H7VA 4YTNA 1WUFA 4EM3A 1RSGA 1XANA 4N9XA 2YLSA 3ALMA 4UDQA 3LZXA 2JKCA 5FMHA 3G5RA 1O5WA 4K5RA 2A8XA 2VRLA 2XFNA 2OAMA 1F8SA 1DOBA 1MO9A 1X2GA 1ZKQA 4E4FA 1Q1RA 3S61A 5KNLA 4EMJA 2V61A 3ENLA 4NTEA 4A6NA 5KMPA 1BGJA 3A7AA 4E5TA 4JNQA 1GETA 3I6TA 3GDNA 2CHRA 2OQYA 2BACA 4J1OA 2YLZA 1NELA 1LQUA 3AB1A 2W55A 4EQXA 4U8IA 2GL5A 2HNEA 3LOVA 2PU1A 3VR8A 3N4FA 3CNJA 3ZLGA 2YLTA 1XHCA 3O0HA 2BRAA 3UTGA 2XGZA 3NVWB 3AD8B 1CJ2A 2DW7A 2A87A 1KNPA 3DDMA 2R45A 3UOVA 2V6OA 2EQ7A 3AE3A 4A35A 4DYEA 1DTNA 3AD9B 1JU2A 2GR1A 4X9NA 2QVHA 4IVOB 3DA1A 5KRQA 3IJIA 4B69A 3EPTA 2BK5A 2OX4A 4D03A 3SZFA 3ADAB 3CGEA 2C67A 4BJYA 4EMWA 1XPQA 1OEPA 1MRAA 1EC8A 4K1WA 4YT0A 2OVLA 2PTXA 5KMQA 3KA7A 1D7YA 5KMSA 2YG6A 3TOYA 3B3RA 3V4BA 2FBWA 4Z2TA 3TWAA 2Z5YA 1K0LA 1KNRA 1PJ6A 4H2RA 1JPDX 1MDRA 3VC5A 4C74A 1YEYA 3ETRB 1TRBA 4C77A 1ELSA 4LIIA 1T3QC 1PJ7A 1CF3A 3Q6JA 1ZMDA 2C3CA 3FIMB 4GCMA 4JNAA 2R0CA 2ZZCA 2PP3A 2APGA 1DXLA 1CHUA 1SJDA 2AL2B 4YKFA 1F3PA 1E39A 1JPMA 1L9EA 3NHOX 2B9WA 1PXCA 4YSXA 1KSUA 2PGWA 1FFVC 3DK4A 5JCLA 2WEUA 3N4EA 4TM0A 2X3NA 2YG7A 3CGCA 3LB8A 4GR1A 3T0KA 1KCZA 5C3JA 1BWCA 2B76A 1LPFA 4GDPA 2BCPA 3AEGA 3AWIA 3UGVA 2BCGG 3NNEA 3ZLFA 4DWDA 3UP5A 1GRGA 3HYXA 2O56A 5HHFA 4NWZA 1X31B 4KX6A 2NPXA 5JCMA 1IUXA 2WHDA 5HY5A 3SFDA 3V3WA 4AOSA 2C7GA 4A3RA 3T31A 3B6DA 3RITA 4II2A 2OZ3A 3MY9A 1BZLA 3AE4A 2WQYA 3UKAA 2QGYA 1K0JA 1KN0A 3CNPA 3NN0X 1JNRA 3GWDA 1TE6A 3N6HA 3NRZB 2TMDA 2XSXA 4HNLA 2XYOA 1R0MA 3F8DA 4K2SA 4MJWA 4XWZA 2W0HA 3QFAA 3UJFA 4EQSA 4O5QA 1YKJA 4EMIA 4DSGA 3NN6X 1FECA 3ZYXA 1S7MA 2WPCA 2MNRA 3TJ4A 1KKOA 5U1OA 1RP0A 4EWJA 4K22A 3PVCA 2OQHA 3AE8A 3AEBA 3ICRA 3CNSA 3VR9A 4M52A 3K1GA 3HYWA 1VDVA 4IVMB 2Y6RA 3NTDA 3NVZB 1SEZA 1CC2A 3RCYA 1FOHA 2V3AA 2QCUA 3IHMA 5EB4A 2XVFA 3AEEA 5IDZA 1DJQA 5C2TA 3QKEA 2OALA 4HCHA 3DJJA 3NKSA 2VZ2A 1ZOYA 2OKTA 2BC1A 4I58A 3EF6A 1YQ4A 4FI4A 1L9DA 1GOSA 4XXGA 2Q0LA 4HCLA 1KD0A 4E0VA 1IUUA 1OJAA 3HYVA 2W54A 3CGBA 3OW1A 4G6GA 3TCSA 3CMMA 5FS7A 1GEUA 4C5OA 1GSNA 3HW2A 3IC9A 4JN7A 3COXA 3FPZA 2RGOA 3U9IA 1H84A 5KWFA 3UOZA 4U8KA 1E1MA 2GH5A 2V60A 2PGEA 3SFEA 3DG6A 3QSMA 4YSYA 2VOUA 4U2SA 1D4EA 3BI5A 1H7XA 2H88A 2YM2A 4JY2A 5KOWA 3R11A 4H4WA 3F8PA 2NVKX 3DFHA 3R10A 1GNDA 4X4JA 1CJ3A 3QVPA 3AE1A 4ENLA 2WOIA 1DNCA 3QVRA 4YXDA 1L0VA 4BK1A 4JQ9A 3V5FA 2OZ8A 1E1KA 2WP5A 2C66A 3V5CA 4RG4A 4HA6A 1ONFA 1TYPA 1F9CA 1EL7A 4H7UA 3VDGA 2E5AA 4H4ZA 2C65A 1TKKA 3GYJA 2C4CA 3ZVHB 3GO2A 4H2HA 2WOWA 2PS2A 3PO7A 1KKRA 1VRQB 4H2NA 3I4KA 2RGJA 4H2QA 2B7RA 3UXKA 1GALA 3UJEA 4I59A 3MSYA 3S47A 2PTYA 3R0UA 1JRXA 2HXUA 3UOXA 1B5QA 2X50A 4O5UA 3OZYA 3T2KA 3FG2P 4FX9A 2YG4A 4X2PA 1CJCA 3P3BA 4NEWA 2YQUA 2YG3A 4G8TA 2QAEA 3NIXA 2WOVA 2R46A 3SJNA 2GV8A 2BYBA 4U8MA 2GDQA 1VQWA 3EUB3 3AMZA 1GRTA 2V3BA 2QDDA 3TTEA 3ZLHA 2RABA 1N4WA 1N63C 2XLUA 2GGJA 2ZZBA 3UKHA 3CT2A 3AE2A 3SZWA 3KKJA 1E1NA 4IHCA 3T4WA 4IP5A 1F6MA 4K8DA 3FBSA 3UTFA 2WS3A 3D9XA 1ZP0A 4NNJA 3KU9A 1Y56B 2HQMA 2E3TA 4FK1A 2OLNA 1F8RA 2BC0A 4YSHA 5M0ZA 2ACZA 1BF3A 1FFUC 3UCLA 3ICTA 3Q45A 2C73A 3K7TA 1PDHA 3AEDA 1VQZA 4JDRA 2QDEA 4B63A 1IYXA 3H8LA 1N61C 2XCGA 4WX1A 4C3XA 3AD7B 4UDPA 4A5LA 1VG0A 1H81A 2XLPA 4FK1C 3ZVIA 1PJ5A 3ATRA 3CPJG 1H6VA 1PBBA 4B64A 1N5WC 2FJEA 3QSEA 1YY5A 2GGGA 3D46A 3CTYA 1GTEA 1PBFA 1JRZA 3V3NA 2WPEA 3SN0A 2WU5A 4Z2RA 3GYIA 1GRFA 3DGHA 5EB5A 3UJ2A 2J3NA 3VRDB 4TVYA 3NYEA 3P4RA 3HRDC 2WETA 2FYMA 1PXAA 1H82A 4ZCWA 4GAPA 4D04A 5KMRA 2GGEA 3BNMA 2AR8A 1PBDA 4YTMA 4Y4NA 2GR0A 2F5ZA 4JY3A 4E4UA 4A6NB 3SQPA 1GESA 3ALJA 2AQJA 3G5QA 2BS4A 3FVDA 4HB9A 2PU0A 1SB3B 4X9MA 2XFOA 3GMBA 2JB1A 4GIRA 2XFUA 2WPFA 3NYFA 2CVJA 2BABA 3JZUA 4NTDA 3S5WA 3CXBA 2VQBA 3K7MX 2YAUA 3BHFA 1TDFA 2Z5XA 4LU6A 4J57A 4J2WA 1VDCA 3BOXA 1D4DA 5KOXA 2JAEA 3GD3A 4B68A 3R1ZA 1W4XA 2WBAA 4CY6A 4A7AA 4P9SA 2BK3A 4U8NA 3BI4A 3U4FA 3GD6A 4GGBA 3UCCA 3I6DA 2DKHA 1BQGA 4GISA 4FP1A 2JB3A 3T14A 2OG9A 1ECQA 1NHQA 1GT8A 1VG9A 2IVEA 2WP6A 3CPHG 2C76A 1SJAA 3L8KA 3GDPA 3OZMA 3UKLA 1TDOA 4H4TA 2WDRA 3NXLA 2ZBWA 3NRNA 2FKPA 4CCRA 1GRHA 1RM6B 3VCNA 4U8PA 3KLJA 3NLCA 3M12A 5BULA 2AKMA 3T9PA 4HPNA 1XS2A 3L5OA 3CNTA 2C72A 2P8BA 3NT6A 2PA6A 3NTAA 3JSKA 2QA1A 4IV9A 5IQ1A 4NTCA 2VRMA 2XVEA 4Z24A 6ENLA 3NH3X 3DH9A 1ZDLA 3ALLA 2MUCA 5EBKA 3CNDA 2BRYA 5DBJA 4IA5A 3CYJA 1NU5A 3OTRA 3SM8A 4H4VA 3QPEA 3E1TA 1DOCA 4USQA 5JCNA 3H4KA 4M6UA 1FL2A 1H83A 3SX6A 4OCGA 2WU2A 3KVEA 3SXIA 4TLZA 1MDLA 3T8QA 3TQPA 1ZX9A 2GR2A 5FJRA 3KD9A 3AE7A 3CGDA 1ZOVA 3VA8A 1H86A 1JDFA 2H89A 4APNA 4ICYA 3NK0X 3PS9A 4RG3A 5FJPA 1E1LA 1XDIA 3ABVA 1M6IA 4OVIA 2B7SA 1PXBA 3RP8A 1K4QA 5EOWA 2OO6A 3K7QX 3D8XA 4GMEA 3JW7A 4XWRA 3JVAA 1EC9A 4KPLA 4HCDA 1PDZA 2JBVA 5U25A 4TM3A 1MNSA 1R6WA 5CKUA 3DGZA 3P1WA 1NG3A 1GV4A 3C4NA 2QJJA 4H4YA 1N1PA 4EQWA 4A99A 4BV6A 4B65A 2BXRA 1NHPA 3SBFA 4H4XA 2XVIA 3R9UA 1NAAA 3LADA 2YR6A 2PCEA 1GTHA 2GGIA 4Z2UA 3NFUA 3UKKA 4OPIA 5FJUA 3SSZA 2YR5A 3NK2X 2X8GA 1Y0PA 4U8JA 3OPSA 1LQTA 5U63A 3H12A 1IUWA 1GRAA 2V5ZA 5GSNA 4A79A 3BI2A 1FIQB 2HZGA 2XH2A 1FEBA 5IQ4A 5J04A 7ENLA 1OJ9A 1NEKA 4JHMA 1B37A 3D47A 2Q7VA 3KUMA 1FHUA 1TZZA 1YQZA 2QJNA 3RO6A 3NS1B 3RR1A 3OZ2A 2ZADA 1CC4A 1IUTA 1E9IA 1X2HA 5CQFA 1V59A 1TYTA 2YLWA 3MZNA 4AP3A 4H4UA 3UKFA 3VQRA 4NZHA 1D4CA 4G9KA 2R4EA 4E8GA 3GYXA 1WUEA 4ZA0A 2DKIA 3V3OA 2A89A 2VVLA 1K0IA 4G6HA 3AEAA 3UOYA 4KPRA 3TJIA 2R0PA 3TWBA 1GRBA 3CPIG 1M64A 4H19A 2FJAA 2PP0A 4AOXA 4DXKA 1S2YA 1EBDA 2Q0KA 3WE0A 2Q6UA 1MUCA 3P4PA 3ES7A 4H4SA 4TLXA 1W6TA 1CJ4A 4C3YA 3GY1A 1Z6LA 5FJOA 2WDQA 4AT2A 2XH7A 1JEHA 2BS2A 2YLRA 1F8WA 2GGHA 2IVDA 2OA1A 2PMQA 3ES8A 4J3ZA 4AP1A 2C75A 1GXFA 3NO1A 1TDKA 1FEAA 3BJSA 3UJSA 4U8LA 2XFQA 4EM4A 2B9XA 4RSLA 3GRSA 2UZZA 3A7UA 1P48A 5KVHA 4PABA 3R0KA 4IT1A 1S3EA 1B8SA 3IWAA 5EU9A 4WCTA 4DSHA 3DJGX 3P4SA 1O94A 3B9JB 4ZCCA 1IJHA 3HPFA 3QFBA 4Z43A 4OPUA 4H4RA 4IL2A 1MXTA 2OPJA 3QSSA 2YWLA 3DIPA 2HXTA 5HYMA 5BOFA 4A9WA 4A65A 1RVKA 1EBGA 1P2HA 2P3ZA 1OJTA 2XH0A 3GD4A 3AECA 1NENA 3KPKA 4Z17A 3ATQA 1BKWA 3FCPA 1REOA 5L46A 3LXDA 3RRAA 1IUSA 3RGTA 3T37A 1CBOA 3DGBA 3CB3A 2POZA 4GDEA 3DJDA 2EQ9A 3QTPA 1QO8A 1JRPA 1NPXA 2XLSA 5FS9A 2GAGB 2C3DA 4IZGA 3DERA 4ZOHB 2P88A 1GERA 3BSMA 3FXGA 4K2XA 3GMCA 3DG7A 3N6JA 2YG5A 1QJDA 4CY8A 3A7RA 4M0XA 4OPLA 4B1BA 2O9ZA 2YVGA 4CNJA 1KDGA 1YQ3A 3II4A 3NK1X 5J60A 5LV9A 2XH4A 3QN3A 3UXLA 4YKGA 2Y6QA 2WP9A 3P4QA 1JCTA 2EQ8A 4U2TA 2W3SA 1NG4A 3EEZA 3T2YA 1ELIA 4GAVA 2QQ6A 3PWIA 2VVMA 1LV0A 3I6EA 3SYIA 1ONEA 3DESA 4JN8A 1QLBA 3NVYB 4MMWA 4UP3A 4J56A 4BK2A 1KFYA 5ER0A 5JCKA 2X8HA 4GYPA 2EQ6A 3AE5A 2GEWA 4U8OA 4B66A 1ZMCA 5G5HB 3VC6A 4REKA 1EL9A 3URHA 2GSHA 2AL2A 3RNMA 3NG7X 4YWOA 4DGKA 3UTEA 3ITJA 2JK6A 1JOAA 2NQLA 2YLXA 3GWFA 2QA2A 4A6GA 1DODA 4TM4A 2VVLG 3I3LA 4BURA 4J34A 3IJQA 3BNUA 2E1MA 1E6EA 1FCDA 4GYPC 3OP2A 1L8PA 3Q4DA 1CC6A 3P9UA 4BK3A 1B4VA 3CN8A 2XVHA 1NHRA 4USRA 3GC2A 5J7XA 2E5VA 2FJBA 2I0ZA 3UP4A 3T6CA 1SJCA 2YM1A 3C4AA 3IHGA 3V76A 3IJLA 2X99A 3P93A 4BJZA 4Z26A 1O95A 3RP7A 4H1ZA 4ADWA 3ISHA 4GUVA 3MKCA 2PP1A 2YR4A 2PPGA 2C64A 2P0IA 4IL0A 1KSSA 2DW6A 3MQTA 3NVVB 3GRTA 2X8CA 3STPA 2XVJA 1S2QA 3P0WA 5ENLA 2ONEA 2XLTA 2GMHA 3DJEA 1L9CA 4EIQA 1NHSA 3FJ4A 4FDCB 4IP4A 4TVWA 3PFRA 1BGNA 4UDRA 4MKSA 1TDNA 2ZC8A 2BA9A 3THUA 4OPTA 3SGLA 4H4PA 4GFIA 4OPDA 3G5SA 2PSNA 4IA6A 5BOEA 1N62C 4CRTA 1OJCA 3CIRA 3PK7A 2E4GA 3AYLA 3DEQA 1COYA 4TM1A 3DMEA 1EL5A 2PYXA 1MOKA 4ZCDA 3FV9A 3DG3A 2I5QA 5IPYA 5G5GB 4K7ZA 4G7FA 4K8GA 2ARDA 1PN0A 1N60C 1WYGA 4DNAA 1JNZA 1N5XA 1P43A 1V97A 2GQFA 4MGGA 2YVFA 2B9YA 2JB2A 3S5SA 1EC7A 4JN9A 3T2ZA 3B97A 2OFJA 1SJBA 4Z25A 4H4QA 3KPFA 3M0OA 4H50A 2FJDA 2CFYA 3R25A 3DK8A 1LTXR 2R9ZA 4OPGA 5KXJA 1BKHA 1PDYA 4F4RA 4YTPA 3ICSA 2CULA 4H2PA 3ZDNA 5JRBA 3AYJA 1FO4A 3VRBA 3IK4A 3L1RA 4AT0A 4J36A 2RDXA 4DN1A 3LJPA 4PAAA 2P8CA 3AYIA 2BK4A 5TR3A 4HNCA 3C96A 4ECHA 4J31A 3OC4A 3VCCA 4GRTA 3RP6A 2PHHA 1H7WA 5BVAA 1CL0A 3UCDA 3UTHA 4HYRA 3EANA 5HXIA 3SY4A 4OPCA 2GB0A 4YSZA 4ZN0A 3R07C 3GSIA 2QJMA 1H2IA 4HN8A 1FHVA 2OZTA 4EQRA 2GF3A 3SZ0A 2R0GA 2AKZA 4G74A 5BRTA 3F8RA 2R4JA 1ZXIC 4B67A 2VQ7A 3AE9A 3H70A 3EAOA 3AEFA 4GGHA 5KVIA 3SZCA 2ZZ0A 2XFPA 2YVJA 3ZVHA 3D1CA 1ZY8A 2AAQA 1Q1WA 3AXBA 5GRTA 3CXOA 1PHHA 5FS8A 4KWSA 3MUCA 2OLOA 4NEVA 3SN1A 4K5SA 1N4UA 3H8AA 4G73A 5FS6A 2PTZA 3LZWA 1D7LA 3UKQA 3SQSA 2OLAA 3NZGA 2GR3A 3HZLA 2RGHA 1LVLA 3SR6B 2XLRA 4DHGA 4J33A 3VFCA 4KEMA 3AN1A 1JRYA 4U2LA 1PS9A 4Z44A 1PBCA 1Q9IA 1HYUA 5M10A
chains in the Genus database with same CATH topology
1NDAA 4H4TA 2XVFA 3AEEA 4EIPA 2WDRA 1GERA 1D5TA 2GQWA 2ZBWA 3NRNA 1DOEA 4K2XA 1DJQA 3GMCA 5C2TA 2YG5A 4CCRA 3NGCX 1GRHA 4U8PA 1QJDA 2OALA 3KLJA 3NLCA 3DJJA 3M12A 4CY8A 3NKSA 2VZ2A 1KF6A 5BULA 2CDUA 1ZOYA 4OPLA 1DJNA 2BC1A 3REDA 3VRAA 4I58A 3EF6A 4B1BA 2C70A 1RYIA 1YQ4A 1EL8A 2O9ZA 2YVGA 5BUKA 3L5OA 3CNTA 1L9DA 1GOSA 4XXGA 1KDGA 2Q0LA 3RHAA 4CNJA 1YQ3A 1AOGA 2C72A 3NT6A 3NYCA 3II4A 3NTAA 1GREA 3AE6A 1GPEA 3JSKA 2QA1A 4IV9A 3NK1X 4Y4MA 5IQ1A 4E0VA 5J60A 1IUUA 2TPRA 4NTCA 1ZK7A 1OJAA 3HYVA 5LV9A 3CGBA 2VRMA 2GAHB 4G6GA 4YKGA 2XVEA 5FS7A 1GEUA 3CMMA 4LA1A 4C5OA 4Z24A 2Y6QA 1GSNA 3IC9A 3NH3X 3DH9A 3COXA 3FMWA 1ZDLA 2WP9A 3ALLA 3FPZA 2RGOA 3P4QA 5EBKA 3UKPA 2EQ8A 4CBQA 3CNDA 4U2TA 1NG4A 5JCIA 2GVCA 1H84A 1UKVG 2BRYA 3QJ4A 4CCQA 5DBJA 3UOZA 5KWFA 4U8KA 4GF7A 1Y56A 3T2YA 1ELIA 4GAVA 4IA5A 1E1MA 3H8IA 2GH5A 1IUVA 2V60A 2VVMA 3SFEA 1LV0A 3SYIA 2GMJA 3SM8A 4H4VA 3E1TA 2QCUA 1DOCA 3QSMA 4USQA 3DK9A 5JCNA 2WDVA 4YSYA 3H4KA 2GRTA 1FL2A 1H83A 1QLBA 4OCGA 3SX6A 2VOUA 2WU2A 4UP3A 1OJDA 3KVEA 4J56A 1S3BA 1KFYA 2BXSA 4TLZA 3SXIA 4BK2A 4U2SA 5ER0A 2IIDA 5JCKA 1ZX9A 1D4EA 2GR2A 2X8HA 2EQ6A 3BI5A 3AE5A 2GEWA 3IF9A 3M13A 4U8OA 4B66A 1H7XA 1ZMCA 4REKA 4CNKA 3KD9A 1EL9A 3URHA 3AE7A 3CGDA 1ZOVA 2H88A 2WESA 2YM2A 4JY2A 4Y4LA 1H86A 3RNMA 3PG6A 1P2EA 3NG7X 5KOWA 3BHKA 4YWOA 2H89A 4APNA 4DGKA 4II3A 4ICYA 2BS3A 3UTEA 3ITJA 3NK0X 3Q9TA 2JK6A 1JOAA 3PS9A 4RG3A 2YLXA 3K30A 3GWFA 4H4WA 2QA2A 1E1LA 1TDEA 1E7PA 1XDIA 2XDOA 1N4VA 1DODA 3F8PA 4TM4A 2NVKX 2VVLG 3ABVA 1LJ1A 1PBEA 1M6IA 1GNDA 3I3LA 4OVIA 2B7SA 1PXBA 3RP8A 4YTNA 4BURA 4EM3A 4J34A 1RSGA 1K4QA 5EOWA 3K7QX 3BNUA 3D8XA 2E1MA 4X4JA 1CJ3A 3QVPA 1XANA 4N9XA 1E6EA 3IHMA 1FCDA 2YLSA 3ALMA 4XWRA 3AE1A 2WOIA 1DNCA 1CC6A 3P9UA 4UDQA 4BK3A 1B4VA 3LZXA 3QVRA 3CN8A 4YXDA 2XVHA 1L0VA 4BK1A 4JQ9A 2JKCA 5FMHA 3G5RA 1NHRA 1O5WA 2JBVA 4K5RA 4USRA 5U25A 1E1KA 4TM3A 2A8XA 2WP5A 2VRLA 2XFNA 5J7XA 2OAMA 2C66A 2E5VA 5CKUA 4RG4A 1F8SA 3DGZA 4HA6A 1ONFA 1DOBA 2FJBA 1MO9A 1TYPA 2I0ZA 3UP4A 3P1WA 1ZKQA 1NG3A 1EL7A 4H7UA 1Q1RA 1GV4A 3S61A 3C4NA 5KNLA 2YM1A 4H4YA 1N1PA 4H4ZA 4EMJA 2C65A 2V61A 3C4AA 3GYJA 3IHGA 4EQWA 2C4CA 4NTEA 4BV6A 3V76A 4A99A 4B65A 2X99A 2BXRA 2WOWA 4A6NA 5KMPA 1NHPA 1BGJA 4H4XA 3PO7A 1VRQB 4H2NA 4BJZA 2XVIA 4Z26A 1O95A 3R9UA 4JNQA 3RP7A 1NAAA 1GETA 4ADWA 2RGJA 3GDNA 3ISHA 4H2QA 2B7RA 4GUVA 2YR4A 2C64A 2BACA 1GALA 3LADA 2YLZA 2YR6A 1KSSA 4I59A 1LQUA 3AB1A 1GTHA 1JRXA 4EQXA 3GRTA 3UOXA 4Z2UA 4U8IA 1B5QA 2X50A 4O5UA 3LOVA 3UKKA 2X8CA 4OPIA 3VR8A 3T2KA 3FG2P 3CNJA 2YLTA 2YR5A 1XHCA 3NK2X 2XVJA 3O0HA 2X8GA 4FX9A 1S2QA 2BRAA 1Y0PA 2YG4A 4U8JA 3UTGA 2XLTA 2GMHA 3DJEA 3AD8B 1CJ2A 1LQTA 1L9CA 2A87A 4EIQA 1NHSA 5U63A 1CJCA 1IUWA 1GRAA 1KNPA 4FDCB 2V5ZA 5GSNA 2R45A 4A79A 4NEWA 2YQUA 3BI2A 2YG3A 3UOVA 2V6OA 2QAEA 3NIXA 2EQ7A 1BGNA 3AE3A 4UDRA 1TDNA 2WOVA 2BA9A 1FEBA 2R46A 4OPTA 2GV8A 3SGLA 4H4PA 4OPDA 5IQ4A 2BYBA 1OJ9A 1NEKA 3G5SA 3AD9B 1JU2A 4U8MA 1VQWA 2GR1A 4X9NA 4IA6A 1GRTA 1B37A 2V3BA 2Q7VA 3DA1A 4IVOB 5KRQA 4B69A 3EPTA 4CRTA 1YQZA 2BK5A 2RABA 1OJCA 1N4WA 3CIRA 4D03A 2E4GA 3AYLA 3OZ2A 1CC4A 1IUTA 2XLUA 3SZFA 1COYA 3ADAB 5CQFA 1V59A 1TYTA 4TM1A 2YLWA 3CGEA 5EB4A 3DMEA 2C67A 2ZZBA 1EL5A 2PYXA 4EMWA 4BJYA 3UKHA 3AE2A 1XPQA 1MOKA 3SZWA 3KKJA 1E1NA 4AP3A 4H4UA 3UKFA 4ZCDA 3VQRA 4YT0A 4NZHA 1D4CA 4G9KA 5IPYA 4K7ZA 2ARDA 5KMQA 1F6MA 3KA7A 2R4EA 1PN0A 1D7YA 4K8DA 3FBSA 5KMSA 3UTFA 4DNAA 2YG6A 3B3RA 1JNZA 3GYXA 2WS3A 3D9XA 1ZP0A 2FBWA 4NNJA 4Z2TA 3KU9A 1Y56B 2HQMA 2Z5YA 1K0LA 2DKIA 1KNRA 3V3OA 2GQFA 4FK1A 1PJ6A 2OLNA 1F8RA 4H2RA 2BC0A 2A89A 4YSHA 2YVFA 2B9YA 5M0ZA 2VVLA 1K0IA 4G6HA 2ACZA 2JB2A 1BF3A 3AEAA 3UCLA 4C74A 3ICTA 3UOYA 4KPRA 4JN9A 1TRBA 2C73A 2R0PA 3T2ZA 4C77A 1GRBA 3CPIG 1M64A 4LIIA 3K7TA 4Z25A 1PDHA 4H4QA 3KPFA 2FJAA 1PJ7A 4AOXA 3AEDA 1CF3A 3Q6JA 1ZMDA 2C3CA 3FIMB 4JDRA 1S2YA 3M0OA 2R0CA 4GCMA 4JNAA 2ZZCA 4H50A 1EBDA 2APGA 1DXLA 1CHUA 2FJDA 4B63A 2CFYA 2Q0KA 3WE0A 4YKFA 1F3PA 2Q6UA 3H8LA 1E39A 3DK8A 3P4PA 2XCGA 4WX1A 1L9EA 1LTXR 2R9ZA 4OPGA 4C3XA 3NHOX 2B9WA 4H4SA 5KXJA 1PXCA 3AD7B 4TLXA 1VG0A 4UDPA 4A5LA 1CJ4A 4C3YA 4YTPA 1H81A 4YSXA 2XLPA 3ICSA 1KSUA 4FK1C 2CULA 1PJ5A 1Z6LA 3ATRA 3CPJG 4H2PA 3ZDNA 3DK4A 5JRBA 5JCLA 1H6VA 1PBBA 3AYJA 4B64A 2WEUA 3VRBA 2FJEA 2WDQA 3QSEA 4AT2A 1YY5A 3L1RA 2X3NA 2YG7A 4TM0A 3CGCA 3CTYA 1GTEA 3LB8A 4J36A 4GR1A 1JEHA 4AT0A 3T0KA 3LJPA 1PBFA 4PAAA 2BS2A 5C3JA 2YLRA 1BWCA 3AYIA 1F8WA 1JRZA 3V3NA 2WPEA 2B76A 2BK4A 5TR3A 1LPFA 2WU5A 3C96A 4GDPA 2BCPA 3AEGA 4Z2RA 3AWIA 3GYIA 1GRFA 3DGHA 4J31A 5EB5A 4ECHA 2BCGG 3NNEA 3OC4A 2J3NA 2OA1A 2IVDA 3VRDB 3NYEA 3P4RA 3UP5A 1GRGA 4AP1A 2WETA 4GRTA 2C75A 1GXFA 1TDKA 1FEAA 4U8LA 1PXAA 3RP6A 1H82A 2PHHA 2XFQA 3HYXA 4EM4A 2B9XA 4RSLA 5HHFA 4GAPA 1H7WA 5BVAA 3GRSA 4NWZA 4D04A 1CL0A 2UZZA 5KMRA 3UTHA 1X31B 5KVHA 4PABA 4KX6A 2NPXA 3EANA 5JCMA 3BNMA 5HXIA 2AR8A 1IUXA 2WHDA 3SY4A 5HY5A 1S3EA 4OPCA 2GB0A 1PBDA 3SFDA 4AOSA 2C7GA 4YSZA 4YTMA 4Y4NA 3T31A 1B8SA 3B6DA 2GR0A 3IWAA 2F5ZA 4II2A 4ZN0A 4WCTA 3GSIA 4JY3A 4A6NB 4DSHA 1H2IA 3DJGX 1BZLA 3SQPA 1GESA 2WQYA 3AE4A 3P4SA 3ALJA 3UKAA 1K0JA 2AQJA 1O94A 3G5QA 1KN0A 2BS4A 4EQRA 2GF3A 3CNPA 2R0GA 3SZ0A 3NN0X 4HB9A 1JNRA 4ZCCA 3GWDA 1IJHA 4G74A 2TMDA 5BRTA 4X9MA 3QFBA 2XFOA 4Z43A 2XYOA 3GMBA 3F8RA 2R4JA 3F8DA 2JB1A 4OPUA 4H4RA 2XFUA 4B67A 2WPFA 1MXTA 2VQ7A 3NYFA 4MJWA 4XWZA 3QSSA 2CVJA 2YWLA 2BABA 3AE9A 4NTDA 2W0HA 3S5WA 3QFAA 2VQBA 3EAOA 5HYMA 4EQSA 4O5QA 1YKJA 4A9WA 5M10A 4EMIA 3K7MX 4A65A 2YAUA 3BHFA 1TDFA 3AEFA 4DSGA 3NN6X 2Z5XA 1FECA 1P2HA 1OJTA 4LU6A 5KVIA 4J57A 4J2WA 3SZCA 3ZYXA 1S7MA 2ZZ0A 1VDCA 2YVJA 2WPCA 2XFPA 3D1CA 1ZY8A 1D4DA 5KOXA 3GD4A 3AECA 5U1OA 2JAEA 3GD3A 2AAQA 1RP0A 4B68A 1W4XA 1NENA 1Q1WA 3KPKA 3ATQA 3AXBA 5GRTA 1BKWA 1PHHA 5FS8A 1REOA 2WBAA 4K22A 5L46A 4CY6A 3LXDA 2OLOA 4A7AA 1IUSA 4NEVA 4K5SA 1N4UA 4P9SA 2BK3A 3T37A 4G73A 3PVCA 5FS6A 4U8NA 1CBOA 3AE8A 3AEBA 3ICRA 3LZWA 3CNSA 1D7LA 3VR9A 4M52A 4GDEA 3BI4A 3UKQA 3DJDA 2EQ9A 1QO8A 3HYWA 3I6DA 2DKHA 1NPXA 2XLSA 3HZLA 2GR3A 5FS9A 4IVMB 2JB3A 2RGHA 2Y6RA 3T14A 1LVLA 3NTDA 2XLRA 2GAGB 1NHQA 1GT8A 2C3DA 1VG9A 2IVEA 4J33A 1SEZA 2WP6A 1CC2A 3CPHG 2C76A 3L8KA 1FOHA 3GDPA 2V3AA 1JRYA 4U2LA 1PS9A 3UKLA 4Z44A 1PBCA 1Q9IA 1HYUA 1TDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NDA A;  4H4T A;  2XVF A;  3AEE A;  4EIP A;  2WDR A;  1GER A;  1D5T A;  2GQW A;  2ZBW A;  3NRN A;  1DOE A;  4K2X A;  1DJQ A;  3GMC A;  5C2T A;  2YG5 A;  4CCR A;  3NGC X;  1GRH A;  4U8P A;  1QJD A;  2OAL A;  3KLJ A;  3NLC A;  3DJJ A;  3M12 A;  4CY8 A;  3NKS A;  2VZ2 A;  1KF6 A;  5BUL A;  2CDU A;  1ZOY A;  4OPL A;  1DJN A;  2BC1 A;  3RED A;  3VRA A;  4I58 A;  3EF6 A;  4B1B A;  2C70 A;  1RYI A;  1YQ4 A;  1EL8 A;  2O9Z A;  2YVG A;  5BUK A;  3CNT A;  1L9D A;  1GOS A;  4XXG A;  1KDG A;  2Q0L A;  3RHA A;  4CNJ A;  1YQ3 A;  1AOG A;  2C72 A;  3NT6 A;  3NYC A;  3II4 A;  3NTA A;  1GRE A;  3AE6 A;  1GPE A;  3JSK A;  2QA1 A;  4IV9 A;  3NK1 X;  4Y4M A;  5IQ1 A;  4E0V A;  5J60 A;  1IUU A;  2TPR A;  4NTC A;  1ZK7 A;  1OJA A;  5LV9 A;  3CGB A;  2VRM A;  2GAH B;  4YKG A;  2XVE A;  5FS7 A;  1GEU A;  4C5O A;  4LA1 A;  4Z24 A;  2Y6Q A;  1GSN A;  3IC9 A;  3NH3 X;  3DH9 A;  3COX A;  3FMW A;  1ZDL A;  2WP9 A;  3ALL A;  3FPZ A;  2RGO A;  3P4Q A;  5EBK A;  3UKP A;  2EQ8 A;  4CBQ A;  3CND A;  4U2T A;  1NG4 A;  5JCI A;  2GVC A;  1H84 A;  1UKV G;  3QJ4 A;  4CCQ A;  5KWF A;  5DBJ A;  3UOZ A;  4U8K A;  4GF7 A;  1Y56 A;  1ELI A;  4IA5 A;  1E1M A;  3H8I A;  2GH5 A;  1IUV A;  2V60 A;  2VVM A;  3SFE A;  1LV0 A;  2GMJ A;  3SM8 A;  4H4V A;  3E1T A;  2QCU A;  1DOC A;  3QSM A;  4USQ A;  3DK9 A;  5JCN A;  2WDV A;  4YSY A;  3H4K A;  2GRT A;  1FL2 A;  1H83 A;  1QLB A;  4OCG A;  2VOU A;  2WU2 A;  4UP3 A;  1OJD A;  3KVE A;  4J56 A;  1S3B A;  1KFY A;  2BXS A;  4TLZ A;  4BK2 A;  4U2S A;  5ER0 A;  2IID A;  5JCK A;  1ZX9 A;  1D4E A;  2GR2 A;  2X8H A;  2EQ6 A;  3BI5 A;  3AE5 A;  2GEW A;  3IF9 A;  3M13 A;  4U8O A;  4B66 A;  1H7X A;  1ZMC A;  4REK A;  4CNK A;  3KD9 A;  1EL9 A;  3URH A;  3AE7 A;  3CGD A;  1ZOV A;  2H88 A;  2WES A;  2YM2 A;  4JY2 A;  4Y4L A;  1H86 A;  3RNM A;  1P2E A;  3NG7 X;  5KOW A;  3BHK A;  4YWO A;  2H89 A;  4APN A;  4DGK A;  4ICY A;  2BS3 A;  3UTE A;  3ITJ A;  3NK0 X;  3Q9T A;  2JK6 A;  1JOA A;  3PS9 A;  4RG3 A;  2YLX A;  3K30 A;  3GWF A;  4H4W A;  2QA2 A;  1E1L A;  1TDE A;  1E7P A;  1XDI A;  2XDO A;  1N4V A;  1DOD A;  3F8P A;  4TM4 A;  2NVK X;  2VVL G;  3ABV A;  1LJ1 A;  1PBE A;  1M6I A;  1GND A;  3I3L A;  4OVI A;  2B7S A;  1PXB A;  3RP8 A;  4YTN A;  4BUR A;  4EM3 A;  4J34 A;  1RSG A;  1K4Q A;  5EOW A;  3K7Q X;  3BNU A;  3D8X A;  2E1M A;  4X4J A;  1CJ3 A;  3QVP A;  1XAN A;  4N9X A;  1E6E A;  3IHM A;  1FCD A;  2YLS A;  3ALM A;  4XWR A;  3AE1 A;  2WOI A;  1DNC A;  1CC6 A;  3P9U A;  4UDQ A;  4BK3 A;  1B4V A;  3LZX A;  3QVR A;  3CN8 A;  4YXD A;  2XVH A;  1L0V A;  4BK1 A;  4JQ9 A;  2JKC A;  5FMH A;  3G5R A;  1NHR A;  1O5W A;  2JBV A;  4K5R A;  4USR A;  5U25 A;  1E1K A;  4TM3 A;  2A8X A;  2WP5 A;  2VRL A;  2XFN A;  5J7X A;  2OAM A;  2C66 A;  2E5V A;  5CKU A;  4RG4 A;  1F8S A;  3DGZ A;  4HA6 A;  1ONF A;  1DOB A;  2FJB A;  1MO9 A;  1TYP A;  2I0Z A;  3UP4 A;  3P1W A;  1ZKQ A;  1NG3 A;  1EL7 A;  4H7U A;  1Q1R A;  1GV4 A;  3S61 A;  3C4N A;  2YM1 A;  4H4Y A;  1N1P A;  4H4Z A;  4EMJ A;  2C65 A;  2V61 A;  3C4A A;  3GYJ A;  3IHG A;  4EQW A;  4A99 A;  4NTE A;  4BV6 A;  3V76 A;  4B65 A;  2X99 A;  2BXR A;  2WOW A;  4A6N A;  1NHP A;  1BGJ A;  4H4X A;  3PO7 A;  1VRQ B;  4H2N A;  4BJZ A;  2XVI A;  4Z26 A;  1O95 A;  3R9U A;  4JNQ A;  3RP7 A;  1NAA A;  1GET A;  4ADW A;  2RGJ A;  3GDN A;  3ISH A;  4H2Q A;  2B7R A;  4GUV A;  2YR4 A;  2C64 A;  2BAC A;  1GAL A;  3LAD A;  2YLZ A;  2YR6 A;  1KSS A;  4I59 A;  1LQU A;  3AB1 A;  1GTH A;  1JRX A;  4EQX A;  3GRT A;  3UOX A;  4Z2U A;  4U8I A;  1B5Q A;  2X50 A;  4O5U A;  3LOV A;  3UKK A;  2X8C A;  4OPI A;  3VR8 A;  3FG2 P;  3CNJ A;  2YLT A;  2YR5 A;  1XHC A;  3NK2 X;  2XVJ A;  3O0H A;  2X8G A;  4FX9 A;  1S2Q A;  1Y0P A;  2YG4 A;  4U8J A;  3UTG A;  2XLT A;  2GMH A;  3DJE A;  3AD8 B;  1CJ2 A;  1LQT A;  1L9C A;  2A87 A;  4EIQ A;  1NHS A;  5U63 A;  1CJC A;  1IUW A;  1GRA A;  1KNP A;  4FDC B;  2V5Z A;  5GSN A;  2R45 A;  4A79 A;  4NEW A;  2YQU A;  3BI2 A;  2YG3 A;  3UOV A;  2V6O A;  2QAE A;  3NIX A;  2EQ7 A;  1BGN A;  3AE3 A;  4UDR A;  1TDN A;  2WOV A;  2BA9 A;  1FEB A;  2R46 A;  4OPT A;  2GV8 A;  3SGL A;  4H4P A;  4OPD A;  5IQ4 A;  2BYB A;  1OJ9 A;  1NEK A;  3G5S A;  3AD9 B;  1JU2 A;  4U8M A;  1VQW A;  2GR1 A;  4X9N A;  4IA6 A;  1GRT A;  1B37 A;  2Q7V A;  2V3B A;  3DA1 A;  4IVO B;  5KRQ A;  4B69 A;  3EPT A;  4CRT A;  1YQZ A;  2BK5 A;  2RAB A;  1OJC A;  1N4W A;  3CIR A;  4D03 A;  2E4G A;  3AYL A;  3OZ2 A;  1CC4 A;  1IUT A;  2XLU A;  1COY A;  3ADA B;  5CQF A;  1V59 A;  1TYT A;  4TM1 A;  2YLW A;  3CGE A;  5EB4 A;  3DME A;  2C67 A;  2ZZB A;  1EL5 A;  2PYX A;  4EMW A;  4BJY A;  3UKH A;  3AE2 A;  1XPQ A;  1MOK A;  3KKJ A;  1E1N A;  4AP3 A;  4H4U A;  3UKF A;  4ZCD A;  3VQR A;  4YT0 A;  4NZH A;  1D4C A;  5IPY A;  4K7Z A;  2ARD A;  1F6M A;  3KA7 A;  2R4E A;  1PN0 A;  1D7Y A;  4K8D A;  3FBS A;  3UTF A;  4DNA A;  2YG6 A;  3B3R A;  1JNZ A;  2WS3 A;  2FBW A;  1ZP0 A;  4Z2T A;  3KU9 A;  1Y56 B;  2HQM A;  2Z5Y A;  1K0L A;  2DKI A;  1KNR A;  3V3O A;  2GQF A;  4FK1 A;  1PJ6 A;  2OLN A;  1F8R A;  4H2R A;  2BC0 A;  2A89 A;  4YSH A;  2YVF A;  2B9Y A;  5M0Z A;  2VVL A;  1K0I A;  2ACZ A;  2JB2 A;  1BF3 A;  3AEA A;  3UCL A;  4C74 A;  3ICT A;  3UOY A;  4KPR A;  4JN9 A;  1TRB A;  2C73 A;  2R0P A;  4C77 A;  1GRB A;  3CPI G;  1M64 A;  4LII A;  3K7T A;  4Z25 A;  1PDH A;  4H4Q A;  3KPF A;  2FJA A;  1PJ7 A;  4AOX A;  3AED A;  1CF3 A;  3Q6J A;  1ZMD A;  2C3C A;  3FIM B;  4JDR A;  1S2Y A;  3M0O A;  2R0C A;  4GCM A;  4JNA A;  2ZZC A;  4H50 A;  1EBD A;  2APG A;  1DXL A;  1CHU A;  2FJD A;  4B63 A;  2CFY A;  2Q0K A;  3WE0 A;  4YKF A;  1F3P A;  2Q6U A;  3H8L A;  1E39 A;  3DK8 A;  3P4P A;  2XCG A;  4WX1 A;  1L9E A;  1LTX R;  2R9Z A;  4OPG A;  4C3X A;  3NHO X;  2B9W A;  4H4S A;  5KXJ A;  1PXC A;  3AD7 B;  4TLX A;  1VG0 A;  4UDP A;  4A5L A;  1CJ4 A;  4C3Y A;  4YTP A;  1H81 A;  4YSX A;  2XLP A;  3ICS A;  1KSU A;  4FK1 C;  2CUL A;  1PJ5 A;  1Z6L A;  3ATR A;  3CPJ G;  4H2P A;  3ZDN A;  3DK4 A;  5JCL A;  1H6V A;  1PBB A;  3AYJ A;  4B64 A;  2WEU A;  3VRB A;  2FJE A;  2WDQ A;  3QSE A;  4AT2 A;  1YY5 A;  3L1R A;  2X3N A;  2YG7 A;  4TM0 A;  3CGC A;  3CTY A;  1GTE A;  3LB8 A;  4J36 A;  4GR1 A;  1JEH A;  4AT0 A;  3LJP A;  1PBF A;  4PAA A;  2BS2 A;  5C3J A;  2YLR A;  1BWC A;  3AYI A;  1F8W A;  1JRZ A;  3V3N A;  2WPE A;  2B76 A;  2BK4 A;  5TR3 A;  1LPF A;  2WU5 A;  3C96 A;  4GDP A;  2BCP A;  3AEG A;  4Z2R A;  3AWI A;  3GYI A;  1GRF A;  3DGH A;  4J31 A;  5EB5 A;  4ECH A;  2BCG G;  3NNE A;  3OC4 A;  2J3N A;  2OA1 A;  2IVD A;  3VRD B;  3NYE A;  3P4R A;  3UP5 A;  1GRG A;  4AP1 A;  2WET A;  4GRT A;  2C75 A;  1GXF A;  1TDK A;  1FEA A;  4U8L A;  1PXA A;  3RP6 A;  1H82 A;  2PHH A;  2XFQ A;  4EM4 A;  2B9X A;  4RSL A;  5HHF A;  1H7W A;  5BVA A;  3GRS A;  4D04 A;  1CL0 A;  2UZZ A;  3UTH A;  1X31 B;  5KVH A;  4PAB A;  4KX6 A;  2NPX A;  3EAN A;  5JCM A;  3BNM A;  5HXI A;  2AR8 A;  1IUX A;  2WHD A;  5HY5 A;  1S3E A;  4OPC A;  2GB0 A;  1PBD A;  3SFD A;  4AOS A;  2C7G A;  4YSZ A;  4YTM A;  4Y4N A;  1B8S A;  3B6D A;  2GR0 A;  3IWA A;  2F5Z A;  4ZN0 A;  4WCT A;  3GSI A;  4JY3 A;  4A6N B;  4DSH A;  3DJG X;  1BZL A;  3SQP A;  1GES A;  2WQY A;  3AE4 A;  3P4S A;  3ALJ A;  3UKA A;  1K0J A;  2AQJ A;  1O94 A;  3G5Q A;  2BS4 A;  4EQR A;  2GF3 A;  3CNP A;  2R0G A;  3NN0 X;  4HB9 A;  1JNR A;  4ZCC A;  3GWD A;  1IJH A;  5BRT A;  2TMD A;  4X9M A;  3QFB A;  2XFO A;  4Z43 A;  2XYO A;  3GMB A;  3F8R A;  2R4J A;  3F8D A;  2JB1 A;  4OPU A;  4H4R A;  2XFU A;  4B67 A;  2WPF A;  1MXT A;  2VQ7 A;  3NYF A;  4MJW A;  4XWZ A;  3QSS A;  2CVJ A;  2YWL A;  2BAB A;  3AE9 A;  4NTD A;  2W0H A;  3S5W A;  3QFA A;  2VQB A;  3EAO A;  5HYM A;  4EQS A;  4O5Q A;  1YKJ A;  4A9W A;  5M10 A;  4EMI A;  3K7M X;  4A65 A;  2YAU A;  3BHF A;  1TDF A;  3AEF A;  4DSG A;  3NN6 X;  2Z5X A;  1FEC A;  1P2H A;  1OJT A;  4LU6 A;  5KVI A;  4J57 A;  4J2W A;  3ZYX A;  1VDC A;  2ZZ0 A;  2XFP A;  2YVJ A;  2WPC A;  3D1C A;  1ZY8 A;  1D4D A;  5KOX A;  3GD4 A;  3AEC A;  5U1O A;  2JAE A;  3GD3 A;  2AAQ A;  1RP0 A;  4B68 A;  1W4X A;  1NEN A;  1Q1W A;  3ATQ A;  3AXB A;  5GRT A;  1BKW A;  1PHH A;  5FS8 A;  1REO A;  2WBA A;  4K22 A;  5L46 A;  4CY6 A;  3LXD A;  2OLO A;  4A7A A;  1IUS A;  4NEV A;  4K5S A;  1N4U A;  4P9S A;  2BK3 A;  3T37 A;  4U8N A;  3PVC A;  5FS6 A;  1CBO A;  3AE8 A;  3AEB A;  3ICR A;  3LZW A;  3CNS A;  1D7L A;  3VR9 A;  4M52 A;  4GDE A;  3BI4 A;  3UKQ A;  3DJD A;  2EQ9 A;  1QO8 A;  3I6D A;  2DKH A;  1NPX A;  2XLS A;  3HZL A;  2GR3 A;  5FS9 A;  4IVM B;  2JB3 A;  2RGH A;  2Y6R A;  1LVL A;  3NTD A;  2XLR A;  2GAG B;  1NHQ A;  1GT8 A;  2C3D A;  1VG9 A;  2IVE A;  4J33 A;  1SEZ A;  2WP6 A;  1CC2 A;  3CPH G;  2C76 A;  3L8K A;  1FOH A;  3GDP A;  2V3A A;  1JRY A;  4U2L A;  1PS9 A;  3UKL A;  4Z44 A;  1PBC A;  1Q9I A;  1HYU A;  1TDO A; 
#chains in the Genus database with same CATH topology
 1NDA A;  4EIP A;  1D5T A;  3CAW A;  2GQW A;  1DOE A;  3FYY A;  3NGC X;  5FJT A;  1KF6 A;  2CDU A;  3DFY A;  3SN4 A;  1DJN A;  3RED A;  3VRA A;  4DX3 A;  2C70 A;  1RYI A;  1EL8 A;  5BUK A;  3RHA A;  3CK5 A;  1AOG A;  3NYC A;  1EBH A;  3PWG A;  1GRE A;  3AE6 A;  1GPE A;  4Y4M A;  2PTW A;  2TPR A;  1ZK7 A;  2GAH B;  4LA1 A;  2POD A;  1XPY A;  4YWS A;  3FMW A;  3UKP A;  4CBQ A;  5JCI A;  2GVC A;  4CCQ A;  1UKV G;  3QJ4 A;  3TW9 A;  3UJR A;  4GF7 A;  1Y56 A;  3H8I A;  1IUV A;  2AL1 A;  2GMJ A;  4H83 A;  2W3R A;  3DK9 A;  2WDV A;  2GRT A;  3AM9 A;  1OJD A;  1S3B A;  2BXS A;  3EKG A;  2IID A;  3MWC A;  3M13 A;  3IF9 A;  4CNK A;  2WES A;  4Y4L A;  3PG6 A;  1P2E A;  3BHK A;  4KT2 A;  1JRO A;  4ROP A;  4Z1Y A;  4II3 A;  4E6M A;  2BS3 A;  3Q9T A;  3K30 A;  1TDE A;  1E7P A;  2XDO A;  1N4V A;  1STZ A;  3QLD A;  1LJ1 A;  1PBE A;  3H7V A;  4YTN A;  1WUF A;  4EM3 A;  1RSG A;  1XAN A;  4N9X A;  2YLS A;  3ALM A;  4UDQ A;  3LZX A;  2JKC A;  5FMH A;  3G5R A;  1O5W A;  4K5R A;  2A8X A;  2VRL A;  2XFN A;  2OAM A;  1F8S A;  1DOB A;  1MO9 A;  1X2G A;  1ZKQ A;  4E4F A;  1Q1R A;  3S61 A;  5KNL A;  4EMJ A;  2V61 A;  3ENL A;  4NTE A;  4A6N A;  5KMP A;  1BGJ A;  3A7A A;  4E5T A;  4JNQ A;  1GET A;  3I6T A;  3GDN A;  2CHR A;  2OQY A;  2BAC A;  4J1O A;  2YLZ A;  1NEL A;  1LQU A;  3AB1 A;  2W55 A;  4EQX A;  4U8I A;  2GL5 A;  2HNE A;  3LOV A;  2PU1 A;  3VR8 A;  3N4F A;  3CNJ A;  3ZLG A;  2YLT A;  1XHC A;  3O0H A;  2BRA A;  3UTG A;  2XGZ A;  3NVW B;  3AD8 B;  1CJ2 A;  2DW7 A;  2A87 A;  1KNP A;  3DDM A;  2R45 A;  3UOV A;  2V6O A;  2EQ7 A;  3AE3 A;  4A35 A;  4DYE A;  1DTN A;  3AD9 B;  1JU2 A;  2GR1 A;  4X9N A;  2QVH A;  4IVO B;  3DA1 A;  5KRQ A;  3IJI A;  4B69 A;  3EPT A;  2BK5 A;  2OX4 A;  4D03 A;  3SZF A;  3ADA B;  3CGE A;  2C67 A;  4BJY A;  4EMW A;  1XPQ A;  1OEP A;  1MRA A;  1EC8 A;  4K1W A;  4YT0 A;  2OVL A;  2PTX A;  5KMQ A;  3KA7 A;  1D7Y A;  5KMS A;  2YG6 A;  3TOY A;  3B3R A;  3V4B A;  2FBW A;  4Z2T A;  3TWA A;  2Z5Y A;  1K0L A;  1KNR A;  1PJ6 A;  4H2R A;  1JPD X;  1MDR A;  3VC5 A;  4C74 A;  1YEY A;  3ETR B;  1TRB A;  4C77 A;  1ELS A;  4LII A;  1T3Q C;  1PJ7 A;  1CF3 A;  3Q6J A;  1ZMD A;  2C3C A;  3FIM B;  4GCM A;  4JNA A;  2R0C A;  2ZZC A;  2PP3 A;  2APG A;  1DXL A;  1CHU A;  1SJD A;  2AL2 B;  4YKF A;  1F3P A;  1E39 A;  1JPM A;  1L9E A;  3NHO X;  2B9W A;  1PXC A;  4YSX A;  1KSU A;  2PGW A;  1FFV C;  3DK4 A;  5JCL A;  2WEU A;  3N4E A;  4TM0 A;  2X3N A;  2YG7 A;  3CGC A;  3LB8 A;  4GR1 A;  3T0K A;  1KCZ A;  5C3J A;  1BWC A;  2B76 A;  1LPF A;  4GDP A;  2BCP A;  3AEG A;  3AWI A;  3UGV A;  2BCG G;  3NNE A;  3ZLF A;  4DWD A;  3UP5 A;  1GRG A;  3HYX A;  2O56 A;  5HHF A;  4NWZ A;  1X31 B;  4KX6 A;  2NPX A;  5JCM A;  1IUX A;  2WHD A;  5HY5 A;  3SFD A;  3V3W A;  4AOS A;  2C7G A;  4A3R A;  3T31 A;  3B6D A;  3RIT A;  4II2 A;  2OZ3 A;  3MY9 A;  1BZL A;  3AE4 A;  2WQY A;  3UKA A;  2QGY A;  1K0J A;  1KN0 A;  3CNP A;  3NN0 X;  1JNR A;  3GWD A;  1TE6 A;  3N6H A;  3NRZ B;  2TMD A;  2XSX A;  4HNL A;  2XYO A;  1R0M A;  3F8D A;  4K2S A;  4MJW A;  4XWZ A;  2W0H A;  3QFA A;  3UJF A;  4EQS A;  4O5Q A;  1YKJ A;  4EMI A;  4DSG A;  3NN6 X;  1FEC A;  3ZYX A;  1S7M A;  2WPC A;  2MNR A;  3TJ4 A;  1KKO A;  5U1O A;  1RP0 A;  4EWJ A;  4K22 A;  3PVC A;  2OQH A;  3AE8 A;  3AEB A;  3ICR A;  3CNS A;  3VR9 A;  4M52 A;  3K1G A;  3HYW A;  1VDV A;  4IVM B;  2Y6R A;  3NTD A;  3NVZ B;  1SEZ A;  1CC2 A;  3RCY A;  1FOH A;  2V3A A;  2QCU A;  3IHM A;  5EB4 A;  2XVF A;  3AEE A;  5IDZ A;  1DJQ A;  5C2T A;  3QKE A;  2OAL A;  4HCH A;  3DJJ A;  3NKS A;  2VZ2 A;  1ZOY A;  2OKT A;  2BC1 A;  4I58 A;  3EF6 A;  1YQ4 A;  4FI4 A;  1L9D A;  1GOS A;  4XXG A;  2Q0L A;  4HCL A;  1KD0 A;  4E0V A;  1IUU A;  1OJA A;  3HYV A;  2W54 A;  3CGB A;  3OW1 A;  4G6G A;  3TCS A;  3CMM A;  5FS7 A;  1GEU A;  4C5O A;  1GSN A;  3HW2 A;  3IC9 A;  4JN7 A;  3COX A;  3FPZ A;  2RGO A;  3U9I A;  1H84 A;  5KWF A;  3UOZ A;  4U8K A;  1E1M A;  2GH5 A;  2V60 A;  2PGE A;  3SFE A;  3DG6 A;  3QSM A;  4YSY A;  2VOU A;  4U2S A;  1D4E A;  3BI5 A;  1H7X A;  2H88 A;  2YM2 A;  4JY2 A;  5KOW A;  3R11 A;  4H4W A;  3F8P A;  2NVK X;  3DFH A;  3R10 A;  1GND A;  4X4J A;  1CJ3 A;  3QVP A;  3AE1 A;  4ENL A;  2WOI A;  1DNC A;  3QVR A;  4YXD A;  1L0V A;  4BK1 A;  4JQ9 A;  3V5F A;  2OZ8 A;  1E1K A;  2WP5 A;  2C66 A;  3V5C A;  4RG4 A;  4HA6 A;  1ONF A;  1TYP A;  1F9C A;  1EL7 A;  4H7U A;  3VDG A;  2E5A A;  4H4Z A;  2C65 A;  1TKK A;  3GYJ A;  2C4C A;  3ZVH B;  3GO2 A;  4H2H A;  2WOW A;  2PS2 A;  3PO7 A;  1KKR A;  1VRQ B;  4H2N A;  3I4K A;  2RGJ A;  4H2Q A;  2B7R A;  3UXK A;  1GAL A;  3UJE A;  4I59 A;  3MSY A;  3S47 A;  2PTY A;  3R0U A;  1JRX A;  2HXU A;  3UOX A;  1B5Q A;  2X50 A;  4O5U A;  3OZY A;  3T2K A;  3FG2 P;  4FX9 A;  2YG4 A;  4X2P A;  1CJC A;  3P3B A;  4NEW A;  2YQU A;  2YG3 A;  4G8T A;  2QAE A;  3NIX A;  2WOV A;  2R46 A;  3SJN A;  2GV8 A;  2BYB A;  4U8M A;  2GDQ A;  1VQW A;  3EUB 3;  3AMZ A;  1GRT A;  2V3B A;  2QDD A;  3TTE A;  3ZLH A;  2RAB A;  1N4W A;  1N63 C;  2XLU A;  2GGJ A;  2ZZB A;  3UKH A;  3CT2 A;  3AE2 A;  3SZW A;  3KKJ A;  1E1N A;  4IHC A;  3T4W A;  4IP5 A;  1F6M A;  4K8D A;  3FBS A;  3UTF A;  2WS3 A;  3D9X A;  1ZP0 A;  4NNJ A;  3KU9 A;  1Y56 B;  2HQM A;  2E3T A;  4FK1 A;  2OLN A;  1F8R A;  2BC0 A;  4YSH A;  5M0Z A;  2ACZ A;  1BF3 A;  1FFU C;  3UCL A;  3ICT A;  3Q45 A;  2C73 A;  3K7T A;  1PDH A;  3AED A;  1VQZ A;  4JDR A;  2QDE A;  4B63 A;  1IYX A;  3H8L A;  1N61 C;  2XCG A;  4WX1 A;  4C3X A;  3AD7 B;  4UDP A;  4A5L A;  1VG0 A;  1H81 A;  2XLP A;  4FK1 C;  3ZVI A;  1PJ5 A;  3ATR A;  3CPJ G;  1H6V A;  1PBB A;  4B64 A;  1N5W C;  2FJE A;  3QSE A;  1YY5 A;  2GGG A;  3D46 A;  3CTY A;  1GTE A;  1PBF A;  1JRZ A;  3V3N A;  2WPE A;  3SN0 A;  2WU5 A;  4Z2R A;  3GYI A;  1GRF A;  3DGH A;  5EB5 A;  3UJ2 A;  2J3N A;  3VRD B;  4TVY A;  3NYE A;  3P4R A;  3HRD C;  2WET A;  2FYM A;  1PXA A;  1H82 A;  4ZCW A;  4GAP A;  4D04 A;  5KMR A;  2GGE A;  3BNM A;  2AR8 A;  1PBD A;  4YTM A;  4Y4N A;  2GR0 A;  2F5Z A;  4JY3 A;  4E4U A;  4A6N B;  3SQP A;  1GES A;  3ALJ A;  2AQJ A;  3G5Q A;  2BS4 A;  3FVD A;  4HB9 A;  2PU0 A;  1SB3 B;  4X9M A;  2XFO A;  3GMB A;  2JB1 A;  4GIR A;  2XFU A;  2WPF A;  3NYF A;  2CVJ A;  2BAB A;  3JZU A;  4NTD A;  3S5W A;  3CXB A;  2VQB A;  3K7M X;  2YAU A;  3BHF A;  1TDF A;  2Z5X A;  4LU6 A;  4J57 A;  4J2W A;  1VDC A;  3BOX A;  1D4D A;  5KOX A;  2JAE A;  3GD3 A;  4B68 A;  3R1Z A;  1W4X A;  2WBA A;  4CY6 A;  4A7A A;  4P9S A;  2BK3 A;  4U8N A;  3BI4 A;  3U4F A;  3GD6 A;  4GGB A;  3UCC A;  3I6D A;  2DKH A;  1BQG A;  4GIS A;  4FP1 A;  2JB3 A;  3T14 A;  2OG9 A;  1ECQ A;  1NHQ A;  1GT8 A;  1VG9 A;  2IVE A;  2WP6 A;  3CPH G;  2C76 A;  1SJA A;  3L8K A;  3GDP A;  3OZM A;  3UKL A;  1TDO A;  4H4T A;  2WDR A;  3NXL A;  2ZBW A;  3NRN A;  2FKP A;  4CCR A;  1GRH A;  1RM6 B;  3VCN A;  4U8P A;  3KLJ A;  3NLC A;  3M12 A;  5BUL A;  2AKM A;  3T9P A;  4HPN A;  1XS2 A;  3L5O A;  3CNT A;  2C72 A;  2P8B A;  3NT6 A;  2PA6 A;  3NTA A;  3JSK A;  2QA1 A;  4IV9 A;  5IQ1 A;  4NTC A;  2VRM A;  2XVE A;  4Z24 A;  6ENL A;  3NH3 X;  3DH9 A;  1ZDL A;  3ALL A;  2MUC A;  5EBK A;  3CND A;  2BRY A;  5DBJ A;  4IA5 A;  3CYJ A;  1NU5 A;  3OTR A;  3SM8 A;  4H4V A;  3QPE A;  3E1T A;  1DOC A;  4USQ A;  5JCN A;  3H4K A;  4M6U A;  1FL2 A;  1H83 A;  3SX6 A;  4OCG A;  2WU2 A;  3KVE A;  3SXI A;  4TLZ A;  1MDL A;  3T8Q A;  3TQP A;  1ZX9 A;  2GR2 A;  5FJR A;  3KD9 A;  3AE7 A;  3CGD A;  1ZOV A;  3VA8 A;  1H86 A;  1JDF A;  2H89 A;  4APN A;  4ICY A;  3NK0 X;  3PS9 A;  4RG3 A;  5FJP A;  1E1L A;  1XDI A;  3ABV A;  1M6I A;  4OVI A;  2B7S A;  1PXB A;  3RP8 A;  1K4Q A;  5EOW A;  2OO6 A;  3K7Q X;  3D8X A;  4GME A;  3JW7 A;  4XWR A;  3JVA A;  1EC9 A;  4KPL A;  4HCD A;  1PDZ A;  2JBV A;  5U25 A;  4TM3 A;  1MNS A;  1R6W A;  5CKU A;  3DGZ A;  3P1W A;  1NG3 A;  1GV4 A;  3C4N A;  2QJJ A;  4H4Y A;  1N1P A;  4EQW A;  4A99 A;  4BV6 A;  4B65 A;  2BXR A;  1NHP A;  3SBF A;  4H4X A;  2XVI A;  3R9U A;  1NAA A;  3LAD A;  2YR6 A;  2PCE A;  1GTH A;  2GGI A;  4Z2U A;  3NFU A;  3UKK A;  4OPI A;  5FJU A;  3SSZ A;  2YR5 A;  3NK2 X;  2X8G A;  1Y0P A;  4U8J A;  3OPS A;  1LQT A;  5U63 A;  3H12 A;  1IUW A;  1GRA A;  2V5Z A;  5GSN A;  4A79 A;  3BI2 A;  1FIQ B;  2HZG A;  2XH2 A;  1FEB A;  5IQ4 A;  5J04 A;  7ENL A;  1OJ9 A;  1NEK A;  4JHM A;  1B37 A;  3D47 A;  2Q7V A;  3KUM A;  1FHU A;  1TZZ A;  1YQZ A;  2QJN A;  3RO6 A;  3NS1 B;  3RR1 A;  3OZ2 A;  2ZAD A;  1CC4 A;  1IUT A;  1E9I A;  1X2H A;  5CQF A;  1V59 A;  1TYT A;  2YLW A;  3MZN A;  4AP3 A;  4H4U A;  3UKF A;  3VQR A;  4NZH A;  1D4C A;  4G9K A;  2R4E A;  4E8G A;  3GYX A;  1WUE A;  4ZA0 A;  2DKI A;  3V3O A;  2A89 A;  2VVL A;  1K0I A;  4G6H A;  3AEA A;  3UOY A;  4KPR A;  3TJI A;  2R0P A;  3TWB A;  1GRB A;  3CPI G;  1M64 A;  4H19 A;  2FJA A;  2PP0 A;  4AOX A;  4DXK A;  1S2Y A;  1EBD A;  2Q0K A;  3WE0 A;  2Q6U A;  1MUC A;  3P4P A;  3ES7 A;  4H4S A;  4TLX A;  1W6T A;  1CJ4 A;  4C3Y A;  3GY1 A;  1Z6L A;  5FJO A;  2WDQ A;  4AT2 A;  2XH7 A;  1JEH A;  2BS2 A;  2YLR A;  1F8W A;  2GGH A;  2IVD A;  2OA1 A;  2PMQ A;  3ES8 A;  4J3Z A;  4AP1 A;  2C75 A;  1GXF A;  3NO1 A;  1TDK A;  1FEA A;  3BJS A;  3UJS A;  4U8L A;  2XFQ A;  4EM4 A;  2B9X A;  4RSL A;  3GRS A;  2UZZ A;  3A7U A;  1P48 A;  5KVH A;  4PAB A;  3R0K A;  4IT1 A;  1S3E A;  1B8S A;  3IWA A;  5EU9 A;  4WCT A;  4DSH A;  3DJG X;  3P4S A;  1O94 A;  3B9J B;  4ZCC A;  1IJH A;  3HPF A;  3QFB A;  4Z43 A;  4OPU A;  4H4R A;  4IL2 A;  1MXT A;  2OPJ A;  3QSS A;  2YWL A;  3DIP A;  2HXT A;  5HYM A;  5BOF A;  4A9W A;  4A65 A;  1RVK A;  1EBG A;  1P2H A;  2P3Z A;  1OJT A;  2XH0 A;  3GD4 A;  3AEC A;  1NEN A;  3KPK A;  4Z17 A;  3ATQ A;  1BKW A;  3FCP A;  1REO A;  5L46 A;  3LXD A;  3RRA A;  1IUS A;  3RGT A;  3T37 A;  1CBO A;  3DGB A;  3CB3 A;  2POZ A;  4GDE A;  3DJD A;  2EQ9 A;  3QTP A;  1QO8 A;  1JRP A;  1NPX A;  2XLS A;  5FS9 A;  2GAG B;  2C3D A;  4IZG A;  3DER A;  4ZOH B;  2P88 A;  1GER A;  3BSM A;  3FXG A;  4K2X A;  3GMC A;  3DG7 A;  3N6J A;  2YG5 A;  1QJD A;  4CY8 A;  3A7R A;  4M0X A;  4OPL A;  4B1B A;  2O9Z A;  2YVG A;  4CNJ A;  1KDG A;  1YQ3 A;  3II4 A;  3NK1 X;  5J60 A;  5LV9 A;  2XH4 A;  3QN3 A;  3UXL A;  4YKG A;  2Y6Q A;  2WP9 A;  3P4Q A;  1JCT A;  2EQ8 A;  4U2T A;  2W3S A;  1NG4 A;  3EEZ A;  3T2Y A;  1ELI A;  4GAV A;  2QQ6 A;  3PWI A;  2VVM A;  1LV0 A;  3I6E A;  3SYI A;  1ONE A;  3DES A;  4JN8 A;  1QLB A;  3NVY B;  4MMW A;  4UP3 A;  4J56 A;  4BK2 A;  1KFY A;  5ER0 A;  5JCK A;  2X8H A;  4GYP A;  2EQ6 A;  3AE5 A;  2GEW A;  4U8O A;  4B66 A;  1ZMC A;  5G5H B;  3VC6 A;  4REK A;  1EL9 A;  3URH A;  2GSH A;  2AL2 A;  3RNM A;  3NG7 X;  4YWO A;  4DGK A;  3UTE A;  3ITJ A;  2JK6 A;  1JOA A;  2NQL A;  2YLX A;  3GWF A;  2QA2 A;  4A6G A;  1DOD A;  4TM4 A;  2VVL G;  3I3L A;  4BUR A;  4J34 A;  3IJQ A;  3BNU A;  2E1M A;  1E6E A;  1FCD A;  4GYP C;  3OP2 A;  1L8P A;  3Q4D A;  1CC6 A;  3P9U A;  4BK3 A;  1B4V A;  3CN8 A;  2XVH A;  1NHR A;  4USR A;  3GC2 A;  5J7X A;  2E5V A;  2FJB A;  2I0Z A;  3UP4 A;  3T6C A;  1SJC A;  2YM1 A;  3C4A A;  3IHG A;  3V76 A;  3IJL A;  2X99 A;  3P93 A;  4BJZ A;  4Z26 A;  1O95 A;  3RP7 A;  4H1Z A;  4ADW A;  3ISH A;  4GUV A;  3MKC A;  2PP1 A;  2YR4 A;  2PPG A;  2C64 A;  2P0I A;  4IL0 A;  1KSS A;  2DW6 A;  3MQT A;  3NVV B;  3GRT A;  2X8C A;  3STP A;  2XVJ A;  1S2Q A;  3P0W A;  5ENL A;  2ONE A;  2XLT A;  2GMH A;  3DJE A;  1L9C A;  4EIQ A;  1NHS A;  3FJ4 A;  4FDC B;  4IP4 A;  4TVW A;  3PFR A;  1BGN A;  4UDR A;  4MKS A;  1TDN A;  2ZC8 A;  2BA9 A;  3THU A;  4OPT A;  3SGL A;  4H4P A;  4GFI A;  4OPD A;  3G5S A;  2PSN A;  4IA6 A;  5BOE A;  1N62 C;  4CRT A;  1OJC A;  3CIR A;  3PK7 A;  2E4G A;  3AYL A;  3DEQ A;  1COY A;  4TM1 A;  3DME A;  1EL5 A;  2PYX A;  1MOK A;  4ZCD A;  3FV9 A;  3DG3 A;  2I5Q A;  5IPY A;  5G5G B;  4K7Z A;  4G7F A;  4K8G A;  2ARD A;  1PN0 A;  1N60 C;  1WYG A;  4DNA A;  1JNZ A;  1N5X A;  1P43 A;  1V97 A;  2GQF A;  4MGG A;  2YVF A;  2B9Y A;  2JB2 A;  3S5S A;  1EC7 A;  4JN9 A;  3T2Z A;  3B97 A;  2OFJ A;  1SJB A;  4Z25 A;  4H4Q A;  3KPF A;  3M0O A;  4H50 A;  2FJD A;  2CFY A;  3R25 A;  3DK8 A;  1LTX R;  2R9Z A;  4OPG A;  5KXJ A;  1BKH A;  1PDY A;  4F4R A;  4YTP A;  3ICS A;  2CUL A;  4H2P A;  3ZDN A;  5JRB A;  3AYJ A;  1FO4 A;  3VRB A;  3IK4 A;  3L1R A;  4AT0 A;  4J36 A;  2RDX A;  4DN1 A;  3LJP A;  4PAA A;  2P8C A;  3AYI A;  2BK4 A;  5TR3 A;  4HNC A;  3C96 A;  4ECH A;  4J31 A;  3OC4 A;  3VCC A;  4GRT A;  3RP6 A;  2PHH A;  1H7W A;  5BVA A;  1CL0 A;  3UCD A;  3UTH A;  4HYR A;  3EAN A;  5HXI A;  3SY4 A;  4OPC A;  2GB0 A;  4YSZ A;  4ZN0 A;  3R07 C;  3GSI A;  2QJM A;  1H2I A;  4HN8 A;  1FHV A;  2OZT A;  4EQR A;  2GF3 A;  3SZ0 A;  2R0G A;  2AKZ A;  4G74 A;  5BRT A;  3F8R A;  2R4J A;  1ZXI C;  4B67 A;  2VQ7 A;  3AE9 A;  3H70 A;  3EAO A;  3AEF A;  4GGH A;  5KVI A;  3SZC A;  2ZZ0 A;  2XFP A;  2YVJ A;  3ZVH A;  3D1C A;  1ZY8 A;  2AAQ A;  1Q1W A;  3AXB A;  5GRT A;  3CXO A;  1PHH A;  5FS8 A;  4KWS A;  3MUC A;  2OLO A;  4NEV A;  3SN1 A;  4K5S A;  1N4U A;  3H8A A;  4G73 A;  5FS6 A;  2PTZ A;  3LZW A;  1D7L A;  3UKQ A;  3SQS A;  2OLA A;  3NZG A;  2GR3 A;  3HZL A;  2RGH A;  1LVL A;  3SR6 B;  2XLR A;  4DHG A;  4J33 A;  3VFC A;  4KEM A;  3AN1 A;  1JRY A;  4U2L A;  1PS9 A;  4Z44 A;  1PBC A;  1Q9I A;  1HYU A;  5M10 A; 
#chains in the Genus database with same CATH homology
 1NDA A;  4H4T A;  2XVF A;  3AEE A;  4EIP A;  2WDR A;  1GER A;  1D5T A;  2GQW A;  2ZBW A;  3NRN A;  1DOE A;  4K2X A;  1DJQ A;  3GMC A;  5C2T A;  2YG5 A;  4CCR A;  3NGC X;  1GRH A;  4U8P A;  1QJD A;  2OAL A;  3KLJ A;  3NLC A;  3DJJ A;  3M12 A;  4CY8 A;  3NKS A;  2VZ2 A;  1KF6 A;  5BUL A;  2CDU A;  1ZOY A;  4OPL A;  1DJN A;  2BC1 A;  3RED A;  3VRA A;  4I58 A;  3EF6 A;  4B1B A;  2C70 A;  1RYI A;  1YQ4 A;  1EL8 A;  2O9Z A;  2YVG A;  5BUK A;  3L5O A;  3CNT A;  1L9D A;  1GOS A;  4XXG A;  1KDG A;  2Q0L A;  3RHA A;  4CNJ A;  1YQ3 A;  1AOG A;  2C72 A;  3NT6 A;  3NYC A;  3II4 A;  3NTA A;  1GRE A;  3AE6 A;  1GPE A;  3JSK A;  2QA1 A;  4IV9 A;  3NK1 X;  4Y4M A;  5IQ1 A;  4E0V A;  5J60 A;  1IUU A;  2TPR A;  4NTC A;  1ZK7 A;  1OJA A;  3HYV A;  5LV9 A;  3CGB A;  2VRM A;  2GAH B;  4G6G A;  4YKG A;  2XVE A;  5FS7 A;  1GEU A;  3CMM A;  4LA1 A;  4C5O A;  4Z24 A;  2Y6Q A;  1GSN A;  3IC9 A;  3NH3 X;  3DH9 A;  3COX A;  3FMW A;  1ZDL A;  2WP9 A;  3ALL A;  3FPZ A;  2RGO A;  3P4Q A;  5EBK A;  3UKP A;  2EQ8 A;  4CBQ A;  3CND A;  4U2T A;  1NG4 A;  5JCI A;  2GVC A;  1H84 A;  1UKV G;  2BRY A;  3QJ4 A;  4CCQ A;  5DBJ A;  3UOZ A;  5KWF A;  4U8K A;  4GF7 A;  1Y56 A;  3T2Y A;  1ELI A;  4GAV A;  4IA5 A;  1E1M A;  3H8I A;  2GH5 A;  1IUV A;  2V60 A;  2VVM A;  3SFE A;  1LV0 A;  3SYI A;  2GMJ A;  3SM8 A;  4H4V A;  3E1T A;  2QCU A;  1DOC A;  3QSM A;  4USQ A;  3DK9 A;  5JCN A;  2WDV A;  4YSY A;  3H4K A;  2GRT A;  1FL2 A;  1H83 A;  1QLB A;  4OCG A;  3SX6 A;  2VOU A;  2WU2 A;  4UP3 A;  1OJD A;  3KVE A;  4J56 A;  1S3B A;  1KFY A;  2BXS A;  4TLZ A;  3SXI A;  4BK2 A;  4U2S A;  5ER0 A;  2IID A;  5JCK A;  1ZX9 A;  1D4E A;  2GR2 A;  2X8H A;  2EQ6 A;  3BI5 A;  3AE5 A;  2GEW A;  3IF9 A;  3M13 A;  4U8O A;  4B66 A;  1H7X A;  1ZMC A;  4REK A;  4CNK A;  3KD9 A;  1EL9 A;  3URH A;  3AE7 A;  3CGD A;  1ZOV A;  2H88 A;  2WES A;  2YM2 A;  4JY2 A;  4Y4L A;  1H86 A;  3RNM A;  3PG6 A;  1P2E A;  3NG7 X;  5KOW A;  3BHK A;  4YWO A;  2H89 A;  4APN A;  4DGK A;  4II3 A;  4ICY A;  2BS3 A;  3UTE A;  3ITJ A;  3NK0 X;  3Q9T A;  2JK6 A;  1JOA A;  3PS9 A;  4RG3 A;  2YLX A;  3K30 A;  3GWF A;  4H4W A;  2QA2 A;  1E1L A;  1TDE A;  1E7P A;  1XDI A;  2XDO A;  1N4V A;  1DOD A;  3F8P A;  4TM4 A;  2NVK X;  2VVL G;  3ABV A;  1LJ1 A;  1PBE A;  1M6I A;  1GND A;  3I3L A;  4OVI A;  2B7S A;  1PXB A;  3RP8 A;  4YTN A;  4BUR A;  4EM3 A;  4J34 A;  1RSG A;  1K4Q A;  5EOW A;  3K7Q X;  3BNU A;  3D8X A;  2E1M A;  4X4J A;  1CJ3 A;  3QVP A;  1XAN A;  4N9X A;  1E6E A;  3IHM A;  1FCD A;  2YLS A;  3ALM A;  4XWR A;  3AE1 A;  2WOI A;  1DNC A;  1CC6 A;  3P9U A;  4UDQ A;  4BK3 A;  1B4V A;  3LZX A;  3QVR A;  3CN8 A;  4YXD A;  2XVH A;  1L0V A;  4BK1 A;  4JQ9 A;  2JKC A;  5FMH A;  3G5R A;  1NHR A;  1O5W A;  2JBV A;  4K5R A;  4USR A;  5U25 A;  1E1K A;  4TM3 A;  2A8X A;  2WP5 A;  2VRL A;  2XFN A;  5J7X A;  2OAM A;  2C66 A;  2E5V A;  5CKU A;  4RG4 A;  1F8S A;  3DGZ A;  4HA6 A;  1ONF A;  1DOB A;  2FJB A;  1MO9 A;  1TYP A;  2I0Z A;  3UP4 A;  3P1W A;  1ZKQ A;  1NG3 A;  1EL7 A;  4H7U A;  1Q1R A;  1GV4 A;  3S61 A;  3C4N A;  5KNL A;  2YM1 A;  4H4Y A;  1N1P A;  4H4Z A;  4EMJ A;  2C65 A;  2V61 A;  3C4A A;  3GYJ A;  3IHG A;  4EQW A;  2C4C A;  4NTE A;  4BV6 A;  3V76 A;  4A99 A;  4B65 A;  2X99 A;  2BXR A;  2WOW A;  4A6N A;  5KMP A;  1NHP A;  1BGJ A;  4H4X A;  3PO7 A;  1VRQ B;  4H2N A;  4BJZ A;  2XVI A;  4Z26 A;  1O95 A;  3R9U A;  4JNQ A;  3RP7 A;  1NAA A;  1GET A;  4ADW A;  2RGJ A;  3GDN A;  3ISH A;  4H2Q A;  2B7R A;  4GUV A;  2YR4 A;  2C64 A;  2BAC A;  1GAL A;  3LAD A;  2YLZ A;  2YR6 A;  1KSS A;  4I59 A;  1LQU A;  3AB1 A;  1GTH A;  1JRX A;  4EQX A;  3GRT A;  3UOX A;  4Z2U A;  4U8I A;  1B5Q A;  2X50 A;  4O5U A;  3LOV A;  3UKK A;  2X8C A;  4OPI A;  3VR8 A;  3T2K A;  3FG2 P;  3CNJ A;  2YLT A;  2YR5 A;  1XHC A;  3NK2 X;  2XVJ A;  3O0H A;  2X8G A;  4FX9 A;  1S2Q A;  2BRA A;  1Y0P A;  2YG4 A;  4U8J A;  3UTG A;  2XLT A;  2GMH A;  3DJE A;  3AD8 B;  1CJ2 A;  1LQT A;  1L9C A;  2A87 A;  4EIQ A;  1NHS A;  5U63 A;  1CJC A;  1IUW A;  1GRA A;  1KNP A;  4FDC B;  2V5Z A;  5GSN A;  2R45 A;  4A79 A;  4NEW A;  2YQU A;  3BI2 A;  2YG3 A;  3UOV A;  2V6O A;  2QAE A;  3NIX A;  2EQ7 A;  1BGN A;  3AE3 A;  4UDR A;  1TDN A;  2WOV A;  2BA9 A;  1FEB A;  2R46 A;  4OPT A;  2GV8 A;  3SGL A;  4H4P A;  4OPD A;  5IQ4 A;  2BYB A;  1OJ9 A;  1NEK A;  3G5S A;  3AD9 B;  1JU2 A;  4U8M A;  1VQW A;  2GR1 A;  4X9N A;  4IA6 A;  1GRT A;  1B37 A;  2V3B A;  2Q7V A;  3DA1 A;  4IVO B;  5KRQ A;  4B69 A;  3EPT A;  4CRT A;  1YQZ A;  2BK5 A;  2RAB A;  1OJC A;  1N4W A;  3CIR A;  4D03 A;  2E4G A;  3AYL A;  3OZ2 A;  1CC4 A;  1IUT A;  2XLU A;  3SZF A;  1COY A;  3ADA B;  5CQF A;  1V59 A;  1TYT A;  4TM1 A;  2YLW A;  3CGE A;  5EB4 A;  3DME A;  2C67 A;  2ZZB A;  1EL5 A;  2PYX A;  4EMW A;  4BJY A;  3UKH A;  3AE2 A;  1XPQ A;  1MOK A;  3SZW A;  3KKJ A;  1E1N A;  4AP3 A;  4H4U A;  3UKF A;  4ZCD A;  3VQR A;  4YT0 A;  4NZH A;  1D4C A;  4G9K A;  5IPY A;  4K7Z A;  2ARD A;  5KMQ A;  1F6M A;  3KA7 A;  2R4E A;  1PN0 A;  1D7Y A;  4K8D A;  3FBS A;  5KMS A;  3UTF A;  4DNA A;  2YG6 A;  3B3R A;  1JNZ A;  3GYX A;  2WS3 A;  3D9X A;  1ZP0 A;  2FBW A;  4NNJ A;  4Z2T A;  3KU9 A;  1Y56 B;  2HQM A;  2Z5Y A;  1K0L A;  2DKI A;  1KNR A;  3V3O A;  2GQF A;  4FK1 A;  1PJ6 A;  2OLN A;  1F8R A;  4H2R A;  2BC0 A;  2A89 A;  4YSH A;  2YVF A;  2B9Y A;  5M0Z A;  2VVL A;  1K0I A;  4G6H A;  2ACZ A;  2JB2 A;  1BF3 A;  3AEA A;  3UCL A;  4C74 A;  3ICT A;  3UOY A;  4KPR A;  4JN9 A;  1TRB A;  2C73 A;  2R0P A;  3T2Z A;  4C77 A;  1GRB A;  3CPI G;  1M64 A;  4LII A;  3K7T A;  4Z25 A;  1PDH A;  4H4Q A;  3KPF A;  2FJA A;  1PJ7 A;  4AOX A;  3AED A;  1CF3 A;  3Q6J A;  1ZMD A;  2C3C A;  3FIM B;  4JDR A;  1S2Y A;  3M0O A;  2R0C A;  4GCM A;  4JNA A;  2ZZC A;  4H50 A;  1EBD A;  2APG A;  1DXL A;  1CHU A;  2FJD A;  4B63 A;  2CFY A;  2Q0K A;  3WE0 A;  4YKF A;  1F3P A;  2Q6U A;  3H8L A;  1E39 A;  3DK8 A;  3P4P A;  2XCG A;  4WX1 A;  1L9E A;  1LTX R;  2R9Z A;  4OPG A;  4C3X A;  3NHO X;  2B9W A;  4H4S A;  5KXJ A;  1PXC A;  3AD7 B;  4TLX A;  1VG0 A;  4UDP A;  4A5L A;  1CJ4 A;  4C3Y A;  4YTP A;  1H81 A;  4YSX A;  2XLP A;  3ICS A;  1KSU A;  4FK1 C;  2CUL A;  1PJ5 A;  1Z6L A;  3ATR A;  3CPJ G;  4H2P A;  3ZDN A;  3DK4 A;  5JRB A;  5JCL A;  1H6V A;  1PBB A;  3AYJ A;  4B64 A;  2WEU A;  3VRB A;  2FJE A;  2WDQ A;  3QSE A;  4AT2 A;  1YY5 A;  3L1R A;  2X3N A;  2YG7 A;  4TM0 A;  3CGC A;  3CTY A;  1GTE A;  3LB8 A;  4J36 A;  4GR1 A;  1JEH A;  4AT0 A;  3T0K A;  3LJP A;  1PBF A;  4PAA A;  2BS2 A;  5C3J A;  2YLR A;  1BWC A;  3AYI A;  1F8W A;  1JRZ A;  3V3N A;  2WPE A;  2B76 A;  2BK4 A;  5TR3 A;  1LPF A;  2WU5 A;  3C96 A;  4GDP A;  2BCP A;  3AEG A;  4Z2R A;  3AWI A;  3GYI A;  1GRF A;  3DGH A;  4J31 A;  5EB5 A;  4ECH A;  2BCG G;  3NNE A;  3OC4 A;  2J3N A;  2OA1 A;  2IVD A;  3VRD B;  3NYE A;  3P4R A;  3UP5 A;  1GRG A;  4AP1 A;  2WET A;  4GRT A;  2C75 A;  1GXF A;  1TDK A;  1FEA A;  4U8L A;  1PXA A;  3RP6 A;  1H82 A;  2PHH A;  2XFQ A;  3HYX A;  4EM4 A;  2B9X A;  4RSL A;  5HHF A;  4GAP A;  1H7W A;  5BVA A;  3GRS A;  4NWZ A;  4D04 A;  1CL0 A;  2UZZ A;  5KMR A;  3UTH A;  1X31 B;  5KVH A;  4PAB A;  4KX6 A;  2NPX A;  3EAN A;  5JCM A;  3BNM A;  5HXI A;  2AR8 A;  1IUX A;  2WHD A;  3SY4 A;  5HY5 A;  1S3E A;  4OPC A;  2GB0 A;  1PBD A;  3SFD A;  4AOS A;  2C7G A;  4YSZ A;  4YTM A;  4Y4N A;  3T31 A;  1B8S A;  3B6D A;  2GR0 A;  3IWA A;  2F5Z A;  4II2 A;  4ZN0 A;  4WCT A;  3GSI A;  4JY3 A;  4A6N B;  4DSH A;  1H2I A;  3DJG X;  1BZL A;  3SQP A;  1GES A;  2WQY A;  3AE4 A;  3P4S A;  3ALJ A;  3UKA A;  1K0J A;  2AQJ A;  1O94 A;  3G5Q A;  1KN0 A;  2BS4 A;  4EQR A;  2GF3 A;  3CNP A;  2R0G A;  3SZ0 A;  3NN0 X;  4HB9 A;  1JNR A;  4ZCC A;  3GWD A;  1IJH A;  4G74 A;  2TMD A;  5BRT A;  4X9M A;  3QFB A;  2XFO A;  4Z43 A;  2XYO A;  3GMB A;  3F8R A;  2R4J A;  3F8D A;  2JB1 A;  4OPU A;  4H4R A;  2XFU A;  4B67 A;  2WPF A;  1MXT A;  2VQ7 A;  3NYF A;  4MJW A;  4XWZ A;  3QSS A;  2CVJ A;  2YWL A;  2BAB A;  3AE9 A;  4NTD A;  2W0H A;  3S5W A;  3QFA A;  2VQB A;  3EAO A;  5HYM A;  4EQS A;  4O5Q A;  1YKJ A;  4A9W A;  5M10 A;  4EMI A;  3K7M X;  4A65 A;  2YAU A;  3BHF A;  1TDF A;  3AEF A;  4DSG A;  3NN6 X;  2Z5X A;  1FEC A;  1P2H A;  1OJT A;  4LU6 A;  5KVI A;  4J57 A;  4J2W A;  3SZC A;  3ZYX A;  1S7M A;  2ZZ0 A;  1VDC A;  2YVJ A;  2WPC A;  2XFP A;  3D1C A;  1ZY8 A;  1D4D A;  5KOX A;  3GD4 A;  3AEC A;  5U1O A;  2JAE A;  3GD3 A;  2AAQ A;  1RP0 A;  4B68 A;  1W4X A;  1NEN A;  1Q1W A;  3KPK A;  3ATQ A;  3AXB A;  5GRT A;  1BKW A;  1PHH A;  5FS8 A;  1REO A;  2WBA A;  4K22 A;  5L46 A;  4CY6 A;  3LXD A;  2OLO A;  4A7A A;  1IUS A;  4NEV A;  4K5S A;  1N4U A;  4P9S A;  2BK3 A;  3T37 A;  4G73 A;  3PVC A;  5FS6 A;  4U8N A;  1CBO A;  3AE8 A;  3AEB A;  3ICR A;  3LZW A;  3CNS A;  1D7L A;  3VR9 A;  4M52 A;  4GDE A;  3BI4 A;  3UKQ A;  3DJD A;  2EQ9 A;  1QO8 A;  3HYW A;  3I6D A;  2DKH A;  1NPX A;  2XLS A;  3HZL A;  2GR3 A;  5FS9 A;  4IVM B;  2JB3 A;  2RGH A;  2Y6R A;  3T14 A;  1LVL A;  3NTD A;  2XLR A;  2GAG B;  1NHQ A;  1GT8 A;  2C3D A;  1VG9 A;  2IVE A;  4J33 A;  1SEZ A;  2WP6 A;  1CC2 A;  3CPH G;  2C76 A;  3L8K A;  1FOH A;  3GDP A;  2V3A A;  1JRY A;  4U2L A;  1PS9 A;  3UKL A;  4Z44 A;  1PBC A;  1Q9I A;  1HYU A;  1TDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...