1NPXA

Structure of nadh peroxidase from streptococcus faecalis 10c1 refined at 2.16 angstroms resolution
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
447
structure length
446
Chain Sequence
MKVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNVFSNTEITAIQPKEHQVTVKDLVSGEERVENYDKLIISPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKTVDPEVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLGVYLDKEFTDVLTEEMEANNITIATGETVERYEGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWLKGTLELHPNGLIKTDEYMRTSEPDVFAVGDATLIKYNPADTEVNIALATNARKQGRFAVKNLEEPVKPFPGVQGSSGLAVFDYKFASTGINEVMAQKLGKETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYADFFFQPAFDKPWNIINTAALEAVKQER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of NADH peroxidase from Streptococcus faecalis 10C1 refined at 2.16 A resolution.
pubmed rcsb
source organism Enterococcus faecalis
molecule tags Oxidoreductase(h2o2(a))
molecule keywords NADH PEROXIDASE
total genus 140
structure length 446
sequence length 447
ec nomenclature ec 1.11.1.1: NADH peroxidase.
pdb deposition date 1991-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
A PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.390.30 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like; domain 1 1npxA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1npxA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1npxA02
3NG7X 4RSLA 3ICTA 3V3OA 4CBQA 3S5WA 1KSUA 4X9NA 4J36A 4EQSA 1E1KA 5IPYA 4C74A 3AXBA 1IUSA 3M0OA 2XFNA 3AEEA 2AAQA 1KFYA 2PYXA 1F8WA 2Y6RA 2YVGA 3DMEA 3UKHA 1FCDA 2GQFA 4B68A 4H50A 2XYOA 3VR9A 5GRTA 3LB8A 1D4CA 2BYBA 4XWZA 1ONFA 3SGLA 1ZMDA 1IUWA 4E0VA 1KSSA 4U2TA 3GRSA 4EIPA 5KOXA 2WS3A 2WESA 3ALJA 3AE5A 3H4KA 3AE9A 4Z2TA 2J3NA 2B76A 4NTDA 4P9SA 2BK4A 2E4GA 4BK1A 1XPQA 5C2TA 3LOVA 3CN8A 1REOA 4K2XA 2WP9A 2GH5A 3BI2A 3H8LA 2JB2A 3LZWA 4YTNA 3GD3A 4C3YA 1IUUA 4WX1A 1GERA 3IC9A 4CCQA 4IV9A 1PBDA 4EMIA 4B64A 3URHA 3PS9A 4OPDA 3UTHA 1ZDLA 5KXJA 2C67A 5C3JA 3QFAA 1PJ6A 4J2WA 1GSNA 2QA1A 1KNRA 2CVJA 1VQWA 2DKHA 2WQYA 3FIMB 3P4SA 3ZYXA 4YSYA 5BULA 4Z24A 1PBCA 5FS6A 4BK3A 5KVHA 3UKQA 1Q1WA 4PABA 4H2QA 2JK6A 4EMJA 2EQ6A 2QAEA 2R0PA 3AD8B 1YQ3A 3G5RA 1NPXA 2R4JA 2H89A 3S61A 3P1WA 3DGHA 3UKPA 1PBFA 3ALMA 1N4UA 1ZY8A 3VRBA 1EBDA 1QJDA 3DJEA 2XFQA 4TM0A 4GRTA 3RNMA 5J7XA 2B7RA 4H4PA 1N4VA 3PVCA 2XLSA 1GRTA 1GREA 2JKCA 3CGDA 1JRYA 2GAHB 5KRQA 1GTHA 1TDFA 2XCGA 3K7TA 3NIXA 4AOXA 2B9XA 3GYJA 1PBEA 2CULA 2Z5XA 2GB0A 2V3BA 1MOKA 2IVEA 2WU2A 2OAMA 2JB3A 2WP6A 4OPIA 4TM3A 1DJNA 3O0HA 5JCIA 1CL0A 2BS4A 1Y56A 4A5LA 1CJ3A 3AEBA 3AE1A 2BCGG 4EIQA 3AEAA 2HQMA 3NK1X 4TLZA 1Q1RA 3NYEA 3EANA 3ATRA 2XVJA 1VRQB 4EMWA 1GNDA 2BK3A 3AE3A 2C64A 4D03A 2DKIA 4YTMA 4NEWA 3VRAA 2XVIA 1NG3A 1ZOYA 2FJEA 5CQFA 4UDRA 4U8PA 1TDOA 3C4NA 2H88A 5U1OA 1GTEA 4U8MA 3GD4A 3ZDNA 2C66A 3LZXA 4LU6A 1OJDA 2XFUA 1RYIA 3QSEA 2R0GA 3UOVA 1EL7A 4GCMA 1Q9IA 3BI4A 4YKGA 1O5WA 1GRAA 4WCTA 2C7GA 4NEVA 4HA6A 2GF3A 2Q0KA 3P4RA 2AR8A 4H7UA 4O5QA 3F8RA 2R9ZA 3B3RA 1F8RA 1BGJA 4JN9A 1M6IA 3AB1A 4NZHA 2GV8A 1JOAA 4APNA 1AOGA 5FMHA 3G5QA 3PO7A 4U8OA 3DK8A 3RP6A 2YVJA 4JNQA 1YQZA 4RG4A 4D04A 3K30A 3KLJA 1V59A 2IVDA 2WHDA 4A6NB 3NTAA 1B8SA 3B6DA 1NHSA 1H7WA 4H2PA 4FX9A 2C73A 3NRNA 3UTFA 4EQXA 1N4WA 2YLTA 2BA9A 5KWFA 4YSXA 1QLBA 1E39A 3UCLA 1XHCA 2YG5A 1LVLA 1FEBA 3DA1A 1CC2A 3HZLA 4C77A 4EM4A 3CGEA 3LJPA 3C96A 1CHUA 2GR2A 4K5RA 3ISHA 1TYPA 1Y0PA 4DNAA 3BI5A 3UKKA 3DH9A 1E7PA 4CCRA 1OJ9A 3AYLA 2VVMA 3CNDA 4ZCDA 3UTGA 2XLTA 4B67A 3CPJG 3QVRA 5U25A 2OALA 4Y4MA 5FS8A 3AECA 2A89A 1D7YA 3KD9A 4H4RA 5EOWA 1XDIA 2EQ9A 1B4VA 2XVEA 2OLOA 5BRTA 3DGZA 3K7QX 4JY3A 2YLSA 2BS2A 2YLRA 3QSMA 1NHRA 4B63A 2YR4A 4BV6A 1W4XA 4O5UA 4H4QA 4B65A 2RABA 3AEDA 5J60A 2PHHA 2NVKX 1H83A 2BXRA 5EB5A 2E5VA 4DSHA 4C3XA 2FJBA 2JAEA 5JCLA 1GESA 2JBVA 2WEUA 3AD9B 4K22A 2BCPA 1TDEA 2YLXA 3EF6A 2XFOA 4H2NA 4TM1A 2WP5A 4I58A 2FBWA 3NK0X 4GDPA 4J33A 3IF9A 4OPTA 1RSGA 2GEWA 4CNJA 1LPFA 4ZN0A 3VRDB 4EM3A 2YQUA 4J57A 1DNCA 1B5QA 1JU2A 3KA7A 4B66A 1D7LA 5IQ1A 4U2SA 3NNEA 4H4TA 4H4YA 1VDCA 2JB1A 2O9ZA 2Z5YA 4J31A 1NAAA 3CNPA 4NTCA 2VQ7A 2R46A 1NHPA 2V60A 4U8NA 1KF6A 3ABVA 4USRA 5BUKA 4AOSA 3CTYA 4H4WA 2CFYA 1NEKA 3BHFA 3UKAA 3OC4A 2APGA 2R45A 1PXCA 3AE8A 3NHOX 3KU9A 4Z44A 4Z2UA 1TRBA 1L9DA 4UDQA 2FJAA 2BACA 3AYJA 3IHMA 4H4XA 5JCNA 1VG9A 4IA6A 4A9WA 2X50A 1NDAA 2XLUA 1PJ5A 3M12A 4LIIA 1PXAA 2B7SA 3CIRA 3D1CA 3CPHG 2BS3A 4H4UA 1D4DA 1NHQA 1OJTA 3GMBA 3NGCX 1L0VA 2OA1A 1K0IA 3P4QA 4PAAA 4OCGA 1DODA 1H7XA 1YKJA 1S3BA 1LV0A 3COXA 2WOIA 2VRLA 3P9UA 4BURA 2XFPA 2YG7A 2GRTA 3CNSA 2GR0A 3EAOA 3FG2P 1JRXA 1OJAA 2V61A 3NTDA 2ZZ0A 3UOYA 2Q0LA 4YSHA 1ZK7A 3L8KA 1H6VA 5LV9A 1NENA 3ICRA 3QJ4A 3DJGX 1COYA 4BJZA 3REDA 3VR8A 5FS7A 3ITJA 2Q7VA 4Z2RA 3LADA 3UOZA 2X3NA 2AQJA 4LA1A 4A99A 2C76A 4XXGA 1UKVG 4GDEA 4U2LA 1YQ4A 1P2EA 1YY5A 4OPLA 1N1PA 4Z26A 2C3DA 1CBOA 1RP0A 1MO9A 2GQWA 1H82A 4GF7A 2W0HA 2QA2A 1JRZA 1O95A 4I59A 3GYIA 4FK1A 1ZMCA 1CJCA 5EB4A 2XVHA 1IUTA 3UOXA 2B9YA 2YM2A 2WPCA 2BXSA 2C3CA 1JNZA 3BHKA 2A8XA 2VOUA 2X8GA 1K0LA 5IQ4A 2GVCA 2R0CA 1GV4A 2E1MA 3Q9TA 2YWLA 3EPTA 2ACZA 5KVIA 1XANA 1GETA 3GRTA 2WPFA 4AT0A 2RGOA 4JQ9A 4Y4LA 1BGNA 3K7MX 2YLWA 3AEFA 2EQ7A 1EL5A 2C72A 3BNUA 2FJDA 3WE0A 1CC4A 1IJHA 3C4AA 4H2RA 1KNPA 1S2YA 4TLXA 4B1BA 1GOSA 3Q6JA 4M52A 3P4PA 1PXBA 5BVAA 2YM1A 3G5SA 1B37A 1DJQA 1HYUA 4OVIA 4JDRA 2YG6A 4XWRA 5JCMA 1EL8A 3DK4A 1DXLA 4Z25A 1GPEA 3ATQA 2TPRA 2WETA 3ICSA 1JNRA 3NN0X 4IVOB 3GWFA 1IUVA 3UP5A 3AE4A 1ZP0A 2X99A 1E1LA 4KX6A 4B69A 2B9WA 3SM8A 1K0JA 1BWCA 1H86A 3GDNA 1F8SA 3SFEA 3NT6A 4AT2A 1H84A 2QCUA 4H4ZA 2XLRA 1LJ1A 1GRFA 3F8DA 4UDPA 3H8IA 1GRBA 5HXIA 4X4JA 3DJJA 4AP3A 3NYCA 4A6NA 1O94A 4RG3A 1VG0A 4K5SA 3I6DA 4REKA 2ARDA 1E6EA 3AE2A 3BNMA 5FS9A 3AD7B 4AP1A 2A87A 3FMWA 4H4VA 3ALLA 1KDGA 1EL9A 3F8PA 3DK9A 4FK1C 4A65A 1GRHA 4A7AA 3M13A 5M10A 1Z6LA 3R9UA 4U8KA 4ADWA 1D5TA 1PBBA 1SEZA 2GMHA 3IHGA 1L9CA 3L1RA 1PN0A 3RP7A 1GXFA 1BZLA 2NPXA 2YR6A 3AWIA 4J56A 1K4QA 1CC6A 1TDNA 3QSSA 3RP8A 4IA5A 2WOWA 3QFBA 1GRGA 2BABA 2OLNA 2YR5A 4CRTA 4DSGA 4MJWA 1DOEA 1ELIA 2VQBA 3ADAB 4U8LA 3DJDA 3NK2X 2GR1A 4KPRA 2XLPA 1BKWA 1TDKA 2C70A 2ZBWA 4N9XA 2UZZA 1E1MA 3D8XA 1Y56B 4X9MA 1MXTA 1FECA 2EQ8A 2WDQA 3GMCA 2IIDA 2GMJA 2WDVA 3GSIA 3NLCA 3NYFA 2R4EA 3I3LA 2WPEA 3NKSA 5HY5A 2BC0A 3NN6X 1DOBA 2WU5A 1ZX9A 4HB9A 3V76A 4JNAA 4TM4A 5HYMA 2YLZA 1BF3A 1M64A 3KPFA 1FOHA 2Q6UA 3AE7A 4H4SA 5KOWA 1H81A 2RGJA 3T37A 3CNTA 4GUVA 4IVMB 1CJ2A 3JSKA 4OPCA 1LQTA 2TMDA 4YKFA 3CGCA 4Z43A 4J34A 2YG3A 5GSNA 2VZ2A 1P2HA 2WDRA 4GR1A 3FPZA 5DBJA 2V5ZA 1QO8A 4A79A 1S3EA 4CY6A 1PHHA 2GR3A 4U8JA 3VQRA 2VRMA 3SFDA 5L46A 4EQWA 2X8HA 3AE6A 1NG4A 2XDOA 1DOCA 3NH3X 5JCKA 2F5ZA 4BJYA 5U63A 1LTXR 2YVFA 3UKLA 4ZCCA 4K8DA 4NTEA 4YWOA 4USQA 1OJCA 1PS9A 3GWDA 3RHAA 2YG4A 1ZKQA 2I0ZA 5EBKA 2Y6QA 3UP4A 3AEGA 3FBSA 1FL2A 1JEHA 5TR3A 2C65A 4C5OA 1GT8A 2ZZCA 2BK5A 4OPGA 2V3AA 2VVLG 4ECHA 1PJ7A 1ZOVA 4ICYA 1PDHA 5M0ZA 3UKFA 1CF3A 3AYIA 5CKUA 4OPUA 4U8IA 4FDCB 1GEUA 3II4A 4K7ZA 4EQRA 3OZ2A 2YAUA 1CJ4A 1D4EA 3E1TA 3IWAA 2CDUA 1GALA 3CPIG 3SQPA 3KVEA 1X31B 3CGBA 2X8CA 3KKJA 3UTEA 5HHFA 3QVPA 4YTPA 2XVFA 1F3PA 3CNJA 4CNKA 1LQUA 1FEAA 2C75A 3LXDA 2WBAA 2ZZBA 2GAGB 4YT0A 2VVLA 2WOVA 5ER0A 1IUXA 1L9EA 4JY2A 1S2QA 3GDPA 3V3NA 1E1NA 4CY8A 4YSZA 2V6OA 4YXDA 4UP3A 2BC1A 1F6MA 4BK2A 1TYTA 4Y4NA 2RGHA 4DGKA
chains in the Genus database with same CATH superfamily
2NQLA 3V3OA 3DIPA 4X9NA 4EQSA 4C74A 3M0OA 2XFNA 1KFYA 3L5OA 2OQYA 2YVGA 3DMEA 3UKHA 2GQFA 4H50A 4CY6A 2GGGA 1IUWA 3SN1A 4EIPA 5KOXA 2WS3A 3AE5A 4Z2TA 2J3NA 5C2TA 3CN8A 1VDVA 2JB2A 4ZA0A 4NWZA 3URHA 3PS9A 3DGBA 4IZGA 4A6GA 5IPYA 1KNRA 2WQYA 2OZ8A 4Z24A 1Q1WA 4H2QA 1JROA 2JK6A 3AD8B 3PWIA 3G5RA 3NXLA 3ALMA 2AL2B 3T14A 3AN1A 3RNMA 1JRYA 4M0XA 2HNEA 4DWDA 1GTHA 1TDFA 2XCGA 3NIXA 2XGZA 2B9XA 5EU9A 4II3A 4OPIA 3AEBA 4EIQA 3AEAA 2QJMA 4TLZA 2GGHA 2DKIA 3GY1A 1ZOYA 3VA8A 5U1OA 3ZDNA 2C66A 2XFUA 1RYIA 3QSEA 3T9PA 4GCMA 4YKGA 4H19A 1GRAA 2OQHA 2C7GA 4HA6A 2GF3A 4J3ZA 4JN9A 1AOGA 3G5QA 3DK8A 4JNQA 5G5GB 4RG4A 3K30A 1V59A 3MUCA 2WHDA 4FX9A 2C73A 3NRNA 1N4WA 2YLTA 2BA9A 1FEBA 3DA1A 3SBFA 4C77A 3C96A 1CHUA 2GR2A 4K5RA 4DNAA 3BI5A 3DH9A 1E7PA 3DG6A 5IDZA 5KMQA 1OJ9A 4E6MA 4DN1A 2A89A 3KD9A 4JN8A 1FO4A 2OLOA 3RCYA 3DGZA 2YLSA 3QSMA 1DTNA 1NHRA 1W4XA 2RABA 3AEDA 2BXRA 1ELSA 4JN7A 4Z17A 3HW2A 2JAEA 2WEUA 2GL5A 2BCPA 1TDEA 2YLXA 2XFOA 4I58A 2FBWA 3TCSA 1LPFA 1JU2A 4U2SA 2JB1A 2Z5YA 4NTCA 1NHPA 5KMSA 3ABVA 2CFYA 2APGA 3SZ0A 3AE8A 3KU9A 4Z44A 3IHMA 1VG9A 2XLUA 1PXAA 3CPHG 1NHQA 1OJTA 2AL2A 1L0VA 4PAAA 3P4QA 4OCGA 1EC9A 3COXA 2VRLA 4A3RA 2YG7A 2GR0A 3NTDA 2ZZ0A 2GDQA 3L8KA 3T2KA 1H6VA 3SQSA 5FS7A 2AQJA 1TZZA 5JRBA 4GDEA 2CHRA 3SZWA 2GQWA 1H82A 4GF7A 2QA2A 1O95A 4I59A 4FI4A 2WPCA 4HPNA 2A8XA 2VOUA 7ENLA 3V5CA 5IQ4A 2E1MA 2ACZA 5KVIA 3GRTA 4AT0A 2YLWA 2EQ7A 2OLAA 1EL5A 3WE0A 1CC4A 4K8GA 3R0UA 3S5SA 1GOSA 3I6EA 2YM1A 4E5TA 3CK5A 2YG6A 3DK4A 3TJ4A 3ATQA 2WETA 3ICSA 3UP5A 3AE4A 1E1LA 4KX6A 3GDNA 1F8SA 3SFEA 2QCUA 1GRFA 2QQ6A 1GRBA 5HXIA 3TTEA 4AP3A 3N4FA 3UXKA 1VG0A 4K5SA 3ES8A 4AP1A 3FMWA 5M10A 3BOXA 1PBBA 3RP7A 2PTWA 1K4QA 1ZXIC 3VCCA 1CC6A 1TDNA 4MKSA 2GGJA 2GR1A 2QGYA 1BKWA 5FJTA 2C70A 2UZZA 3D8XA 3GMCA 1FECA 3HYWA 3NLCA 1XPYA 2WDVA 3CXOA 3GSIA 3NYFA 3NFUA 3SSZA 2WPEA 2BC0A 2P3ZA 4HCHA 4HB9A 3V76A 4JNAA 2YLZA 1BF3A 1M64A 3SR6B 3Q4DA 2GGEA 5GSNA 2VZ2A 3FPZA 1QO8A 1S3EA 1PHHA 2GR3A 3UJ2A 3VQRA 3SFDA 2X8HA 3AE6A 4GISA 2F5ZA 1LTXR 4ZCCA 3RHAA 3GWDA 3IJQA 5TR3A 1W6TA 1JRPA 3OZMA 2ZZCA 2VVLG 3UJFA 1PJ7A 3THUA 4IP5A 3UKFA 3AYIA 4OPUA 4FDCB 1GEUA 2CDUA 1GALA 1FFUC 1L8PA 1N60C 3CGBA 1NU5A 1MNSA 3KKJA 4YTPA 3MY9A 1LQUA 2GAGB 3LXDA 3SYIA 2VVLA 3TW9A 3UGVA 4YXDA 1E1NA 3PFRA 3NG7X 4RSLA 3AXBA 2I5QA 3AEEA 2AAQA 2Y6RA 1F8WA 4B68A 1D4CA 3LB8A 3UJRA 3UJEA 1ZMDA 3ALJA 3H4KA 2QJNA 3AE9A 4P9SA 3KPKA 2HZGA 2BK4A 2E4GA 2AKMA 4BK1A 1XPQA 1JCTA 4K2XA 2GH5A 4YTNA 4C3YA 4EMIA 3P93A 4OPDA 1ZDLA 5C3JA 3QFAA 4YWSA 4PABA 2EQ6A 3P1WA 3DGHA 1ZY8A 3VRBA 3QLDA 2XFQA 4TM0A 4GRTA 2B7RA 4H4PA 1N4VA 3CGDA 2GAHB 3GO2A 3PK7A 4AOXA 2V3BA 2GB0A 3A7AA 2IVEA 2OZTA 2JB3A 2WP6A 3CB3A 3O0HA 1Y56A 1CJ3A 3AE1A 2BCGG 3DDMA 2P88A 2HQMA 3NK1X 1Q1RA 3H7VA 3EANA 1FHVA 2XVJA 1VRQB 2BK3A 4NEWA 4ROPA 1NG3A 5CQFA 3NS1B 4UDRA 2H88A 3GD4A 3LZXA 2RDXA 1OJDA 1EL7A 1Q9IA 3BI4A 2QDEA 4NEVA 2AR8A 3F8RA 2GV8A 4U8OA 2YVJA 1YQZA 4D04A 3NTAA 1B8SA 1NHSA 1H7WA 3UTFA 1QLBA 3UCLA 2YG5A 1LVLA 3KUMA 5ENLA 1ECQA 2VVMA 2XLTA 3V5FA 2OALA 3EKGA 1XDIA 2EQ9A 2XVEA 3K7QX 3AMZA 4B63A 2YR4A 4BV6A 4M6UA 4H4QA 5J60A 2PHHA 1H83A 5G5HB 5EB5A 2E5VA 1GESA 4H2NA 4IP4A 3NK0X 4OPTA 1SJDA 2W54A 1RSGA 4CNJA 3OPSA 3SXIA 3VRDB 2YQUA 1DNCA 1B5QA 4J31A 4H4TA 1NAAA 2VQ7A 2V60A 1KF6A 4H2HA 4AOSA 3CTYA 3OC4A 2E3TA 2PP3A 3DFHA 1L9DA 4UDQA 4H4XA 4ENLA 4A9WA 3M12A 4LIIA 3GMBA 3NGCX 1H7XA 4MMWA 2WOIA 3P9UA 4BURA 4DHGA 2GRTA 3EAOA 3T31A 1JRXA 4YSHA 3R1ZA 3D47A 3DJGX 1COYA 4GAVA 4Z2RA 3LADA 2QDDA 4OPLA 1RM6B 1PDZA 2BXSA 1JNZA 3I6TA 3Q9TA 3EPTA 3T2ZA 1BGNA 4H2RA 1KNPA 4TLXA 4B1BA 3N4EA 1HYUA 4OVIA 1EL8A 3RRAA 2XH7A 4HNLA 2B9WA 1BWCA 3BSMA 1H84A 1LJ1A 4X4JA 1O94A 3P3BA 4GYPC 3RITA 4REKA 2OVLA 5FS9A 1KDGA 3F8PA 3MWCA 3DK9A 4A65A 1GRHA 3ZVIA 1Z6LA 3PG6A 4ADWA 4E4UA 3IHGA 1L9CA 3L1RA 2PTXA 2NPXA 3AWIA 4J56A 3RP8A 4IA5A 2YR5A 4DSGA 2PMQA 4U8LA 1YEYA 3DJDA 4KPRA 2PTZA 5KMRA 4X9MA 1MXTA 2WDQA 4J1OA 5HY5A 3NN6X 1DOBA 4TM4A 1FOHA 3AE7A 4H4SA 4IL2A 2RGJA 2AKZA 4GUVA 4IVMB 1CJ2A 4A79A 2V5ZA 4U8JA 3FJ4A 4GYPA 3NH3X 4A35A 4BJYA 5U63A 3AM9A 4NTEA 3T4WA 2YG4A 3ZLHA 2Y6QA 4G74A 1SB3B 3AEGA 1FIQB 3QKEA 3ENLA 4OPGA 2V3AA 4KPLA 3TWBA 3NZGA 1P48A 5M0ZA 1R6WA 5CKUA 4U8IA 4EQRA 3IWAA 1D4EA 3CPIG 3KVEA 1X31B 3VC5A 3QVPA 2XVFA 3CNJA 3SJNA 4CNKA 2C75A 2ZZBA 3V3NA 3CT2A 1S2QA 4CY8A 4UP3A 3U9IA 4BK2A 4Y4NA 2RGHA 4DX3A 3ICTA 4J36A 1N5XA 4HN8A 2PYXA 1FCDA 3FV9A 2XYOA 3DG7A 4XWZA 2BYBA 3SGLA 1KSSA 4U2TA 3GRSA 4GGHA 3QTPA 2B76A 5BOFA 3LOVA 1REOA 2WP9A 3LZWA 1IUUA 3A7UA 1PBDA 3IK4A 4B64A 1MDLA 3UTHA 5KXJA 2C67A 3FVDA 4J2WA 4FP1A 1GSNA 3ZYXA 1N61C 2CVJA 2DKHA 4YSYA 5FS6A 4DYEA 4BK3A 3UKQA 2PGWA 2QAEA 2R0PA 1PBFA 3ZLGA 1N4UA 1EBDA 3Q45A 3PVCA 2XLSA 1GRTA 1GREA 4GGBA 2OX4A 4TVWA 3R07C 1PBEA 2CULA 2Z5XA 3ZVHA 2WU2A 2OAMA 4TM3A 2BS4A 4A5LA 2E5AA 3UJSA 2GSHA 1N5WC 3NYEA 3ATRA 4EMWA 2C64A 1OEPA 2HXUA 3VRAA 2XVIA 3NVZB 5J04A 3BJSA 1TDOA 1GTEA 4KT2A 3JZUA 2R0GA 2PSNA 4WCTA 1X2GA 3P4RA 4H7UA 4K1WA 2R9ZA 1F8RA 1BGJA 1M6IA 4HCLA 1KN0A 3K1GA 2PGEA 1JOAA 1MRAA 4APNA 5FMHA 5BUKA 3KLJA 2IVDA 4A6NB 1PDYA 3B6DA 4EQXA 2PCEA 1N62C 1E39A 4DXKA 3DEQA 1CC2A 4G9KA 3ZLFA 3LJPA 5FJPA 1TYPA 3UKKA 4GFIA 3OP2A 4CCRA 3CNDA 4ZCDA 3R0KA 2PP0A 3CPJG 3QVRA 5FS8A 3AECA 1D7YA 5EOWA 2OZ3A 1B4VA 5BRTA 4JY3A 4KWSA 4O5UA 3SZFA 3H8AA 3FXGA 2NVKX 2ZC8A 4DSHA 4C3XA 2FJBA 5JCLA 3AD9B 4K22A 2OKTA 4GDPA 4ZCWA 3IF9A 4J33A 5KMPA 2GEWA 1VQZA 4ZN0A 4EM3A 4B66A 1D7LA 5IQ1A 3MSYA 3NNEA 2O9ZA 3N6HA 4MGGA 4H4WA 1NEKA 3BHFA 4HCDA 1PXCA 3NHOX 3RR1A 4Z2UA 2FJAA 2BACA 3AYJA 1SJAA 5JCNA 3S47A 2C4CA 1JPMA 4H4UA 1D4DA 2OA1A 1K0IA 1DODA 1S3BA 5BOEA 2XFPA 3CNSA 1OJAA 3UOYA 5LV9A 3ICRA 4BJZA 1BQGA 3REDA 3ITJA 3RGTA 2Q7VA 1FFVC 3UOZA 3VFCA 4U2LA 1YQ4A 2W55A 1N1PA 4Z26A 2C3DA 1CBOA 2OFJA 3SN0A 1MO9A 3MKCA 3DFYA 2XVHA 3UOXA 3CAWA 4Z1YA 2C3CA 4IL0A 3T8QA 2GVCA 3TJIA 1XANA 2RGOA 3V4BA 4Y4LA 3FCPA 3TWAA 3K7MX 3AEFA 2C72A 3BNUA 3C4AA 1S2YA 2OPJA 4M52A 4GMEA 2MUCA 1B37A 3GYXA 4XWRA 4Z25A 1E9IA 2TPRA 1JNRA 4G73A 3NN0X 3GWFA 3D46A 2X99A 4B69A 4NNJA 4IHCA 1K0JA 4AT2A 4H4ZA 3F8DA 4UDPA 1KKOA 4A6NA 1S7MA 3I6DA 1E6EA 3JW7A 3ALLA 4U8KA 1PN0A 1GXFA 3VDGA 2YR6A 2P8BA 4TVYA 2OLNA 4CRTA 3ADAB 3NK2X 1R0MA 3MZNA 3STPA 2EQ8A 2PA6A 2GMJA 3GC2A 2R4EA 3NKSA 1ZX9A 3R11A 5HYMA 1JDFA 2Q6UA 1H81A 2OG9A 3CGCA 4Z43A 3HPFA 1P2HA 4EQWA 1NG4A 3TQPA 2XDOA 1DOCA 1EBHA 3P0WA 2YVFA 3UKLA 4K8DA 4YWOA 4USQA 1F9CA 2DW7A 1ZKQA 2I0ZA 1TKKA 3FBSA 1FL2A 2C65A 2HXTA 1GT8A 2BK5A 4ICYA 1PDHA 3T6CA 1CF3A 3II4A 4K7ZA 3OZ2A 2YAUA 1CJ4A 3E1TA 4E8GA 2PTYA 2PODA 4ZOHB 1WUEA 3EUB3 5HHFA 3SZCA 3R25A 4YT0A 2WBAA 2WOVA 5ER0A 4JY2A 2P8CA 4YSZA 1TYTA 2P0IA 4G8TA 3UKAA 4CBQA 3S5WA 1KSUA 1E1KA 3UCDA 4HNCA 1IUSA 1H2IA 3VR9A 5GRTA 4E0VA 1ONFA 1ONEA 2WESA 2FYMA 4NTDA 2OO6A 3VCNA 3BI2A 3H8LA 3GD3A 4WX1A 1GERA 3IC9A 4CCQA 4IV9A 1X2HA 2W3RA 1PJ6A 2QA1A 3FIMB 1VQWA 3P4SA 5BULA 2BRYA 1PBCA 2PU0A 5KVHA 1IYXA 3QPEA 4EMJA 1YQ3A 1NPXA 2R4JA 3H70A 2H89A 3S61A 3UKPA 2PU1A 1QJDA 3DJEA 3QN3A 5J7XA 3ZVHB 2JKCA 4II2A 1SJCA 5KRQA 3NVYB 3CXBA 3K7TA 3EEZA 3GYJA 1MOKA 2QVHA 3NVVB 1DJNA 5JCIA 1CL0A 2GGIA 3SX6A 3MQTA 3D9XA 1GNDA 3AE3A 4D03A 4YTMA 1V97A 1STZA 2FJEA 1JPDX 4U8PA 3C4NA 4U8MA 1MUCA 3A7RA 3NVWB 4LU6A 3UOVA 3HYVA 1O5WA 2Q0KA 4O5QA 3B3RA 3AB1A 4NZHA 4JHMA 3GD6A 3PO7A 3RP6A 2XH4A 4H2PA 4GIRA 1KCZA 5KWFA 4YSXA 1XHCA 3HZLA 2DW6A 4EM4A 3NO1A 3CGEA 1BKHA 3ISHA 4K2SA 1N63C 1Y0PA 3AYLA 3UTGA 1EC8A 4B67A 5U25A 4Y4MA 4H4RA 4HYRA 3HYXA 2YLRA 2BS2A 1TE6A 1NELA 4B65A 4X2PA 3U4FA 1KKRA 2FKPA 2JBVA 3DESA 4TM1A 3EF6A 2WP5A 4J57A 3KA7A 1VDCA 4H4YA 1XS2A 3CNPA 2R46A 4U8NA 2PPGA 4USRA 4EWJA 2R45A 1TRBA 1EBGA 3T2YA 3R10A 4IA6A 2X50A 1NDAA 1PJ5A 2B7SA 3CIRA 3D1CA 2BS3A 3B97A 1YKJA 1LV0A 2XH2A 3VC6A 4G7FA 3FG2P 2V61A 3UCCA 2Q0LA 1ZK7A 3HRDC 1NENA 3QJ4A 3VR8A 3RO6A 2X3NA 4LA1A 4A99A 2C76A 4XXGA 1UKVG 1P2EA 1EC7A 1YY5A 4E4FA 1RP0A 2W0HA 1JRZA 3GYIA 4FK1A 1ZMCA 1CJCA 5EB4A 1IUTA 2YM2A 2B9YA 4F4RA 3BHKA 2ONEA 5KNLA 2QJJA 2X8GA 1K0LA 2R0CA 1GV4A 2YWLA 1FHUA 1GETA 2WPFA 2PS2A 4JQ9A 3N6JA 2FJDA 1IJHA 1WYGA 3Q6JA 3P4PA 1PXBA 5BVAA 3G5SA 1DJQA 4JDRA 5JCMA 1DXLA 1GPEA 4IVOB 4KEMA 1IUVA 1ZP0A 2XSXA 2AL1A 3SM8A 1H86A 3NT6A 3SY4A 2XLRA 3H8IA 3OTRA 3DJJA 3NYCA 4RG3A 2ARDA 3AE2A 3UXLA 3BNMA 3H12A 3AD7B 1KD0A 2A87A 4H4VA 1SJBA 1EL9A 4FK1C 4A7AA 4H1ZA 3M13A 3V3WA 3R9UA 3DG3A 1D5TA 1SEZA 2GMHA 3T0KA 3JVAA 1BZLA 3QSSA 1P43A 5FJRA 2WOWA 5FJOA 3QFBA 1GRGA 2BABA 3NRZB 5FJUA 4MJWA 1DOEA 1ELIA 2VQBA 2XLPA 2ZADA 1TDKA 2ZBWA 4N9XA 1E1MA 2XH0A 4G6GA 4G6HA 1Y56B 2W3SA 3PWGA 2BRAA 3IJLA 2IIDA 6ENLA 3I3LA 2WU5A 3KPFA 5KOWA 3T37A 3CNTA 4IT1A 1RVKA 3JSKA 4GAPA 4OPCA 1LQTA 2TMDA 4YKFA 4J34A 2YG3A 5DBJA 2WDRA 4GR1A 3OW1A 2O56A 3I4KA 2VRMA 5L46A 3TOYA 5JCKA 2MNRA 2PP1A 1OJCA 1PS9A 3ES7A 3IJIA 3OZYA 5EBKA 3UP4A 3ETRB 1WUFA 1JEHA 4C5OA 3SN4A 3CYJA 4ECHA 1ZOVA 3FYYA 3CMMA 4H83A 1T3QC 3DERA 1MDRA 2POZA 3SQPA 3B9JB 2X8CA 3UTEA 1F3PA 1FEAA 1IUXA 1L9EA 3GDPA 2V6OA 2BC1A 1F6MA 4DGKA
chains in the Genus database with same CATH topology
3NG7X 4RSLA 3ICTA 3V3OA 4CBQA 3S5WA 1KSUA 4X9NA 4J36A 4EQSA 1E1KA 5IPYA 4C74A 3AXBA 1IUSA 1H2IA 3M0OA 2XFNA 3AEEA 2AAQA 3L5OA 1KFYA 1F8WA 2PYXA 2YVGA 2Y6RA 3DMEA 3UKHA 1FCDA 2GQFA 4B68A 4H50A 2XYOA 3VR9A 5GRTA 3LB8A 1D4CA 2BYBA 4XWZA 1ONFA 3SGLA 1ZMDA 1IUWA 4E0VA 1KSSA 4U2TA 3GRSA 4EIPA 5KOXA 2WS3A 2WESA 3ALJA 3AE5A 3H4KA 3AE9A 4Z2TA 2J3NA 2B76A 4NTDA 3KPKA 2BK4A 4P9SA 2E4GA 4BK1A 1XPQA 5C2TA 3LOVA 3CN8A 1REOA 4K2XA 2WP9A 2GH5A 3BI2A 3H8LA 2JB2A 3LZWA 4YTNA 3GD3A 4C3YA 1IUUA 4WX1A 1GERA 3IC9A 4CCQA 4IV9A 1PBDA 4EMIA 4NWZA 4B64A 3URHA 3PS9A 4OPDA 3UTHA 1ZDLA 5KXJA 2C67A 5C3JA 3QFAA 1PJ6A 4J2WA 1GSNA 2QA1A 1KNRA 2CVJA 1VQWA 2DKHA 2WQYA 3FIMB 3P4SA 3ZYXA 4YSYA 2BRYA 5BULA 4Z24A 1PBCA 5FS6A 4BK3A 5KVHA 3UKQA 1Q1WA 4PABA 4H2QA 2JK6A 4EMJA 2EQ6A 2QAEA 2R0PA 3AD8B 1YQ3A 3G5RA 1NPXA 2R4JA 2H89A 3S61A 3P1WA 3DGHA 3UKPA 1PBFA 3ALMA 1N4UA 1ZY8A 3VRBA 1EBDA 3T14A 1QJDA 3DJEA 2XFQA 4TM0A 4GRTA 3RNMA 5J7XA 2B7RA 4H4PA 1N4VA 3PVCA 2XLSA 1GRTA 1GREA 2JKCA 4II2A 3CGDA 1JRYA 2GAHB 5KRQA 1GTHA 1TDFA 2XCGA 3K7TA 3NIXA 4AOXA 2B9XA 3GYJA 1PBEA 2CULA 2Z5XA 2V3BA 2GB0A 1MOKA 2IVEA 2WU2A 4II3A 2OAMA 2JB3A 2WP6A 4OPIA 4TM3A 1DJNA 3O0HA 5JCIA 1CL0A 2BS4A 1Y56A 4A5LA 1CJ3A 3AEBA 3AE1A 2BCGG 4EIQA 3AEAA 2HQMA 3SX6A 3NK1X 4TLZA 1Q1RA 3NYEA 3EANA 3ATRA 2XVJA 3D9XA 1VRQB 4EMWA 1GNDA 2BK3A 3AE3A 2C64A 4D03A 2DKIA 4YTMA 4NEWA 3VRAA 2XVIA 1NG3A 1ZOYA 2FJEA 5CQFA 4UDRA 4U8PA 1TDOA 3C4NA 2H88A 5U1OA 1GTEA 4U8MA 3GD4A 3ZDNA 2C66A 3LZXA 4LU6A 1OJDA 2XFUA 1RYIA 3QSEA 2R0GA 3UOVA 1EL7A 3HYVA 1Q9IA 3BI4A 4GCMA 4YKGA 1O5WA 1GRAA 4WCTA 2C7GA 4NEVA 4HA6A 2GF3A 2Q0KA 3P4RA 2AR8A 4H7UA 4O5QA 3F8RA 2R9ZA 3B3RA 1F8RA 1BGJA 4JN9A 1M6IA 3AB1A 1KN0A 4NZHA 2GV8A 1JOAA 4APNA 1AOGA 5FMHA 3G5QA 3PO7A 4U8OA 3DK8A 3RP6A 2YVJA 4JNQA 1YQZA 4RG4A 4D04A 3K30A 3KLJA 1V59A 2IVDA 2WHDA 4A6NB 3NTAA 1B8SA 3B6DA 1NHSA 1H7WA 4H2PA 4FX9A 2C73A 3NRNA 3UTFA 4EQXA 1N4WA 2YLTA 2BA9A 5KWFA 4YSXA 1QLBA 1E39A 3UCLA 1XHCA 2YG5A 1LVLA 1FEBA 3DA1A 1CC2A 4G9KA 3HZLA 4C77A 4EM4A 3CGEA 3LJPA 3C96A 1CHUA 2GR2A 4K5RA 3ISHA 1TYPA 1Y0PA 4DNAA 3BI5A 3UKKA 3DH9A 1E7PA 4CCRA 5KMQA 1OJ9A 3AYLA 2VVMA 3CNDA 4ZCDA 3UTGA 2XLTA 4B67A 3CPJG 3QVRA 5U25A 2OALA 4Y4MA 5FS8A 3AECA 2A89A 1D7YA 3KD9A 4H4RA 5EOWA 3HYXA 1XDIA 2EQ9A 1B4VA 2XVEA 2OLOA 5BRTA 3DGZA 3K7QX 4JY3A 2YLSA 2BS2A 2YLRA 3QSMA 1NHRA 4B63A 2YR4A 4BV6A 1W4XA 4O5UA 3SZFA 4H4QA 4B65A 2RABA 3AEDA 5J60A 2PHHA 2NVKX 1H83A 2BXRA 5EB5A 2E5VA 4DSHA 4C3XA 2FJBA 2JAEA 5JCLA 1GESA 2JBVA 2WEUA 3AD9B 4K22A 2BCPA 1TDEA 2YLXA 3EF6A 2XFOA 4H2NA 4TM1A 2WP5A 4I58A 2FBWA 3NK0X 4GDPA 4J33A 3IF9A 4OPTA 5KMPA 1RSGA 2GEWA 4CNJA 1LPFA 4ZN0A 3SXIA 3VRDB 4EM3A 2YQUA 4J57A 1DNCA 1B5QA 1JU2A 3KA7A 4B66A 1D7LA 5IQ1A 4U2SA 3NNEA 4H4TA 4H4YA 1VDCA 2JB1A 2O9ZA 2Z5YA 4J31A 1NAAA 3CNPA 4NTCA 2VQ7A 2R46A 1NHPA 2V60A 4U8NA 5KMSA 1KF6A 3ABVA 4USRA 5BUKA 4AOSA 3CTYA 4H4WA 2CFYA 1NEKA 3BHFA 3UKAA 3OC4A 2APGA 2R45A 1PXCA 3AE8A 3NHOX 3KU9A 3SZ0A 4Z44A 4Z2UA 1TRBA 3T2YA 1L9DA 4UDQA 2FJAA 2BACA 3AYJA 3IHMA 4H4XA 5JCNA 1VG9A 2C4CA 4IA6A 4A9WA 2X50A 1NDAA 2XLUA 1PJ5A 3M12A 4LIIA 1PXAA 2B7SA 3CIRA 3D1CA 3CPHG 2BS3A 4H4UA 1D4DA 1NHQA 1OJTA 3GMBA 3NGCX 1L0VA 2OA1A 1K0IA 3P4QA 4PAAA 4OCGA 1DODA 1H7XA 1YKJA 1S3BA 1LV0A 3COXA 2WOIA 2VRLA 3P9UA 4BURA 2XFPA 2YG7A 2GRTA 3CNSA 2GR0A 3EAOA 3T31A 3FG2P 1JRXA 1OJAA 2V61A 3NTDA 2ZZ0A 3UOYA 2Q0LA 4YSHA 1ZK7A 3L8KA 3T2KA 1H6VA 5LV9A 1NENA 3ICRA 3QJ4A 3DJGX 1COYA 4BJZA 3REDA 3VR8A 5FS7A 4GAVA 3ITJA 2Q7VA 4Z2RA 3LADA 3UOZA 2X3NA 2AQJA 4LA1A 4A99A 2C76A 4XXGA 1UKVG 5JRBA 4GDEA 4U2LA 1YQ4A 1P2EA 1YY5A 4OPLA 1N1PA 4Z26A 2C3DA 1CBOA 3SZWA 1RP0A 1MO9A 2GQWA 1H82A 4GF7A 2W0HA 2QA2A 1JRZA 1O95A 4I59A 3GYIA 4FK1A 1ZMCA 1CJCA 5EB4A 2XVHA 1IUTA 3UOXA 2B9YA 2YM2A 2WPCA 2BXSA 2C3CA 1JNZA 3BHKA 2A8XA 5KNLA 2VOUA 2X8GA 1K0LA 5IQ4A 2GVCA 2R0CA 1GV4A 2E1MA 3Q9TA 2YWLA 3EPTA 3T2ZA 2ACZA 5KVIA 1XANA 1GETA 3GRTA 2WPFA 4AT0A 2RGOA 4JQ9A 4Y4LA 1BGNA 3K7MX 2YLWA 3AEFA 2EQ7A 1EL5A 2C72A 3BNUA 2FJDA 3WE0A 1CC4A 1IJHA 3C4AA 4H2RA 1KNPA 1S2YA 4TLXA 4B1BA 1GOSA 3Q6JA 4M52A 3P4PA 1PXBA 5BVAA 2YM1A 3G5SA 1B37A 1DJQA 1HYUA 3GYXA 4JDRA 2YG6A 4OVIA 4XWRA 5JCMA 1EL8A 3DK4A 1DXLA 4Z25A 1GPEA 3ATQA 2TPRA 2WETA 3ICSA 1JNRA 4G73A 3NN0X 4IVOB 3GWFA 1IUVA 3UP5A 3AE4A 1ZP0A 2X99A 1E1LA 4KX6A 4B69A 4NNJA 2B9WA 3SM8A 1K0JA 1BWCA 1H86A 3GDNA 1F8SA 3SFEA 3NT6A 4AT2A 1H84A 2QCUA 4H4ZA 2XLRA 3SY4A 1LJ1A 1GRFA 3F8DA 4UDPA 3H8IA 1GRBA 5HXIA 4X4JA 3DJJA 4AP3A 3NYCA 4A6NA 1O94A 4RG3A 1VG0A 4K5SA 1S7MA 3I6DA 2ARDA 1E6EA 3AE2A 4REKA 3BNMA 5FS9A 3AD7B 4AP1A 2A87A 3FMWA 4H4VA 3ALLA 1KDGA 1EL9A 3F8PA 3DK9A 4FK1C 4A65A 1GRHA 4A7AA 3M13A 5M10A 1Z6LA 3R9UA 4U8KA 3PG6A 4ADWA 1D5TA 1PBBA 1SEZA 2GMHA 3T0KA 3IHGA 1L9CA 3L1RA 1PN0A 3RP7A 1GXFA 1BZLA 2NPXA 2YR6A 3AWIA 4J56A 1K4QA 1CC6A 1TDNA 3QSSA 3RP8A 4IA5A 2WOWA 3QFBA 1GRGA 2BABA 2OLNA 2YR5A 4CRTA 4DSGA 4MJWA 1DOEA 1ELIA 2VQBA 3ADAB 4U8LA 3DJDA 3NK2X 2GR1A 4KPRA 2XLPA 1BKWA 1TDKA 2C70A 2ZBWA 4N9XA 2UZZA 1E1MA 4G6GA 3D8XA 4G6HA 1Y56B 4X9MA 5KMRA 1MXTA 1FECA 2EQ8A 2WDQA 3GMCA 3HYWA 2BRAA 2GMJA 2IIDA 2WDVA 3GSIA 3NLCA 3NYFA 2R4EA 3I3LA 2WPEA 3NKSA 5HY5A 2BC0A 3NN6X 1DOBA 2WU5A 1ZX9A 4HB9A 3V76A 4JNAA 4TM4A 5HYMA 2YLZA 1BF3A 1M64A 3KPFA 1FOHA 2Q6UA 3AE7A 4H4SA 5KOWA 1H81A 2RGJA 3T37A 3CNTA 4GUVA 4IVMB 1CJ2A 3JSKA 4GAPA 4OPCA 1LQTA 2TMDA 4YKFA 3CGCA 4Z43A 4J34A 2YG3A 5GSNA 2VZ2A 1P2HA 2WDRA 4GR1A 3FPZA 5DBJA 2V5ZA 1QO8A 4A79A 1S3EA 4CY6A 1PHHA 2GR3A 4U8JA 3VQRA 2VRMA 3SFDA 5L46A 4EQWA 2X8HA 3AE6A 1NG4A 2XDOA 1DOCA 3NH3X 5JCKA 2F5ZA 4BJYA 5U63A 1LTXR 2YVFA 3UKLA 4ZCCA 4K8DA 4NTEA 4YWOA 4USQA 1OJCA 1PS9A 3GWDA 3RHAA 2YG4A 1ZKQA 2I0ZA 5EBKA 2Y6QA 4G74A 3UP4A 3AEGA 3FBSA 1FL2A 1JEHA 5TR3A 2C65A 4C5OA 1GT8A 2ZZCA 2BK5A 4OPGA 2V3AA 2VVLG 4ECHA 1PJ7A 1ZOVA 4ICYA 1PDHA 3CMMA 5M0ZA 3UKFA 1CF3A 3AYIA 5CKUA 4OPUA 4U8IA 4FDCB 1GEUA 3II4A 4K7ZA 4EQRA 3OZ2A 2YAUA 1CJ4A 1D4EA 3E1TA 3IWAA 2CDUA 1GALA 3CPIG 3SQPA 3KVEA 1X31B 3CGBA 2X8CA 3KKJA 3UTEA 5HHFA 3QVPA 4YTPA 2XVFA 1F3PA 3CNJA 3SZCA 4CNKA 1LQUA 1FEAA 2C75A 3LXDA 2WBAA 2ZZBA 2GAGB 3SYIA 4YT0A 2VVLA 2WOVA 5ER0A 1IUXA 1L9EA 4JY2A 1S2QA 3GDPA 3V3NA 1E1NA 4CY8A 4YSZA 2V6OA 4YXDA 4UP3A 2BC1A 1F6MA 4BK2A 1TYTA 4Y4NA 2RGHA 4DGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NG7 X;  4RSL A;  3ICT A;  3V3O A;  4CBQ A;  3S5W A;  1KSU A;  4X9N A;  4J36 A;  4EQS A;  1E1K A;  5IPY A;  4C74 A;  3AXB A;  1IUS A;  3M0O A;  2XFN A;  3AEE A;  2AAQ A;  1KFY A;  2PYX A;  1F8W A;  2Y6R A;  2YVG A;  3DME A;  3UKH A;  1FCD A;  2GQF A;  4B68 A;  4H50 A;  2XYO A;  3VR9 A;  5GRT A;  3LB8 A;  1D4C A;  2BYB A;  4XWZ A;  1ONF A;  3SGL A;  1ZMD A;  1IUW A;  4E0V A;  1KSS A;  4U2T A;  3GRS A;  4EIP A;  5KOX A;  2WS3 A;  2WES A;  3ALJ A;  3AE5 A;  3H4K A;  3AE9 A;  4Z2T A;  2J3N A;  2B76 A;  4NTD A;  4P9S A;  2BK4 A;  2E4G A;  4BK1 A;  1XPQ A;  5C2T A;  3LOV A;  3CN8 A;  1REO A;  4K2X A;  2WP9 A;  2GH5 A;  3BI2 A;  3H8L A;  2JB2 A;  3LZW A;  4YTN A;  3GD3 A;  4C3Y A;  1IUU A;  4WX1 A;  1GER A;  3IC9 A;  4CCQ A;  4IV9 A;  1PBD A;  4EMI A;  4B64 A;  3URH A;  3PS9 A;  4OPD A;  3UTH A;  1ZDL A;  5KXJ A;  2C67 A;  5C3J A;  3QFA A;  1PJ6 A;  4J2W A;  1GSN A;  2QA1 A;  1KNR A;  2CVJ A;  1VQW A;  2DKH A;  2WQY A;  3FIM B;  3P4S A;  3ZYX A;  4YSY A;  5BUL A;  4Z24 A;  1PBC A;  5FS6 A;  4BK3 A;  5KVH A;  3UKQ A;  1Q1W A;  4PAB A;  4H2Q A;  2JK6 A;  4EMJ A;  2EQ6 A;  2QAE A;  2R0P A;  3AD8 B;  1YQ3 A;  3G5R A;  1NPX A;  2R4J A;  2H89 A;  3S61 A;  3P1W A;  3DGH A;  3UKP A;  1PBF A;  3ALM A;  1N4U A;  1ZY8 A;  3VRB A;  1EBD A;  1QJD A;  3DJE A;  2XFQ A;  4TM0 A;  4GRT A;  3RNM A;  5J7X A;  2B7R A;  4H4P A;  1N4V A;  3PVC A;  2XLS A;  1GRT A;  1GRE A;  2JKC A;  3CGD A;  1JRY A;  2GAH B;  5KRQ A;  1GTH A;  1TDF A;  2XCG A;  3K7T A;  3NIX A;  4AOX A;  2B9X A;  3GYJ A;  1PBE A;  2CUL A;  2Z5X A;  2GB0 A;  2V3B A;  1MOK A;  2IVE A;  2WU2 A;  2OAM A;  2JB3 A;  2WP6 A;  4OPI A;  4TM3 A;  1DJN A;  3O0H A;  5JCI A;  1CL0 A;  2BS4 A;  1Y56 A;  4A5L A;  1CJ3 A;  3AEB A;  3AE1 A;  2BCG G;  4EIQ A;  3AEA A;  2HQM A;  3NK1 X;  4TLZ A;  1Q1R A;  3NYE A;  3EAN A;  3ATR A;  2XVJ A;  1VRQ B;  4EMW A;  1GND A;  2BK3 A;  3AE3 A;  2C64 A;  4D03 A;  2DKI A;  4YTM A;  4NEW A;  3VRA A;  2XVI A;  1NG3 A;  1ZOY A;  2FJE A;  5CQF A;  4UDR A;  4U8P A;  1TDO A;  3C4N A;  2H88 A;  5U1O A;  1GTE A;  4U8M A;  3GD4 A;  3ZDN A;  2C66 A;  3LZX A;  4LU6 A;  1OJD A;  2XFU A;  1RYI A;  3QSE A;  2R0G A;  3UOV A;  1EL7 A;  4GCM A;  1Q9I A;  3BI4 A;  4YKG A;  1O5W A;  1GRA A;  4WCT A;  2C7G A;  4NEV A;  4HA6 A;  2GF3 A;  2Q0K A;  3P4R A;  2AR8 A;  4H7U A;  4O5Q A;  3F8R A;  2R9Z A;  3B3R A;  1F8R A;  1BGJ A;  4JN9 A;  1M6I A;  3AB1 A;  4NZH A;  2GV8 A;  1JOA A;  4APN A;  1AOG A;  5FMH A;  3G5Q A;  3PO7 A;  4U8O A;  3DK8 A;  3RP6 A;  2YVJ A;  4JNQ A;  1YQZ A;  4RG4 A;  4D04 A;  3K30 A;  3KLJ A;  1V59 A;  2IVD A;  2WHD A;  4A6N B;  3NTA A;  1B8S A;  3B6D A;  1NHS A;  1H7W A;  4H2P A;  4FX9 A;  2C73 A;  3NRN A;  3UTF A;  4EQX A;  1N4W A;  2YLT A;  2BA9 A;  5KWF A;  4YSX A;  1QLB A;  1E39 A;  3UCL A;  1XHC A;  2YG5 A;  1LVL A;  1FEB A;  3DA1 A;  1CC2 A;  3HZL A;  4C77 A;  4EM4 A;  3CGE A;  3LJP A;  3C96 A;  1CHU A;  2GR2 A;  4K5R A;  3ISH A;  1TYP A;  1Y0P A;  4DNA A;  3BI5 A;  3UKK A;  3DH9 A;  1E7P A;  4CCR A;  1OJ9 A;  3AYL A;  2VVM A;  3CND A;  4ZCD A;  3UTG A;  2XLT A;  4B67 A;  3CPJ G;  3QVR A;  5U25 A;  2OAL A;  4Y4M A;  5FS8 A;  3AEC A;  2A89 A;  1D7Y A;  3KD9 A;  4H4R A;  5EOW A;  1XDI A;  2EQ9 A;  1B4V A;  2XVE A;  2OLO A;  5BRT A;  3DGZ A;  3K7Q X;  4JY3 A;  2YLS A;  2BS2 A;  2YLR A;  3QSM A;  1NHR A;  4B63 A;  2YR4 A;  4BV6 A;  1W4X A;  4O5U A;  4H4Q A;  4B65 A;  2RAB A;  3AED A;  5J60 A;  2PHH A;  2NVK X;  1H83 A;  2BXR A;  5EB5 A;  2E5V A;  4DSH A;  4C3X A;  2FJB A;  2JAE A;  5JCL A;  1GES A;  2JBV A;  2WEU A;  3AD9 B;  4K22 A;  2BCP A;  1TDE A;  2YLX A;  3EF6 A;  2XFO A;  4H2N A;  4TM1 A;  2WP5 A;  4I58 A;  2FBW A;  3NK0 X;  4GDP A;  4J33 A;  3IF9 A;  4OPT A;  1RSG A;  2GEW A;  4CNJ A;  1LPF A;  4ZN0 A;  3VRD B;  4EM3 A;  2YQU A;  4J57 A;  1DNC A;  1B5Q A;  1JU2 A;  3KA7 A;  4B66 A;  1D7L A;  5IQ1 A;  4U2S A;  3NNE A;  4H4T A;  4H4Y A;  1VDC A;  2JB1 A;  2O9Z A;  2Z5Y A;  4J31 A;  1NAA A;  3CNP A;  4NTC A;  2VQ7 A;  2R46 A;  1NHP A;  2V60 A;  4U8N A;  1KF6 A;  3ABV A;  4USR A;  5BUK A;  4AOS A;  3CTY A;  4H4W A;  2CFY A;  1NEK A;  3BHF A;  3UKA A;  3OC4 A;  2APG A;  2R45 A;  1PXC A;  3AE8 A;  3NHO X;  3KU9 A;  4Z44 A;  4Z2U A;  1TRB A;  1L9D A;  4UDQ A;  2FJA A;  2BAC A;  3AYJ A;  3IHM A;  4H4X A;  5JCN A;  1VG9 A;  4IA6 A;  4A9W A;  2X50 A;  1NDA A;  2XLU A;  1PJ5 A;  3M12 A;  4LII A;  1PXA A;  2B7S A;  3CIR A;  3D1C A;  3CPH G;  2BS3 A;  4H4U A;  1D4D A;  1NHQ A;  1OJT A;  3GMB A;  3NGC X;  1L0V A;  2OA1 A;  1K0I A;  3P4Q A;  4PAA A;  4OCG A;  1DOD A;  1H7X A;  1YKJ A;  1S3B A;  1LV0 A;  3COX A;  2WOI A;  2VRL A;  3P9U A;  4BUR A;  2XFP A;  2YG7 A;  2GRT A;  3CNS A;  2GR0 A;  3EAO A;  3FG2 P;  1JRX A;  1OJA A;  2V61 A;  3NTD A;  2ZZ0 A;  3UOY A;  2Q0L A;  4YSH A;  1ZK7 A;  3L8K A;  1H6V A;  5LV9 A;  1NEN A;  3ICR A;  3QJ4 A;  3DJG X;  1COY A;  4BJZ A;  3RED A;  3VR8 A;  5FS7 A;  3ITJ A;  2Q7V A;  4Z2R A;  3LAD A;  3UOZ A;  2X3N A;  2AQJ A;  4LA1 A;  4A99 A;  2C76 A;  4XXG A;  1UKV G;  4GDE A;  4U2L A;  1YQ4 A;  1P2E A;  1YY5 A;  4OPL A;  1N1P A;  4Z26 A;  2C3D A;  1CBO A;  1RP0 A;  1MO9 A;  2GQW A;  1H82 A;  4GF7 A;  2W0H A;  2QA2 A;  1JRZ A;  1O95 A;  4I59 A;  3GYI A;  4FK1 A;  1ZMC A;  1CJC A;  5EB4 A;  2XVH A;  1IUT A;  3UOX A;  2B9Y A;  2YM2 A;  2WPC A;  2BXS A;  2C3C A;  1JNZ A;  3BHK A;  2A8X A;  2VOU A;  2X8G A;  1K0L A;  5IQ4 A;  2GVC A;  2R0C A;  1GV4 A;  2E1M A;  3Q9T A;  2YWL A;  3EPT A;  2ACZ A;  5KVI A;  1XAN A;  1GET A;  3GRT A;  2WPF A;  4AT0 A;  2RGO A;  4JQ9 A;  4Y4L A;  1BGN A;  3K7M X;  2YLW A;  3AEF A;  2EQ7 A;  1EL5 A;  2C72 A;  3BNU A;  2FJD A;  3WE0 A;  1CC4 A;  1IJH A;  3C4A A;  4H2R A;  1KNP A;  1S2Y A;  4TLX A;  4B1B A;  1GOS A;  3Q6J A;  4M52 A;  3P4P A;  1PXB A;  5BVA A;  2YM1 A;  3G5S A;  1B37 A;  1DJQ A;  1HYU A;  4OVI A;  4JDR A;  2YG6 A;  4XWR A;  5JCM A;  1EL8 A;  3DK4 A;  1DXL A;  4Z25 A;  1GPE A;  3ATQ A;  2TPR A;  2WET A;  3ICS A;  1JNR A;  3NN0 X;  4IVO B;  3GWF A;  1IUV A;  3UP5 A;  3AE4 A;  1ZP0 A;  2X99 A;  1E1L A;  4KX6 A;  4B69 A;  2B9W A;  3SM8 A;  1K0J A;  1BWC A;  1H86 A;  3GDN A;  1F8S A;  3SFE A;  3NT6 A;  4AT2 A;  1H84 A;  2QCU A;  4H4Z A;  2XLR A;  1LJ1 A;  1GRF A;  3F8D A;  4UDP A;  3H8I A;  1GRB A;  5HXI A;  4X4J A;  3DJJ A;  4AP3 A;  3NYC A;  4A6N A;  1O94 A;  4RG3 A;  1VG0 A;  4K5S A;  3I6D A;  4REK A;  2ARD A;  1E6E A;  3AE2 A;  3BNM A;  5FS9 A;  3AD7 B;  4AP1 A;  2A87 A;  3FMW A;  4H4V A;  3ALL A;  1KDG A;  1EL9 A;  3F8P A;  3DK9 A;  4FK1 C;  4A65 A;  1GRH A;  4A7A A;  3M13 A;  5M10 A;  1Z6L A;  3R9U A;  4U8K A;  4ADW A;  1D5T A;  1PBB A;  1SEZ A;  2GMH A;  3IHG A;  1L9C A;  3L1R A;  1PN0 A;  3RP7 A;  1GXF A;  1BZL A;  2NPX A;  2YR6 A;  3AWI A;  4J56 A;  1K4Q A;  1CC6 A;  1TDN A;  3QSS A;  3RP8 A;  4IA5 A;  2WOW A;  3QFB A;  1GRG A;  2BAB A;  2OLN A;  2YR5 A;  4CRT A;  4DSG A;  4MJW A;  1DOE A;  1ELI A;  2VQB A;  3ADA B;  4U8L A;  3DJD A;  3NK2 X;  2GR1 A;  4KPR A;  2XLP A;  1BKW A;  1TDK A;  2C70 A;  2ZBW A;  4N9X A;  2UZZ A;  1E1M A;  3D8X A;  1Y56 B;  4X9M A;  1MXT A;  1FEC A;  2EQ8 A;  2WDQ A;  3GMC A;  2IID A;  2GMJ A;  2WDV A;  3GSI A;  3NLC A;  3NYF A;  2R4E A;  3I3L A;  2WPE A;  3NKS A;  5HY5 A;  2BC0 A;  3NN6 X;  1DOB A;  2WU5 A;  1ZX9 A;  4HB9 A;  3V76 A;  4JNA A;  4TM4 A;  5HYM A;  2YLZ A;  1BF3 A;  1M64 A;  3KPF A;  1FOH A;  2Q6U A;  3AE7 A;  4H4S A;  5KOW A;  1H81 A;  2RGJ A;  3T37 A;  3CNT A;  4GUV A;  4IVM B;  1CJ2 A;  3JSK A;  4OPC A;  1LQT A;  2TMD A;  4YKF A;  3CGC A;  4Z43 A;  4J34 A;  2YG3 A;  5GSN A;  2VZ2 A;  1P2H A;  2WDR A;  4GR1 A;  3FPZ A;  5DBJ A;  2V5Z A;  1QO8 A;  4A79 A;  1S3E A;  4CY6 A;  1PHH A;  2GR3 A;  4U8J A;  3VQR A;  2VRM A;  3SFD A;  5L46 A;  4EQW A;  2X8H A;  3AE6 A;  1NG4 A;  2XDO A;  1DOC A;  3NH3 X;  5JCK A;  2F5Z A;  4BJY A;  5U63 A;  1LTX R;  2YVF A;  3UKL A;  4ZCC A;  4K8D A;  4NTE A;  4YWO A;  4USQ A;  1OJC A;  1PS9 A;  3GWD A;  3RHA A;  2YG4 A;  1ZKQ A;  2I0Z A;  5EBK A;  2Y6Q A;  3UP4 A;  3AEG A;  3FBS A;  1FL2 A;  1JEH A;  5TR3 A;  2C65 A;  4C5O A;  1GT8 A;  2ZZC A;  2BK5 A;  4OPG A;  2V3A A;  2VVL G;  4ECH A;  1PJ7 A;  1ZOV A;  4ICY A;  1PDH A;  5M0Z A;  3UKF A;  1CF3 A;  3AYI A;  5CKU A;  4OPU A;  4U8I A;  4FDC B;  1GEU A;  3II4 A;  4K7Z A;  4EQR A;  3OZ2 A;  2YAU A;  1CJ4 A;  1D4E A;  3E1T A;  3IWA A;  2CDU A;  1GAL A;  3CPI G;  3SQP A;  3KVE A;  1X31 B;  3CGB A;  2X8C A;  3KKJ A;  3UTE A;  5HHF A;  3QVP A;  4YTP A;  2XVF A;  1F3P A;  3CNJ A;  4CNK A;  1LQU A;  1FEA A;  2C75 A;  3LXD A;  2WBA A;  2ZZB A;  2GAG B;  4YT0 A;  2VVL A;  2WOV A;  5ER0 A;  1IUX A;  1L9E A;  4JY2 A;  1S2Q A;  3GDP A;  3V3N A;  1E1N A;  4CY8 A;  4YSZ A;  2V6O A;  4YXD A;  4UP3 A;  2BC1 A;  1F6M A;  4BK2 A;  1TYT A;  4Y4N A;  2RGH A;  4DGK A; 
#chains in the Genus database with same CATH topology
 2NQL A;  3V3O A;  3DIP A;  4X9N A;  4EQS A;  4C74 A;  3M0O A;  2XFN A;  1KFY A;  3L5O A;  2OQY A;  2YVG A;  3DME A;  3UKH A;  2GQF A;  4H50 A;  4CY6 A;  2GGG A;  1IUW A;  3SN1 A;  4EIP A;  5KOX A;  2WS3 A;  3AE5 A;  4Z2T A;  2J3N A;  5C2T A;  3CN8 A;  1VDV A;  2JB2 A;  4ZA0 A;  4NWZ A;  3URH A;  3PS9 A;  3DGB A;  4IZG A;  4A6G A;  5IPY A;  1KNR A;  2WQY A;  2OZ8 A;  4Z24 A;  1Q1W A;  4H2Q A;  1JRO A;  2JK6 A;  3AD8 B;  3PWI A;  3G5R A;  3NXL A;  3ALM A;  2AL2 B;  3T14 A;  3AN1 A;  3RNM A;  1JRY A;  4M0X A;  2HNE A;  4DWD A;  1GTH A;  1TDF A;  2XCG A;  3NIX A;  2XGZ A;  2B9X A;  5EU9 A;  4II3 A;  4OPI A;  3AEB A;  4EIQ A;  3AEA A;  2QJM A;  4TLZ A;  2GGH A;  2DKI A;  3GY1 A;  1ZOY A;  3VA8 A;  5U1O A;  3ZDN A;  2C66 A;  2XFU A;  1RYI A;  3QSE A;  3T9P A;  4GCM A;  4YKG A;  4H19 A;  1GRA A;  2OQH A;  2C7G A;  4HA6 A;  2GF3 A;  4J3Z A;  4JN9 A;  1AOG A;  3G5Q A;  3DK8 A;  4JNQ A;  5G5G B;  4RG4 A;  3K30 A;  1V59 A;  3MUC A;  2WHD A;  4FX9 A;  2C73 A;  3NRN A;  1N4W A;  2YLT A;  2BA9 A;  1FEB A;  3DA1 A;  3SBF A;  4C77 A;  3C96 A;  1CHU A;  2GR2 A;  4K5R A;  4DNA A;  3BI5 A;  3DH9 A;  1E7P A;  3DG6 A;  5IDZ A;  5KMQ A;  1OJ9 A;  4E6M A;  4DN1 A;  2A89 A;  3KD9 A;  4JN8 A;  1FO4 A;  2OLO A;  3RCY A;  3DGZ A;  2YLS A;  3QSM A;  1DTN A;  1NHR A;  1W4X A;  2RAB A;  3AED A;  2BXR A;  1ELS A;  4JN7 A;  4Z17 A;  3HW2 A;  2JAE A;  2WEU A;  2GL5 A;  2BCP A;  1TDE A;  2YLX A;  2XFO A;  4I58 A;  2FBW A;  3TCS A;  1LPF A;  1JU2 A;  4U2S A;  2JB1 A;  2Z5Y A;  4NTC A;  1NHP A;  5KMS A;  3ABV A;  2CFY A;  2APG A;  3SZ0 A;  3AE8 A;  3KU9 A;  4Z44 A;  3IHM A;  1VG9 A;  2XLU A;  1PXA A;  3CPH G;  1NHQ A;  1OJT A;  2AL2 A;  1L0V A;  4PAA A;  3P4Q A;  4OCG A;  1EC9 A;  3COX A;  2VRL A;  4A3R A;  2YG7 A;  2GR0 A;  3NTD A;  2ZZ0 A;  2GDQ A;  3L8K A;  3T2K A;  1H6V A;  3SQS A;  5FS7 A;  2AQJ A;  1TZZ A;  5JRB A;  4GDE A;  2CHR A;  3SZW A;  2GQW A;  1H82 A;  4GF7 A;  2QA2 A;  1O95 A;  4I59 A;  4FI4 A;  2WPC A;  4HPN A;  2A8X A;  2VOU A;  7ENL A;  3V5C A;  5IQ4 A;  2E1M A;  2ACZ A;  5KVI A;  3GRT A;  4AT0 A;  2YLW A;  2EQ7 A;  2OLA A;  1EL5 A;  3WE0 A;  1CC4 A;  4K8G A;  3R0U A;  3S5S A;  1GOS A;  3I6E A;  2YM1 A;  4E5T A;  3CK5 A;  2YG6 A;  3DK4 A;  3TJ4 A;  3ATQ A;  2WET A;  3ICS A;  3UP5 A;  3AE4 A;  1E1L A;  4KX6 A;  3GDN A;  1F8S A;  3SFE A;  2QCU A;  1GRF A;  2QQ6 A;  1GRB A;  5HXI A;  3TTE A;  4AP3 A;  3N4F A;  3UXK A;  1VG0 A;  4K5S A;  3ES8 A;  4AP1 A;  3FMW A;  5M10 A;  3BOX A;  1PBB A;  3RP7 A;  2PTW A;  1K4Q A;  1ZXI C;  3VCC A;  1CC6 A;  1TDN A;  4MKS A;  2GGJ A;  2GR1 A;  2QGY A;  1BKW A;  5FJT A;  2C70 A;  2UZZ A;  3D8X A;  3GMC A;  1FEC A;  3HYW A;  3NLC A;  1XPY A;  2WDV A;  3CXO A;  3GSI A;  3NYF A;  3NFU A;  3SSZ A;  2WPE A;  2BC0 A;  2P3Z A;  4HCH A;  4HB9 A;  3V76 A;  4JNA A;  2YLZ A;  1BF3 A;  1M64 A;  3SR6 B;  3Q4D A;  2GGE A;  5GSN A;  2VZ2 A;  3FPZ A;  1QO8 A;  1S3E A;  1PHH A;  2GR3 A;  3UJ2 A;  3VQR A;  3SFD A;  2X8H A;  3AE6 A;  4GIS A;  2F5Z A;  1LTX R;  4ZCC A;  3RHA A;  3GWD A;  3IJQ A;  5TR3 A;  1W6T A;  1JRP A;  3OZM A;  2ZZC A;  2VVL G;  3UJF A;  1PJ7 A;  3THU A;  4IP5 A;  3UKF A;  3AYI A;  4OPU A;  4FDC B;  1GEU A;  2CDU A;  1GAL A;  1FFU C;  1L8P A;  1N60 C;  3CGB A;  1NU5 A;  1MNS A;  3KKJ A;  4YTP A;  3MY9 A;  1LQU A;  2GAG B;  3LXD A;  3SYI A;  2VVL A;  3TW9 A;  3UGV A;  4YXD A;  1E1N A;  3PFR A;  3NG7 X;  4RSL A;  3AXB A;  2I5Q A;  3AEE A;  2AAQ A;  2Y6R A;  1F8W A;  4B68 A;  1D4C A;  3LB8 A;  3UJR A;  3UJE A;  1ZMD A;  3ALJ A;  3H4K A;  2QJN A;  3AE9 A;  4P9S A;  3KPK A;  2HZG A;  2BK4 A;  2E4G A;  2AKM A;  4BK1 A;  1XPQ A;  1JCT A;  4K2X A;  2GH5 A;  4YTN A;  4C3Y A;  4EMI A;  3P93 A;  4OPD A;  1ZDL A;  5C3J A;  3QFA A;  4YWS A;  4PAB A;  2EQ6 A;  3P1W A;  3DGH A;  1ZY8 A;  3VRB A;  3QLD A;  2XFQ A;  4TM0 A;  4GRT A;  2B7R A;  4H4P A;  1N4V A;  3CGD A;  2GAH B;  3GO2 A;  3PK7 A;  4AOX A;  2V3B A;  2GB0 A;  3A7A A;  2IVE A;  2OZT A;  2JB3 A;  2WP6 A;  3CB3 A;  3O0H A;  1Y56 A;  1CJ3 A;  3AE1 A;  2BCG G;  3DDM A;  2P88 A;  2HQM A;  3NK1 X;  1Q1R A;  3H7V A;  3EAN A;  1FHV A;  2XVJ A;  1VRQ B;  2BK3 A;  4NEW A;  4ROP A;  1NG3 A;  5CQF A;  3NS1 B;  4UDR A;  2H88 A;  3GD4 A;  3LZX A;  2RDX A;  1OJD A;  1EL7 A;  1Q9I A;  3BI4 A;  2QDE A;  4NEV A;  2AR8 A;  3F8R A;  2GV8 A;  4U8O A;  2YVJ A;  1YQZ A;  4D04 A;  3NTA A;  1B8S A;  1NHS A;  1H7W A;  3UTF A;  1QLB A;  3UCL A;  2YG5 A;  1LVL A;  3KUM A;  5ENL A;  1ECQ A;  2VVM A;  2XLT A;  3V5F A;  2OAL A;  3EKG A;  1XDI A;  2EQ9 A;  2XVE A;  3K7Q X;  3AMZ A;  4B63 A;  2YR4 A;  4BV6 A;  4M6U A;  4H4Q A;  5J60 A;  2PHH A;  1H83 A;  5G5H B;  5EB5 A;  2E5V A;  1GES A;  4H2N A;  4IP4 A;  3NK0 X;  4OPT A;  1SJD A;  2W54 A;  1RSG A;  4CNJ A;  3OPS A;  3SXI A;  3VRD B;  2YQU A;  1DNC A;  1B5Q A;  4J31 A;  4H4T A;  1NAA A;  2VQ7 A;  2V60 A;  1KF6 A;  4H2H A;  4AOS A;  3CTY A;  3OC4 A;  2E3T A;  2PP3 A;  3DFH A;  1L9D A;  4UDQ A;  4H4X A;  4ENL A;  4A9W A;  3M12 A;  4LII A;  3GMB A;  3NGC X;  1H7X A;  4MMW A;  2WOI A;  3P9U A;  4BUR A;  4DHG A;  2GRT A;  3EAO A;  3T31 A;  1JRX A;  4YSH A;  3R1Z A;  3D47 A;  3DJG X;  1COY A;  4GAV A;  4Z2R A;  3LAD A;  2QDD A;  4OPL A;  1RM6 B;  1PDZ A;  2BXS A;  1JNZ A;  3I6T A;  3Q9T A;  3EPT A;  3T2Z A;  1BGN A;  4H2R A;  1KNP A;  4TLX A;  4B1B A;  3N4E A;  1HYU A;  4OVI A;  1EL8 A;  3RRA A;  2XH7 A;  4HNL A;  2B9W A;  1BWC A;  3BSM A;  1H84 A;  1LJ1 A;  4X4J A;  1O94 A;  3P3B A;  4GYP C;  3RIT A;  4REK A;  2OVL A;  5FS9 A;  1KDG A;  3F8P A;  3MWC A;  3DK9 A;  4A65 A;  1GRH A;  3ZVI A;  1Z6L A;  3PG6 A;  4ADW A;  4E4U A;  3IHG A;  1L9C A;  3L1R A;  2PTX A;  2NPX A;  3AWI A;  4J56 A;  3RP8 A;  4IA5 A;  2YR5 A;  4DSG A;  2PMQ A;  4U8L A;  1YEY A;  3DJD A;  4KPR A;  2PTZ A;  5KMR A;  4X9M A;  1MXT A;  2WDQ A;  4J1O A;  5HY5 A;  3NN6 X;  1DOB A;  4TM4 A;  1FOH A;  3AE7 A;  4H4S A;  4IL2 A;  2RGJ A;  2AKZ A;  4GUV A;  4IVM B;  1CJ2 A;  4A79 A;  2V5Z A;  4U8J A;  3FJ4 A;  4GYP A;  3NH3 X;  4A35 A;  4BJY A;  5U63 A;  3AM9 A;  4NTE A;  3T4W A;  2YG4 A;  3ZLH A;  2Y6Q A;  4G74 A;  1SB3 B;  3AEG A;  1FIQ B;  3QKE A;  3ENL A;  4OPG A;  2V3A A;  4KPL A;  3TWB A;  3NZG A;  1P48 A;  5M0Z A;  1R6W A;  5CKU A;  4U8I A;  4EQR A;  3IWA A;  1D4E A;  3CPI G;  3KVE A;  1X31 B;  3VC5 A;  3QVP A;  2XVF A;  3CNJ A;  3SJN A;  4CNK A;  2C75 A;  2ZZB A;  3V3N A;  3CT2 A;  1S2Q A;  4CY8 A;  4UP3 A;  3U9I A;  4BK2 A;  4Y4N A;  2RGH A;  4DX3 A;  3ICT A;  4J36 A;  1N5X A;  4HN8 A;  2PYX A;  1FCD A;  3FV9 A;  2XYO A;  3DG7 A;  4XWZ A;  2BYB A;  3SGL A;  1KSS A;  4U2T A;  3GRS A;  4GGH A;  3QTP A;  2B76 A;  5BOF A;  3LOV A;  1REO A;  2WP9 A;  3LZW A;  1IUU A;  3A7U A;  1PBD A;  3IK4 A;  4B64 A;  1MDL A;  3UTH A;  5KXJ A;  2C67 A;  3FVD A;  4J2W A;  4FP1 A;  1GSN A;  3ZYX A;  1N61 C;  2CVJ A;  2DKH A;  4YSY A;  5FS6 A;  4DYE A;  4BK3 A;  3UKQ A;  2PGW A;  2QAE A;  2R0P A;  1PBF A;  3ZLG A;  1N4U A;  1EBD A;  3Q45 A;  3PVC A;  2XLS A;  1GRT A;  1GRE A;  4GGB A;  2OX4 A;  4TVW A;  3R07 C;  1PBE A;  2CUL A;  2Z5X A;  3ZVH A;  2WU2 A;  2OAM A;  4TM3 A;  2BS4 A;  4A5L A;  2E5A A;  3UJS A;  2GSH A;  1N5W C;  3NYE A;  3ATR A;  4EMW A;  2C64 A;  1OEP A;  2HXU A;  3VRA A;  2XVI A;  3NVZ B;  5J04 A;  3BJS A;  1TDO A;  1GTE A;  4KT2 A;  3JZU A;  2R0G A;  2PSN A;  4WCT A;  1X2G A;  3P4R A;  4H7U A;  4K1W A;  2R9Z A;  1F8R A;  1BGJ A;  1M6I A;  4HCL A;  1KN0 A;  3K1G A;  2PGE A;  1JOA A;  1MRA A;  4APN A;  5FMH A;  5BUK A;  3KLJ A;  2IVD A;  4A6N B;  1PDY A;  3B6D A;  4EQX A;  2PCE A;  1N62 C;  1E39 A;  4DXK A;  3DEQ A;  1CC2 A;  4G9K A;  3ZLF A;  3LJP A;  5FJP A;  1TYP A;  3UKK A;  4GFI A;  3OP2 A;  4CCR A;  3CND A;  4ZCD A;  3R0K A;  2PP0 A;  3CPJ G;  3QVR A;  5FS8 A;  3AEC A;  1D7Y A;  5EOW A;  2OZ3 A;  1B4V A;  5BRT A;  4JY3 A;  4KWS A;  4O5U A;  3SZF A;  3H8A A;  3FXG A;  2NVK X;  2ZC8 A;  4DSH A;  4C3X A;  2FJB A;  5JCL A;  3AD9 B;  4K22 A;  2OKT A;  4GDP A;  4ZCW A;  3IF9 A;  4J33 A;  5KMP A;  2GEW A;  1VQZ A;  4ZN0 A;  4EM3 A;  4B66 A;  1D7L A;  5IQ1 A;  3MSY A;  3NNE A;  2O9Z A;  3N6H A;  4MGG A;  4H4W A;  1NEK A;  3BHF A;  4HCD A;  1PXC A;  3NHO X;  3RR1 A;  4Z2U A;  2FJA A;  2BAC A;  3AYJ A;  1SJA A;  5JCN A;  3S47 A;  2C4C A;  1JPM A;  4H4U A;  1D4D A;  2OA1 A;  1K0I A;  1DOD A;  1S3B A;  5BOE A;  2XFP A;  3CNS A;  1OJA A;  3UOY A;  5LV9 A;  3ICR A;  4BJZ A;  1BQG A;  3RED A;  3ITJ A;  3RGT A;  2Q7V A;  1FFV C;  3UOZ A;  3VFC A;  4U2L A;  1YQ4 A;  2W55 A;  1N1P A;  4Z26 A;  2C3D A;  1CBO A;  2OFJ A;  3SN0 A;  1MO9 A;  3MKC A;  3DFY A;  2XVH A;  3UOX A;  3CAW A;  4Z1Y A;  2C3C A;  4IL0 A;  3T8Q A;  2GVC A;  3TJI A;  1XAN A;  2RGO A;  3V4B A;  4Y4L A;  3FCP A;  3TWA A;  3K7M X;  3AEF A;  2C72 A;  3BNU A;  3C4A A;  1S2Y A;  2OPJ A;  4M52 A;  4GME A;  2MUC A;  1B37 A;  3GYX A;  4XWR A;  4Z25 A;  1E9I A;  2TPR A;  1JNR A;  4G73 A;  3NN0 X;  3GWF A;  3D46 A;  2X99 A;  4B69 A;  4NNJ A;  4IHC A;  1K0J A;  4AT2 A;  4H4Z A;  3F8D A;  4UDP A;  1KKO A;  4A6N A;  1S7M A;  3I6D A;  1E6E A;  3JW7 A;  3ALL A;  4U8K A;  1PN0 A;  1GXF A;  3VDG A;  2YR6 A;  2P8B A;  4TVY A;  2OLN A;  4CRT A;  3ADA B;  3NK2 X;  1R0M A;  3MZN A;  3STP A;  2EQ8 A;  2PA6 A;  2GMJ A;  3GC2 A;  2R4E A;  3NKS A;  1ZX9 A;  3R11 A;  5HYM A;  1JDF A;  2Q6U A;  1H81 A;  2OG9 A;  3CGC A;  4Z43 A;  3HPF A;  1P2H A;  4EQW A;  1NG4 A;  3TQP A;  2XDO A;  1DOC A;  1EBH A;  3P0W A;  2YVF A;  3UKL A;  4K8D A;  4YWO A;  4USQ A;  1F9C A;  2DW7 A;  1ZKQ A;  2I0Z A;  1TKK A;  3FBS A;  1FL2 A;  2C65 A;  2HXT A;  1GT8 A;  2BK5 A;  4ICY A;  1PDH A;  3T6C A;  1CF3 A;  3II4 A;  4K7Z A;  3OZ2 A;  2YAU A;  1CJ4 A;  3E1T A;  4E8G A;  2PTY A;  2POD A;  4ZOH B;  1WUE A;  3EUB 3;  5HHF A;  3SZC A;  3R25 A;  4YT0 A;  2WBA A;  2WOV A;  5ER0 A;  4JY2 A;  2P8C A;  4YSZ A;  1TYT A;  2P0I A;  4G8T A;  3UKA A;  4CBQ A;  3S5W A;  1KSU A;  1E1K A;  3UCD A;  4HNC A;  1IUS A;  1H2I A;  3VR9 A;  5GRT A;  4E0V A;  1ONF A;  1ONE A;  2WES A;  2FYM A;  4NTD A;  2OO6 A;  3VCN A;  3BI2 A;  3H8L A;  3GD3 A;  4WX1 A;  1GER A;  3IC9 A;  4CCQ A;  4IV9 A;  1X2H A;  2W3R A;  1PJ6 A;  2QA1 A;  3FIM B;  1VQW A;  3P4S A;  5BUL A;  2BRY A;  1PBC A;  2PU0 A;  5KVH A;  1IYX A;  3QPE A;  4EMJ A;  1YQ3 A;  1NPX A;  2R4J A;  3H70 A;  2H89 A;  3S61 A;  3UKP A;  2PU1 A;  1QJD A;  3DJE A;  3QN3 A;  5J7X A;  3ZVH B;  2JKC A;  4II2 A;  1SJC A;  5KRQ A;  3NVY B;  3CXB A;  3K7T A;  3EEZ A;  3GYJ A;  1MOK A;  2QVH A;  3NVV B;  1DJN A;  5JCI A;  1CL0 A;  2GGI A;  3SX6 A;  3MQT A;  3D9X A;  1GND A;  3AE3 A;  4D03 A;  4YTM A;  1V97 A;  1STZ A;  2FJE A;  1JPD X;  4U8P A;  3C4N A;  4U8M A;  1MUC A;  3A7R A;  3NVW B;  4LU6 A;  3UOV A;  3HYV A;  1O5W A;  2Q0K A;  4O5Q A;  3B3R A;  3AB1 A;  4NZH A;  4JHM A;  3GD6 A;  3PO7 A;  3RP6 A;  2XH4 A;  4H2P A;  4GIR A;  1KCZ A;  5KWF A;  4YSX A;  1XHC A;  3HZL A;  2DW6 A;  4EM4 A;  3NO1 A;  3CGE A;  1BKH A;  3ISH A;  4K2S A;  1N63 C;  1Y0P A;  3AYL A;  3UTG A;  1EC8 A;  4B67 A;  5U25 A;  4Y4M A;  4H4R A;  4HYR A;  3HYX A;  2YLR A;  2BS2 A;  1TE6 A;  1NEL A;  4B65 A;  4X2P A;  3U4F A;  1KKR A;  2FKP A;  2JBV A;  3DES A;  4TM1 A;  3EF6 A;  2WP5 A;  4J57 A;  3KA7 A;  1VDC A;  4H4Y A;  1XS2 A;  3CNP A;  2R46 A;  4U8N A;  2PPG A;  4USR A;  4EWJ A;  2R45 A;  1TRB A;  1EBG A;  3T2Y A;  3R10 A;  4IA6 A;  2X50 A;  1NDA A;  1PJ5 A;  2B7S A;  3CIR A;  3D1C A;  2BS3 A;  3B97 A;  1YKJ A;  1LV0 A;  2XH2 A;  3VC6 A;  4G7F A;  3FG2 P;  2V61 A;  3UCC A;  2Q0L A;  1ZK7 A;  3HRD C;  1NEN A;  3QJ4 A;  3VR8 A;  3RO6 A;  2X3N A;  4LA1 A;  4A99 A;  2C76 A;  4XXG A;  1UKV G;  1P2E A;  1EC7 A;  1YY5 A;  4E4F A;  1RP0 A;  2W0H A;  1JRZ A;  3GYI A;  4FK1 A;  1ZMC A;  1CJC A;  5EB4 A;  1IUT A;  2YM2 A;  2B9Y A;  4F4R A;  3BHK A;  2ONE A;  5KNL A;  2QJJ A;  2X8G A;  1K0L A;  2R0C A;  1GV4 A;  2YWL A;  1FHU A;  1GET A;  2WPF A;  2PS2 A;  4JQ9 A;  3N6J A;  2FJD A;  1IJH A;  1WYG A;  3Q6J A;  3P4P A;  1PXB A;  5BVA A;  3G5S A;  1DJQ A;  4JDR A;  5JCM A;  1DXL A;  1GPE A;  4IVO B;  4KEM A;  1IUV A;  1ZP0 A;  2XSX A;  2AL1 A;  3SM8 A;  1H86 A;  3NT6 A;  3SY4 A;  2XLR A;  3H8I A;  3OTR A;  3DJJ A;  3NYC A;  4RG3 A;  2ARD A;  3AE2 A;  3UXL A;  3BNM A;  3H12 A;  3AD7 B;  1KD0 A;  2A87 A;  4H4V A;  1SJB A;  1EL9 A;  4FK1 C;  4A7A A;  4H1Z A;  3M13 A;  3V3W A;  3R9U A;  3DG3 A;  1D5T A;  1SEZ A;  2GMH A;  3T0K A;  3JVA A;  1BZL A;  3QSS A;  1P43 A;  5FJR A;  2WOW A;  5FJO A;  3QFB A;  1GRG A;  2BAB A;  3NRZ B;  5FJU A;  4MJW A;  1DOE A;  1ELI A;  2VQB A;  2XLP A;  2ZAD A;  1TDK A;  2ZBW A;  4N9X A;  1E1M A;  2XH0 A;  4G6G A;  4G6H A;  1Y56 B;  2W3S A;  3PWG A;  2BRA A;  3IJL A;  2IID A;  6ENL A;  3I3L A;  2WU5 A;  3KPF A;  5KOW A;  3T37 A;  3CNT A;  4IT1 A;  1RVK A;  3JSK A;  4GAP A;  4OPC A;  1LQT A;  2TMD A;  4YKF A;  4J34 A;  2YG3 A;  5DBJ A;  2WDR A;  4GR1 A;  3OW1 A;  2O56 A;  3I4K A;  2VRM A;  5L46 A;  3TOY A;  5JCK A;  2MNR A;  2PP1 A;  1OJC A;  1PS9 A;  3ES7 A;  3IJI A;  3OZY A;  5EBK A;  3UP4 A;  3ETR B;  1WUF A;  1JEH A;  4C5O A;  3SN4 A;  3CYJ A;  4ECH A;  1ZOV A;  3FYY A;  3CMM A;  4H83 A;  1T3Q C;  3DER A;  1MDR A;  2POZ A;  3SQP A;  3B9J B;  2X8C A;  3UTE A;  1F3P A;  1FEA A;  1IUX A;  1L9E A;  3GDP A;  2V6O A;  2BC1 A;  1F6M A;  4DGK A; 
#chains in the Genus database with same CATH homology
 3NG7 X;  4RSL A;  3ICT A;  3V3O A;  4CBQ A;  3S5W A;  1KSU A;  4X9N A;  4J36 A;  4EQS A;  1E1K A;  5IPY A;  4C74 A;  3AXB A;  1IUS A;  1H2I A;  3M0O A;  2XFN A;  3AEE A;  2AAQ A;  3L5O A;  1KFY A;  1F8W A;  2PYX A;  2YVG A;  2Y6R A;  3DME A;  3UKH A;  1FCD A;  2GQF A;  4B68 A;  4H50 A;  2XYO A;  3VR9 A;  5GRT A;  3LB8 A;  1D4C A;  2BYB A;  4XWZ A;  1ONF A;  3SGL A;  1ZMD A;  1IUW A;  4E0V A;  1KSS A;  4U2T A;  3GRS A;  4EIP A;  5KOX A;  2WS3 A;  2WES A;  3ALJ A;  3AE5 A;  3H4K A;  3AE9 A;  4Z2T A;  2J3N A;  2B76 A;  4NTD A;  3KPK A;  2BK4 A;  4P9S A;  2E4G A;  4BK1 A;  1XPQ A;  5C2T A;  3LOV A;  3CN8 A;  1REO A;  4K2X A;  2WP9 A;  2GH5 A;  3BI2 A;  3H8L A;  2JB2 A;  3LZW A;  4YTN A;  3GD3 A;  4C3Y A;  1IUU A;  4WX1 A;  1GER A;  3IC9 A;  4CCQ A;  4IV9 A;  1PBD A;  4EMI A;  4NWZ A;  4B64 A;  3URH A;  3PS9 A;  4OPD A;  3UTH A;  1ZDL A;  5KXJ A;  2C67 A;  5C3J A;  3QFA A;  1PJ6 A;  4J2W A;  1GSN A;  2QA1 A;  1KNR A;  2CVJ A;  1VQW A;  2DKH A;  2WQY A;  3FIM B;  3P4S A;  3ZYX A;  4YSY A;  2BRY A;  5BUL A;  4Z24 A;  1PBC A;  5FS6 A;  4BK3 A;  5KVH A;  3UKQ A;  1Q1W A;  4PAB A;  4H2Q A;  2JK6 A;  4EMJ A;  2EQ6 A;  2QAE A;  2R0P A;  3AD8 B;  1YQ3 A;  3G5R A;  1NPX A;  2R4J A;  2H89 A;  3S61 A;  3P1W A;  3DGH A;  3UKP A;  1PBF A;  3ALM A;  1N4U A;  1ZY8 A;  3VRB A;  1EBD A;  3T14 A;  1QJD A;  3DJE A;  2XFQ A;  4TM0 A;  4GRT A;  3RNM A;  5J7X A;  2B7R A;  4H4P A;  1N4V A;  3PVC A;  2XLS A;  1GRT A;  1GRE A;  2JKC A;  4II2 A;  3CGD A;  1JRY A;  2GAH B;  5KRQ A;  1GTH A;  1TDF A;  2XCG A;  3K7T A;  3NIX A;  4AOX A;  2B9X A;  3GYJ A;  1PBE A;  2CUL A;  2Z5X A;  2V3B A;  2GB0 A;  1MOK A;  2IVE A;  2WU2 A;  4II3 A;  2OAM A;  2JB3 A;  2WP6 A;  4OPI A;  4TM3 A;  1DJN A;  3O0H A;  5JCI A;  1CL0 A;  2BS4 A;  1Y56 A;  4A5L A;  1CJ3 A;  3AEB A;  3AE1 A;  2BCG G;  4EIQ A;  3AEA A;  2HQM A;  3SX6 A;  3NK1 X;  4TLZ A;  1Q1R A;  3NYE A;  3EAN A;  3ATR A;  2XVJ A;  3D9X A;  1VRQ B;  4EMW A;  1GND A;  2BK3 A;  3AE3 A;  2C64 A;  4D03 A;  2DKI A;  4YTM A;  4NEW A;  3VRA A;  2XVI A;  1NG3 A;  1ZOY A;  2FJE A;  5CQF A;  4UDR A;  4U8P A;  1TDO A;  3C4N A;  2H88 A;  5U1O A;  1GTE A;  4U8M A;  3GD4 A;  3ZDN A;  2C66 A;  3LZX A;  4LU6 A;  1OJD A;  2XFU A;  1RYI A;  3QSE A;  2R0G A;  3UOV A;  1EL7 A;  3HYV A;  1Q9I A;  3BI4 A;  4GCM A;  4YKG A;  1O5W A;  1GRA A;  4WCT A;  2C7G A;  4NEV A;  4HA6 A;  2GF3 A;  2Q0K A;  3P4R A;  2AR8 A;  4H7U A;  4O5Q A;  3F8R A;  2R9Z A;  3B3R A;  1F8R A;  1BGJ A;  4JN9 A;  1M6I A;  3AB1 A;  1KN0 A;  4NZH A;  2GV8 A;  1JOA A;  4APN A;  1AOG A;  5FMH A;  3G5Q A;  3PO7 A;  4U8O A;  3DK8 A;  3RP6 A;  2YVJ A;  4JNQ A;  1YQZ A;  4RG4 A;  4D04 A;  3K30 A;  3KLJ A;  1V59 A;  2IVD A;  2WHD A;  4A6N B;  3NTA A;  1B8S A;  3B6D A;  1NHS A;  1H7W A;  4H2P A;  4FX9 A;  2C73 A;  3NRN A;  3UTF A;  4EQX A;  1N4W A;  2YLT A;  2BA9 A;  5KWF A;  4YSX A;  1QLB A;  1E39 A;  3UCL A;  1XHC A;  2YG5 A;  1LVL A;  1FEB A;  3DA1 A;  1CC2 A;  4G9K A;  3HZL A;  4C77 A;  4EM4 A;  3CGE A;  3LJP A;  3C96 A;  1CHU A;  2GR2 A;  4K5R A;  3ISH A;  1TYP A;  1Y0P A;  4DNA A;  3BI5 A;  3UKK A;  3DH9 A;  1E7P A;  4CCR A;  5KMQ A;  1OJ9 A;  3AYL A;  2VVM A;  3CND A;  4ZCD A;  3UTG A;  2XLT A;  4B67 A;  3CPJ G;  3QVR A;  5U25 A;  2OAL A;  4Y4M A;  5FS8 A;  3AEC A;  2A89 A;  1D7Y A;  3KD9 A;  4H4R A;  5EOW A;  3HYX A;  1XDI A;  2EQ9 A;  1B4V A;  2XVE A;  2OLO A;  5BRT A;  3DGZ A;  3K7Q X;  4JY3 A;  2YLS A;  2BS2 A;  2YLR A;  3QSM A;  1NHR A;  4B63 A;  2YR4 A;  4BV6 A;  1W4X A;  4O5U A;  3SZF A;  4H4Q A;  4B65 A;  2RAB A;  3AED A;  5J60 A;  2PHH A;  2NVK X;  1H83 A;  2BXR A;  5EB5 A;  2E5V A;  4DSH A;  4C3X A;  2FJB A;  2JAE A;  5JCL A;  1GES A;  2JBV A;  2WEU A;  3AD9 B;  4K22 A;  2BCP A;  1TDE A;  2YLX A;  3EF6 A;  2XFO A;  4H2N A;  4TM1 A;  2WP5 A;  4I58 A;  2FBW A;  3NK0 X;  4GDP A;  4J33 A;  3IF9 A;  4OPT A;  5KMP A;  1RSG A;  2GEW A;  4CNJ A;  1LPF A;  4ZN0 A;  3SXI A;  3VRD B;  4EM3 A;  2YQU A;  4J57 A;  1DNC A;  1B5Q A;  1JU2 A;  3KA7 A;  4B66 A;  1D7L A;  5IQ1 A;  4U2S A;  3NNE A;  4H4T A;  4H4Y A;  1VDC A;  2JB1 A;  2O9Z A;  2Z5Y A;  4J31 A;  1NAA A;  3CNP A;  4NTC A;  2VQ7 A;  2R46 A;  1NHP A;  2V60 A;  4U8N A;  5KMS A;  1KF6 A;  3ABV A;  4USR A;  5BUK A;  4AOS A;  3CTY A;  4H4W A;  2CFY A;  1NEK A;  3BHF A;  3UKA A;  3OC4 A;  2APG A;  2R45 A;  1PXC A;  3AE8 A;  3NHO X;  3KU9 A;  3SZ0 A;  4Z44 A;  4Z2U A;  1TRB A;  3T2Y A;  1L9D A;  4UDQ A;  2FJA A;  2BAC A;  3AYJ A;  3IHM A;  4H4X A;  5JCN A;  1VG9 A;  2C4C A;  4IA6 A;  4A9W A;  2X50 A;  1NDA A;  2XLU A;  1PJ5 A;  3M12 A;  4LII A;  1PXA A;  2B7S A;  3CIR A;  3D1C A;  3CPH G;  2BS3 A;  4H4U A;  1D4D A;  1NHQ A;  1OJT A;  3GMB A;  3NGC X;  1L0V A;  2OA1 A;  1K0I A;  3P4Q A;  4PAA A;  4OCG A;  1DOD A;  1H7X A;  1YKJ A;  1S3B A;  1LV0 A;  3COX A;  2WOI A;  2VRL A;  3P9U A;  4BUR A;  2XFP A;  2YG7 A;  2GRT A;  3CNS A;  2GR0 A;  3EAO A;  3T31 A;  3FG2 P;  1JRX A;  1OJA A;  2V61 A;  3NTD A;  2ZZ0 A;  3UOY A;  2Q0L A;  4YSH A;  1ZK7 A;  3L8K A;  3T2K A;  1H6V A;  5LV9 A;  1NEN A;  3ICR A;  3QJ4 A;  3DJG X;  1COY A;  4BJZ A;  3RED A;  3VR8 A;  5FS7 A;  4GAV A;  3ITJ A;  2Q7V A;  4Z2R A;  3LAD A;  3UOZ A;  2X3N A;  2AQJ A;  4LA1 A;  4A99 A;  2C76 A;  4XXG A;  1UKV G;  5JRB A;  4GDE A;  4U2L A;  1YQ4 A;  1P2E A;  1YY5 A;  4OPL A;  1N1P A;  4Z26 A;  2C3D A;  1CBO A;  3SZW A;  1RP0 A;  1MO9 A;  2GQW A;  1H82 A;  4GF7 A;  2W0H A;  2QA2 A;  1JRZ A;  1O95 A;  4I59 A;  3GYI A;  4FK1 A;  1ZMC A;  1CJC A;  5EB4 A;  2XVH A;  1IUT A;  3UOX A;  2B9Y A;  2YM2 A;  2WPC A;  2BXS A;  2C3C A;  1JNZ A;  3BHK A;  2A8X A;  5KNL A;  2VOU A;  2X8G A;  1K0L A;  5IQ4 A;  2GVC A;  2R0C A;  1GV4 A;  2E1M A;  3Q9T A;  2YWL A;  3EPT A;  3T2Z A;  2ACZ A;  5KVI A;  1XAN A;  1GET A;  3GRT A;  2WPF A;  4AT0 A;  2RGO A;  4JQ9 A;  4Y4L A;  1BGN A;  3K7M X;  2YLW A;  3AEF A;  2EQ7 A;  1EL5 A;  2C72 A;  3BNU A;  2FJD A;  3WE0 A;  1CC4 A;  1IJH A;  3C4A A;  4H2R A;  1KNP A;  1S2Y A;  4TLX A;  4B1B A;  1GOS A;  3Q6J A;  4M52 A;  3P4P A;  1PXB A;  5BVA A;  2YM1 A;  3G5S A;  1B37 A;  1DJQ A;  1HYU A;  3GYX A;  4JDR A;  2YG6 A;  4OVI A;  4XWR A;  5JCM A;  1EL8 A;  3DK4 A;  1DXL A;  4Z25 A;  1GPE A;  3ATQ A;  2TPR A;  2WET A;  3ICS A;  1JNR A;  4G73 A;  3NN0 X;  4IVO B;  3GWF A;  1IUV A;  3UP5 A;  3AE4 A;  1ZP0 A;  2X99 A;  1E1L A;  4KX6 A;  4B69 A;  4NNJ A;  2B9W A;  3SM8 A;  1K0J A;  1BWC A;  1H86 A;  3GDN A;  1F8S A;  3SFE A;  3NT6 A;  4AT2 A;  1H84 A;  2QCU A;  4H4Z A;  2XLR A;  3SY4 A;  1LJ1 A;  1GRF A;  3F8D A;  4UDP A;  3H8I A;  1GRB A;  5HXI A;  4X4J A;  3DJJ A;  4AP3 A;  3NYC A;  4A6N A;  1O94 A;  4RG3 A;  1VG0 A;  4K5S A;  1S7M A;  3I6D A;  2ARD A;  1E6E A;  3AE2 A;  4REK A;  3BNM A;  5FS9 A;  3AD7 B;  4AP1 A;  2A87 A;  3FMW A;  4H4V A;  3ALL A;  1KDG A;  1EL9 A;  3F8P A;  3DK9 A;  4FK1 C;  4A65 A;  1GRH A;  4A7A A;  3M13 A;  5M10 A;  1Z6L A;  3R9U A;  4U8K A;  3PG6 A;  4ADW A;  1D5T A;  1PBB A;  1SEZ A;  2GMH A;  3T0K A;  3IHG A;  1L9C A;  3L1R A;  1PN0 A;  3RP7 A;  1GXF A;  1BZL A;  2NPX A;  2YR6 A;  3AWI A;  4J56 A;  1K4Q A;  1CC6 A;  1TDN A;  3QSS A;  3RP8 A;  4IA5 A;  2WOW A;  3QFB A;  1GRG A;  2BAB A;  2OLN A;  2YR5 A;  4CRT A;  4DSG A;  4MJW A;  1DOE A;  1ELI A;  2VQB A;  3ADA B;  4U8L A;  3DJD A;  3NK2 X;  2GR1 A;  4KPR A;  2XLP A;  1BKW A;  1TDK A;  2C70 A;  2ZBW A;  4N9X A;  2UZZ A;  1E1M A;  4G6G A;  3D8X A;  4G6H A;  1Y56 B;  4X9M A;  5KMR A;  1MXT A;  1FEC A;  2EQ8 A;  2WDQ A;  3GMC A;  3HYW A;  2BRA A;  2GMJ A;  2IID A;  2WDV A;  3GSI A;  3NLC A;  3NYF A;  2R4E A;  3I3L A;  2WPE A;  3NKS A;  5HY5 A;  2BC0 A;  3NN6 X;  1DOB A;  2WU5 A;  1ZX9 A;  4HB9 A;  3V76 A;  4JNA A;  4TM4 A;  5HYM A;  2YLZ A;  1BF3 A;  1M64 A;  3KPF A;  1FOH A;  2Q6U A;  3AE7 A;  4H4S A;  5KOW A;  1H81 A;  2RGJ A;  3T37 A;  3CNT A;  4GUV A;  4IVM B;  1CJ2 A;  3JSK A;  4GAP A;  4OPC A;  1LQT A;  2TMD A;  4YKF A;  3CGC A;  4Z43 A;  4J34 A;  2YG3 A;  5GSN A;  2VZ2 A;  1P2H A;  2WDR A;  4GR1 A;  3FPZ A;  5DBJ A;  2V5Z A;  1QO8 A;  4A79 A;  1S3E A;  4CY6 A;  1PHH A;  2GR3 A;  4U8J A;  3VQR A;  2VRM A;  3SFD A;  5L46 A;  4EQW A;  2X8H A;  3AE6 A;  1NG4 A;  2XDO A;  1DOC A;  3NH3 X;  5JCK A;  2F5Z A;  4BJY A;  5U63 A;  1LTX R;  2YVF A;  3UKL A;  4ZCC A;  4K8D A;  4NTE A;  4YWO A;  4USQ A;  1OJC A;  1PS9 A;  3GWD A;  3RHA A;  2YG4 A;  1ZKQ A;  2I0Z A;  5EBK A;  2Y6Q A;  4G74 A;  3UP4 A;  3AEG A;  3FBS A;  1FL2 A;  1JEH A;  5TR3 A;  2C65 A;  4C5O A;  1GT8 A;  2ZZC A;  2BK5 A;  4OPG A;  2V3A A;  2VVL G;  4ECH A;  1PJ7 A;  1ZOV A;  4ICY A;  1PDH A;  3CMM A;  5M0Z A;  3UKF A;  1CF3 A;  3AYI A;  5CKU A;  4OPU A;  4U8I A;  4FDC B;  1GEU A;  3II4 A;  4K7Z A;  4EQR A;  3OZ2 A;  2YAU A;  1CJ4 A;  1D4E A;  3E1T A;  3IWA A;  2CDU A;  1GAL A;  3CPI G;  3SQP A;  3KVE A;  1X31 B;  3CGB A;  2X8C A;  3KKJ A;  3UTE A;  5HHF A;  3QVP A;  4YTP A;  2XVF A;  1F3P A;  3CNJ A;  3SZC A;  4CNK A;  1LQU A;  1FEA A;  2C75 A;  3LXD A;  2WBA A;  2ZZB A;  2GAG B;  3SYI A;  4YT0 A;  2VVL A;  2WOV A;  5ER0 A;  1IUX A;  1L9E A;  4JY2 A;  1S2Q A;  3GDP A;  3V3N A;  1E1N A;  4CY8 A;  4YSZ A;  2V6O A;  4YXD A;  4UP3 A;  2BC1 A;  1F6M A;  4BK2 A;  1TYT A;  4Y4N A;  2RGH A;  4DGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...