1NR4A

High resolution crystal structures of thymus and activation-regulated chemokine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
RGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of thymus and activation-regulated chemokine (TARC).
pubmed doi rcsb
molecule tags Cytokine
molecule keywords Thymus and activation-regulated chemokine
total genus 13
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1nr4A00
1U4PA 2HDMA 5D14A 1EIHA 2Q8TA 4HEDA 2EPBA 2K05A 2XIWA 2Q8RE 1EQTA 1RHPA 3DEPA 1KNAA 5EPLA 1F9QA 2L1BA 3HP3A 3I8ZA 1BF4A 4X3SA 5EJWA 1A15A 2MPMA 1QNKA 4UAIA 4ZKCB 5E4XA 1PFBA 2KEDA 3GV6A 2R3ZA 3KBXA 4NW2A 4QUFA 5CBEE 1B2TA 1RTNA 3FPUB 1GUWA 1G2TA 3R93A 5EPKA 4CJ0B 2B2TA 5CBAE 1NR4A 1B3AA 1EIGA 1MSGA 2L12A 2RSNA 1HRJA 4O42A 3I3CA 1KNEA 1RJTA 5EQ0A 1QG7A 2MJ8A 2N88A 1O7YA 1J9OA 1PDQA 2K03A 2EOTA 2NZ1D 2RSOA 1TVXA 4IUUA 5T1GA 1CA6A 1NCVA 1VMCA 1RTOA 1O7ZA 1JE4A 1MI2A 1S4ZA 2J7ZA 3MWYW 2H1EA 1ESRA 1WTPA 1RODA 4MHEA 2JP1A 4XDXA 1B4OA 2KECA 1ILPA 1HUMA 1X3QA 1E0BA 3UI2A 2SDFA 2X6GA 2N55A 3Q6SA 3KUPA 3LWEA 4R9WA 2B2UC 2MP1A 4XT3B 1X3PA 5DNFA 1F2LA 3ONAB 2DY7A 4DN4M 1J8IA 3I90A 1DOLA 2FFKB 1HFNA 4ZKBB 4X3KA 4RWSC 1QE6A 2BDNA 2X69A 1HFGA 1X32A 2K04A 1SSOA 2K28A 2KVMA 2L4NA 4HSVA 4IUTA 4MN3A 4R8IA 1G2SA 1AZQA 3GV3A 3D6WA 1WTOA 1WTWA 5T1IA 3MTSA 4ZK9B 4LMQD 1HA6A 1PLFA 1NAPA 2DY8A 1BO0A 2K1BA 2EE1A 2MGSA 5CORA 4XT1B 1Q3LA 1NR2A 1PFMA 1VMPA 3TZDA 1MSHA 1WTVA 1XX8A 1MGSA 1B53A 4OIJA 3G7LA 1CM9A 3N52A 1WTXA 2B2TC 1AP0A 2HCIA 1G6ZA 4QUCA 1DONA 4X3TA 2HCCA 1M8AA 1JICA 2B2WA 1B50A 2KUMA 3IFDA 1CA5A 1U4RA 2KOLA 4X3UA 1WD1A 2IL8A 2NWGA 5JJZA 1DZ1A 1O80A 2B2VA 1ICWA 4IURA 4ZAIA 3P7JA 5D65A 4RA8A 4ZLTF 4HAEA 3TN2A 5E4WC 1EL0A 2FHTA 4U68A 1LV9A 5COYA 1AZPA 2B2UA 2B2WC 1IKLA 4IUPA 2L11A 2NYZD 1F9RA 5CMDA 1SAPA 1F9SA 1WD0A 1F9PA 2FMMA 3QO2A 2B2YA 2D9UA 2K01A 5AFWA 1G91A 3F2UA 2B2YC 2X6LA 4CJ1B 2FJ2A 2B2VC 1ZXTA 1WTRA 1C8CA 1BNZA 2L9HA 1U4MA 2RA4A 1PFNA 2RVLA 1EOTA 1IL8A 4HCSA 2HDLA 1WVLA 1IKMA 1HHVA 5EPJA 1ILQA 4RAUC 2M2LA 3DM1A 1SDFA 2JYOA 3FDTA 4CJ2C 3SVMA 1XYIA 1BBXC 1WTQA 4OIKA 2KEEA 2CVRA 4IUQA 3I91A 1ML0D 2FINB 1DOMA 1DOKA 2VXWA 5EKIA 3IL8A 1HUNA 1U4LA 3DEOA 2HUGA 3H91A 4IUVA
chains in the Genus database with same CATH superfamily
3VA5A 3QIAA 3CCEA 3GTJH 1S40A 1XTDA 2EPBA 2K05A 2FMCA 4B3MQ 4C3IB 5GROA 3HKZB 5C4ZA 4JI8L 1O7LA 2F0PA 3HOXH 3O13A 5KRUA 1QNKA 1HNXL 3DUZA 4A3IH 1A2TA 3MXNB 1RTNA 4XQJA 2ZM6Q 4X62L 4JYAL 4A93H 1I5FA 4CDFC 1IXRA 2JEAI 2UU9Q 1HRJA 2I07B 1QUQB 1LTGD 4K2KA 3TBIB 1YITA 5J1ZA 1QNUA 5J22A 3NXWA 4G7HC 2WV6D 1GVPA 1GXDC 4LAAA 2KHIA 3LWEA 1T5EA 2B2UC 4OWWB 5DAUA 3CCSA 1I4HA 3TEHB 1EQQA 3PF5A 3FKIB 2UXCQ 5IGDA 5CV7A 1HTLD 4OWXB 1XPUA 4LUVA 4DK0A 4EGVA 2YTYA 1K8MA 5IYBH 1I4RA 2SEBD 2ICEC 3NWTA 2PZWA 2DY8A 3NE5B 4P74A 1U5KA 5C4HA 3M4QA 1AW7A 3F2DA 3IAYA 4ZRZA 3PO2H 4Q0FA 3S16H 3PF4A 3AU7A 1AE3A 4PZ8A 3NELA 4X3TA 2BH8A 4LFAQ 2JK8A 2IHEA 2PMZB 1O80A 2N8NA 1LT4D 2F0LA 1A3UA 2IHFA 1I94Q 3NHHA 3NBIA 1JB3A 1LTTD 1PZID 3HOYH 2VB3X 3TREA 2HQLA 5DLQE 1DD2A 4E6IA 4B3TL 3S17B 1KAAA 1F9RA 3KYHC 2I5HA 2QILA 2D9UA 5AFWA 4PV1C 3HRZC 2G5DA 3ERQA 3OTOL 2LXKA 3RMHA 3OW7A 1TWFH 4BBSH 1E2ZA 4C56C 3V2TA 3GTKB 1NMFA 2ENBA 4NXNL 5CV6A 4DPGA 4IOAA 3CCVA 5EKLA 2K5WA 5FO9B 1GUSA 3PUZA 4RFBA 4L5TA 2GA4B 5M9OA 1K0SA 2F0MA 4Y7NH 1D5ZC 2EY5A 4X3SA 1YJ9A 1EWIA 1PTOH 3CC2A 3KFUA 5KEEA 2K33A 2TMPA 4Z9CB 4IFDJ 4B3RL 3OWFA 2AUJD 2ATWA 1G2TA 4DV0L 4X62Q 3KF8A 2F4IA 3DM3A 4O42A 4FNFA 4YIJA 4UP9A 1KNEA 3G6JB 5ELEA 1S5ED 2MJ8A 1WI5A 1LLRD 2A68D 1QZHA 2P5ZX 1H9SB 1JE4A 1MBYA 5M3FB 2B8GA 5CR3A 3SEBA 4JI3Q 1S5CD 1PXUA 2DGYA 5CV9A 5DM73 3HOVB 4K5WA 3RLNA 1WFQA 5A2QE 2YTXA 3CMEA 4DV4Q 2L55A 2SDFA 3A5ZB 4L6TB 4B3SL 1CZWA 2N3SA 3CMAA 4LF6Q 1S3OA 4XT3B 4GLXA 3BZCA 1LTRD 4FXDA 1YEZA 5I6WA 1DOLA 1E2VA 2UXDQ 4KD4A 3GQBA 3M3YB 4IUTA 3J81j 4R8IA 1XNQL 1TWGB 2BCOA 4L8JA 1STNA 1NE3A 4PMBA 2MGSA 4DAPA 1DYQA 1WTVA 1WTXA 2JA5H 1YNXA 3S15H 1CM9A 5ELCA 3MAQA 4GKJL 1T9HA 2HCCA 1M8AA 5C0XI 5LL6X 1KC8C 2F0SA 1DZ1A 5K36G 3P7JA 1XPOA 1PH7A 3SHLA 3NTIA 4B3TQ 1EY7A 1N34Q 3PO2B 5CMDA 4A3KG 1SAPA 2JE6I 5KGUA 1UEBA 4K0KL 2K5NA 1SFOH 2AWOA 4M8AA 1NUCA 1OO9B 3K0XA 3OSOA 5FJ8H 1ET6A 4YHHQ 5IT9E 3IRBA 2VUMG 1ZKOA 4HJ5A 3CCJA 4BA1I 1TQOA 2EXZA 1BCPB 1WTHA 1XNRL 3VR3A 4PQXA 5KNCA 5KYLA 2RQXA 2PZUA 4L5QA 1ET9A 4ME3A 3DHQA 2Z1CA 1N34L 3NENA 5D3DA 1EIHA 4ZUJA 4A3MG 5J3BA 1JOOA 1E2WA 1KNAA 2CQOA 4H13C 2ZXOA 5IE8A 1IYJB 4DR5Q 3D0FA 4KMUC 5E4XA 3KJPA 2R92B 3S1QH 1Y8PB 1WCMB 5IT9c 1SYDA 4BBRH 4H02A 4X64L 3K5NA 1CKNA 3S9WA 3S1MB 4A93G 2F03A 3PIO3 4NB3A 4QJFA 2ZTCA 2NVXB 1K8AC 4GN3B 1VQNA 3S1RH 3M4OB 1PZKD 3AQQA 2VUMB 4H7BA 3K5MA 2ZJQA 2CFMA 3VR5A 5L37A 4DV2L 4A3JB 3S2DH 5I9PA 2I0QA 4WJ3M 2A19A 1HH2P 1HNXQ 2Z0SA 4V0BA 4FF2A 2UUCQ 5M3FG 4NDXA 1XWEA 2E2IH 2R7DA 1HZ9A 4LUZA 2EY2A 2X69A 4R4OA 1EY8A 2K04A 3BVZA 3BG3A 4HIKA 5LMNQ 1PZJD 4A3EH 2R92G 3HG9A 3ULPA 3PUWA 4JBMA 4UP8A 4IPCA 4R1JA 1BO0A 4RGNA 4F8MA 2AWNA 2HT1A 3T51B 3CU7A 3MZ5A 4IZ8A 3MXNA 4CDCC 1JICA 2F3IA 4XYOA 1BBWA 5JJZA 3T1YQ 4OEMB 3QG1A 2XGTA 3T1YL 3KF8B 3L2PA 3CW2C 2B39A 1EL0A 4R4IA 2YU9B 1SEBD 1I3QH 1GUOA 4JBWA 3HKSA 1UE6A 3CCMA 4JC0A 1WD0A 3SK5A 2VNUD 1VQFA 1CFMA 4A3FG 5JJIA 1YI2A 1H95A 3CRKC 1CZGA 3S1QB 2WAQG 3E5SA 1I6HB 3J7AV 1H9MA 1PFNA 1T5XD 2CWPA 1K3BC 4PMCA 5C3XA 2OWOA 1BCPD 2ZXPA 2M2LA 3FDTA 5CV8A 1K8OA 2Q2IA 4LF8Q 4DAMA 4EQPA 3HOUH 2Z9HA 5IGBA 3TS2A 3H91A 4JI7L 2NVYH 4HJAA 3KJOA 4DV6Q 2XIWA 2SNSA 1LTLA 3T13A 1STHA 2K5QA 4DR2Q 3OMCA 1LYLA 5EJWA 1SFOB 1SE3A 1TS2A 4C1NK 2CCZA 4ABNA 1Q7YC 4QIWE 3J80L 2C5CA 5E1FA 2C9OA 2PW5A 3FPUB 4JI0Q 1GUWA 1HZBA 3FP9A 5FOBB 4A3DB 4IN3A 4OONA 1J5EL 2N88A 3VYUA 5C4XG 1AE2A 1CA6A 2BE5C 2F0DA 3HOXG 1Q81C 4A3CG 3HOVG 1CTMA 1EZ8A 4TQUS 5CC4A 4A76A 3V96A 1PYWD 4APVA 4WFN3 1IBML 5FO8B 3E6ZX 3ND9A 4TVAB 4OL7A 1ZYRD 3PO3B 1PYBA 4DF7A 3HOUG 1D5MC 1Z47A 2XWJB 2JA5B 1X3PA 1B44D 2I5MX 3I56A 1EQRA 2A68C 2K28A 2NTTA 4JI5L 1TY2A 3P75A 1G2SA 3GV3A 3D6WA 1HXYD 1XMQL 3I4NH 3CPFA 1B9NA 3J80c 1NR2A 3TZDA 2EVBA 5IGGA 1XX8A 2B2TC 1JCKB 2E2IB 4LF5Q 4DUYL 5FK9C 1PH6A 3BVMA 1CA5A 2LKVA 3D31A 5K5PA 1R4QB 5FJ8G 5D65A 2XVSA 1A2UA 1KRSA 1TWAB 2F0QA 3OMGA 5LMNL 3HOZB 3SGIA 2L11A 3OOCA 1R9TB 2YYZA 1G291 5IP9G 4C3IH 3MXPA 3OYYA 4N8FA 2K01A 1YJWA 2LY7A 1FJGQ 2JA8G 2EY6A 4A3EG 2R92H 1KDBA 1WCMH 3H3VC 3STBC 1Z9FA 4DV0Q 2D0PA 4RAUC 4CJ2C 4DNIA 2ZM6L 2UXDL 3UDGA 1RCVD 3H3VH 3URYA 1EY5A 2EYFA 2K5HA 3IL8A 1U4LA 5TSSA 4YY3Q 1ICFB 2WFWA 2N78A 2QDBA 1PH3A 3S24A 1R4PB 2E74C 1II3A 4GOPC 5JEAG 1STGA 1A15A 3PO3H 1HNWL 3OTOQ 1OXVA 3Q24A 2RDGA 1VCIA 2AUKA 2OQKA 1EEID 2F1MA 4L63B 4A3FH 2KCMA 4KJNA 1Y1WB 2K03A 2F4VQ 1L1OC 3JC66 2BH2A 2VQEL 1JOKA 4XDXA 4HMJA 4IFDH 4JOIA 2EY1A 5E7NA 2EJMA 4CGYB 4JBJA 3FHWA 2A6HD 4YHHL 5KIXA 4KN7C 2VS1A 4R9WA 3P20A 4A3IG 1F2LA 4XQNA 2QF7A 2DNEA 4MIUA 4A93B 1MD2D 2JJQA 2BDNA 3ZYYX 4LF8L 2PNHA 3K7AB 1HFGA 2WB1G 4MN3A 3ICEA 1IBKL 1PH9A 3GTGH 4JI7Q 3U50C 1FVIA 2CH4W 1PVOA 3JAML 1B70B 1PLFA 2B63G 2EYOA 1MSHA 1HNWQ 1CKMA 2UUAQ 1SROA 3N6RA 4YCUA 4LWCA 1B50A 1F77A 2NWGA 1Q90A 3K0YA 4JI6Q 1ICWA 1S5DD 1I6HH 4KKUA 4DR3L 4DNRB 5E4WC 4A3JG 1Y8OB 1VF5C 1B8AA 1LV9A 5COYA 2L5TA 2MO0A 4XTCS 1IKLA 3A8KE 3SK6A 2NYZD 4DV6L 2JA5G 2M9VA 2PPBC 1HQMC 4KHPQ 3EJIA 4JV5Q 3NSWA 2FJ2A 2B2VC 2PCFB 4KJOA 2F0TA 2QCPX 1LACA 2KBNA 2VL6A 3HOXB 4JYAQ 4J8QA 1BBXC 2WACA 1GUNA 1DOMA 1S5FD 1I4QA 1KHIA 1WJJA 4HJ7A 2VY3A 3S1NB 1KD1C 4A3DH 1K0RA 1L1OB 1RL2A 3I73A 2QEXA 4DXGA 4FYDA 4HEDA 5I4DA 3TP5A 1N36L 2L1BA 2ZTDA 4DV2Q 1BF4A 3RLFA 1X6OA 2KA7A 1JOQA 2WP8J 1XMOL 2NBFA 2EIFA 1EY4A 5CBAE 3K7AH 2BOSA 4A3LG 4JI5Q 2QDLA 4GOPB 2D2CC 1O7YA 2A6ED 4JPBW 1YHAA 3M85A 3TQYA 1NCVA 1O7ZA 2K14A 4RGMA 5DEHA 4A3KH 4DR4Q 1NNXA 1QCBD 2JP1A 3S2HH 4A3MH 3RLOA 3AFPA 4JI4L 3Q6SA 2XRQD 3EFXD 4H44C 3RZDB 1M1KC 4EQ5A 2NVTB 1H9KA 4LF7Q 2Z4IA 2NVQH 3NTHA 1GO3E 1PTOC 2VUMH 5JJKA 3HOZH 5C3EH 3E0EA 5LL6S 1Z6HA 2EXDA 4LMQD 2E2JB 1HR0Q 1BR9A 2OTJA 4F7XA 2EE1A 4X65L 2KQ3A 5HGQA 1VDZA 4K5VA 3N52A 3J81i 3RZOB 4FF1A 2JXMB 1TR5A 3PUVA 1Y69U 4DA2A 3L7ZC 3BYTB 4LFBQ 3WOFA 1OXTA 3VYRA 2Q2TA 2HHHL 4YCVA 4P72A 3S1NH 2A69D 5EBDA 5EBCA 4Q5VA 3OPOA 2R7ZH 2CW0D 4QGUA 1IBLL 3TZUA 4CDEC 4IPDA 3NEMA 2FMMA 4LK1C 2G9HD 2X6LA 1BNZA 2L9HA 1IW7C 2Z6KA 2BA1A 1PRTF 4LFAL 1PTOF 4JI1Q 1A3VA 5ELBA 3VYTA 5BN3A 4LFCL 1WTQA 4OIKA 1DOKA 2AMCB 1YNND 4LF4Q 4EQNA 5C44H 4HTHA 4HN7A 3EIVA 1F9QA 1Q46A 1TS4A 2WKDA 2QGQA 2IWHA 1PH5A 1N36Q 1ENFA 4JI4Q 4QQBX 3X3NA 3HOUB 3CF5A 1B2TA 5A2QL 1C7YA 2UUBQ 3DWPA 1WCMG 4GKKL 4P73A 5ELDA 4JBKA 1SMYD 5M5WH 1FNVA 2RSNA 3M9BA 3RD4A 2A73B 2RSOA 1TVXA 1FYCA 3K5LA 4DV5L 3DMUA 1KLUD 1FL0A 3K8AA 1PRTD 1PH4A 3OW2A 3GTPB 2K5DA 4J1MA 2F0HA 3PIP3 2WIIB 5IYCG 4H0LC 2LFNA 2EYLA 4QMGA 3SXHA 2RKSA 4DUZL 3SDZA 4B3RQ 3I2ZA 3RUZA 4A3IB 2AHOB 3I90A 2NVXH 1LTSD 1E22A 4Y52H 2F0NA 3U4VA 1CKNB 2VZAA 4ID6A 2XSCA 2ALYB 1STEA 2KVMA 3SE0A 3MXGA 5IP7H 1UAPA 4F87A 1CUKA 3MVVA 4KV6A 4UHVA 1K3RA 5IWAQ 4BY7G 4GLVB 4A3KB 1V8QA 3H0GB 4UP7A 4C1NI 1HNZL 4HJ8A 1A62A 3LGJA 4OIJA 4O1NA 4OX9Q 1SNDA 4QUCA 5ELFA 1VQBA 3IFDA 3FKIG 1VQHA 2ZTEA 4RA8A 1EY6A 4BXXH 5IGEA 1MJCA 1S72A 1KL9A 4RKLA 3TSSA 1LT3D 3CC7A 1SE8A 4C3HB 4DR6Q 3GTQH 1VF7A 2JA8B 1M4VA 5M5XB 1MIUA 1VQJA 2KCNA 1WTRA 3C2PA 4DR5L 3Q8DA 4HCSA 4R4QA 2WB1E 1ILQA 1CHPD 4LUOA 1XYIA 1JJ2A 3CPWA 4V190 1TS5A 1W6KA 3ER0A 2MNAA 2F0VA 3KDFA 3AYHB 2K75A 1GJXA 1HUNA 3DEOA 1BXTA 5EQ0A 2A5HA 4FVMA 2HDMA 4L5SA 4BA2I 1W6JA 4N8X1 1IYUA 1H9RA 4A3MB 3I8ZA 4A3CH 3F1ZA 2N49A 2KENA 1TWHB 4QUFA 3TRZA 3R93A 1EIGA 1HZAA 4QB4A 1RJTA 1QG7A 1PRTB 4RHSA 5T1GA 3AFQA 3J7YW 4CKEA 4A75A 1SNQA 2V4DA 3ERSX 5DM63 2IPKD 1X3QA 2NN6I 4FO2A 4JI8Q 5IYBG 4BXXG 3J7A5 1EYCA 4OGQC 3GDEA 4UPAA 5DNFA 2GVBA 3ONAB 3K7UC 2CWAA 2D62A 2L15A 5G3LD 4A4IA 4P2CB 3HOYB 1TWAH 3A8IE 4A3BH 1BCPF 5KYIA 3WOEA 1SSOA 2RDFA 4JK1C 3KF6B 2XN9C 2IX0A 2NZOA 3I70A 4C3HH 4FP5D 5KNDA 4IFDG 1HA6A 3I72A 1V9PA 2VW9A 1L2FA 4RGOS 3L3OC 2K7VA 1W2BA 1CKOA 3DWAA 4QY7A 5HY6A 1AEXA 2ES2A 3W1BA 3AMUA 4R8NA 4DUZQ 1IL2A 4PZ7A 3JAME 1D2BA 4DK3C 1N33L 1VQOA 1WD1A 2R93G 2IL8A 1MJEA 4LFCQ 4JCVE 4ALPA 2KHSA 3GTGB 3TMEA 1YNJD 3FKIH 4G57A 3NK9A 2F0IA 4BBSB 1JJGA 1KXLA 2MFIA 4NXNQ 4IO9A 3A5UA 2RDHA 1PH2A 1VQLA 1SBBB 3LX0A 3HOYG 5G3LF 2BA0A 1ZXTA 1LTID 5C0XJ 1U4MA 3EVQA 2DJFC 4ZYSA 4DR1L 5EPJA 4IPHA 3GTOB 3J80i 3LNNA 2EDGA 1Y1WH 2QA4A 2SNMA 3NPPA 3BS1A 4JVZA 3CXCA 1Y14B 4XIGS 1FR3A 4I65A 1CHQD 3MC0B 2F0WA 1VQMA 4BY1B 5CGKA 3V05A 1Q1EA 4DR2L 1VQEA 3TP7A 2PQAB 3C1EA 1IBMQ 1EIYB 1STBA 2PZTA 4NW2A 1XXGA 3KLRA 5EPKA 4CJ0B 2B2TA 3D6CA 1OXSC 4YCWA 4KN4C 2ID0A 5IGCA 1J5EQ 1PDQA 2O2LD 3KLSA 1WOCA 4X6AH 4QL5A 5LMUL 2H1EA 3CKIB 1ESRA 3H15A 1TT2A 1HUMA 3J81c 3UI2A 3MEHA 2EQSA 2N55A 5M3MG 4HSPA 3RR5A 5C4JH 1YHBA 4R4CA 3VR2A 2FFKB 1IHZA 1SYBA 4BBRB 3EROA 1I50B 1LT6D 3E0JA 2K32A 2F0OA 3HFZB 4JG2A 1W3SA 3VR4A 1N9WA 1X55A 5T1IA 5HGTA 2MUYA 4AYBB 2WINB 4AIMA 1UE5A 4PNYA 1VMPA 5NUCA 5GADC 5FLXc 2HCIA 4KY7A 3GTQB 5AJ3Q 1SYEA 4AQYQ 1JC7A 1A3TA 4B9WA 4P71A 4ZLTF 3MXUA 4C3JH 4HAEA 2F3WA 3NP8A 4ME5A 2E2JH 2R7FA 3R8BA 1SN8A 2MO1A 3D4RA 1ASZA 2JSOA 1XNQQ 1M90C 3PO3G 4QF4A 4POFA 1BOSA 4MTKA 1VQPA 1QOHA 2F52A 2OEOA 3ND8A 4GNXC 1LM0A 3HOWB 5E3FA 1OXXK 2RA4A 4DFAA 3NQTA 3PUYA 4KKTA 3M4YA 2G9DA 3BZKA 3CCUA 1JR0D 4DAYA 3S1MH 2WKCA 3DM1A 3K58A 2OCEA 3BYYB 2A8VA 5EGTA 2RHQB 3JAMi 1ML0D 5HURA 1K83B 4FXGC 5EKIA 3E9HA 1YNJC 1I3QB 1EYAA 2BDOA 1XJVA 1U4PA 1D6EC 1L0XB 2NN6H 4A3FB 3ULLA 3DEPA 4RCNA 1KLGD 3HP3A 4JV5L 3IKJA 2MPMA 4ZKCB 1LO5D 2PO4A 1QZGA 3NWSA 4BY7B 1CQVA 3TDQA 5C6AA 1Z7TA 3HKZG 1STYA 4KI0A 2HIVA 4A3EB 4IJLA 1C4QA 1RTOA 3MWYW 2NVQB 2JEBI 4J6HA 1VQDA 1RDPD 1EYGA 3Q22A 3H0GG 4P75A 2Y0SE 4KY6A 1CSPA 4WORA 5BR8L 2O5IC 3U9OA 1YVCA 1HA5A 1PV4A 3GTLB 2LXJA 3I7FA 1GKHA 2QW7A 2MP1A 3FPPA 3HEJA 1C48A 4HIMA 4LF7L 3VA7A 4RMFA 1B1ZA 4IOCA 4NXMQ 4KK7A 2HHHQ 2JA7H 4K6DA 2IT1A 3CRLC 3HOWG 2NTSA 1JJCB 4CKBA 1TY0A 4G4KA 5LHY1 1C0AA 2PNRC 4ZK9B 1EFID 3H09A 3M4OH 2K1BA 3ZJYC 4G7ZC 5GQOA 5GAHC 4POGA 1PFMA 3A54A 2R7ZB 4DV1L 2E5LL 1A8VA 1L1OA 3NTKA 1AFPA 3GTOH 4NPSA 1U4RA 3S14H 1TWCH 1EY0A 2WB1B 3HZXA 4DK1A 3H0GH 2F4VL 2PW7A 2JA9A 5I6YA 2I46A 1FD7D 2ICIA 1F9SA 3F2UA 3D8GA 4OX9L 4DAYB 1IL8A 4IFDI 1E1OA 2AQ3B 1HHVA 4WJ4A 2C35B 1G8ZD 3S17H 1KABA 3I91A 4EQOA 4YY3L 4RGTA 1ZEQX 3KBGA 4EX5A 3NQIA 5IY0A 5IIFA 4C3HG 1KDCA 3A0JA 3I4MG 4A3DG 2PYKA 2J0TD 3X3MA 3T56B 2PMZE 5FLXL 4IPGA 1STAA 1UE1A 3Q23A 4CBVA 1UWVA 2ZJRA 1SE4A 1FNUA 5JPNC 4AQYL 3BDOA 4A3LH 1DCZA 1LTBD 2D5DA 2UUBL 1NR4A 1MSGA 2L12A 4GKKQ 1LTAD 2Q2HA 1CK1A 1K73C 3PIOA 2XNAC 2DN8A 3H3VI 1MI2A 1PTOB 1IZ6A 1FGUA 2OXPA 1RODA 1LT5D 1PFSA 1B4OA 4BY7H 3BU2A 1CQFA 4GZYC 3T16A 5D3IB 5ELNA 4OO1I 1QVCA 4K14A 3AB9A 1EY9A 2JA7G 3PSIA 1F2ZA 4DN4M 4XYQA 5M5YH 4UY8C 1I94L 4YWKA 1XNRQ 4BBSG 2CQAA 2L4NA 3GTPH 1BKBA 1SYFA 1SMYC 2Y0SG 4DNTB 2JA8H 1NAPA 2OF1A 2YTVA 1MGSA 1EUJA 4HMIA 3PMFA 1NTGA 3BVGA 4PZ6A 3E3XA 4CKCA 1Q82C 1X9NA 2R93B 3A55A 4X3UA 4LFBL 5M3MH 5A35A 3I4OA 2HQEA 2DJGC 5JJLA 3Q0AA 2Q2UA 1YNNC 3M3YH 1X54A 4IUPA 1JWUD 1AN8A 4CDDC 3RNUA 1SLJA 1EWHA 2NUCA 2AKWB 3UE0A 3A8JE 3PV0A 2I5LX 1IW7D 3DLLA 5C44B 2YV5A 1GOZA 1ASYA 5K36H 3R2TA 3G71A 1CI3M 4PMWA 3UDXA 3KLWA 3W2DA 1XMOQ 3PUXA 2PQEA 1JWMD 2XWBB 4OHJA 5IYDH 1PH8A 2CW0C 1DJRD 1YBYA 1X3GA 2A69C 5JEAH 4DK6C 3S1RB 1BQQT 4A3GH 3H6MA 1K8GA 1FJGL 1OXUA 1V43A 1HNZQ 3P1HA 4KY5A 3M4PA 2K4KA 4GKJQ 2KEDA 1MKHA 3KBXA 3F2CA 2B8FA 5AJ3L 3DXJC 3H94A 1Y1VB 1F2YA 2Q8IB 2D0OA 4C2MB 2LMCB 1JMCA 3I3CA 2E2HH 1HPCA 4FXKC 1Q12A 1I4GA 1PTOD 4DXFA 4GN5A 4DV7Q 4DV7L 5GAEC 1SRUA 2GN5A 1SYGA 3D4DA 4GLAC 4K2LA 2IY5B 3EN2A 2X6GA 4OO1G 3KUPA 1EIFA 5FKAC 1D1IA 4X64Q 3QJYA 1JT8A 3I4LA 2E76C 4KHZA 3TS0A 1QUQA 1D7QA 3KF6A 1BVSA 1WTWA 1WTOA 2JQOA 4DGZA 1EYDA 2TSSA 3S2DB 4O0AA 2FXQA 4FF3A 1B3QA 1SNMA 4MZ9A 1Q3LA 4KD3A 2DUDA 3S2HB 5BR8Q 3MEFA 1V1PA 2E75C 3J81L 1XPRA 3HKZE 4ULLA 3K5OA 1NMGA 3CD6A 3OIQA 4B9XA 2FHTA 2NB0A 1AZPA 1LUZA 1V1OA 2B2UA 2ZJPA 1SJED 1C9OA 1AH9A 3JAMc 4DR6L 4G7OC 1C8CA 3L9AX 3M7NA 3J80E 2UUAL 4BY1H 4FF4A 4HJ9A 2RVLA 5FLXE 4DR1Q 3ULJA 1OTCA 2AQ1B 3QOLA 1PA6A 3ITPA 3GTMB 2FINB 4OELB 1IBKQ 2IW3A 1BBUA 2HUGA 4ZQ3A 5I2XA 4BWGB 3C3LA 1EOVA 2Q8TA 2RF4A 4EVOA 2HD3A 3M7GA 4NMZA 4C3IG 5CV5A 1GM5A 2NZHA 3E9IA 1TKWB 3RZDH 4K6LA 1VQ7A 2F0FA 4WJWA 1EU3A 4J15A 4OWTB 1YJNA 4L5RC 1D1KA 2QEJC 4HIDA 1JORA 1VQ4A 5C5LA 3F8TA 2E2DC 4DV5Q 4DR7L 1SE2A 1VQ8A 4CHTB 2MQHA 3F2BA 1EQVA 4MHEA 4QIWB 3I4NG 2A6HC 3J7AF 5I2YA 5CV4A 5M5WB 2L0CA 5M3MB 1J8IA 2EYMA 2MHVA 3TP8A 4GOPA 2Z8LA 4IUNA 3EQLC 1H9SA 4OXPA 1FGBD 5EKKA 1TXYA 3EBEA 2R61A 2Y0SB 2J4XA 1WYDA 2OT2A 2F0GA 4XT1B 3HOWH 5JVH3 3FMCA 4NP5A 3RN2A 2IX3A 4DKAC 3I55A 1XTCD 3GD7A 4M1UB 4RH6A 2JA7B 2XRSD 4N9TA 2K5VA 3HS0C 1VQIA 4IURA 2PQAA 2A1AA 3IFTA 4HIOA 1HZCA 1RF2D 5FLMH 1ENCA 3BZDB 2VQFL 3HGBA 4ZUIA 2B2WC 2EYPA 3A7LA 1KQSA 3A74A 3BJUA 3U4ZA 3AEVA 5LMUQ 2F0UA 1RIPA 3CP0A 3QO2A 3DWQA 2B2YA 3NUCA 3STBD 4GNXA 1B7YB 4CJ1B 2CH4A 3D4WA 4K8IA 4LF5L 2WAQB 5I9OA 4O2DA 3RZOH 5JVG3 5C3EG 3HOZG 4JI1L 4JI0L 3NBHB 3C46A 1QB5D 1SDFA 1G6PA 2V1CC 3T1HL 4JI6L 2CVRA 4KHVA 4IQZA 1Q86C 4KLKA 1SXTA 5D14A 1IBLQ 1CT1D 2VQEQ 1R9TH 2RBMA 2RCNA 2Q8RE 1HJPA 4X65Q 1TWFB 5EAYA 2O5JC 3FEWX 5ISRA 1X65A 2RCFA 1K28A 5M5XH 3GTLH 5JPMC 3GV6A 3SK8A 3T53B 1V1PB 2IJ0A 1SNPA 1N8RC 1I6VC 5JOBA 2K6AA 2F0KA 2GVAA 4IALA 2PI2A 4LW1A 2NZ1D 4Y7NB 1TU2B 2J7ZA 1E1TA 4MTNA 3CCLA 5C4XH 3U9SA 4JOIC 1NBWA 2NN6G 5CYUA 1QVGA 3I4MH 3RN5A 1KRTA 4AYBE 1ZYRC 5C3WA 1SNOA 1SR3A 3I4NB 1N32Q 4TSSA 5IP7G 3S14B 1TWHH 2A74C 1N33Q 1Y1VG 3A7AB 1ESFA 1Q8KA 3MFGA 1HFNA 2E8GA 4RWSC 2BE5D 4YWMA 5M3FH 4BS9A 3FVQA 5KNBA 1X32A 4HSVA 4N9PA 3BDLA 1EZ6A 1I4PA 4GN4B 4A3GG 4DR4L 1VS0A 3J81E 4B3ML 5IWAL 1U9RA 3WWVA 1S5BD 3HOVH 1Y8NB 4XXEA 2B63B 3G6EA 1VQ5A 1B53A 2KHJA 2K52A 1AP0A 1A0IA 4IJHA 4MNOA 1G6ZA 3A56A 1DONA 5C5MA 2KOLA 4X66L 2WAQE 1X3FA 2KCCA 4BY1G 3G4SA 4BBRG 3TN2A 1NJIC 4U68A 1QJOA 2JA6B 5FO7B 3UDFA 4AH6A 4LF4L 1GUGA 1I4XA 3W1GA 3U58A 3PO2G 1IYVA 1BCPC 1F9PA 2Z6BA 1RD9D 4DV1Q 2E5LQ 2B2YC 1X3EA 5ELOA 3GO5A 1J6QA 1UE7A 4YWLA 1TS3A 2F0JA 3T4AC 3W3AA 5BN5A 1KIXA 2KEEA 4UDUC 4NXML 4IUQA 3K57A 1TIID 2VXWA 3K81C 4DR7Q 1WVLA 3B6YA 4IUVA 3QOJA 1P8LA 1D8LA 4I7ZC 1EQTA 5EPLA 2EYHA 1N32L 1Y1WG 4A3BG 4UAIA 3UDIA 2F0EA 1PFBA 2R3ZA 1GHJA 2B29A 5CBEE 1JB7A 1EWCA 1QWYA 2B3GA 3G48A 3QR8A 2CKZB 1E7ZA 3OHXC 3T1HQ 4FDBA 4DR3Q 3GTJB 3MFYA 1H9JA 1VQCA 5M5YB 1VMCA 1VQGA 3MHBA 4K8JA 1UUPA 3R2IA 1ONLA 4JI2Q 4LF9Q 4F88A 2KECA 1LABA 1TWGH 3PIPA 1E0BA 2R6GA 4C3JG 1JQYD 4LNQA 1EEFD 5JAVA 2R93H 2QKIC 1JE5A 4S3SA 1PRTC 2DY7A 3GP7A 4ZKBB 1BDOA 1SYCA 4R4TA 2UXCL 1QE6A 3L0OA 3CAMA 5BN4A 2IX1A 1NY4A 2O4XA 1AZQA 5C4XB 1GUTA 2H5XA 3QWNA 3TP6A 2SOBA 1HR0W 4AYBG 1PYSB 4ZCKA 3EA6A 3CQZB 4K5XA 2LS01 2YU9H 2UXBQ 2JN4A 3KDFB 4RHRA 3SR1A 4HCEA 3G7LA 2CHBD 1L0WA 2F3VA 2KUMA 1KDAA 2Z6KC 5IGFA 5C3EB 4LF6L 4OO1H 3CHBD 4RG1A 2EJGC 4DV3L 2AQ2B 2UU9L 1UEAB 2KJXA 2M00A 3CCQA 4A3BB 5IOCA 1SJHD 4QCLA 1D5XC 4DU9A 1G51A 4JI3L 4GS3A 1CSQA 1O78A 4RCOA 2R7ZG 3K80C 3LWUA 1G91A 5C44G 3S16B 4DUYQ 5H1SE 2LSSA 1A6XA 1EOTA 3VDYA 1KAWA 4C2MH 4DV3Q 2JYOA 4GNXB 4RKBA 2UUCL 1E24A 5IODA 3KK7A 4TKOB 1GD7A 1V1QA 1PMRA 2JA6H 5GAGC 2E2HB 3I4MB 5IT9L 1RHPA 1JWSD 2OQ0A 2ZT9C 1BUVT 3GTKH 4B3SQ 4ILWA 4DV4L 2RHSB 5IYDG 1YIJA 2PI2E 3GTMH 4A3JH 3WDNA 1B3AA 2VB2X 3VYSA 1X56A 1VQ9A 3UE1A 1QVFA 2ASBA 4LJZC 2NVTH 5IYCH 1J9OA 2EOTA 4IUUA 1PH1A 1O7IA 1S4ZA 1XMQQ 4KHPL 4WRDA 4NKLA 4JI2L 4A3GB 4PG3A 1A63A 3PGZA 2B63H 2DNCA 1WTPA 3KOJA 1MHWC 3SK4A 5J39A 1HQRD 1ILPA 2EJFC 2KCTA 2UXBL 1YZ6A 3D3RA 2JA6G 5C0XH 4ODGA 1HCZA 4HR7B 1B9MA 1EFWA 3KLSX 3J7ZC 1NSNS 1RKNA 1VQKA 4X3KA 1Y1VH 2XTIA 2EYJA 2A6EC 3OIPA 3BDCA 3C1FA 4TRDA 1KTKA 3MTSA 3W5OA 5LMNW 3VR6A 1ENAA 3NBHA 4KKSA 5CORA 2EZVA 4LF9L 2H4OA 1VQ6A 5IP9H 1F2MA 4U673 1SMXA 1YHQA 3K6OA 1QILA 2OTLA 1SNCA 1Q1BA 3PQIA 3QB3A 1EU4A 2B2WA 5C4JB 4ZAIA 2B2VA 2ZXRA 1K83H 2K50A 4XQQA 3FRPB 1HTPA 3PCOB 3CQZH 5JEAJ 1I50H 2HIXA 1FNWA 3S15B 1PHJA 1DM0B 1UNSA 3OWEB 3R3OA 1HR0L 3CC4A 4K0KQ 5FLMG 2Z4HA 2NVYB 4JW0A 1P16A 3MA2B 1L0YB 3K59A 1DGSA 1E3PA 2HDLA 1IKMA 4KTAA 3SVMA 4X66Q 5F2DA 1VQAA 1Q8IA 1TWCB 1K9MC 4C3JB 4B08A 1DXMA 4I7AA 4DAVA 1GHKA 2VQFQ 3CCRA 5C0XG 1U0LA
chains in the Genus database with same CATH topology
3VA5A 3QIAA 2EPBA 2K05A 2FMCA 4C3IB 3HKZB 5C4ZA 1O7LA 2F0PA 3O13A 5KRUA 1QNKA 3DUZA 1A2TA 1RTNA 4XQJA 2JEAI 1HRJA 2I07B 1LTGD 4K2KA 3TBIB 5J1ZA 1QNUA 5J22A 3NXWA 4G7HC 2WV6D 1GXDC 4LAAA 3LWEA 1T5EA 2B2UC 5DAUA 1I4HA 3FKIB 5IGDA 5CV7A 1HTLD 4DK0A 4EGVA 1K8MA 1I4RA 2SEBD 2ICEC 3NWTA 2PZWA 2DY8A 3NE5B 5C4HA 1AW7A 3IAYA 4ZRZA 4Q0FA 3AU7A 4X3TA 2PMZB 1O80A 1LT4D 2F0LA 1A3UA 3NHHA 3NBIA 1JB3A 1LTTD 1PZID 2VB3X 1DD2A 4E6IA 3S17B 1KAAA 1F9RA 2QILA 2D9UA 5AFWA 4PV1C 3HRZC 3ERQA 3RMHA 3OW7A 1E2ZA 4C56C 3V2TA 3GTKB 2ENBA 5CV6A 5EKLA 2K5WA 5FO9B 1GUSA 3PUZA 4RFBA 2GA4B 5M9OA 2F0MA 1D5ZC 2EY5A 4X3SA 1PTOH 5KEEA 2K33A 2TMPA 4Z9CB 4IFDJ 3OWFA 2AUJD 1G2TA 3KF8A 2F4IA 4O42A 4FNFA 4YIJA 1KNEA 3G6JB 5ELEA 1S5ED 2MJ8A 1LLRD 2A68D 1H9SB 1JE4A 1MBYA 5M3FB 2B8GA 5CR3A 3SEBA 1S5CD 1PXUA 5CV9A 5DM73 3HOVB 4K5WA 5A2QE 2L55A 2SDFA 4L6TB 1CZWA 4XT3B 1LTRD 4FXDA 5I6WA 1DOLA 1E2VA 4KD4A 3GQBA 3M3YB 4IUTA 4R8IA 1TWGB 2BCOA 4L8JA 1STNA 4PMBA 2MGSA 4DAPA 1DYQA 1WTVA 1WTXA 1CM9A 5ELCA 3MAQA 2HCCA 1M8AA 5C0XI 5LL6X 2F0SA 1DZ1A 5K36G 3P7JA 3SHLA 3NTIA 1EY7A 3PO2B 5CMDA 1SAPA 2JE6I 5KGUA 2AWOA 4M8AA 1NUCA 1OO9B 3OSOA 1ET6A 5IT9E 1ZKOA 4BA1I 1TQOA 2EXZA 1BCPB 3VR3A 4PQXA 5KNCA 5KYLA 2RQXA 2PZUA 1ET9A 3DHQA 2Z1CA 5D3DA 1EIHA 4ZUJA 1JOOA 1E2WA 1KNAA 4H13C 2ZXOA 4KMUC 5E4XA 2R92B 1Y8PB 1WCMB 1SYDA 3K5NA 3S9WA 3S1MB 2F03A 3PIO3 2NVXB 3M4OB 1PZKD 2VUMB 4H7BA 3K5MA 4A3JB 3VR5A 5I9PA 4V0BA 4FF2A 4NDXA 1XWEA 2EY2A 2X69A 1EY8A 2K04A 3BVZA 3BG3A 1PZJD 3HG9A 3PUWA 4RGNA 1BO0A 4F8MA 2AWNA 3T51B 3CU7A 3MZ5A 4IZ8A 3MXNA 1JICA 4XYOA 5JJZA 3QG1A 2B39A 1EL0A 2YU9B 1SEBD 1GUOA 4JBWA 1WD0A 3SK5A 2VNUD 1CFMA 3CRKC 1CZGA 3S1QB 3E5SA 1I6HB 3J7AV 1H9MA 1PFNA 1T5XD 4PMCA 5C3XA 1BCPD 2ZXPA 2M2LA 3FDTA 5CV8A 1K8OA 4EQPA 5IGBA 3H91A 2XIWA 2SNSA 3T13A 1STHA 2K5QA 3OMCA 5EJWA 1SFOB 1SE3A 1TS2A 4C1NK 4ABNA 3J80L 2C5CA 5E1FA 2C9OA 2PW5A 3FPUB 1GUWA 5FOBB 4A3DB 4IN3A 2N88A 3VYUA 1CA6A 2BE5C 2F0DA 1CTMA 1EZ8A 4TQUS 5CC4A 3V96A 1PYWD 4WFN3 5FO8B 3E6ZX 3ND9A 4OL7A 1ZYRD 3PO3B 4DF7A 1D5MC 1Z47A 2XWJB 2JA5B 1X3PA 1B44D 2A68C 2K28A 2NTTA 1TY2A 3P75A 1G2SA 3GV3A 3D6WA 1HXYD 1B9NA 1NR2A 3TZDA 2EVBA 5IGGA 1XX8A 2B2TC 1JCKB 2E2IB 5FK9C 3BVMA 1CA5A 2LKVA 3D31A 5K5PA 1R4QB 5D65A 2XVSA 1A2UA 1TWAB 2F0QA 3OMGA 3HOZB 2L11A 3OOCA 1R9TB 2YYZA 1G291 3MXPA 2K01A 2LY7A 2EY6A 1KDBA 3H3VC 4RAUC 4CJ2C 1RCVD 3URYA 1EY5A 2EYFA 3IL8A 5TSSA 1U4LA 2QDBA 1R4PB 2E74C 1II3A 5JEAG 1STGA 1A15A 1OXVA 3Q24A 2RDGA 1VCIA 2AUKA 1EEID 2F1MA 4L63B 4KJNA 1Y1WB 2K03A 1JOKA 4XDXA 4HMJA 4IFDH 2EY1A 2EJMA 4CGYB 2A6HD 5KIXA 4KN7C 4R9WA 3P20A 1F2LA 4XQNA 2QF7A 2DNEA 4MIUA 4A93B 1MD2D 3ZYYX 2BDNA 3K7AB 1HFGA 4MN3A 3JAML 1PLFA 2EYOA 1MSHA 3N6RA 1B50A 1F77A 2NWGA 1Q90A 3K0YA 1ICWA 1S5DD 4KKUA 4DNRB 5E4WC 1Y8OB 1VF5C 1LV9A 5COYA 2L5TA 4XTCS 1IKLA 3A8KE 3SK6A 2NYZD 2M9VA 2PPBC 1HQMC 3EJIA 3NSWA 2FJ2A 2B2VC 2PCFB 4KJOA 2F0TA 2QCPX 1LACA 3HOXB 4J8QA 1BBXC 2WACA 1GUNA 1DOMA 1S5FD 1I4QA 3S1NB 3I73A 4DXGA 4FYDA 4HEDA 5I4DA 3TP5A 2L1BA 1BF4A 3RLFA 2KA7A 1JOQA 2WP8J 2NBFA 1EY4A 5CBAE 2BOSA 2D2CC 1O7YA 2A6ED 3M85A 1NCVA 1O7ZA 4RGMA 5DEHA 1QCBD 2JP1A 3Q6SA 2XRQD 3EFXD 4H44C 3RZDB 2NVTB 1H9KA 2Z4IA 3NTHA 1PTOC 5LL6S 1Z6HA 4LMQD 2E2JB 1BR9A 4F7XA 2EE1A 2KQ3A 1VDZA 4K5VA 3N52A 3RZOB 4FF1A 2JXMB 1TR5A 3PUVA 1Y69U 4DA2A 3L7ZC 3BYTB 3WOFA 1OXTA 3VYRA 2A69D 5EBDA 5EBCA 4Q5VA 3OPOA 2CW0D 3TZUA 2FMMA 4LK1C 2G9HD 2X6LA 1BNZA 2L9HA 1IW7C 2BA1A 1PRTF 1PTOF 1A3VA 5ELBA 3VYTA 5BN3A 1WTQA 4OIKA 1DOKA 1YNND 4EQNA 4HTHA 4HN7A 1F9QA 1TS4A 2WKDA 2IWHA 1ENFA 3X3NA 3HOUB 1B2TA 5A2QL 3DWPA 5ELDA 1SMYD 1FNVA 2RSNA 3RD4A 2A73B 2RSOA 1TVXA 1FYCA 3K5LA 3DMUA 1KLUD 1PRTD 3GTPB 2K5DA 4J1MA 2F0HA 3PIP3 2WIIB 4H0LC 2LFNA 2EYLA 4QMGA 3SXHA 2RKSA 3SDZA 3RUZA 4A3IB 3I90A 1LTSD 2F0NA 4ID6A 2XSCA 1STEA 2KVMA 3SE0A 3MXGA 1UAPA 4F87A 3MVVA 4KV6A 4A3KB 1V8QA 3H0GB 4C1NI 4OIJA 4O1NA 1SNDA 4QUCA 5ELFA 3IFDA 4RA8A 1EY6A 5IGEA 4RKLA 3TSSA 1LT3D 4C3HB 1VF7A 2JA8B 1M4VA 5M5XB 2KCNA 1WTRA 3C2PA 4HCSA 1ILQA 1CHPD 1XYIA 4V190 1TS5A 1W6KA 2F0VA 1GJXA 1HUNA 3DEOA 1BXTA 5EQ0A 2A5HA 4FVMA 2HDMA 4BA2I 1W6JA 4A3MB 1IYUA 1H9RA 3I8ZA 1TWHB 4QUFA 3R93A 1EIGA 4QB4A 1RJTA 1QG7A 1PRTB 4RHSA 5T1GA 3J7YW 4CKEA 1SNQA 2V4DA 5DM63 2IPKD 1X3QA 2NN6I 4FO2A 1EYCA 4OGQC 5DNFA 3ONAB 2D62A 5G3LD 4P2CB 3HOYB 3A8IE 1BCPF 5KYIA 3WOEA 1SSOA 2RDFA 4JK1C 2XN9C 2IX0A 3I70A 4FP5D 5KNDA 4IFDG 1HA6A 3I72A 4RGOS 3L3OC 2K7VA 3DWAA 1AEXA 3AMUA 4R8NA 1D2BA 3JAME 1WD1A 2IL8A 3GTGB 2KHSA 3TMEA 1YNJD 3NK9A 4G57A 2F0IA 4BBSB 2RDHA 1SBBB 3LX0A 5G3LF 2BA0A 1ZXTA 1LTID 5C0XJ 1U4MA 3EVQA 4ZYSA 5EPJA 3GTOB 3LNNA 2EDGA 2SNMA 3NPPA 3BS1A 4XIGS 1FR3A 4I65A 1CHQD 3MC0B 2F0WA 4BY1B 5CGKA 3V05A 1Q1EA 3TP7A 3C1EA 1STBA 2PZTA 4NW2A 1XXGA 3KLRA 5EPKA 4CJ0B 2B2TA 3D6CA 1OXSC 4KN4C 2ID0A 5IGCA 1PDQA 2O2LD 3KLSA 2H1EA 3CKIB 1ESRA 1TT2A 1HUMA 3UI2A 3MEHA 2N55A 4HSPA 3VR2A 2FFKB 1IHZA 1SYBA 4BBRB 3EROA 1I50B 1LT6D 3E0JA 2K32A 2F0OA 3VR4A 5HGTA 5T1IA 2MUYA 4AYBB 2WINB 4PNYA 1VMPA 5NUCA 2HCIA 4KY7A 3GTQB 1SYEA 1JC7A 1A3TA 4B9WA 4ZLTF 3MXUA 4HAEA 2F3WA 3NP8A 4ME5A 3R8BA 3D4RA 2JSOA 4QF4A 1BOSA 1QOHA 2OEOA 3ND8A 3HOWB 5E3FA 1OXXK 2RA4A 4DFAA 3NQTA 3PUYA 4KKTA 3M4YA 2G9DA 1JR0D 4DAYA 2WKCA 3DM1A 3K58A 3BYYB 5EGTA 1ML0D 5HURA 1K83B 4FXGC 5EKIA 1YNJC 1I3QB 1EYAA 2BDOA 1U4PA 1D6EC 1L0XB 2NN6H 4A3FB 3DEPA 4RCNA 1KLGD 3HP3A 3IKJA 2MPMA 4ZKCB 1LO5D 2PO4A 3NWSA 4BY7B 1CQVA 3TDQA 5C6AA 1Z7TA 1STYA 4KI0A 4A3EB 1C4QA 1RTOA 3MWYW 2NVQB 2JEBI 4J6HA 1RDPD 3Q22A 4KY6A 4WORA 2O5IC 3U9OA 1HA5A 3GTLB 2MP1A 3FPPA 3HEJA 1C48A 3VA7A 1B1ZA 4KK7A 4K6DA 2IT1A 3CRLC 2NTSA 4CKBA 1TY0A 4G4KA 5LHY1 2PNRC 4ZK9B 1EFID 3H09A 2K1BA 2R7ZB 4G7ZC 1PFMA 3A54A 3NTKA 1AFPA 1U4RA 1EY0A 2WB1B 3HZXA 4DK1A 2PW7A 5I6YA 2I46A 1FD7D 2ICIA 1F9SA 3F2UA 3D8GA 1IL8A 4IFDI 2AQ3B 1HHVA 1G8ZD 1KABA 3I91A 4EQOA 4RGTA 1ZEQX 3KBGA 3NQIA 5IIFA 4C3HG 1KDCA 2PYKA 2J0TD 3X3MA 3T56B 5FLXL 1STAA 3Q23A 4CBVA 1SE4A 1FNUA 5JPNC 3BDOA 1DCZA 1LTBD 2D5DA 1NR4A 1MSGA 2L12A 1LTAD 1CK1A 2XNAC 2DN8A 1MI2A 1PTOB 2OXPA 1RODA 1LT5D 1B4OA 1CQFA 4GZYC 3T16A 5D3IB 4OO1I 4K14A 3AB9A 1EY9A 1F2ZA 4DN4M 4XYQA 2CQAA 2L4NA 1SYFA 1SMYC 4DNTB 1NAPA 2OF1A 1MGSA 4HMIA 3PMFA 3BVGA 4CKCA 2R93B 3A55A 4X3UA 5A35A 2HQEA 3Q0AA 1YNNC 4IUPA 1JWUD 1AN8A 1EWHA 2NUCA 3A8JE 3PV0A 1IW7D 5C44B 1GOZA 5K36H 3R2TA 1CI3M 4PMWA 3W2DA 3PUXA 2PQEA 1JWMD 2XWBB 4OHJA 2CW0C 1DJRD 2A69C 5JEAH 3S1RB 1BQQT 3H6MA 1OXUA 1V43A 3P1HA 4KY5A 2KEDA 3KBXA 2B8FA 3DXJC 3H94A 1Y1VB 1F2YA 2Q8IB 4C2MB 2LMCB 3I3CA 1HPCA 4FXKC 1Q12A 1I4GA 1PTOD 4DXFA 1SYGA 3D4DA 4K2LA 2X6GA 4OO1G 3KUPA 5FKAC 1D1IA 3QJYA 3I4LA 2E76C 4KHZA 1WTWA 1WTOA 4DGZA 1EYDA 2TSSA 3S2DB 4FF3A 1SNMA 1Q3LA 4KD3A 3S2HB 1V1PA 2E75C 3J81L 4ULLA 3K5OA 3OIQA 4B9XA 2FHTA 2NB0A 1AZPA 2B2UA 1V1OA 1SJED 4G7OC 1C8CA 3L9AX 3M7NA 3J80E 4FF4A 2RVLA 5FLXE 2AQ1B 3QOLA 3ITPA 3GTMB 2FINB 2IW3A 4ZQ3A 5I2XA 2HUGA 4BWGB 3C3LA 2Q8TA 4EVOA 3M7GA 4NMZA 4C3IG 5CV5A 1TKWB 4K6LA 2F0FA 4WJWA 1EU3A 1D1KA 2QEJC 1JORA 5C5LA 2E2DC 1SE2A 4CHTB 1EQVA 4MHEA 4QIWB 2A6HC 3J7AF 5I2YA 5CV4A 5M5WB 2L0CA 5M3MB 1J8IA 2EYMA 2MHVA 3TP8A 2Z8LA 4IUNA 3EQLC 1H9SA 1FGBD 5EKKA 2R61A 2Y0SB 2J4XA 2OT2A 2F0GA 4XT1B 5JVH3 3FMCA 4NP5A 2IX3A 1XTCD 3GD7A 4M1UB 4RH6A 2JA7B 2XRSD 4N9TA 3HS0C 4IURA 3IFTA 1RF2D 1ENCA 3BZDB 3HGBA 4ZUIA 2B2WC 2EYPA 3A7LA 2F0UA 3QO2A 3DWQA 2B2YA 3NUCA 4CJ1B 3D4WA 4K8IA 2WAQB 5I9OA 5JVG3 3C46A 1QB5D 1SDFA 2CVRA 4KHVA 4IQZA 1SXTA 5D14A 1CT1D 2RBMA 2Q8RE 1TWFB 2O5JC 3FEWX 5ISRA 5JPMC 3GV6A 3SK8A 3T53B 1V1PB 2IJ0A 1SNPA 1I6VC 5JOBA 2K6AA 2F0KA 4IALA 2NZ1D 4Y7NB 1TU2B 2J7ZA 3U9SA 2NN6G 5CYUA 1ZYRC 5C3WA 1SNOA 3I4NB 4TSSA 3S14B 2A74C 3A7AB 1ESFA 1HFNA 3MFGA 4RWSC 2BE5D 4BS9A 5KNBA 3FVQA 1X32A 4HSVA 4N9PA 3BDLA 1EZ6A 1I4PA 3J81E 1U9RA 1S5BD 1Y8NB 4XXEA 2B63B 1B53A 1AP0A 1G6ZA 3A56A 1DONA 5C5MA 2KOLA 2KCCA 3TN2A 4U68A 1QJOA 2JA6B 5FO7B 1GUGA 1I4XA 1IYVA 1BCPC 1F9PA 1RD9D 2B2YC 3GO5A 1TS3A 2F0JA 3T4AC 3W3AA 5BN5A 2KEEA 4UDUC 4IUQA 3K57A 1TIID 2VXWA 1WVLA 4IUVA 3QOJA 4I7ZC 1EQTA 5EPLA 2EYHA 4UAIA 2F0EA 1PFBA 2R3ZA 1GHJA 5CBEE 1EWCA 1QWYA 3OHXC 3GTJB 3MFYA 1H9JA 5M5YB 1VMCA 3MHBA 4K8JA 1UUPA 3R2IA 1ONLA 4F88A 2KECA 1LABA 1E0BA 2R6GA 4C3JG 1JQYD 1EEFD 5JAVA 2QKIC 4S3SA 1PRTC 2DY7A 3GP7A 4ZKBB 1BDOA 1SYCA 1QE6A 5BN4A 2IX1A 2O4XA 1AZQA 5C4XB 1GUTA 3QWNA 3TP6A 2SOBA 3EA6A 3CQZB 4K5XA 2LS01 4RHRA 3SR1A 4HCEA 3G7LA 2CHBD 2F3VA 2KUMA 1KDAA 5C3EB 5IGFA 4OO1H 3CHBD 2EJGC 2AQ2B 1UEAB 2KJXA 2M00A 4A3BB 5IOCA 1SJHD 4QCLA 1D5XC 4DU9A 1O78A 4RCOA 3LWUA 1G91A 3S16B 1A6XA 1EOTA 2JYOA 4RKBA 5IODA 3KK7A 4TKOB 1PMRA 2E2HB 3I4MB 5IT9L 1RHPA 1JWSD 2ZT9C 1BUVT 4ILWA 3WDNA 1B3AA 2VB2X 3VYSA 4LJZC 1J9OA 2EOTA 4IUUA 1S4ZA 4WRDA 4NKLA 4A3GB 2DNCA 1WTPA 5J39A 3SK4A 1ILPA 1HQRD 2EJFC 3D3RA 5C0XH 4ODGA 1HCZA 4HR7B 1B9MA 3KLSX 1NSNS 1RKNA 4X3KA 2EYJA 2A6EC 3OIPA 3BDCA 3C1FA 4TRDA 1KTKA 3MTSA 3VR6A 1ENAA 3NBHA 4KKSA 5CORA 2EZVA 2H4OA 1F2MA 4U673 3K6OA 1QILA 1SNCA 1Q1BA 3QB3A 1EU4A 2B2WA 5C4JB 4ZAIA 2B2VA 2ZXRA 4XQQA 3FRPB 1HTPA 5JEAJ 1FNWA 3S15B 1DM0B 1UNSA 3OWEB 3R3OA 2Z4HA 2NVYB 3MA2B 1L0YB 3K59A 2HDLA 1IKMA 4KTAA 3SVMA 5F2DA 1Q8IA 1TWCB 4C3JB 4B08A 1DXMA 4DAVA 1GHKA 5C0XG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U4P A;  2HDM A;  5D14 A;  1EIH A;  2Q8T A;  4HED A;  2EPB A;  2K05 A;  2XIW A;  2Q8R E;  1EQT A;  1RHP A;  3DEP A;  1KNA A;  5EPL A;  1F9Q A;  2L1B A;  3HP3 A;  3I8Z A;  1BF4 A;  4X3S A;  5EJW A;  1A15 A;  2MPM A;  1QNK A;  4UAI A;  4ZKC B;  5E4X A;  1PFB A;  2KED A;  3GV6 A;  2R3Z A;  3KBX A;  4NW2 A;  4QUF A;  5CBE E;  1B2T A;  1RTN A;  3FPU B;  1GUW A;  1G2T A;  3R93 A;  5EPK A;  4CJ0 B;  2B2T A;  5CBA E;  1NR4 A;  1B3A A;  1EIG A;  1MSG A;  2L12 A;  2RSN A;  1HRJ A;  4O42 A;  3I3C A;  1KNE A;  1RJT A;  5EQ0 A;  1QG7 A;  2MJ8 A;  2N88 A;  1O7Y A;  1J9O A;  1PDQ A;  2K03 A;  2EOT A;  2NZ1 D;  2RSO A;  1TVX A;  4IUU A;  5T1G A;  1CA6 A;  1NCV A;  1VMC A;  1RTO A;  1O7Z A;  1JE4 A;  1MI2 A;  1S4Z A;  2J7Z A;  3MWY W;  2H1E A;  1ESR A;  1WTP A;  1ROD A;  4MHE A;  2JP1 A;  4XDX A;  1B4O A;  2KEC A;  1ILP A;  1HUM A;  1X3Q A;  1E0B A;  3UI2 A;  2SDF A;  2X6G A;  2N55 A;  3Q6S A;  3KUP A;  3LWE A;  4R9W A;  2B2U C;  2MP1 A;  4XT3 B;  1X3P A;  5DNF A;  1F2L A;  3ONA B;  2DY7 A;  4DN4 M;  1J8I A;  3I90 A;  1DOL A;  2FFK B;  1HFN A;  4ZKB B;  4X3K A;  4RWS C;  1QE6 A;  2BDN A;  2X69 A;  1HFG A;  1X32 A;  2K04 A;  1SSO A;  2K28 A;  2KVM A;  2L4N A;  4HSV A;  4IUT A;  4MN3 A;  4R8I A;  1G2S A;  1AZQ A;  3GV3 A;  3D6W A;  1WTO A;  1WTW A;  5T1I A;  3MTS A;  4ZK9 B;  4LMQ D;  1HA6 A;  1PLF A;  1NAP A;  2DY8 A;  1BO0 A;  2K1B A;  2EE1 A;  2MGS A;  5COR A;  4XT1 B;  1Q3L A;  1NR2 A;  1PFM A;  1VMP A;  3TZD A;  1MSH A;  1WTV A;  1XX8 A;  1MGS A;  1B53 A;  4OIJ A;  3G7L A;  1CM9 A;  3N52 A;  1WTX A;  2B2T C;  1AP0 A;  2HCI A;  1G6Z A;  4QUC A;  1DON A;  4X3T A;  2HCC A;  1M8A A;  1JIC A;  2B2W A;  1B50 A;  2KUM A;  3IFD A;  1CA5 A;  1U4R A;  2KOL A;  4X3U A;  1WD1 A;  2IL8 A;  2NWG A;  5JJZ A;  1DZ1 A;  1O80 A;  2B2V A;  1ICW A;  4IUR A;  4ZAI A;  3P7J A;  5D65 A;  4RA8 A;  4ZLT F;  4HAE A;  3TN2 A;  5E4W C;  1EL0 A;  2FHT A;  4U68 A;  1LV9 A;  5COY A;  1AZP A;  2B2U A;  2B2W C;  1IKL A;  4IUP A;  2L11 A;  2NYZ D;  1F9R A;  5CMD A;  1SAP A;  1F9S A;  1WD0 A;  1F9P A;  2FMM A;  3QO2 A;  2B2Y A;  2D9U A;  2K01 A;  5AFW A;  1G91 A;  3F2U A;  2B2Y C;  2X6L A;  4CJ1 B;  2FJ2 A;  2B2V C;  1ZXT A;  1WTR A;  1C8C A;  1BNZ A;  2L9H A;  1U4M A;  2RA4 A;  1PFN A;  2RVL A;  1EOT A;  1IL8 A;  4HCS A;  2HDL A;  1WVL A;  1IKM A;  1HHV A;  5EPJ A;  1ILQ A;  4RAU C;  2M2L A;  3DM1 A;  1SDF A;  2JYO A;  3FDT A;  4CJ2 C;  3SVM A;  1XYI A;  1BBX C;  1WTQ A;  4OIK A;  2KEE A;  2CVR A;  4IUQ A;  3I91 A;  1ML0 D;  2FIN B;  1DOM A;  1DOK A;  2VXW A;  5EKI A;  3IL8 A;  1HUN A;  1U4L A;  3DEO A;  2HUG A;  3H91 A;  4IUV A; 
#chains in the Genus database with same CATH topology
 3VA5 A;  3QIA A;  3CCE A;  3GTJ H;  1S40 A;  1XTD A;  2EPB A;  2K05 A;  2FMC A;  4B3M Q;  4C3I B;  5GRO A;  3HKZ B;  5C4Z A;  4JI8 L;  1O7L A;  2F0P A;  3HOX H;  3O13 A;  5KRU A;  1QNK A;  1HNX L;  3DUZ A;  4A3I H;  1A2T A;  3MXN B;  1RTN A;  4XQJ A;  2ZM6 Q;  4X62 L;  4JYA L;  4A93 H;  1I5F A;  4CDF C;  1IXR A;  2JEA I;  2UU9 Q;  1HRJ A;  2I07 B;  1QUQ B;  1LTG D;  4K2K A;  3TBI B;  1YIT A;  5J1Z A;  1QNU A;  5J22 A;  3NXW A;  4G7H C;  2WV6 D;  1GVP A;  1GXD C;  4LAA A;  2KHI A;  3LWE A;  1T5E A;  2B2U C;  4OWW B;  5DAU A;  3CCS A;  1I4H A;  3TEH B;  1EQQ A;  3PF5 A;  3FKI B;  2UXC Q;  5IGD A;  5CV7 A;  1HTL D;  4OWX B;  1XPU A;  4LUV A;  4DK0 A;  4EGV A;  2YTY A;  1K8M A;  5IYB H;  1I4R A;  2SEB D;  2ICE C;  3NWT A;  2PZW A;  2DY8 A;  3NE5 B;  4P74 A;  1U5K A;  5C4H A;  3M4Q A;  1AW7 A;  3F2D A;  3IAY A;  4ZRZ A;  3PO2 H;  4Q0F A;  3S16 H;  3PF4 A;  3AU7 A;  1AE3 A;  4PZ8 A;  3NEL A;  4X3T A;  2BH8 A;  4LFA Q;  2JK8 A;  2IHE A;  2PMZ B;  1O80 A;  2N8N A;  1LT4 D;  2F0L A;  1A3U A;  2IHF A;  1I94 Q;  3NHH A;  3NBI A;  1JB3 A;  1LTT D;  1PZI D;  3HOY H;  2VB3 X;  3TRE A;  2HQL A;  5DLQ E;  1DD2 A;  4E6I A;  4B3T L;  3S17 B;  1KAA A;  1F9R A;  3KYH C;  2I5H A;  2QIL A;  2D9U A;  5AFW A;  4PV1 C;  3HRZ C;  2G5D A;  3ERQ A;  3OTO L;  2LXK A;  3RMH A;  3OW7 A;  1TWF H;  4BBS H;  1E2Z A;  4C56 C;  3V2T A;  3GTK B;  1NMF A;  2ENB A;  4NXN L;  5CV6 A;  4DPG A;  4IOA A;  3CCV A;  5EKL A;  2K5W A;  5FO9 B;  1GUS A;  3PUZ A;  4RFB A;  4L5T A;  2GA4 B;  5M9O A;  1K0S A;  2F0M A;  4Y7N H;  1D5Z C;  2EY5 A;  4X3S A;  1YJ9 A;  1EWI A;  1PTO H;  3CC2 A;  3KFU A;  5KEE A;  2K33 A;  2TMP A;  4Z9C B;  4IFD J;  4B3R L;  3OWF A;  2AUJ D;  2ATW A;  1G2T A;  4DV0 L;  4X62 Q;  3KF8 A;  2F4I A;  3DM3 A;  4O42 A;  4FNF A;  4YIJ A;  4UP9 A;  1KNE A;  3G6J B;  5ELE A;  1S5E D;  2MJ8 A;  1WI5 A;  1LLR D;  2A68 D;  1QZH A;  2P5Z X;  1H9S B;  1JE4 A;  1MBY A;  5M3F B;  2B8G A;  5CR3 A;  3SEB A;  4JI3 Q;  1S5C D;  1PXU A;  2DGY A;  5CV9 A;  5DM7 3;  3HOV B;  4K5W A;  3RLN A;  1WFQ A;  5A2Q E;  2YTX A;  3CME A;  4DV4 Q;  2L55 A;  2SDF A;  3A5Z B;  4L6T B;  4B3S L;  1CZW A;  2N3S A;  3CMA A;  4LF6 Q;  1S3O A;  4XT3 B;  4GLX A;  3BZC A;  1LTR D;  4FXD A;  1YEZ A;  5I6W A;  1DOL A;  1E2V A;  2UXD Q;  4KD4 A;  3GQB A;  3M3Y B;  4IUT A;  3J81 j;  4R8I A;  1XNQ L;  1TWG B;  2BCO A;  4L8J A;  1STN A;  1NE3 A;  4PMB A;  2MGS A;  4DAP A;  1DYQ A;  1WTV A;  1WTX A;  2JA5 H;  1YNX A;  3S15 H;  1CM9 A;  5ELC A;  3MAQ A;  4GKJ L;  1T9H A;  2HCC A;  1M8A A;  5C0X I;  5LL6 X;  1KC8 C;  2F0S A;  1DZ1 A;  5K36 G;  3P7J A;  1XPO A;  1PH7 A;  3SHL A;  3NTI A;  4B3T Q;  1EY7 A;  1N34 Q;  3PO2 B;  5CMD A;  4A3K G;  1SAP A;  2JE6 I;  5KGU A;  1UEB A;  4K0K L;  2K5N A;  1SFO H;  2AWO A;  4M8A A;  1NUC A;  1OO9 B;  3K0X A;  3OSO A;  5FJ8 H;  1ET6 A;  4YHH Q;  5IT9 E;  3IRB A;  2VUM G;  1ZKO A;  4HJ5 A;  3CCJ A;  4BA1 I;  1TQO A;  2EXZ A;  1BCP B;  1WTH A;  1XNR L;  3VR3 A;  4PQX A;  5KNC A;  5KYL A;  2RQX A;  2PZU A;  4L5Q A;  1ET9 A;  4ME3 A;  3DHQ A;  2Z1C A;  1N34 L;  3NEN A;  5D3D A;  1EIH A;  4ZUJ A;  4A3M G;  5J3B A;  1JOO A;  1E2W A;  1KNA A;  2CQO A;  4H13 C;  2ZXO A;  5IE8 A;  1IYJ B;  4DR5 Q;  3D0F A;  4KMU C;  5E4X A;  3KJP A;  2R92 B;  3S1Q H;  1Y8P B;  1WCM B;  5IT9 c;  1SYD A;  4BBR H;  4H02 A;  4X64 L;  3K5N A;  1CKN A;  3S9W A;  3S1M B;  4A93 G;  2F03 A;  3PIO 3;  4NB3 A;  4QJF A;  2ZTC A;  2NVX B;  1K8A C;  4GN3 B;  1VQN A;  3S1R H;  3M4O B;  1PZK D;  3AQQ A;  2VUM B;  4H7B A;  3K5M A;  2ZJQ A;  2CFM A;  3VR5 A;  5L37 A;  4DV2 L;  4A3J B;  3S2D H;  5I9P A;  2I0Q A;  4WJ3 M;  2A19 A;  1HH2 P;  1HNX Q;  2Z0S A;  4V0B A;  4FF2 A;  2UUC Q;  5M3F G;  4NDX A;  1XWE A;  2E2I H;  2R7D A;  1HZ9 A;  4LUZ A;  2EY2 A;  2X69 A;  4R4O A;  1EY8 A;  2K04 A;  3BVZ A;  3BG3 A;  4HIK A;  5LMN Q;  1PZJ D;  4A3E H;  2R92 G;  3HG9 A;  3ULP A;  3PUW A;  4JBM A;  4UP8 A;  4IPC A;  4R1J A;  1BO0 A;  4RGN A;  4F8M A;  2AWN A;  2HT1 A;  3T51 B;  3CU7 A;  3MZ5 A;  4IZ8 A;  3MXN A;  4CDC C;  1JIC A;  2F3I A;  4XYO A;  1BBW A;  5JJZ A;  3T1Y Q;  4OEM B;  3QG1 A;  2XGT A;  3T1Y L;  3KF8 B;  3L2P A;  3CW2 C;  2B39 A;  1EL0 A;  4R4I A;  2YU9 B;  1SEB D;  1I3Q H;  1GUO A;  4JBW A;  3HKS A;  1UE6 A;  3CCM A;  4JC0 A;  1WD0 A;  3SK5 A;  2VNU D;  1VQF A;  1CFM A;  4A3F G;  5JJI A;  1YI2 A;  1H95 A;  3CRK C;  1CZG A;  3S1Q B;  2WAQ G;  3E5S A;  1I6H B;  3J7A V;  1H9M A;  1PFN A;  1T5X D;  2CWP A;  1K3B C;  4PMC A;  5C3X A;  2OWO A;  1BCP D;  2ZXP A;  2M2L A;  3FDT A;  5CV8 A;  1K8O A;  2Q2I A;  4LF8 Q;  4DAM A;  4EQP A;  3HOU H;  2Z9H A;  5IGB A;  3TS2 A;  3H91 A;  4JI7 L;  2NVY H;  4HJA A;  3KJO A;  4DV6 Q;  2XIW A;  2SNS A;  1LTL A;  3T13 A;  1STH A;  2K5Q A;  4DR2 Q;  3OMC A;  1LYL A;  5EJW A;  1SFO B;  1SE3 A;  1TS2 A;  4C1N K;  2CCZ A;  4ABN A;  1Q7Y C;  4QIW E;  3J80 L;  2C5C A;  5E1F A;  2C9O A;  2PW5 A;  3FPU B;  4JI0 Q;  1GUW A;  1HZB A;  3FP9 A;  5FOB B;  4A3D B;  4IN3 A;  4OON A;  1J5E L;  2N88 A;  3VYU A;  5C4X G;  1AE2 A;  1CA6 A;  2BE5 C;  2F0D A;  3HOX G;  1Q81 C;  4A3C G;  3HOV G;  1CTM A;  1EZ8 A;  4TQU S;  5CC4 A;  4A76 A;  3V96 A;  1PYW D;  4APV A;  4WFN 3;  1IBM L;  5FO8 B;  3E6Z X;  3ND9 A;  4TVA B;  4OL7 A;  1ZYR D;  3PO3 B;  1PYB A;  4DF7 A;  3HOU G;  1D5M C;  1Z47 A;  2XWJ B;  2JA5 B;  1X3P A;  1B44 D;  2I5M X;  3I56 A;  1EQR A;  2A68 C;  2K28 A;  2NTT A;  4JI5 L;  1TY2 A;  3P75 A;  1G2S A;  3GV3 A;  3D6W A;  1HXY D;  1XMQ L;  3I4N H;  3CPF A;  1B9N A;  3J80 c;  1NR2 A;  3TZD A;  2EVB A;  5IGG A;  1XX8 A;  2B2T C;  1JCK B;  2E2I B;  4LF5 Q;  4DUY L;  5FK9 C;  1PH6 A;  3BVM A;  1CA5 A;  2LKV A;  3D31 A;  5K5P A;  1R4Q B;  5FJ8 G;  5D65 A;  2XVS A;  1A2U A;  1KRS A;  1TWA B;  2F0Q A;  3OMG A;  5LMN L;  3HOZ B;  3SGI A;  2L11 A;  3OOC A;  1R9T B;  2YYZ A;  1G29 1;  5IP9 G;  4C3I H;  3MXP A;  3OYY A;  4N8F A;  2K01 A;  1YJW A;  2LY7 A;  1FJG Q;  2JA8 G;  2EY6 A;  4A3E G;  2R92 H;  1KDB A;  1WCM H;  3H3V C;  3STB C;  1Z9F A;  4DV0 Q;  2D0P A;  4RAU C;  4CJ2 C;  4DNI A;  2ZM6 L;  2UXD L;  3UDG A;  1RCV D;  3H3V H;  3URY A;  1EY5 A;  2EYF A;  2K5H A;  3IL8 A;  1U4L A;  5TSS A;  4YY3 Q;  1ICF B;  2WFW A;  2N78 A;  2QDB A;  1PH3 A;  3S24 A;  1R4P B;  2E74 C;  1II3 A;  4GOP C;  5JEA G;  1STG A;  1A15 A;  3PO3 H;  1HNW L;  3OTO Q;  1OXV A;  3Q24 A;  2RDG A;  1VCI A;  2AUK A;  2OQK A;  1EEI D;  2F1M A;  4L63 B;  4A3F H;  2KCM A;  4KJN A;  1Y1W B;  2K03 A;  2F4V Q;  1L1O C;  3JC6 6;  2BH2 A;  2VQE L;  1JOK A;  4XDX A;  4HMJ A;  4IFD H;  4JOI A;  2EY1 A;  5E7N A;  2EJM A;  4CGY B;  4JBJ A;  3FHW A;  2A6H D;  4YHH L;  5KIX A;  4KN7 C;  2VS1 A;  4R9W A;  3P20 A;  4A3I G;  1F2L A;  4XQN A;  2QF7 A;  2DNE A;  4MIU A;  4A93 B;  1MD2 D;  2JJQ A;  2BDN A;  3ZYY X;  4LF8 L;  2PNH A;  3K7A B;  1HFG A;  2WB1 G;  4MN3 A;  3ICE A;  1IBK L;  1PH9 A;  3GTG H;  4JI7 Q;  3U50 C;  1FVI A;  2CH4 W;  1PVO A;  3JAM L;  1B70 B;  1PLF A;  2B63 G;  2EYO A;  1MSH A;  1HNW Q;  1CKM A;  2UUA Q;  1SRO A;  3N6R A;  4YCU A;  4LWC A;  1B50 A;  1F77 A;  2NWG A;  1Q90 A;  3K0Y A;  4JI6 Q;  1ICW A;  1S5D D;  1I6H H;  4KKU A;  4DR3 L;  4DNR B;  5E4W C;  4A3J G;  1Y8O B;  1VF5 C;  1B8A A;  1LV9 A;  5COY A;  2L5T A;  2MO0 A;  4XTC S;  1IKL A;  3A8K E;  3SK6 A;  2NYZ D;  4DV6 L;  2JA5 G;  2M9V A;  2PPB C;  1HQM C;  4KHP Q;  3EJI A;  4JV5 Q;  3NSW A;  2FJ2 A;  2B2V C;  2PCF B;  4KJO A;  2F0T A;  2QCP X;  1LAC A;  2KBN A;  2VL6 A;  3HOX B;  4JYA Q;  4J8Q A;  1BBX C;  2WAC A;  1GUN A;  1DOM A;  1S5F D;  1I4Q A;  1KHI A;  1WJJ A;  4HJ7 A;  2VY3 A;  3S1N B;  1KD1 C;  4A3D H;  1K0R A;  1L1O B;  1RL2 A;  3I73 A;  2QEX A;  4DXG A;  4FYD A;  4HED A;  5I4D A;  3TP5 A;  1N36 L;  2L1B A;  2ZTD A;  4DV2 Q;  1BF4 A;  3RLF A;  1X6O A;  2KA7 A;  1JOQ A;  2WP8 J;  1XMO L;  2NBF A;  2EIF A;  1EY4 A;  5CBA E;  3K7A H;  2BOS A;  4A3L G;  4JI5 Q;  2QDL A;  4GOP B;  2D2C C;  1O7Y A;  2A6E D;  4JPB W;  1YHA A;  3M85 A;  3TQY A;  1NCV A;  1O7Z A;  2K14 A;  4RGM A;  5DEH A;  4A3K H;  4DR4 Q;  1NNX A;  1QCB D;  2JP1 A;  3S2H H;  4A3M H;  3RLO A;  3AFP A;  4JI4 L;  3Q6S A;  2XRQ D;  3EFX D;  4H44 C;  3RZD B;  1M1K C;  4EQ5 A;  2NVT B;  1H9K A;  4LF7 Q;  2Z4I A;  2NVQ H;  3NTH A;  1GO3 E;  1PTO C;  2VUM H;  5JJK A;  3HOZ H;  5C3E H;  3E0E A;  5LL6 S;  1Z6H A;  2EXD A;  4LMQ D;  2E2J B;  1HR0 Q;  1BR9 A;  2OTJ A;  4F7X A;  2EE1 A;  4X65 L;  2KQ3 A;  5HGQ A;  1VDZ A;  4K5V A;  3N52 A;  3J81 i;  3RZO B;  4FF1 A;  2JXM B;  1TR5 A;  3PUV A;  1Y69 U;  4DA2 A;  3L7Z C;  3BYT B;  4LFB Q;  3WOF A;  1OXT A;  3VYR A;  2Q2T A;  2HHH L;  4YCV A;  4P72 A;  3S1N H;  2A69 D;  5EBD A;  5EBC A;  4Q5V A;  3OPO A;  2R7Z H;  2CW0 D;  4QGU A;  1IBL L;  3TZU A;  4CDE C;  4IPD A;  3NEM A;  2FMM A;  4LK1 C;  2G9H D;  2X6L A;  1BNZ A;  2L9H A;  1IW7 C;  2Z6K A;  2BA1 A;  1PRT F;  4LFA L;  1PTO F;  4JI1 Q;  1A3V A;  5ELB A;  3VYT A;  5BN3 A;  4LFC L;  1WTQ A;  4OIK A;  1DOK A;  2AMC B;  1YNN D;  4LF4 Q;  4EQN A;  5C44 H;  4HTH A;  4HN7 A;  3EIV A;  1F9Q A;  1Q46 A;  1TS4 A;  2WKD A;  2QGQ A;  2IWH A;  1PH5 A;  1N36 Q;  1ENF A;  4JI4 Q;  4QQB X;  3X3N A;  3HOU B;  3CF5 A;  1B2T A;  5A2Q L;  1C7Y A;  2UUB Q;  3DWP A;  1WCM G;  4GKK L;  4P73 A;  5ELD A;  4JBK A;  1SMY D;  5M5W H;  1FNV A;  2RSN A;  3M9B A;  3RD4 A;  2A73 B;  2RSO A;  1TVX A;  1FYC A;  3K5L A;  4DV5 L;  3DMU A;  1KLU D;  1FL0 A;  3K8A A;  1PRT D;  1PH4 A;  3OW2 A;  3GTP B;  2K5D A;  4J1M A;  2F0H A;  3PIP 3;  2WII B;  5IYC G;  4H0L C;  2LFN A;  2EYL A;  4QMG A;  3SXH A;  2RKS A;  4DUZ L;  3SDZ A;  4B3R Q;  3I2Z A;  3RUZ A;  4A3I B;  2AHO B;  3I90 A;  2NVX H;  1LTS D;  1E22 A;  4Y52 H;  2F0N A;  3U4V A;  1CKN B;  2VZA A;  4ID6 A;  2XSC A;  2ALY B;  1STE A;  2KVM A;  3SE0 A;  3MXG A;  5IP7 H;  1UAP A;  4F87 A;  1CUK A;  3MVV A;  4KV6 A;  4UHV A;  1K3R A;  5IWA Q;  4BY7 G;  4GLV B;  4A3K B;  1V8Q A;  3H0G B;  4UP7 A;  4C1N I;  1HNZ L;  4HJ8 A;  1A62 A;  3LGJ A;  4OIJ A;  4O1N A;  4OX9 Q;  1SND A;  4QUC A;  5ELF A;  1VQB A;  3IFD A;  3FKI G;  1VQH A;  2ZTE A;  4RA8 A;  1EY6 A;  4BXX H;  5IGE A;  1MJC A;  1S72 A;  1KL9 A;  4RKL A;  3TSS A;  1LT3 D;  3CC7 A;  1SE8 A;  4C3H B;  4DR6 Q;  3GTQ H;  1VF7 A;  2JA8 B;  1M4V A;  5M5X B;  1MIU A;  1VQJ A;  2KCN A;  1WTR A;  3C2P A;  4DR5 L;  3Q8D A;  4HCS A;  4R4Q A;  2WB1 E;  1ILQ A;  1CHP D;  4LUO A;  1XYI A;  1JJ2 A;  3CPW A;  4V19 0;  1TS5 A;  1W6K A;  3ER0 A;  2MNA A;  2F0V A;  3KDF A;  3AYH B;  2K75 A;  1GJX A;  1HUN A;  3DEO A;  1BXT A;  5EQ0 A;  2A5H A;  4FVM A;  2HDM A;  4L5S A;  4BA2 I;  1W6J A;  4N8X 1;  1IYU A;  1H9R A;  4A3M B;  3I8Z A;  4A3C H;  3F1Z A;  2N49 A;  2KEN A;  1TWH B;  4QUF A;  3TRZ A;  3R93 A;  1EIG A;  1HZA A;  4QB4 A;  1RJT A;  1QG7 A;  1PRT B;  4RHS A;  5T1G A;  3AFQ A;  3J7Y W;  4CKE A;  4A75 A;  1SNQ A;  2V4D A;  3ERS X;  5DM6 3;  2IPK D;  1X3Q A;  2NN6 I;  4FO2 A;  4JI8 Q;  5IYB G;  4BXX G;  3J7A 5;  1EYC A;  4OGQ C;  3GDE A;  4UPA A;  5DNF A;  2GVB A;  3ONA B;  3K7U C;  2CWA A;  2D62 A;  2L15 A;  5G3L D;  4A4I A;  4P2C B;  3HOY B;  1TWA H;  3A8I E;  4A3B H;  1BCP F;  5KYI A;  3WOE A;  1SSO A;  2RDF A;  4JK1 C;  3KF6 B;  2XN9 C;  2IX0 A;  2NZO A;  3I70 A;  4C3H H;  4FP5 D;  5KND A;  4IFD G;  1HA6 A;  3I72 A;  1V9P A;  2VW9 A;  1L2F A;  4RGO S;  3L3O C;  2K7V A;  1W2B A;  1CKO A;  3DWA A;  4QY7 A;  5HY6 A;  1AEX A;  2ES2 A;  3W1B A;  3AMU A;  4R8N A;  4DUZ Q;  1IL2 A;  4PZ7 A;  3JAM E;  1D2B A;  4DK3 C;  1N33 L;  1VQO A;  1WD1 A;  2R93 G;  2IL8 A;  1MJE A;  4LFC Q;  4JCV E;  4ALP A;  2KHS A;  3GTG B;  3TME A;  1YNJ D;  3FKI H;  4G57 A;  3NK9 A;  2F0I A;  4BBS B;  1JJG A;  1KXL A;  2MFI A;  4NXN Q;  4IO9 A;  3A5U A;  2RDH A;  1PH2 A;  1VQL A;  1SBB B;  3LX0 A;  3HOY G;  5G3L F;  2BA0 A;  1ZXT A;  1LTI D;  5C0X J;  1U4M A;  3EVQ A;  2DJF C;  4ZYS A;  4DR1 L;  5EPJ A;  4IPH A;  3GTO B;  3J80 i;  3LNN A;  2EDG A;  1Y1W H;  2QA4 A;  2SNM A;  3NPP A;  3BS1 A;  4JVZ A;  3CXC A;  1Y14 B;  4XIG S;  1FR3 A;  4I65 A;  1CHQ D;  3MC0 B;  2F0W A;  1VQM A;  4BY1 B;  5CGK A;  3V05 A;  1Q1E A;  4DR2 L;  1VQE A;  3TP7 A;  2PQA B;  3C1E A;  1IBM Q;  1EIY B;  1STB A;  2PZT A;  4NW2 A;  1XXG A;  3KLR A;  5EPK A;  4CJ0 B;  2B2T A;  3D6C A;  1OXS C;  4YCW A;  4KN4 C;  2ID0 A;  5IGC A;  1J5E Q;  1PDQ A;  2O2L D;  3KLS A;  1WOC A;  4X6A H;  4QL5 A;  5LMU L;  2H1E A;  3CKI B;  1ESR A;  3H15 A;  1TT2 A;  1HUM A;  3J81 c;  3UI2 A;  3MEH A;  2EQS A;  2N55 A;  5M3M G;  4HSP A;  3RR5 A;  5C4J H;  1YHB A;  4R4C A;  3VR2 A;  2FFK B;  1IHZ A;  1SYB A;  4BBR B;  3ERO A;  1I50 B;  1LT6 D;  3E0J A;  2K32 A;  2F0O A;  3HFZ B;  4JG2 A;  1W3S A;  3VR4 A;  1N9W A;  1X55 A;  5T1I A;  5HGT A;  2MUY A;  4AYB B;  2WIN B;  4AIM A;  1UE5 A;  4PNY A;  1VMP A;  5NUC A;  5GAD C;  5FLX c;  2HCI A;  4KY7 A;  3GTQ B;  5AJ3 Q;  1SYE A;  4AQY Q;  1JC7 A;  1A3T A;  4B9W A;  4P71 A;  4ZLT F;  3MXU A;  4C3J H;  4HAE A;  2F3W A;  3NP8 A;  4ME5 A;  2E2J H;  2R7F A;  3R8B A;  1SN8 A;  2MO1 A;  3D4R A;  1ASZ A;  2JSO A;  1XNQ Q;  1M90 C;  3PO3 G;  4QF4 A;  4POF A;  1BOS A;  4MTK A;  1VQP A;  1QOH A;  2F52 A;  2OEO A;  3ND8 A;  4GNX C;  1LM0 A;  3HOW B;  5E3F A;  1OXX K;  2RA4 A;  4DFA A;  3NQT A;  3PUY A;  4KKT A;  3M4Y A;  2G9D A;  3BZK A;  3CCU A;  1JR0 D;  4DAY A;  3S1M H;  2WKC A;  3DM1 A;  3K58 A;  2OCE A;  3BYY B;  2A8V A;  5EGT A;  2RHQ B;  3JAM i;  1ML0 D;  5HUR A;  1K83 B;  4FXG C;  5EKI A;  3E9H A;  1YNJ C;  1I3Q B;  1EYA A;  2BDO A;  1XJV A;  1U4P A;  1D6E C;  1L0X B;  2NN6 H;  4A3F B;  3ULL A;  3DEP A;  4RCN A;  1KLG D;  3HP3 A;  4JV5 L;  3IKJ A;  2MPM A;  4ZKC B;  1LO5 D;  2PO4 A;  1QZG A;  3NWS A;  4BY7 B;  1CQV A;  3TDQ A;  5C6A A;  1Z7T A;  3HKZ G;  1STY A;  4KI0 A;  2HIV A;  4A3E B;  4IJL A;  1C4Q A;  1RTO A;  3MWY W;  2NVQ B;  2JEB I;  4J6H A;  1VQD A;  1RDP D;  1EYG A;  3Q22 A;  3H0G G;  4P75 A;  2Y0S E;  4KY6 A;  1CSP A;  4WOR A;  5BR8 L;  2O5I C;  3U9O A;  1YVC A;  1HA5 A;  1PV4 A;  3GTL B;  2LXJ A;  3I7F A;  1GKH A;  2QW7 A;  2MP1 A;  3FPP A;  3HEJ A;  1C48 A;  4HIM A;  4LF7 L;  3VA7 A;  4RMF A;  1B1Z A;  4IOC A;  4NXM Q;  4KK7 A;  2HHH Q;  2JA7 H;  4K6D A;  2IT1 A;  3CRL C;  3HOW G;  2NTS A;  1JJC B;  4CKB A;  1TY0 A;  4G4K A;  5LHY 1;  1C0A A;  2PNR C;  4ZK9 B;  1EFI D;  3H09 A;  3M4O H;  2K1B A;  3ZJY C;  4G7Z C;  5GQO A;  5GAH C;  4POG A;  1PFM A;  3A54 A;  2R7Z B;  4DV1 L;  2E5L L;  1A8V A;  1L1O A;  3NTK A;  1AFP A;  3GTO H;  4NPS A;  1U4R A;  3S14 H;  1TWC H;  1EY0 A;  2WB1 B;  3HZX A;  4DK1 A;  3H0G H;  2F4V L;  2PW7 A;  2JA9 A;  5I6Y A;  2I46 A;  1FD7 D;  2ICI A;  1F9S A;  3F2U A;  3D8G A;  4OX9 L;  4DAY B;  1IL8 A;  4IFD I;  1E1O A;  2AQ3 B;  1HHV A;  4WJ4 A;  2C35 B;  1G8Z D;  3S17 H;  1KAB A;  3I91 A;  4EQO A;  4YY3 L;  4RGT A;  1ZEQ X;  3KBG A;  4EX5 A;  3NQI A;  5IY0 A;  5IIF A;  4C3H G;  1KDC A;  3A0J A;  3I4M G;  4A3D G;  2PYK A;  2J0T D;  3X3M A;  3T56 B;  2PMZ E;  5FLX L;  4IPG A;  1STA A;  1UE1 A;  3Q23 A;  4CBV A;  1UWV A;  2ZJR A;  1SE4 A;  1FNU A;  5JPN C;  4AQY L;  3BDO A;  4A3L H;  1DCZ A;  1LTB D;  2D5D A;  2UUB L;  1NR4 A;  1MSG A;  2L12 A;  4GKK Q;  1LTA D;  2Q2H A;  1CK1 A;  1K73 C;  3PIO A;  2XNA C;  2DN8 A;  3H3V I;  1MI2 A;  1PTO B;  1IZ6 A;  1FGU A;  2OXP A;  1ROD A;  1LT5 D;  1PFS A;  1B4O A;  4BY7 H;  3BU2 A;  1CQF A;  4GZY C;  3T16 A;  5D3I B;  5ELN A;  4OO1 I;  1QVC A;  4K14 A;  3AB9 A;  1EY9 A;  2JA7 G;  3PSI A;  1F2Z A;  4DN4 M;  4XYQ A;  5M5Y H;  4UY8 C;  1I94 L;  4YWK A;  1XNR Q;  4BBS G;  2CQA A;  2L4N A;  3GTP H;  1BKB A;  1SYF A;  1SMY C;  2Y0S G;  4DNT B;  2JA8 H;  1NAP A;  2OF1 A;  2YTV A;  1MGS A;  1EUJ A;  4HMI A;  3PMF A;  1NTG A;  3BVG A;  4PZ6 A;  3E3X A;  4CKC A;  1Q82 C;  1X9N A;  2R93 B;  3A55 A;  4X3U A;  4LFB L;  5M3M H;  5A35 A;  3I4O A;  2HQE A;  2DJG C;  5JJL A;  3Q0A A;  2Q2U A;  1YNN C;  3M3Y H;  1X54 A;  4IUP A;  1JWU D;  1AN8 A;  4CDD C;  3RNU A;  1SLJ A;  1EWH A;  2NUC A;  2AKW B;  3UE0 A;  3A8J E;  3PV0 A;  2I5L X;  1IW7 D;  3DLL A;  5C44 B;  2YV5 A;  1GOZ A;  1ASY A;  5K36 H;  3R2T A;  3G71 A;  1CI3 M;  4PMW A;  3UDX A;  3KLW A;  3W2D A;  1XMO Q;  3PUX A;  2PQE A;  1JWM D;  2XWB B;  4OHJ A;  5IYD H;  1PH8 A;  2CW0 C;  1DJR D;  1YBY A;  1X3G A;  2A69 C;  5JEA H;  4DK6 C;  3S1R B;  1BQQ T;  4A3G H;  3H6M A;  1K8G A;  1FJG L;  1OXU A;  1V43 A;  1HNZ Q;  3P1H A;  4KY5 A;  3M4P A;  2K4K A;  4GKJ Q;  2KED A;  1MKH A;  3KBX A;  3F2C A;  2B8F A;  5AJ3 L;  3DXJ C;  3H94 A;  1Y1V B;  1F2Y A;  2Q8I B;  2D0O A;  4C2M B;  2LMC B;  1JMC A;  3I3C A;  2E2H H;  1HPC A;  4FXK C;  1Q12 A;  1I4G A;  1PTO D;  4DXF A;  4GN5 A;  4DV7 Q;  4DV7 L;  5GAE C;  1SRU A;  2GN5 A;  1SYG A;  3D4D A;  4GLA C;  4K2L A;  2IY5 B;  3EN2 A;  2X6G A;  4OO1 G;  3KUP A;  1EIF A;  5FKA C;  1D1I A;  4X64 Q;  3QJY A;  1JT8 A;  3I4L A;  2E76 C;  4KHZ A;  3TS0 A;  1QUQ A;  1D7Q A;  3KF6 A;  1BVS A;  1WTW A;  1WTO A;  2JQO A;  4DGZ A;  1EYD A;  2TSS A;  3S2D B;  4O0A A;  2FXQ A;  4FF3 A;  1B3Q A;  1SNM A;  4MZ9 A;  1Q3L A;  4KD3 A;  2DUD A;  3S2H B;  5BR8 Q;  3MEF A;  1V1P A;  2E75 C;  3J81 L;  1XPR A;  3HKZ E;  4ULL A;  3K5O A;  1NMG A;  3CD6 A;  3OIQ A;  4B9X A;  2FHT A;  2NB0 A;  1AZP A;  1LUZ A;  1V1O A;  2B2U A;  2ZJP A;  1SJE D;  1C9O A;  1AH9 A;  3JAM c;  4DR6 L;  4G7O C;  1C8C A;  3L9A X;  3M7N A;  3J80 E;  2UUA L;  4BY1 H;  4FF4 A;  4HJ9 A;  2RVL A;  5FLX E;  4DR1 Q;  3ULJ A;  1OTC A;  2AQ1 B;  3QOL A;  1PA6 A;  3ITP A;  3GTM B;  2FIN B;  4OEL B;  1IBK Q;  2IW3 A;  1BBU A;  2HUG A;  4ZQ3 A;  5I2X A;  4BWG B;  3C3L A;  1EOV A;  2Q8T A;  2RF4 A;  4EVO A;  2HD3 A;  3M7G A;  4NMZ A;  4C3I G;  5CV5 A;  1GM5 A;  2NZH A;  3E9I A;  1TKW B;  3RZD H;  4K6L A;  1VQ7 A;  2F0F A;  4WJW A;  1EU3 A;  4J15 A;  4OWT B;  1YJN A;  4L5R C;  1D1K A;  2QEJ C;  4HID A;  1JOR A;  1VQ4 A;  5C5L A;  3F8T A;  2E2D C;  4DV5 Q;  4DR7 L;  1SE2 A;  1VQ8 A;  4CHT B;  2MQH A;  3F2B A;  1EQV A;  4MHE A;  4QIW B;  3I4N G;  2A6H C;  3J7A F;  5I2Y A;  5CV4 A;  5M5W B;  2L0C A;  5M3M B;  1J8I A;  2EYM A;  2MHV A;  3TP8 A;  4GOP A;  2Z8L A;  4IUN A;  3EQL C;  1H9S A;  4OXP A;  1FGB D;  5EKK A;  1TXY A;  3EBE A;  2R61 A;  2Y0S B;  2J4X A;  1WYD A;  2OT2 A;  2F0G A;  4XT1 B;  3HOW H;  5JVH 3;  3FMC A;  4NP5 A;  3RN2 A;  2IX3 A;  4DKA C;  3I55 A;  1XTC D;  3GD7 A;  4M1U B;  4RH6 A;  2JA7 B;  2XRS D;  4N9T A;  2K5V A;  3HS0 C;  1VQI A;  4IUR A;  2PQA A;  2A1A A;  3IFT A;  4HIO A;  1HZC A;  1RF2 D;  5FLM H;  1ENC A;  3BZD B;  2VQF L;  3HGB A;  4ZUI A;  2B2W C;  2EYP A;  3A7L A;  1KQS A;  3A74 A;  3BJU A;  3U4Z A;  3AEV A;  5LMU Q;  2F0U A;  1RIP A;  3CP0 A;  3QO2 A;  3DWQ A;  2B2Y A;  3NUC A;  3STB D;  4GNX A;  1B7Y B;  4CJ1 B;  2CH4 A;  3D4W A;  4K8I A;  4LF5 L;  2WAQ B;  5I9O A;  4O2D A;  3RZO H;  5JVG 3;  5C3E G;  3HOZ G;  4JI1 L;  4JI0 L;  3NBH B;  3C46 A;  1QB5 D;  1SDF A;  1G6P A;  2V1C C;  3T1H L;  4JI6 L;  2CVR A;  4KHV A;  4IQZ A;  1Q86 C;  4KLK A;  1SXT A;  5D14 A;  1IBL Q;  1CT1 D;  2VQE Q;  1R9T H;  2RBM A;  2RCN A;  2Q8R E;  1HJP A;  4X65 Q;  1TWF B;  5EAY A;  2O5J C;  3FEW X;  5ISR A;  1X65 A;  2RCF A;  1K28 A;  5M5X H;  3GTL H;  5JPM C;  3GV6 A;  3SK8 A;  3T53 B;  1V1P B;  2IJ0 A;  1SNP A;  1N8R C;  1I6V C;  5JOB A;  2K6A A;  2F0K A;  2GVA A;  4IAL A;  2PI2 A;  4LW1 A;  2NZ1 D;  4Y7N B;  1TU2 B;  2J7Z A;  1E1T A;  4MTN A;  3CCL A;  5C4X H;  3U9S A;  4JOI C;  1NBW A;  2NN6 G;  5CYU A;  1QVG A;  3I4M H;  3RN5 A;  1KRT A;  4AYB E;  1ZYR C;  5C3W A;  1SNO A;  1SR3 A;  3I4N B;  1N32 Q;  4TSS A;  5IP7 G;  3S14 B;  1TWH H;  2A74 C;  1N33 Q;  1Y1V G;  3A7A B;  1ESF A;  1Q8K A;  3MFG A;  1HFN A;  2E8G A;  4RWS C;  2BE5 D;  4YWM A;  5M3F H;  4BS9 A;  3FVQ A;  5KNB A;  1X32 A;  4HSV A;  4N9P A;  3BDL A;  1EZ6 A;  1I4P A;  4GN4 B;  4A3G G;  4DR4 L;  1VS0 A;  3J81 E;  4B3M L;  5IWA L;  1U9R A;  3WWV A;  1S5B D;  3HOV H;  1Y8N B;  4XXE A;  2B63 B;  3G6E A;  1VQ5 A;  1B53 A;  2KHJ A;  2K52 A;  1AP0 A;  1A0I A;  4IJH A;  4MNO A;  1G6Z A;  3A56 A;  1DON A;  5C5M A;  2KOL A;  4X66 L;  2WAQ E;  1X3F A;  2KCC A;  4BY1 G;  3G4S A;  4BBR G;  3TN2 A;  1NJI C;  4U68 A;  1QJO A;  2JA6 B;  5FO7 B;  3UDF A;  4AH6 A;  4LF4 L;  1GUG A;  1I4X A;  3W1G A;  3U58 A;  3PO2 G;  1IYV A;  1BCP C;  1F9P A;  2Z6B A;  1RD9 D;  4DV1 Q;  2E5L Q;  2B2Y C;  1X3E A;  5ELO A;  3GO5 A;  1J6Q A;  1UE7 A;  4YWL A;  1TS3 A;  2F0J A;  3T4A C;  3W3A A;  5BN5 A;  1KIX A;  2KEE A;  4UDU C;  4NXM L;  4IUQ A;  3K57 A;  1TII D;  2VXW A;  3K81 C;  4DR7 Q;  1WVL A;  3B6Y A;  4IUV A;  3QOJ A;  1P8L A;  1D8L A;  4I7Z C;  1EQT A;  5EPL A;  2EYH A;  1N32 L;  1Y1W G;  4A3B G;  4UAI A;  3UDI A;  2F0E A;  1PFB A;  2R3Z A;  1GHJ A;  2B29 A;  5CBE E;  1JB7 A;  1EWC A;  1QWY A;  2B3G A;  3G48 A;  3QR8 A;  2CKZ B;  1E7Z A;  3OHX C;  3T1H Q;  4FDB A;  4DR3 Q;  3GTJ B;  3MFY A;  1H9J A;  1VQC A;  5M5Y B;  1VMC A;  1VQG A;  3MHB A;  4K8J A;  1UUP A;  3R2I A;  1ONL A;  4JI2 Q;  4LF9 Q;  4F88 A;  2KEC A;  1LAB A;  1TWG H;  3PIP A;  1E0B A;  2R6G A;  4C3J G;  1JQY D;  4LNQ A;  1EEF D;  5JAV A;  2R93 H;  2QKI C;  1JE5 A;  4S3S A;  1PRT C;  2DY7 A;  3GP7 A;  4ZKB B;  1BDO A;  1SYC A;  4R4T A;  2UXC L;  1QE6 A;  3L0O A;  3CAM A;  5BN4 A;  2IX1 A;  1NY4 A;  2O4X A;  1AZQ A;  5C4X B;  1GUT A;  2H5X A;  3QWN A;  3TP6 A;  2SOB A;  1HR0 W;  4AYB G;  1PYS B;  4ZCK A;  3EA6 A;  3CQZ B;  4K5X A;  2LS0 1;  2YU9 H;  2UXB Q;  2JN4 A;  3KDF B;  4RHR A;  3SR1 A;  4HCE A;  3G7L A;  2CHB D;  1L0W A;  2F3V A;  2KUM A;  1KDA A;  2Z6K C;  5IGF A;  5C3E B;  4LF6 L;  4OO1 H;  3CHB D;  4RG1 A;  2EJG C;  4DV3 L;  2AQ2 B;  2UU9 L;  1UEA B;  2KJX A;  2M00 A;  3CCQ A;  4A3B B;  5IOC A;  1SJH D;  4QCL A;  1D5X C;  4DU9 A;  1G51 A;  4JI3 L;  4GS3 A;  1CSQ A;  1O78 A;  4RCO A;  2R7Z G;  3K80 C;  3LWU A;  1G91 A;  5C44 G;  3S16 B;  4DUY Q;  5H1S E;  2LSS A;  1A6X A;  1EOT A;  3VDY A;  1KAW A;  4C2M H;  4DV3 Q;  2JYO A;  4GNX B;  4RKB A;  2UUC L;  1E24 A;  5IOD A;  3KK7 A;  4TKO B;  1GD7 A;  1V1Q A;  1PMR A;  2JA6 H;  5GAG C;  2E2H B;  3I4M B;  5IT9 L;  1RHP A;  1JWS D;  2OQ0 A;  2ZT9 C;  1BUV T;  3GTK H;  4B3S Q;  4ILW A;  4DV4 L;  2RHS B;  5IYD G;  1YIJ A;  2PI2 E;  3GTM H;  4A3J H;  3WDN A;  1B3A A;  2VB2 X;  3VYS A;  1X56 A;  1VQ9 A;  3UE1 A;  1QVF A;  2ASB A;  4LJZ C;  2NVT H;  5IYC H;  1J9O A;  2EOT A;  4IUU A;  1PH1 A;  1O7I A;  1S4Z A;  1XMQ Q;  4KHP L;  4WRD A;  4NKL A;  4JI2 L;  4A3G B;  4PG3 A;  1A63 A;  3PGZ A;  2B63 H;  2DNC A;  1WTP A;  3KOJ A;  1MHW C;  3SK4 A;  5J39 A;  1HQR D;  1ILP A;  2EJF C;  2KCT A;  2UXB L;  1YZ6 A;  3D3R A;  2JA6 G;  5C0X H;  4ODG A;  1HCZ A;  4HR7 B;  1B9M A;  1EFW A;  3KLS X;  3J7Z C;  1NSN S;  1RKN A;  1VQK A;  4X3K A;  1Y1V H;  2XTI A;  2EYJ A;  2A6E C;  3OIP A;  3BDC A;  3C1F A;  4TRD A;  1KTK A;  3MTS A;  3W5O A;  5LMN W;  3VR6 A;  1ENA A;  3NBH A;  4KKS A;  5COR A;  2EZV A;  4LF9 L;  2H4O A;  1VQ6 A;  5IP9 H;  1F2M A;  4U67 3;  1SMX A;  1YHQ A;  3K6O A;  1QIL A;  2OTL A;  1SNC A;  1Q1B A;  3PQI A;  3QB3 A;  1EU4 A;  2B2W A;  5C4J B;  4ZAI A;  2B2V A;  2ZXR A;  1K83 H;  2K50 A;  4XQQ A;  3FRP B;  1HTP A;  3PCO B;  3CQZ H;  5JEA J;  1I50 H;  2HIX A;  1FNW A;  3S15 B;  1PHJ A;  1DM0 B;  1UNS A;  3OWE B;  3R3O A;  1HR0 L;  3CC4 A;  4K0K Q;  5FLM G;  2Z4H A;  2NVY B;  4JW0 A;  1P16 A;  3MA2 B;  1L0Y B;  3K59 A;  1DGS A;  1E3P A;  2HDL A;  1IKM A;  4KTA A;  3SVM A;  4X66 Q;  5F2D A;  1VQA A;  1Q8I A;  1TWC B;  1K9M C;  4C3J B;  4B08 A;  1DXM A;  4I7A A;  4DAV A;  1GHK A;  2VQF Q;  3CCR A;  5C0X G;  1U0L A; 
#chains in the Genus database with same CATH homology
 3VA5 A;  3QIA A;  2EPB A;  2K05 A;  2FMC A;  4C3I B;  3HKZ B;  5C4Z A;  1O7L A;  2F0P A;  3O13 A;  5KRU A;  1QNK A;  3DUZ A;  1A2T A;  1RTN A;  4XQJ A;  2JEA I;  1HRJ A;  2I07 B;  1LTG D;  4K2K A;  3TBI B;  5J1Z A;  1QNU A;  5J22 A;  3NXW A;  4G7H C;  2WV6 D;  1GXD C;  4LAA A;  3LWE A;  1T5E A;  2B2U C;  5DAU A;  1I4H A;  3FKI B;  5IGD A;  5CV7 A;  1HTL D;  4DK0 A;  4EGV A;  1K8M A;  1I4R A;  2SEB D;  2ICE C;  3NWT A;  2PZW A;  2DY8 A;  3NE5 B;  5C4H A;  1AW7 A;  3IAY A;  4ZRZ A;  4Q0F A;  3AU7 A;  4X3T A;  2PMZ B;  1O80 A;  1LT4 D;  2F0L A;  1A3U A;  3NHH A;  3NBI A;  1JB3 A;  1LTT D;  1PZI D;  2VB3 X;  1DD2 A;  4E6I A;  3S17 B;  1KAA A;  1F9R A;  2QIL A;  2D9U A;  5AFW A;  4PV1 C;  3HRZ C;  3ERQ A;  3RMH A;  3OW7 A;  1E2Z A;  4C56 C;  3V2T A;  3GTK B;  2ENB A;  5CV6 A;  5EKL A;  2K5W A;  5FO9 B;  1GUS A;  3PUZ A;  4RFB A;  2GA4 B;  5M9O A;  2F0M A;  1D5Z C;  2EY5 A;  4X3S A;  1PTO H;  5KEE A;  2K33 A;  2TMP A;  4Z9C B;  4IFD J;  3OWF A;  2AUJ D;  1G2T A;  3KF8 A;  2F4I A;  4O42 A;  4FNF A;  4YIJ A;  1KNE A;  3G6J B;  5ELE A;  1S5E D;  2MJ8 A;  1LLR D;  2A68 D;  1H9S B;  1JE4 A;  1MBY A;  5M3F B;  2B8G A;  5CR3 A;  3SEB A;  1S5C D;  1PXU A;  5CV9 A;  5DM7 3;  3HOV B;  4K5W A;  5A2Q E;  2L55 A;  2SDF A;  4L6T B;  1CZW A;  4XT3 B;  1LTR D;  4FXD A;  5I6W A;  1DOL A;  1E2V A;  4KD4 A;  3GQB A;  3M3Y B;  4IUT A;  4R8I A;  1TWG B;  2BCO A;  4L8J A;  1STN A;  4PMB A;  2MGS A;  4DAP A;  1DYQ A;  1WTV A;  1WTX A;  1CM9 A;  5ELC A;  3MAQ A;  2HCC A;  1M8A A;  5C0X I;  5LL6 X;  2F0S A;  1DZ1 A;  5K36 G;  3P7J A;  3SHL A;  3NTI A;  1EY7 A;  3PO2 B;  5CMD A;  1SAP A;  2JE6 I;  5KGU A;  2AWO A;  4M8A A;  1NUC A;  1OO9 B;  3OSO A;  1ET6 A;  5IT9 E;  1ZKO A;  4BA1 I;  1TQO A;  2EXZ A;  1BCP B;  3VR3 A;  4PQX A;  5KNC A;  5KYL A;  2RQX A;  2PZU A;  1ET9 A;  3DHQ A;  2Z1C A;  5D3D A;  1EIH A;  4ZUJ A;  1JOO A;  1E2W A;  1KNA A;  4H13 C;  2ZXO A;  4KMU C;  5E4X A;  2R92 B;  1Y8P B;  1WCM B;  1SYD A;  3K5N A;  3S9W A;  3S1M B;  2F03 A;  3PIO 3;  2NVX B;  3M4O B;  1PZK D;  2VUM B;  4H7B A;  3K5M A;  4A3J B;  3VR5 A;  5I9P A;  4V0B A;  4FF2 A;  4NDX A;  1XWE A;  2EY2 A;  2X69 A;  1EY8 A;  2K04 A;  3BVZ A;  3BG3 A;  1PZJ D;  3HG9 A;  3PUW A;  4RGN A;  1BO0 A;  4F8M A;  2AWN A;  3T51 B;  3CU7 A;  3MZ5 A;  4IZ8 A;  3MXN A;  1JIC A;  4XYO A;  5JJZ A;  3QG1 A;  2B39 A;  1EL0 A;  2YU9 B;  1SEB D;  1GUO A;  4JBW A;  1WD0 A;  3SK5 A;  2VNU D;  1CFM A;  3CRK C;  1CZG A;  3S1Q B;  3E5S A;  1I6H B;  3J7A V;  1H9M A;  1PFN A;  1T5X D;  4PMC A;  5C3X A;  1BCP D;  2ZXP A;  2M2L A;  3FDT A;  5CV8 A;  1K8O A;  4EQP A;  5IGB A;  3H91 A;  2XIW A;  2SNS A;  3T13 A;  1STH A;  2K5Q A;  3OMC A;  5EJW A;  1SFO B;  1SE3 A;  1TS2 A;  4C1N K;  4ABN A;  3J80 L;  2C5C A;  5E1F A;  2C9O A;  2PW5 A;  3FPU B;  1GUW A;  5FOB B;  4A3D B;  4IN3 A;  2N88 A;  3VYU A;  1CA6 A;  2BE5 C;  2F0D A;  1CTM A;  1EZ8 A;  4TQU S;  5CC4 A;  3V96 A;  1PYW D;  4WFN 3;  5FO8 B;  3E6Z X;  3ND9 A;  4OL7 A;  1ZYR D;  3PO3 B;  4DF7 A;  1D5M C;  1Z47 A;  2XWJ B;  2JA5 B;  1X3P A;  1B44 D;  2A68 C;  2K28 A;  2NTT A;  1TY2 A;  3P75 A;  1G2S A;  3GV3 A;  3D6W A;  1HXY D;  1B9N A;  1NR2 A;  3TZD A;  2EVB A;  5IGG A;  1XX8 A;  2B2T C;  1JCK B;  2E2I B;  5FK9 C;  3BVM A;  1CA5 A;  2LKV A;  3D31 A;  5K5P A;  1R4Q B;  5D65 A;  2XVS A;  1A2U A;  1TWA B;  2F0Q A;  3OMG A;  3HOZ B;  2L11 A;  3OOC A;  1R9T B;  2YYZ A;  1G29 1;  3MXP A;  2K01 A;  2LY7 A;  2EY6 A;  1KDB A;  3H3V C;  4RAU C;  4CJ2 C;  1RCV D;  3URY A;  1EY5 A;  2EYF A;  3IL8 A;  5TSS A;  1U4L A;  2QDB A;  1R4P B;  2E74 C;  1II3 A;  5JEA G;  1STG A;  1A15 A;  1OXV A;  3Q24 A;  2RDG A;  1VCI A;  2AUK A;  1EEI D;  2F1M A;  4L63 B;  4KJN A;  1Y1W B;  2K03 A;  1JOK A;  4XDX A;  4HMJ A;  4IFD H;  2EY1 A;  2EJM A;  4CGY B;  2A6H D;  5KIX A;  4KN7 C;  4R9W A;  3P20 A;  1F2L A;  4XQN A;  2QF7 A;  2DNE A;  4MIU A;  4A93 B;  1MD2 D;  3ZYY X;  2BDN A;  3K7A B;  1HFG A;  4MN3 A;  3JAM L;  1PLF A;  2EYO A;  1MSH A;  3N6R A;  1B50 A;  1F77 A;  2NWG A;  1Q90 A;  3K0Y A;  1ICW A;  1S5D D;  4KKU A;  4DNR B;  5E4W C;  1Y8O B;  1VF5 C;  1LV9 A;  5COY A;  2L5T A;  4XTC S;  1IKL A;  3A8K E;  3SK6 A;  2NYZ D;  2M9V A;  2PPB C;  1HQM C;  3EJI A;  3NSW A;  2FJ2 A;  2B2V C;  2PCF B;  4KJO A;  2F0T A;  2QCP X;  1LAC A;  3HOX B;  4J8Q A;  1BBX C;  2WAC A;  1GUN A;  1DOM A;  1S5F D;  1I4Q A;  3S1N B;  3I73 A;  4DXG A;  4FYD A;  4HED A;  5I4D A;  3TP5 A;  2L1B A;  1BF4 A;  3RLF A;  2KA7 A;  1JOQ A;  2WP8 J;  2NBF A;  1EY4 A;  5CBA E;  2BOS A;  2D2C C;  1O7Y A;  2A6E D;  3M85 A;  1NCV A;  1O7Z A;  4RGM A;  5DEH A;  1QCB D;  2JP1 A;  3Q6S A;  2XRQ D;  3EFX D;  4H44 C;  3RZD B;  2NVT B;  1H9K A;  2Z4I A;  3NTH A;  1PTO C;  5LL6 S;  1Z6H A;  4LMQ D;  2E2J B;  1BR9 A;  4F7X A;  2EE1 A;  2KQ3 A;  1VDZ A;  4K5V A;  3N52 A;  3RZO B;  4FF1 A;  2JXM B;  1TR5 A;  3PUV A;  1Y69 U;  4DA2 A;  3L7Z C;  3BYT B;  3WOF A;  1OXT A;  3VYR A;  2A69 D;  5EBD A;  5EBC A;  4Q5V A;  3OPO A;  2CW0 D;  3TZU A;  2FMM A;  4LK1 C;  2G9H D;  2X6L A;  1BNZ A;  2L9H A;  1IW7 C;  2BA1 A;  1PRT F;  1PTO F;  1A3V A;  5ELB A;  3VYT A;  5BN3 A;  1WTQ A;  4OIK A;  1DOK A;  1YNN D;  4EQN A;  4HTH A;  4HN7 A;  1F9Q A;  1TS4 A;  2WKD A;  2IWH A;  1ENF A;  3X3N A;  3HOU B;  1B2T A;  5A2Q L;  3DWP A;  5ELD A;  1SMY D;  1FNV A;  2RSN A;  3RD4 A;  2A73 B;  2RSO A;  1TVX A;  1FYC A;  3K5L A;  3DMU A;  1KLU D;  1PRT D;  3GTP B;  2K5D A;  4J1M A;  2F0H A;  3PIP 3;  2WII B;  4H0L C;  2LFN A;  2EYL A;  4QMG A;  3SXH A;  2RKS A;  3SDZ A;  3RUZ A;  4A3I B;  3I90 A;  1LTS D;  2F0N A;  4ID6 A;  2XSC A;  1STE A;  2KVM A;  3SE0 A;  3MXG A;  1UAP A;  4F87 A;  3MVV A;  4KV6 A;  4A3K B;  1V8Q A;  3H0G B;  4C1N I;  4OIJ A;  4O1N A;  1SND A;  4QUC A;  5ELF A;  3IFD A;  4RA8 A;  1EY6 A;  5IGE A;  4RKL A;  3TSS A;  1LT3 D;  4C3H B;  1VF7 A;  2JA8 B;  1M4V A;  5M5X B;  2KCN A;  1WTR A;  3C2P A;  4HCS A;  1ILQ A;  1CHP D;  1XYI A;  4V19 0;  1TS5 A;  1W6K A;  2F0V A;  1GJX A;  1HUN A;  3DEO A;  1BXT A;  5EQ0 A;  2A5H A;  4FVM A;  2HDM A;  4BA2 I;  1W6J A;  4A3M B;  1IYU A;  1H9R A;  3I8Z A;  1TWH B;  4QUF A;  3R93 A;  1EIG A;  4QB4 A;  1RJT A;  1QG7 A;  1PRT B;  4RHS A;  5T1G A;  3J7Y W;  4CKE A;  1SNQ A;  2V4D A;  5DM6 3;  2IPK D;  1X3Q A;  2NN6 I;  4FO2 A;  1EYC A;  4OGQ C;  5DNF A;  3ONA B;  2D62 A;  5G3L D;  4P2C B;  3HOY B;  3A8I E;  1BCP F;  5KYI A;  3WOE A;  1SSO A;  2RDF A;  4JK1 C;  2XN9 C;  2IX0 A;  3I70 A;  4FP5 D;  5KND A;  4IFD G;  1HA6 A;  3I72 A;  4RGO S;  3L3O C;  2K7V A;  3DWA A;  1AEX A;  3AMU A;  4R8N A;  1D2B A;  3JAM E;  1WD1 A;  2IL8 A;  3GTG B;  2KHS A;  3TME A;  1YNJ D;  3NK9 A;  4G57 A;  2F0I A;  4BBS B;  2RDH A;  1SBB B;  3LX0 A;  5G3L F;  2BA0 A;  1ZXT A;  1LTI D;  5C0X J;  1U4M A;  3EVQ A;  4ZYS A;  5EPJ A;  3GTO B;  3LNN A;  2EDG A;  2SNM A;  3NPP A;  3BS1 A;  4XIG S;  1FR3 A;  4I65 A;  1CHQ D;  3MC0 B;  2F0W A;  4BY1 B;  5CGK A;  3V05 A;  1Q1E A;  3TP7 A;  3C1E A;  1STB A;  2PZT A;  4NW2 A;  1XXG A;  3KLR A;  5EPK A;  4CJ0 B;  2B2T A;  3D6C A;  1OXS C;  4KN4 C;  2ID0 A;  5IGC A;  1PDQ A;  2O2L D;  3KLS A;  2H1E A;  3CKI B;  1ESR A;  1TT2 A;  1HUM A;  3UI2 A;  3MEH A;  2N55 A;  4HSP A;  3VR2 A;  2FFK B;  1IHZ A;  1SYB A;  4BBR B;  3ERO A;  1I50 B;  1LT6 D;  3E0J A;  2K32 A;  2F0O A;  3VR4 A;  5HGT A;  5T1I A;  2MUY A;  4AYB B;  2WIN B;  4PNY A;  1VMP A;  5NUC A;  2HCI A;  4KY7 A;  3GTQ B;  1SYE A;  1JC7 A;  1A3T A;  4B9W A;  4ZLT F;  3MXU A;  4HAE A;  2F3W A;  3NP8 A;  4ME5 A;  3R8B A;  3D4R A;  2JSO A;  4QF4 A;  1BOS A;  1QOH A;  2OEO A;  3ND8 A;  3HOW B;  5E3F A;  1OXX K;  2RA4 A;  4DFA A;  3NQT A;  3PUY A;  4KKT A;  3M4Y A;  2G9D A;  1JR0 D;  4DAY A;  2WKC A;  3DM1 A;  3K58 A;  3BYY B;  5EGT A;  1ML0 D;  5HUR A;  1K83 B;  4FXG C;  5EKI A;  1YNJ C;  1I3Q B;  1EYA A;  2BDO A;  1U4P A;  1D6E C;  1L0X B;  2NN6 H;  4A3F B;  3DEP A;  4RCN A;  1KLG D;  3HP3 A;  3IKJ A;  2MPM A;  4ZKC B;  1LO5 D;  2PO4 A;  3NWS A;  4BY7 B;  1CQV A;  3TDQ A;  5C6A A;  1Z7T A;  1STY A;  4KI0 A;  4A3E B;  1C4Q A;  1RTO A;  3MWY W;  2NVQ B;  2JEB I;  4J6H A;  1RDP D;  3Q22 A;  4KY6 A;  4WOR A;  2O5I C;  3U9O A;  1HA5 A;  3GTL B;  2MP1 A;  3FPP A;  3HEJ A;  1C48 A;  3VA7 A;  1B1Z A;  4KK7 A;  4K6D A;  2IT1 A;  3CRL C;  2NTS A;  4CKB A;  1TY0 A;  4G4K A;  5LHY 1;  2PNR C;  4ZK9 B;  1EFI D;  3H09 A;  2K1B A;  2R7Z B;  4G7Z C;  1PFM A;  3A54 A;  3NTK A;  1AFP A;  1U4R A;  1EY0 A;  2WB1 B;  3HZX A;  4DK1 A;  2PW7 A;  5I6Y A;  2I46 A;  1FD7 D;  2ICI A;  1F9S A;  3F2U A;  3D8G A;  1IL8 A;  4IFD I;  2AQ3 B;  1HHV A;  1G8Z D;  1KAB A;  3I91 A;  4EQO A;  4RGT A;  1ZEQ X;  3KBG A;  3NQI A;  5IIF A;  4C3H G;  1KDC A;  2PYK A;  2J0T D;  3X3M A;  3T56 B;  5FLX L;  1STA A;  3Q23 A;  4CBV A;  1SE4 A;  1FNU A;  5JPN C;  3BDO A;  1DCZ A;  1LTB D;  2D5D A;  1NR4 A;  1MSG A;  2L12 A;  1LTA D;  1CK1 A;  2XNA C;  2DN8 A;  1MI2 A;  1PTO B;  2OXP A;  1ROD A;  1LT5 D;  1B4O A;  1CQF A;  4GZY C;  3T16 A;  5D3I B;  4OO1 I;  4K14 A;  3AB9 A;  1EY9 A;  1F2Z A;  4DN4 M;  4XYQ A;  2CQA A;  2L4N A;  1SYF A;  1SMY C;  4DNT B;  1NAP A;  2OF1 A;  1MGS A;  4HMI A;  3PMF A;  3BVG A;  4CKC A;  2R93 B;  3A55 A;  4X3U A;  5A35 A;  2HQE A;  3Q0A A;  1YNN C;  4IUP A;  1JWU D;  1AN8 A;  1EWH A;  2NUC A;  3A8J E;  3PV0 A;  1IW7 D;  5C44 B;  1GOZ A;  5K36 H;  3R2T A;  1CI3 M;  4PMW A;  3W2D A;  3PUX A;  2PQE A;  1JWM D;  2XWB B;  4OHJ A;  2CW0 C;  1DJR D;  2A69 C;  5JEA H;  3S1R B;  1BQQ T;  3H6M A;  1OXU A;  1V43 A;  3P1H A;  4KY5 A;  2KED A;  3KBX A;  2B8F A;  3DXJ C;  3H94 A;  1Y1V B;  1F2Y A;  2Q8I B;  4C2M B;  2LMC B;  3I3C A;  1HPC A;  4FXK C;  1Q12 A;  1I4G A;  1PTO D;  4DXF A;  1SYG A;  3D4D A;  4K2L A;  2X6G A;  4OO1 G;  3KUP A;  5FKA C;  1D1I A;  3QJY A;  3I4L A;  2E76 C;  4KHZ A;  1WTW A;  1WTO A;  4DGZ A;  1EYD A;  2TSS A;  3S2D B;  4FF3 A;  1SNM A;  1Q3L A;  4KD3 A;  3S2H B;  1V1P A;  2E75 C;  3J81 L;  4ULL A;  3K5O A;  3OIQ A;  4B9X A;  2FHT A;  2NB0 A;  1AZP A;  2B2U A;  1V1O A;  1SJE D;  4G7O C;  1C8C A;  3L9A X;  3M7N A;  3J80 E;  4FF4 A;  2RVL A;  5FLX E;  2AQ1 B;  3QOL A;  3ITP A;  3GTM B;  2FIN B;  2IW3 A;  4ZQ3 A;  5I2X A;  2HUG A;  4BWG B;  3C3L A;  2Q8T A;  4EVO A;  3M7G A;  4NMZ A;  4C3I G;  5CV5 A;  1TKW B;  4K6L A;  2F0F A;  4WJW A;  1EU3 A;  1D1K A;  2QEJ C;  1JOR A;  5C5L A;  2E2D C;  1SE2 A;  4CHT B;  1EQV A;  4MHE A;  4QIW B;  2A6H C;  3J7A F;  5I2Y A;  5CV4 A;  5M5W B;  2L0C A;  5M3M B;  1J8I A;  2EYM A;  2MHV A;  3TP8 A;  2Z8L A;  4IUN A;  3EQL C;  1H9S A;  1FGB D;  5EKK A;  2R61 A;  2Y0S B;  2J4X A;  2OT2 A;  2F0G A;  4XT1 B;  5JVH 3;  3FMC A;  4NP5 A;  2IX3 A;  1XTC D;  3GD7 A;  4M1U B;  4RH6 A;  2JA7 B;  2XRS D;  4N9T A;  3HS0 C;  4IUR A;  3IFT A;  1RF2 D;  1ENC A;  3BZD B;  3HGB A;  4ZUI A;  2B2W C;  2EYP A;  3A7L A;  2F0U A;  3QO2 A;  3DWQ A;  2B2Y A;  3NUC A;  4CJ1 B;  3D4W A;  4K8I A;  2WAQ B;  5I9O A;  5JVG 3;  3C46 A;  1QB5 D;  1SDF A;  2CVR A;  4KHV A;  4IQZ A;  1SXT A;  5D14 A;  1CT1 D;  2RBM A;  2Q8R E;  1TWF B;  2O5J C;  3FEW X;  5ISR A;  5JPM C;  3GV6 A;  3SK8 A;  3T53 B;  1V1P B;  2IJ0 A;  1SNP A;  1I6V C;  5JOB A;  2K6A A;  2F0K A;  4IAL A;  2NZ1 D;  4Y7N B;  1TU2 B;  2J7Z A;  3U9S A;  2NN6 G;  5CYU A;  1ZYR C;  5C3W A;  1SNO A;  3I4N B;  4TSS A;  3S14 B;  2A74 C;  3A7A B;  1ESF A;  1HFN A;  3MFG A;  4RWS C;  2BE5 D;  4BS9 A;  5KNB A;  3FVQ A;  1X32 A;  4HSV A;  4N9P A;  3BDL A;  1EZ6 A;  1I4P A;  3J81 E;  1U9R A;  1S5B D;  1Y8N B;  4XXE A;  2B63 B;  1B53 A;  1AP0 A;  1G6Z A;  3A56 A;  1DON A;  5C5M A;  2KOL A;  2KCC A;  3TN2 A;  4U68 A;  1QJO A;  2JA6 B;  5FO7 B;  1GUG A;  1I4X A;  1IYV A;  1BCP C;  1F9P A;  1RD9 D;  2B2Y C;  3GO5 A;  1TS3 A;  2F0J A;  3T4A C;  3W3A A;  5BN5 A;  2KEE A;  4UDU C;  4IUQ A;  3K57 A;  1TII D;  2VXW A;  1WVL A;  4IUV A;  3QOJ A;  4I7Z C;  1EQT A;  5EPL A;  2EYH A;  4UAI A;  2F0E A;  1PFB A;  2R3Z A;  1GHJ A;  5CBE E;  1EWC A;  1QWY A;  3OHX C;  3GTJ B;  3MFY A;  1H9J A;  5M5Y B;  1VMC A;  3MHB A;  4K8J A;  1UUP A;  3R2I A;  1ONL A;  4F88 A;  2KEC A;  1LAB A;  1E0B A;  2R6G A;  4C3J G;  1JQY D;  1EEF D;  5JAV A;  2QKI C;  4S3S A;  1PRT C;  2DY7 A;  3GP7 A;  4ZKB B;  1BDO A;  1SYC A;  1QE6 A;  5BN4 A;  2IX1 A;  2O4X A;  1AZQ A;  5C4X B;  1GUT A;  3QWN A;  3TP6 A;  2SOB A;  3EA6 A;  3CQZ B;  4K5X A;  2LS0 1;  4RHR A;  3SR1 A;  4HCE A;  3G7L A;  2CHB D;  2F3V A;  2KUM A;  1KDA A;  5C3E B;  5IGF A;  4OO1 H;  3CHB D;  2EJG C;  2AQ2 B;  1UEA B;  2KJX A;  2M00 A;  4A3B B;  5IOC A;  1SJH D;  4QCL A;  1D5X C;  4DU9 A;  1O78 A;  4RCO A;  3LWU A;  1G91 A;  3S16 B;  1A6X A;  1EOT A;  2JYO A;  4RKB A;  5IOD A;  3KK7 A;  4TKO B;  1PMR A;  2E2H B;  3I4M B;  5IT9 L;  1RHP A;  1JWS D;  2ZT9 C;  1BUV T;  4ILW A;  3WDN A;  1B3A A;  2VB2 X;  3VYS A;  4LJZ C;  1J9O A;  2EOT A;  4IUU A;  1S4Z A;  4WRD A;  4NKL A;  4A3G B;  2DNC A;  1WTP A;  5J39 A;  3SK4 A;  1ILP A;  1HQR D;  2EJF C;  3D3R A;  5C0X H;  4ODG A;  1HCZ A;  4HR7 B;  1B9M A;  3KLS X;  1NSN S;  1RKN A;  4X3K A;  2EYJ A;  2A6E C;  3OIP A;  3BDC A;  3C1F A;  4TRD A;  1KTK A;  3MTS A;  3VR6 A;  1ENA A;  3NBH A;  4KKS A;  5COR A;  2EZV A;  2H4O A;  1F2M A;  4U67 3;  3K6O A;  1QIL A;  1SNC A;  1Q1B A;  3QB3 A;  1EU4 A;  2B2W A;  5C4J B;  4ZAI A;  2B2V A;  2ZXR A;  4XQQ A;  3FRP B;  1HTP A;  5JEA J;  1FNW A;  3S15 B;  1DM0 B;  1UNS A;  3OWE B;  3R3O A;  2Z4H A;  2NVY B;  3MA2 B;  1L0Y B;  3K59 A;  2HDL A;  1IKM A;  4KTA A;  3SVM A;  5F2D A;  1Q8I A;  1TWC B;  4C3J B;  4B08 A;  1DXM A;  4DAV A;  1GHK A;  5C0X G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...