1NR4A

High resolution crystal structures of thymus and activation-regulated chemokine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
RGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymus and activation-regulated chemokine
publication title Structures of thymus and activation-regulated chemokine (TARC).
pubmed doi rcsb
molecule tags Cytokine
total genus 13
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1nr4A00
5CBAE 3DM1A 4HAEA 3D6WA 2B2TC 4DN4M 3R93A 1LV9A 2B2TA 2Q8RE 1RODA 1RTNA 2FFKB 1PFNA 1U4PA 2K28A 2RA4A 1NR2A 3GV3A 2K01A 5EJWA 4ZKCB 1WTPA 2FJ2A 1HFGA 4LMQD 1WTQA 2B2UC 5T1IA 1BO0A 1E0BA 1O7ZA 2B2UA 2B2YC 2MPMA 3FPUB 3IFDA 4IURA 4CJ2C 1KNAA 1RHPA 2B2YA 2HCCA 1PFBA 4HEDA 4ZLTF 1MI2A 4XDXA 5EKIA 5CMDA 2XIWA 1RTOA 1J9OA 2H1EA 2SDFA 2KVMA 4NW2A 2MP1A 1S4ZA 1WTWA 1CA6A 1SAPA 2RVLA 3DEPA 3KUPA 4UAIA 4X3KA 5D65A 1X32A 2X6LA 1WD0A 3ONAB 5D14A 4OIKA 2HCIA 5CORA 5E4WC 2EE1A 4QUFA 4ZAIA 4X3SA 2JYOA 2K05A 1G91A 3MWYW 1EL0A 1CM9A 3IL8A 1DOLA 2D9UA 2KUMA 1DOMA 2JP1A 2K1BA 1F9RA 1B4OA 1EOTA 1BBXC 1JE4A 1EQTA 1MSHA 4MHEA 3TN2A 2L12A 4XT1B 1X3QA 5CBEE 1BF4A 3KBXA 4IUPA 4CJ1B 2EPBA 1XX8A 1B50A 1U4MA 1AZPA 4O42A 2L9HA 1A15A 2L4NA 2KOLA 1ICWA 1IKMA 2HDMA 1PLFA 1X3PA 1U4RA 4X3UA 2KEEA 3HP3A 1VMPA 5DNFA 1VMCA 2MGSA 2RSOA 1HA6A 5EPKA 1DOKA 2NWGA 2X6GA 4IUTA 4IUVA 4R9WA 4CJ0B 4ZKBB 4RWSC 1C8CA 1J8IA 5AFWA 2NZ1D 3FDTA 3GV6A 1MGSA 2R3ZA 1CA5A 1F2LA 1MSGA 1WVLA 1XYIA 1PFMA 2B2WC 2FHTA 2FMMA 1NAPA 1QNKA 1O7YA 1HUMA 3MTSA 2VXWA 1HUNA 2B2WA 3I91A 1AP0A 1AZQA 3TZDA 3G7LA 1ZXTA 1Q3LA 4HSVA 1ILPA 1HHVA 2Q8TA 4IUUA 3SVMA 1DONA 1G2SA 2RSNA 1QG7A 1IKLA 1RJTA 2KECA 1HFNA 1BNZA 5EPJA 1GUWA 1M8AA 1WTXA 1SDFA 2HUGA 1WTOA 1IL8A 1B3AA 3F2UA 4RAUC 3UI2A 2L1BA 2FINB 3I8ZA 2BDNA 5E4XA 1G6ZA 1NCVA 1TVXA 2N55A 1B53A 1F9QA 4U68A 2NYZD 5EQ0A 2KEDA 4X3TA 2CVRA 4XT3B 1KNEA 2K04A 2N88A 3QO2A 4HCSA 1G2TA 5COYA 1O80A 4MN3A 1B2TA 4IUQA 1U4LA 5T1GA 1DZ1A 4OIJA 4RA8A 3N52A 4R8IA 5EPLA 3I3CA 3I90A 1SSOA 3H91A 1WTVA 1F9SA 4ZK9B 3Q6SA 2EOTA 2DY8A 1ESRA 3P7JA 2J7ZA 5JJZA 1EIGA 2DY7A 1WTRA 1EIHA 1QE6A 1ML0D 1F9PA 2X69A 1HRJA 1NR4A 2IL8A 2HDLA 1ILQA 2MJ8A 1WD1A 2B2VC 1JICA 4QUCA 2L11A 3DEOA 2M2LA 3LWEA 1PDQA 2K03A 2B2VA
chains in the Genus database with same CATH superfamily
3DM3A 5HGTA 2A6HD 4BY1H 1LTTD 4J8QA 1NUCA 3DUZA 1PFNA 4A3FG 1GUSA 2JA5G 4EX5A 3NENA 3T1YL 4KY5A 1ICFB 5EKLA 1S5DD 4R1JA 2F0DA 4A3JH 4HMIA 5C44H 3CC7A 3TMEA 1SBBB 1LLRD 2KCCA 3S17B 3BZKA 4KN7C 5GADC 2MP1A 5M3FH 3PO3B 1JOKA 1AN8A 4XQJA 2R7ZH 1A0IA 3NTHA 3D3RA 4LF8L 4Y52H 3IKJA 5KEEA 4BY7B 4DV4Q 4JI8L 4BBSH 1D5XC 3K7AH 4OGQC 3IL8A 3QWNA 4LF4L 1FR3A 1PV4A 1J5EL 2RCNA 4N9PA 4MHEA 2AWNA 1U5KA 3FVQA 1BF4A 4JV5Q 4A3BB 1PFSA 3A8KE 3U4ZA 4DK6C 3KLSA 4X3UA 2Q2TA 2ZM6L 3OW7A 3L0OA 2VQFL 3FKIG 4RWSC 2WB1E 2NZ1D 2B29A 1K83H 1I5FA 1ZKOA 3OYYA 1E2WA 3WOFA 1PTOC 5AJ3Q 2C5CA 4DF7A 2I5MX 4MIUA 2LXKA 2I5HA 1MKHA 1AE2A 2JQOA 3CPFA 3CU7A 2RSNA 3NSWA 2PCFB 3OWFA 4P75A 4X66L 4BBRB 1B3AA 1D1IA 2IHEA 1IW7C 4JI5L 1PH7A 4EQNA 3NE5B 3DLLA 2DNCA 1QVCA 2DNEA 2I5LX 4IQZA 5I4DA 4DAYB 2WB1B 2VB2X 4UPAA 2FXQA 4HIOA 4R4IA 2A8VA 3H09A 5FKAC 3S1RH 2CQAA 2Q2UA 1SMYD 3S2HH 2PZUA 1VQDA 2EOTA 1KC8C 4HJ8A 3MC0B 4RGOS 1TS5A 4IPCA 4A3DH 1HRJA 4L5RC 4YWKA 1CHPD 1CQVA 4DUYQ 4DAYA 3RZDH 4K5WA 3VYRA 1ENCA 3KJPA 5DM73 4A3CH 2NVTH 2EYFA 3OMCA 5IY0A 2R6GA 1LTGD 1YNXA 5GAEC 1MBYA 2BA0A 3O13A 3I4NB 1H9SB 1KDAA 1WCMH 1EYAA 2MPMA 1Y1WB 4DXGA 2NUCA 3ZYYX 4PMBA 4HEDA 2RDGA 5FLXE 4BY1B 1GVPA 1H95A 2XIWA 4L6TB 2A6ED 1CKNB 1STAA 2JN4A 1BR9A 4P73A 3TS0A 4DV0Q 2V1CC 1QJOA 3AQQA 2EDGA 3F2CA 1DCZA 1HPCA 4K8IA 4JI0L 2HCIA 4A3JB 1UE7A 3J81j 2ICIA 3JC66 5C44B 3DMUA 4X3SA 5LMNW 1H9SA 5J3BA 4J6HA 1FGBD 3GP7A 4OONA 1EOTA 1GUNA 1TKWB 3CMEA 3BZDB 4UP9A 5M3FB 4NDXA 4EGVA 2R7ZB 3G6EA 1CKNA 3AMUA 2L4NA 3K80C 1ICWA 4BBSB 5GAGC 1X6OA 4A3MG 3K7AB 1D5MC 5D3IB 4AYBE 4IUNA 2UXBL 4RGMA 4DUZL 3D4RA 1G51A 4IN3A 3AYHB 1D1KA 2PPBC 1XNQQ 3I7FA 4KJNA 3QG1A 3ERQA 2OQ0A 1A63A 1D7QA 4O1NA 5JOBA 3SE0A 5ISRA 4LW1A 3HOVH 3S1QH 1GUWA 1M8AA 3AFQA 3B6YA 1K83B 5FLXc 1XTCD 1NTGA 5IT9L 4AYBB 2NYZD 3HG9A 1SE4A 3S14H 1N33Q 3K5OA 3DHQA 4HCSA 5CYUA 4A3GG 1LT4D 3M3YH 4GNXB 1SSOA 2VQEQ 4K14A 1A6XA 1EFWA 4FNFA 4ALPA 2BOSA 1XPOA 3NXWA 1WTRA 2DY7A 1QE6A 1ML0D 1N32L 1EFID 1FJGL 3CKIB 4DR6Q 2CHBD 5FOBB 4K2LA 2R61A 4JG2A 3S1RB 4GNXA 4DV2Q 3S2HB 1IL2A 3V05A 3HOUH 4A3DB 1A3TA 5A35A 1R4QB 3HOZH 3RZDB 2B63G 4X64Q 3SHLA 3JAME 1S5BD 2F0SA 4KKUA 5CMDA 2Z6BA 5H1SE 2NVTB 3E6ZX 1TWAH 4X65L 1I94Q 3AFPA 3FP9A 1YNJD 2E74C 2IY5B 3TREA 5LMNQ 3ONAB 3TEHB 1WCMB 1B44D 2JYOA 2RCFA 1XMQQ 2DGYA 2ZT9C 5DM63 1IYVA 1DOMA 1VQ4A 1JR0D 2OXPA 2PQEA 2I07B 5IYDH 1Q1BA 5M3MH 5C3EH 2HDMA 3A56A 1X65A 2KEEA 3SDZA 5I6WA 2MGSA 2UUAQ 4YY3Q 1A3VA 4A93H 4KHPL 5M5YH 1KRTA 1CA5A 1A62A 3G71A 1W6KA 4A75A 1T5EA 1WOCA 1NAPA 2FMMA 4FDBA 4WJ4A 1O7YA 2E76C 4OX9L 3I91A 4JI4L 2NVXH 2YTYA 4K8JA 3CCMA 1ILPA 4QF4A 2Q8TA 1KL9A 4DR5L 2JA8H 4TQUS 3TZUA 1T9HA 4XYQA 3W3AA 3WDNA 2OCEA 1U0LA 4IO9A 1LTBD 4YWMA 2L1BA 2TSSA 5IIFA 3KK7A 1NCVA 5JJKA 4CKEA 3PUWA 1A3UA 1SLJA 2QEXA 1DJRD 4U68A 2OTJA 3UE0A 4K2KA 1C0AA 1TWGH 3BVGA 4XT3B 1KNEA 2K04A 3PIP3 1HZ9A 4R4CA 3HOVB 4A3FH 2B3GA 2JA5H 1B2TA 3CCSA 3S1QB 1H9MA 4LFBL 1Q86C 1CFMA 1S3OA 3CCVA 4CDDC 4Z9CB 3TS2A 2EYPA 1EY6A 1I3QH 4KJOA 5C5MA 3S14B 2N8NA 1SNQA 3KF8B 4OEMB 5EBCA 3E0EA 3Q0AA 1E24A 3OHXC 1SNOA 3H0GG 2NVQH 1GO3E 2KA7A 1Q90A 1QCBD 3P1HA 3KJOA 4QY7A 1BXTA 4HIMA 2FFKB 2KHJA 2F03A 4JYAL 2FJ2A 1CT1D 3EJIA 3KF8A 1STYA 2MO1A 3S15B 3PGZA 5EGTA 1XPRA 2F0IA 1OXXK 4CDFC 2PMZE 1Y14B 1FD7D 4BA2I 2KVMA 4LFCL 1EYGA 1ASYA 1S4ZA 3HOUB 1Y69U 1GHJA 1WTWA 3FKIH 4X3KA 3D0FA 4UAIA 4Q5VA 5HGQA 2RDFA 3HOZB 2M9VA 1IBML 4CKBA 1E7ZA 2NN6H 4G4KA 4DV3L 3L3OC 3NWTA 2KUMA 2LY7A 4R8NA 5BN4A 1TWAB 2L12A 4IUPA 2PZTA 4FF4A 1AZPA 4IFDG 3A7AB 1G6PA 3FHWA 2PMZB 5JEAJ 4ZQ3A 4IUVA 2PI2E 1K8MA 3DWQA 5A2QE 4R4QA 1J8IA 4G57A 3I4MH 4P74A 5K36G 4GLAC 1PFMA 5M3MB 5C3EB 2B2WA 1LM0A 1AP0A 1S5FD 1Q3LA 3BG3A 1VQOA 1EY4A 2RBMA 3M4OH 1S5ED 2Y0SG 4NXML 4A93B 5EPJA 5M5YB 1JORA 2A1AA 3K59A 1A2UA 2SNMA 1B7YB 3MEHA 4DR3Q 3HFZB 1JWSD 3M7GA 3A54A 2NVXB 2JA8B 1WYDA 1G291 4ZUJA 4OWWB 1U4LA 1UEBA 1Q1EA 4RA8A 2EY6A 1B3QA 4C56C 2MQHA 1BBUA 4PQXA 1CI3M 4O2DA 2AMCB 4ZK9B 2N78A 2ZJPA 1TWGB 1S72A 4LF5L 1RCVD 2JEAI 1IW7D 1SXTA 3PIPA 3M7NA 4GS3A 4A3FB 2JA5B 4QUCA 2P5ZX 1JWUD 5I9OA 2K5HA 2F0HA 1OO9B 3EBEA 3BDOA 4IZ8A 1I3QB 1STGA 4R4TA 2IPKD 5LL6S 2A74C 4YIJA 3VDYA 1Q82C 2K01A 3A8IE 1K8AC 1K8OA 3R2IA 4XIGS 4ODGA 3X3MA 4LF7Q 1EUJA 2NVQB 1BO0A 1D5ZC 2HQEA 1PVOA 2HCCA 4HJ7A 1EEFD 3D4WA 1XTDA 4A3MH 1X55A 4K5XA 2XTIA 2IJ0A 2JA9A 3S9WA 1JOOA 4DR2Q 3K0YA 3X3NA 4DV6Q 4DR4L 1L0YB 3K6OA 1G91A 4L8JA 4B08A 1B4OA 4RMFA 4YCUA 1AW7A 4GOPB 2WKDA 3FKIB 3KLSX 4R4OA 4WRDA 1X3GA 5LHY1 3C2PA 5IGGA 1MJCA 1UAPA 3VR2A 4K0KQ 1U4RA 4A3EH 4R9WA 4CJ0B 4JOIA 3QOJA 3GV6A 3KYHC 4B3ML 4A3GH 5EKKA 4C3IG 2B2WC 5DEHA 2F0VA 2KJXA 3EA6A 3MEFA 4HJ9A 4GOPA 2QDBA 1STEA 2E2HH 1LT5D 5HURA 3A74A 1XXGA 2CW0C 1WTOA 4DV7Q 1IL8A 3F2UA 3I4MB 4H13C 1HR0Q 2KENA 2A68C 1I4XA 2K5VA 1EU3A 3TSSA 1DM0B 3M4OB 1C9OA 1O80A 1Y8NB 1IBKQ 4A76A 2ZXPA 4J1MA 4DV4L 4LNQA 1TWCH 1BKBA 2B63H 4ZCKA 1K3BC 1LTLA 1D6EC 4OO1G 1GKHA 2KBNA 1BBWA 5ELFA 1TY0A 4JV5L 3NEMA 5LL6X 1LTSD 1II3A 3ULLA 1WD1A 2ZJQA 4IFDJ 1AEXA 3DM1A 1PRTF 2EIFA 4QJFA 2ZJRA 1AH9A 5FJ8G 3FEWX 4AH6A 4L5TA 1V8QA 5CGKA 1EZ6A 4A3KH 4LMQD 3K57A 2CH4A 1WTQA 1P16A 5CV4A 5AJ3L 1O7ZA 2IHFA 4DNTB 1FNWA 2O5JC 1WJJA 4KD4A 1RL2A 4LUVA 1I4GA 1VDZA 1J9OA 2WINB 1QZHA 3H6MA 1BDOA 2K6AA 1Z7TA 1HZAA 5FO8B 1PTOF 5C4HA 1CSQA 1KAWA 2I46A 2IX1A 2MUYA 1BOSA 3RR5A 2F0LA 1AE3A 4A3MB 1BBXC 1MSHA 4GKJQ 4B9WA 4UY8C 5C4ZA 4X62Q 3OIPA 3SK8A 2D2CC 1K9MC 1GUOA 2CQOA 1A15A 3PCOB 1VQFA 2JA6H 3U9SA 3KFUA 3HP3A 2E8GA 4JOIC 2X6GA 3A0JA 4DUYL 1VQKA 1EWCA 2NN6I 2JA7H 1E2ZA 4GOPC 1E2VA 4A3EB 3E0JA 5FLXL 2ZTEA 2KQ3A 3NQTA 2B39A 1L0XB 1H9JA 2NTSA 3RLOA 1PZKD 1N34Q 4A3GB 4OHJA 3H0GH 1DXMA 2WP8J 2ASBA 3IFTA 1IYJB 1MIUA 1CK1A 4RKBA 2E2HB 4DV0L 3URYA 1SYBA 1YNNC 1VF7A 3I90A 2PW5A 3GTOH 4JPBW 3P20A 2RQXA 3QJYA 2EQSA 1ESRA 3LGJA 1VQNA 3DEOA 2M2LA 1TWCB 2E5LQ 1ENAA 2C35B 2VL6A 4TSSA 2B63B 2ALYB 3HS0C 4DN4M 3T56B 4RG1A 2OF1A 4IPGA 3NBIA 3HRZC 3E9IA 1GOZA 2OTLA 1XNQL 4BA1I 1JJGA 1Q46A 4M8AA 4JI1Q 4IFDH 5LMUQ 3J81i 3I4LA 1VQCA 5K5PA 1BCPF 2L55A 4A3KB 4PZ8A 1K28A 1NMFA 4DK1A 3AB9A 1I6HH 1XMOQ 1KQSA 1YITA 5K36H 4ZAIA 2QILA 1N33L 4NB3A 2SOBA 2D9UA 3ER0A 3Q23A 4F7XA 3ERSX 2GA4B 2IW3A 3EFXD 4K6DA 5CBEE 1JJCB 1UUPA 2VQEL 3HOWG 1B50A 2K33A 2ICEC 2H5XA 2F0FA 1VQHA 2NZHA 2ZTCA 1HNZQ 4JI3Q 3HEJA 1NY4A 4RCOA 4POGA 1VMPA 5EPKA 1B1ZA 4ZKBB 2IX0A 3CPWA 3VR6A 4DR6L 3HZXA 3W1BA 2E2IH 3VYTA 2N49A 3OSOA 3J7ZC 4DV2L 2F0QA 2JA6B 4DR7Q 3SVMA 3JAML 1VQLA 1DONA 4GN4B 1PYWD 1P8LA 3UDIA 3PUXA 2HIVA 1RF2D 4JC0A 3NP8A 2JA7B 5C4XH 4X64L 3RUZA 1CKOA 1QNUA 4X6AH 1Y1VG 5EQ0A 1SYGA 4DU9A 4LWCA 1I94L 3TP5A 5LMNL 1LTRD 4C3HG 1LTID 1EY8A 2AUJD 1XMQL 3H0GB 1ENFA 1WTVA 3A55A 2CKZB 4KN4C 4GLVB 1ET6A 5ELBA 1EZ8A 3Q6SA 1NNXA 2AHOB 2QF7A 3P7JA 3SR1A 3PO2H 5E1FA 1Q81C 1L2FA 4A3IG 5JJLA 5G3LD 4HAEA 4HCEA 3GTOB 3S1NH 2FMCA 2L0CA 3CCQA 2UUAL 4YY3L 3S1MH 3VYUA 1R9TH 2BDOA 4GN3B 4LUZA 4APVA 2EYLA 4POFA 1XWEA 2WV6D 3K81C 4DGZA 4DAPA 1NSNS 3J7YW 1EOVA 3TRZA 1RTOA 3STBC 3CHBD 3FMCA 2K32A 5BN3A 3NK9A 4OWXB 1X9NA 4IJHA 5ELDA 3IRBA 1PZID 5CORA 2KCNA 4DR1Q 3MWYW 2F4IA 3QB3A 1W2BA 1FVIA 1SR3A 4XT1B 1PZJD 1QILA 4P71A 5J1ZA 1UE1A 3BYTB 3CCUA 1I6HB 2VZAA 3TDQA 2PQAB 3GTPH 2BCOA 2YYZA 1HTPA 3EROA 3J80i 3I72A 5IYCG 1VS0A 1I6VC 1YZ6A 1PXUA 4HR7B 2LMCB 5IGBA 2F0PA 2UUCQ 4LF9Q 1IHZA 5AFWA 1F2LA 2MNAA 2FHTA 4B3SQ 2HT1A 1F77A 2PW7A 4L5QA 1Q12A 4IUUA 2PQAA 2WB1G 2TMPA 3I55A 3DWPA 1A8VA 1IKLA 4OO1H 3IAYA 4YCVA 2E2IB 2G9HD 2EJGC 3RN5A 4JBWA 3A8JE 1B53A 1YI2A 2JEBI 5FJ8H 2F4VQ 4EQPA 3NBHB 4B3TQ 3OOCA 3K7UC 1DZ1A 5C4XB 3UE1A 1TWHH 3BJUA 2Z4IA 4ILWA 2BA1A 1F9SA 1F2YA 4FXKC 4ULLA 4UDUC 1KLUD 2CW0D 1C4QA 2VW9A 1F9PA 2X69A 5A2QL 3I4NG 1ET9A 4PG3A 2A68D 1I50H 4FO2A 3OIQA 3E5SA 3BS1A 2OWOA 1NMGA 3TBIB 2EXDA 1WTHA 1KDCA 2R7DA 3PO2B 4QGUA 4B9XA 2VB3X 1TWFH 4HIKA 1R4PB 1RKNA 2EJMA 4H02A 1YIJA 1K73C 1KNAA 1BVSA 1Z6HA 3S1NB 2ATWA 3S1MB 2NZOA 1LACA 2SDFA 3H94A 3MFYA 4WFN3 1R9TB 3M3YB 4KI0A 3I56A 1SAPA 4DR3L 1QOHA 3PF4A 4EQ5A 4WJWA 5CV7A 4GNXC 1HJPA 5JAVA 1AFPA 2K05A 4JI2Q 5I2YA 1DOLA 2JP1A 4A3LG 2QKIC 5KRUA 2F0NA 2A69C 2PNHA 4H44C 4JBKA 2EYOA 4F8MA 1MHWC 3CP0A 1PLFA 4PV1C 3KLWA 2DN8A 2RSOA 4H7BA 3HKZE 1S5CD 1DOKA 2Q2HA 4DPGA 2EJFC 3VR3A 4IJLA 2EVBA 3GTPB 1HCZA 3C1FA 5CV6A 1CZWA 1H9RA 4JBJA 1SJED 3R2TA 3S2DH 4HIDA 4LF7L 4P2CB 1EY5A 2F0KA 3I8ZA 3GTMH 2F0GA 5I9PA 3HKZB 4GN5A 5CC4A 2BE5C 1CTMA 5M5XH 1D8LA 4IUQA 4DV6L 4DKAC 4DR2L 2CH4W 5F2DA 1SNMA 4JI7Q 4RKLA 3KOJA 4TKOB 5C0XG 2N3SA 5KIXA 1UWVA 2J7ZA 1EIHA 4QCLA 3NTKA 3R8BA 3P75A 3UDGA 3K0XA 5M5WH 4L5SA 1CZGA 2HIXA 3CQZH 3CCRA 2QW7A 1PTOH 1PH1A 3ND9A 2L11A 3LX0A 2UXCQ 1TWHB 3L9AX 3LWEA 4K0KL 1HQMC 4NXNQ 1HR0W 4TRDA 1SN8A 4CDCC 4A3CG 2CFMA 4GKKQ 3GTJH 2BH8A 2Q8RE 1YNND 2K28A 2F0OA 5EJWA 1TU2B 1V1PB 1JQYD 5IODA 1F2ZA 4GZYC 1VF5C 3HOWH 1I50B 2B2YA 4ABNA 5E3FA 3CCEA 2JK8A 2K7VA 4DAVA 1IXRA 1VQJA 1Q8IA 1RD9D 2PI2A 1K0SA 4DV7L 4FYDA 4LF6Q 1CHQD 4DNIA 1HR0L 2X6LA 1TWFB 2K5NA 1IBLQ 2EE1A 1VQ6A 2RF4A 3Q22A 4NMZA 3WOEA 4MZ9A 3MAQA 2IT1A 3KF6B 5CR3A 5IP9G 2JE6I 3EVQA 4S3SA 1IBKL 3C46A 5IE8A 3PUYA 1CKMA 1LO5D 1U4MA 5E7NA 2UXDQ 5CV8A 1IKMA 5KNDA 4AQYQ 1Y1VH 5DAUA 3D6CA 5GAHC 4N8X1 3KF6A 4PZ7A 2EYMA 1GJXA 1SFOH 2A73B 1QVGA 2H4OA 3J7AV 1I4HA 5C6AA 3J81c 3HOYG 1SE8A 3S16H 4KV6A 1CQFA 1QG7A 2XGTA 2HUGA 5JVG3 4A3IH 3CF5A 2R92G 4DV5Q 1SMXA 5IWAQ 4DXFA 2CVRA 1G2TA 4FVMA 2K5DA 3OTOQ 3S2DB 2I0QA 4JW0A 5IP7G 3H91A 4C3JG 3GTMB 5CV9A 3W5OA 1PH2A 1PRTB 3DXJC 1CUKA 3D8GA 2DY8A 4GKJL 4TVAB 1XNRQ 4B3RQ 4X62L 1LT6D 3PUZA 1Y8PB 4LUOA 1Q8KA 2IL8A 2HDLA 1Y1WH 5M5XB 4PMCA 1VQPA 2XRSD 2QCPX 4ZUIA 2B2VA 3U9OA 4I7ZC 3M4PA 2AWOA 1UEAB 4ME3A 1RTNA 1STHA 2RDHA 4DV1Q 3VA5A 3RMHA 4EVOA 4O0AA 1GM5A 4J15A 3TP7A 4MTNA 5M5WB 3CQZB 1PTOB 3SEBA 3RD4A 2B2YC 4IPHA 2A19A 3T4AC 4Y7NH 1B9MA 4ZLTF 4XQNA 3CD6A 3GTJB 5I2XA 1LTAD 5IYCH 2VUMG 1VQBA 2GN5A 3U4VA 4CBVA 1YJNA 1YHBA 1N34L 3GTGH 1EQVA 1VQIA 1EY0A 5GROA 1CA6A 2J0TD 4JI6Q 4G7ZC 2K5QA 2AUKA 5E4WC 5BR8Q 3HOWB 3RLFA 1CM9A 4LFAQ 1JB7A 1JE4A 1EQTA 1ESFA 3J80E 1I4RA 4XXEA 2SEBD 3BU2A 4O42A 1FL0A 1EIFA 2L9HA 1I4PA 3STBD 2KCMA 3MHBA 3AU7A 4UP7A 2F0JA 4UHVA 5C0XJ 3D4DA 4A93G 2XN9C 3S24A 1EY7A 2E5LL 4QIWB 3PSIA 3TQYA 1WVLA 2UU9Q 3K8AA 2UUBQ 4IALA 2Z0SA 1NE3A 1Y1VB 3BYYB 2HHHQ 2XVSA 2OT2A 2KECA 1PH8A 1BNZA 1BUVT 1HNXQ 1E1OA 2CWAA 3KBGA 4JI1L 1SFOB 3I4NH 5JJIA 1PH4A 5LMUL 2BDNA 1LUZA 4OWTB 4QL5A 4X3TA 2R93G 1SYCA 3S16B 2VY3A 2XNAC 3PUVA 4YHHQ 1XMOL 2YV5A 1D2BA 5M9OA 3U58A 2DUDA 4R8IA 4UP8A 4A3IB 4MNOA 4ID6A 2Q8IB 1V1QA 3J80c 4ZYSA 1L1OB 1HNWQ 1U9RA 4BXXG 1K8GA 2NVYH 1TQOA 1WFQA 1ILQA 2MJ8A 2B2VC 3F2DA 4C2MH 4DNRB 2E75C 1C7YA 3G4SA 2F52A 1HNZL 4JI3L 4RGNA 3M4YA 3H15A 1PRTC 3CC2A 1BCPB 1WTPA 4A3LH 3NTIA 5IGDA 1EWHA 1QVFA 1L1OA 1E0BA 3FPUB 3KDFB 4XTCS 4CJ2C 4IPDA 2F0UA 5BN5A 2WIIB 5I6YA 3A7LA 4DR7L 3I70A 4RH6A 4N8FA 1HXYD 3T13A 3OPOA 1MI2A 1Y8OB 2WACA 4NW2A 4KKTA 1ZYRD 2RVLA 3KUPA 1QB5D 1N36Q 3HOXG 1WD0A 3T1HQ 1EIYB 2NN6G 1M1KC 1Z9FA 4Y7NB 1EL0A 2ZXOA 3CW2C 2K1BA 1SNCA 3KDFA 4WJ3M 3RN2A 3GO5A 3GTGB 4CJ1B 2XWJB 3KLRA 1SJHD 1H9KA 4KMUC 3VA7A 3FRPB 1B70B 1X3PA 3V96A 4AIMA 1TS3A 1YVCA 1VMCA 4V190 2IWHA 3LWUA 4HJAA 1MGSA 3T1YQ 3I4MG 3Q8DA 1MSGA 4G7OC 1O7LA 5L37A 4YCWA 4H0LC 3LNNA 5IYBG 1AZQA 3G7LA 4HSVA 3NPPA 2A69D 3FPPA 1KHIA 3DWAA 1YJWA 1G2SA 2PO4A 5C0XH 1RJTA 3PIO3 2HD3A 5KNCA 4LF8Q 3N6RA 2WAQG 4RHSA 2K4KA 1F9QA 4JI8Q 2KEDA 1VQ9A 4M1UB 2N88A 4LF4Q 2XRQD 5FLMG 2LSSA 2Z9HA 1PHJA 1J5EQ 5T1GA 4G7HC 1W3SA 2F3IA 4DR1L 1JWMD 3OMGA 5C4JH 2ES2A 1VQ7A 2ZM6Q 2VQFQ 1V1OA 3Q24A 2LKVA 4IOCA 4F87A 1CSPA 1NJIC 2BE5D 1HA5A 4U673 1TR5A 2UUCL 4LF9L 2GVAA 1NR2A 3OWEB 2PZWA 2NVYB 1HFGA 1L1OC 5IP9H 5C5LA 2AQ2B 2G9DA 4IURA 4B3SL 4C2MB 2B2UA 4X66Q 4QB4A 2MHVA 3QIAA 4JI5Q 1PFBA 3T53B 2CWPA 4KY6A 2EXZA 4K6LA 1DYQA 1B8AA 1X56A 5FK9C 3NHHA 1W6JA 3MXUA 1NBWA 5J39A 1N8RC 1BCPC 4KKSA 5D65A 1E1TA 2DJFC 1KD1C 5D3DA 3NELA 2F0TA 3EIVA 1VQMA 1L0WA 2K5WA 1PH9A 2F4VL 3PO3G 3I4OA 1EU4A 4B3TL 3QR8A 3TN2A 4GLXA 3HOYH 1V9PA 1DD2A 2VS1A 2PYKA 4BY7G 1QUQB 3GDEA 3MZ5A 3W1GA 1SE3A 4PMWA 1UNSA 1HH2P 1HTLD 3CXCA 4A3EG 5IGCA 2R92H 5J22A 4EQOA 1EQRA 1KRSA 3BVZA 5EAYA 3H3VH 4A3BG 1JJ2A 1O78A 1E3PA 1EYDA 2Y0SE 4C3IH 1XYIA 2VNUD 2RKSA 3MXPA 1VQGA 4FXDA 4FF1A 1SROA 5JEAG 5IP7H 1QUQA 4C3JH 1E22A 3E9HA 4HSPA 4FXGC 4RFBA 3GTKH 3K5MA 1FGUA 3C1EA 1TY2A 1SDFA 4MTKA 3ITPA 4I65A 1RIPA 3S15H 2Z8LA 4JI0Q 2K52A 2N55A 3BVMA 4XYOA 4IOAA 2DJGC 1K0RA 5C3XA 1QZGA 3RZOH 2A6HC 2YTVA 5COYA 4BBRG 3CCJA 1PA6A 3K5LA 2Y0SB 5ELNA 3T16A 3PQIA 3PIOA 4JI2L 3K5NA 3HGBA 4FP5D 3GTQH 5KYIA 1PYBA 1EIGA 2CCZA 2UXBQ 2VUMH 1KLGD 5ELOA 4DUZQ 1X54A 5JPNC 2Z6KA 1F2MA 4DK0A 3A5ZB 3D6WA 2MFIA 5JPMC 3R93A 4DAMA 2B2TA 3MVVA 4CGYB 5EKIA 1PYSB 5C4JB 4ZKCB 1STNA 3F2BA 4A3KG 3CCLA 4ZRZA 2OQKA 1VCIA 4KLKA 1JE5A 2B2UC 1SYDA 4HJ5A 2YU9H 1FNVA 2IX3A 1HZBA 1RHPA 3GTLH 3T51B 4E6IA 1M4VA 3VR4A 3QOLA 4L63B 3HKSA 1GUTA 4RCNA 1VQ8A 2ZXRA 3NBHA 1JOQA 3E3XA 1Y1WG 4HTHA 5NUCA 5D14A 1ZYRC 5IT9E 3SK5A 1OXUA 2M00A 4BY1G 4QUFA 3M85A 3PF5A 1F9RA 1EEID 4QQBX 1EWIA 4Q0FA 1KDBA 4A3JG 3KBXA 1EQQA 1FJGQ 1N32Q 5C44G 4JI7L 3ICEA 1XX8A 3JAMc 3C3LA 4PNYA 2JA6G 3SK4A 2D0PA 1ZEQX 4RHRA 5DNFA 4F88A 5M3FG 4FF3A 3CMAA 2R7ZG 2R93H 4DA2A 1DGSA 4JBMA 3HOYB 2AQ3B 1ASZA 2JA7G 2UXCL 2R3ZA 3J81L 2L15A 4NXNL 4BBSG 4LAAA 4A4IA 2E2JH 1HUMA 2JJQA 2VXWA 4LJZC 4GKKL 1HUNA 1I4QA 2R92B 1VQAA 1X3FA 4BS9A 4KK7A 1SMYC 3M9BA 4BXXH 3ZJYC 4IFDI 3U50C 1WTXA 4HMJA 2GVBA 4X65Q 1TT2A 4C3IB 1QWYA 1VQEA 5E4XA 4JK1C 2QA4A 5G3LF 3PMFA 2B8FA 2Z4HA 2QEJC 2EY5A 4C3JB 5FO9B 2E2DC 2J4XA 1S40A 1JT8A 5IT9c 1SYFA 1K3RA 4LF6L 3GTKB 1VQ5A 1JC7A 2KHIA 5ELEA 1GUGA 1IBLL 4AYBG 5C0XI 4KY7A 1OXSC 2JXMB 1GXDC 3RZOB 4I7AA 1MD2D 1NR4A 4NPSA 4KHPQ 2A6EC 2Z6KC 4N9TA 2UXDL 1LABA 1PDQA 5HY6A 3HOXH 2F0MA 4CDEC 4AQYL 2B2TC 4OX9Q 4JI4Q 3CC4A 3GTQB 1LT3D 3VYSA 1A2TA 3GV3A 4DR5Q 1MJEA 2D0OA 3I2ZA 1WI5A 2VUMB 2KCTA 1V43A 1G8ZD 3MA2B 1EY9A 4C1NK 3ULPA 2BH2A 3UDXA 1IZ6A 1KXLA 1KTKA 1T5XD 1FNUA 2A5HA 2V4DA 4A3DG 2K75A 2H1EA 3BDLA 1SNDA 4OXPA 2JSOA 1STBA 1YEZA 3F1ZA 2SNSA 3MXNB 1YHQA 3EQLC 4YWLA 4OIKA 1PMRA 2YU9B 4LFBQ 4DV5L 1PRTD 5IWAL 2AKWB 3GTLB 5IYBH 3K58A 2NBFA 3OTOL 3NQIA 3SK6A 3J81E 4OELB 1X3QA 2L5TA 2ZTDA 1WCMG 1BQQT 3J7AF 2EPBA 2EYJA 1SRUA 4NKLA 2AQ1B 3MXNA 1B9NA 1XNRL 4B3RL 2F0EA 3BDCA 5KGUA 3GD7A 1XPUA 1J6QA 4IUTA 1YBYA 4JYAQ 1TIID 3FDTA 1PTOD 5FLMH 1V1PA 4KHVA 4K5VA 3A5UA 3G48A 5FO7B 3TZDA 1OXVA 3WWVA 4DV1L 2QDLA 4DFAA 1PH5A 2R93B 4LFCQ 2WKCA 3D31A 3M4QA 4KTAA 1KIXA 5C4XG 4RAUC 2EZVA 1KAAA 4C1NI 2EY2A 2FINB 2LFNA 3NUCA 2E2JB 1G6ZA 1IBMQ 3H3VI 5GQOA 1JB3A 2OEOA 2O2LD 2MO0A 4DV3Q 4JVZA 3GQBA 2F1MA 4JI6L 4MN3A 4JCVE 4C3HH 3J80L 5BR8L 3H3VC 3EN2A 3N52A 3I3CA 5DLQE 4LK1C 1N9WA 4LFAL 4XQQA 1HQRD 1TS2A 3VR5A 2F3WA 3HOVG 2R7FA 2B8GA 5JJZA 1XJVA 1Q7YC 3PO2G 2XSCA 1UE5A 3RLNA 2QGQA 3R3OA 3CRLC 1KABA 4OL7A 2G5DA 3MXGA 2K03A 2LXJA 5KNBA 1SYEA 5CBAE 1PH3A 5C3WA 1YJ9A 1YNJC 4BWGB 2O4XA 1LV9A 1RDPD 3OW2A 3S17H 1RODA 1U4PA 3PO3H 2RA4A 3TP6A 2UU9L 2F3VA 4NXMQ 5CV5A 5T1IA 3MFGA 4BY7H 3TP8A 3IFDA 1HZCA 2UUBL 3HOXB 3G6JB 4OO1I 3BZCA 3RNUA 2ENBA 2EYHA 4XDXA 4DK3C 3SXHA 2HHHL 3F8TA 1HNXL 1TXYA 3W2DA 1OXTA 4FF2A 3UDFA 4A3BH 3DEPA 3JAMi 2HQLA 2K14A 1X32A 1SEBD 2F0WA 3NWSA 3J7A5 3ND8A 5JEAH 3HOUG 3CAMA 4YHHL 1PH6A 1EYCA 2NTTA 2WAQE 4KHZA 5TSSA 2C9OA 1GD7A 3HOZG 1LYLA 4LF5Q 3L2PA 2Z1CA 3L7ZC 4HN7A 1ONLA 2KOLA 5JVH3 4PZ6A 2O5IC 1HNWL 1BCPD 1HA6A 1O7IA 2KHSA 2NWGA 1C8CA 2ID0A 5EBDA 2K50A 2RHSB 1JMCA 3PV0A 4ME5A 4BBRH 2Q2IA 4QIWE 4QMGA 1QNKA 3MTSA 1SNPA 1JCKB 3SGIA 3AEVA 1ZXTA 3HKZG 5IGFA 1HHVA 2WAQB 1Z47A 3I73A 5IYDG 4CKCA 1HFNA 3V2TA 5M3MG 5C3EG 3UI2A 2EY1A 4NP5A 2XWBB 1OTCA 4KD3A 1TVXA 1FYCA 4DR4Q 1X3EA 1YHAA 2D62A 4WORA 4V0BA 3ULJA 1UE6A 3QO2A 4CHTB 1GHKA 1N36L 3T1HL 4OIJA 5IGEA 5EPLA 2LS01 1C48A 3CRKC 5KYLA 2NB0A 2PNRC 1SE2A 4RGTA 2JA8G 2RHQB 1IYUA 2WFWA 1TS4A 5IOCA 4P72A 1M90C 2D5DA 5ELCA 1JICA 4C3HB 2YTXA 4B3MQ
chains in the Genus database with same CATH topology
5HGTA 2A6HD 1LTTD 4J8QA 1NUCA 3DUZA 1PFNA 1GUSA 4KY5A 5EKLA 1S5DD 2F0DA 4HMIA 3TMEA 1SBBB 1LLRD 2KCCA 3S17B 4KN7C 3PO3B 2MP1A 1JOKA 1AN8A 4XQJA 3NTHA 3D3RA 3IKJA 5KEEA 4BY7B 1D5XC 4OGQC 3IL8A 3QWNA 1FR3A 4N9PA 4MHEA 2AWNA 3FVQA 1BF4A 4A3BB 3A8KE 3KLSA 4X3UA 3OW7A 4RWSC 2NZ1D 1ZKOA 1E2WA 3WOFA 1PTOC 2C5CA 4DF7A 4MIUA 3CU7A 2RSNA 3NSWA 2PCFB 3OWFA 4BBRB 1B3AA 1D1IA 1IW7C 4EQNA 3NE5B 2DNCA 2DNEA 4IQZA 5I4DA 2WB1B 2VB2X 3H09A 5FKAC 2CQAA 1SMYD 2PZUA 2EOTA 3MC0B 4RGOS 1TS5A 1HRJA 1CHPD 1CQVA 4DAYA 4K5WA 3VYRA 1ENCA 5DM73 2EYFA 3OMCA 2R6GA 1LTGD 1MBYA 2BA0A 3O13A 3I4NB 1H9SB 1KDAA 2MPMA 1EYAA 1Y1WB 4DXGA 2NUCA 3ZYYX 4PMBA 4HEDA 2RDGA 5FLXE 4BY1B 2XIWA 4L6TB 2A6ED 1STAA 1BR9A 1QJOA 2EDGA 1DCZA 1HPCA 4K8IA 2HCIA 4A3JB 2ICIA 5C44B 3DMUA 4X3SA 1H9SA 4J6HA 1FGBD 3GP7A 1EOTA 1GUNA 1TKWB 3BZDB 5M3FB 4NDXA 4EGVA 2R7ZB 3AMUA 2L4NA 1ICWA 4BBSB 3K7AB 1D5MC 5D3IB 4IUNA 4RGMA 3D4RA 4IN3A 1D1KA 2PPBC 4KJNA 3QG1A 3ERQA 4O1NA 5JOBA 3SE0A 5ISRA 1GUWA 1M8AA 1K83B 1XTCD 5IT9L 4AYBB 2NYZD 3HG9A 1SE4A 3K5OA 3DHQA 4HCSA 5CYUA 1LT4D 1SSOA 4K14A 1A6XA 4FNFA 2BOSA 3NXWA 1WTRA 2DY7A 1QE6A 1ML0D 1EFID 3CKIB 2CHBD 5FOBB 4K2LA 2R61A 3S1RB 3S2HB 3V05A 4A3DB 1A3TA 5A35A 1R4QB 3RZDB 3SHLA 3JAME 1S5BD 2F0SA 4KKUA 5CMDA 2NVTB 3E6ZX 1YNJD 2E74C 3ONAB 1WCMB 1B44D 2JYOA 2ZT9C 5DM63 1IYVA 1DOMA 1JR0D 2OXPA 2PQEA 2I07B 1Q1BA 2HDMA 3A56A 2KEEA 3SDZA 5I6WA 2MGSA 1A3VA 1CA5A 1W6KA 1T5EA 2FMMA 1NAPA 1O7YA 2E76C 3I91A 4K8JA 1ILPA 4QF4A 2Q8TA 4TQUS 3TZUA 4XYQA 3W3AA 3WDNA 1LTBD 2L1BA 2TSSA 5IIFA 3KK7A 1NCVA 4CKEA 3PUWA 1A3UA 1DJRD 4U68A 4K2KA 4XT3B 3BVGA 1KNEA 2K04A 3PIP3 3HOVB 1B2TA 3S1QB 1H9MA 1CFMA 4Z9CB 2EYPA 1EY6A 4KJOA 5C5MA 3S14B 1SNQA 5EBCA 3Q0AA 3OHXC 1SNOA 2KA7A 1Q90A 1QCBD 3P1HA 1BXTA 2FFKB 2F03A 2FJ2A 1CT1D 3EJIA 3KF8A 1STYA 3S15B 5EGTA 2F0IA 1OXXK 1FD7D 4BA2I 2KVMA 1S4ZA 3HOUB 1Y69U 1GHJA 1WTWA 4X3KA 4UAIA 4Q5VA 2RDFA 3HOZB 2M9VA 4CKBA 2NN6H 4G4KA 3L3OC 3NWTA 2KUMA 2LY7A 4R8NA 5BN4A 1TWAB 2L12A 4IUPA 2PZTA 4FF4A 1AZPA 4IFDG 3A7AB 2PMZB 5JEAJ 4ZQ3A 4IUVA 5A2QE 1K8MA 3DWQA 1J8IA 4G57A 5K36G 1PFMA 5M3MB 5C3EB 2B2WA 1AP0A 1S5FD 1Q3LA 3BG3A 1EY4A 2RBMA 1S5ED 4A93B 1JORA 5EPJA 5M5YB 3K59A 1A2UA 2SNMA 3MEHA 1JWSD 3M7GA 3A54A 2NVXB 2JA8B 1G291 4ZUJA 1U4LA 1Q1EA 4RA8A 2EY6A 4C56C 4PQXA 1CI3M 4ZK9B 1TWGB 2JEAI 1RCVD 1SXTA 1IW7D 3M7NA 4A3FB 2JA5B 4QUCA 5I9OA 1JWUD 2F0HA 1OO9B 3BDOA 4IZ8A 1I3QB 1STGA 2IPKD 5LL6S 2A74C 4YIJA 2K01A 3A8IE 1K8OA 3R2IA 4XIGS 4ODGA 3X3MA 2NVQB 1BO0A 1D5ZC 2HQEA 2HCCA 1EEFD 3D4WA 4K5XA 2IJ0A 3S9WA 1JOOA 3K0YA 3X3NA 1L0YB 3K6OA 1G91A 4L8JA 4B08A 1B4OA 1AW7A 2WKDA 3FKIB 3KLSX 4WRDA 5LHY1 3C2PA 5IGGA 1UAPA 3VR2A 1U4RA 4R9WA 4CJ0B 3QOJA 3GV6A 5EKKA 4C3IG 2B2WC 5DEHA 2F0VA 2KJXA 3EA6A 2QDBA 1STEA 1LT5D 5HURA 1XXGA 2CW0C 1WTOA 1IL8A 3F2UA 3I4MB 4H13C 2A68C 1I4XA 1EU3A 3TSSA 1DM0B 3M4OB 1O80A 1Y8NB 2ZXPA 4J1MA 1D6EC 4OO1G 5ELFA 1TY0A 5LL6X 1LTSD 1II3A 1WD1A 4IFDJ 1AEXA 3DM1A 1PRTF 3FEWX 1V8QA 5CGKA 1EZ6A 4LMQD 3K57A 1WTQA 5CV4A 1O7ZA 4DNTB 1FNWA 2O5JC 4KD4A 1I4GA 1VDZA 1J9OA 2WINB 3H6MA 1BDOA 2K6AA 1Z7TA 5FO8B 1PTOF 5C4HA 2I46A 2IX1A 2MUYA 1BOSA 2F0LA 4A3MB 1BBXC 1MSHA 4B9WA 5C4ZA 3OIPA 3SK8A 2D2CC 1GUOA 1A15A 3U9SA 3HP3A 2X6GA 1EWCA 2NN6I 1E2ZA 1E2VA 4A3EB 3E0JA 5FLXL 2KQ3A 3NQTA 2B39A 1L0XB 1H9JA 2NTSA 1PZKD 4A3GB 4OHJA 1DXMA 2WP8J 3IFTA 1CK1A 4RKBA 2E2HB 3URYA 1SYBA 1YNNC 1VF7A 3I90A 2PW5A 3P20A 2RQXA 3QJYA 1ESRA 3DEOA 2M2LA 1TWCB 1ENAA 4TSSA 2B63B 3HS0C 4DN4M 3T56B 2OF1A 3NBIA 3HRZC 1GOZA 4BA1I 4M8AA 4IFDH 3I4LA 5K5PA 1BCPF 2L55A 4A3KB 4DK1A 3AB9A 5K36H 4ZAIA 2QILA 2SOBA 2D9UA 3Q23A 4F7XA 2GA4B 2IW3A 3EFXD 4K6DA 5CBEE 1UUPA 1B50A 2K33A 2ICEC 2F0FA 4RCOA 3HEJA 1VMPA 5EPKA 1B1ZA 4ZKBB 2IX0A 3VR6A 3HZXA 3VYTA 3OSOA 2F0QA 2JA6B 3SVMA 3JAML 1DONA 1PYWD 3PUXA 1RF2D 3NP8A 2JA7B 3RUZA 1QNUA 5EQ0A 1SYGA 4DU9A 3TP5A 1LTRD 4C3HG 1LTID 1EY8A 2AUJD 3H0GB 1ENFA 1WTVA 3A55A 4KN4C 1ET6A 5ELBA 1EZ8A 3Q6SA 2QF7A 3P7JA 3SR1A 5E1FA 5G3LD 4HAEA 4HCEA 3GTOB 2FMCA 2L0CA 3VYUA 2BDOA 2EYLA 1XWEA 2WV6D 4DGZA 4DAPA 1NSNS 3J7YW 1RTOA 3CHBD 3FMCA 2K32A 5BN3A 3NK9A 5ELDA 1PZID 5CORA 2KCNA 3MWYW 2F4IA 3QB3A 4XT1B 1PZJD 1QILA 5J1ZA 3BYTB 1I6HB 3TDQA 2BCOA 2YYZA 1HTPA 3EROA 3I72A 1I6VC 1PXUA 4HR7B 2LMCB 5IGBA 2F0PA 1IHZA 5AFWA 1F2LA 2FHTA 1F77A 2PW7A 1Q12A 4IUUA 2TMPA 3DWPA 1IKLA 4OO1H 3IAYA 2E2IB 2G9HD 2EJGC 4JBWA 3A8JE 1B53A 2JEBI 4EQPA 3OOCA 1DZ1A 5C4XB 2Z4IA 4ILWA 2BA1A 1F9SA 1F2YA 4FXKC 4ULLA 4UDUC 1KLUD 2CW0D 1C4QA 1F9PA 2X69A 5A2QL 1ET9A 2A68D 4FO2A 3OIQA 3E5SA 3BS1A 3TBIB 1KDCA 3PO2B 4B9XA 2VB3X 1R4PB 1RKNA 2EJMA 1KNAA 1Z6HA 3S1NB 3S1MB 2SDFA 1LACA 3H94A 3MFYA 4WFN3 1R9TB 3M3YB 4KI0A 1SAPA 1QOHA 4WJWA 5CV7A 5JAVA 1AFPA 2K05A 5I2YA 1DOLA 2JP1A 2QKIC 5KRUA 2F0NA 2A69C 4H44C 2EYOA 4F8MA 1PLFA 4PV1C 2DN8A 2RSOA 4H7BA 1S5CD 1DOKA 2EJFC 3VR3A 2EVBA 3GTPB 1HCZA 3C1FA 5CV6A 1CZWA 1H9RA 1SJED 3R2TA 4P2CB 1EY5A 2F0KA 3I8ZA 2F0GA 5I9PA 3HKZB 5CC4A 2BE5C 1CTMA 4IUQA 5F2DA 1SNMA 4RKLA 4TKOB 5C0XG 5KIXA 2J7ZA 1EIHA 4QCLA 3NTKA 3R8BA 3P75A 1CZGA 1PTOH 3ND9A 2L11A 3LX0A 1TWHB 3L9AX 3LWEA 1HQMC 4TRDA 2Q8RE 1YNND 2K28A 2F0OA 5EJWA 1TU2B 1V1PB 1JQYD 5IODA 1F2ZA 4GZYC 1VF5C 1I50B 2B2YA 4ABNA 5E3FA 2K7VA 4DAVA 1Q8IA 1RD9D 4FYDA 1CHQD 2X6LA 1TWFB 2EE1A 3Q22A 4NMZA 3WOEA 3MAQA 2IT1A 5CR3A 3C46A 2JE6I 3EVQA 4S3SA 3PUYA 1LO5D 1U4MA 1IKMA 5CV8A 5KNDA 5DAUA 3D6CA 1GJXA 2EYMA 2A73B 2H4OA 3J7AV 1I4HA 5C6AA 4KV6A 1CQFA 1QG7A 2HUGA 5JVG3 4DXFA 2CVRA 1G2TA 4FVMA 2K5DA 3S2DB 3H91A 4C3JG 3GTMB 5CV9A 1PRTB 3DXJC 3D8GA 2DY8A 1LT6D 3PUZA 1Y8PB 2IL8A 2HDLA 5M5XB 4PMCA 2XRSD 2QCPX 4ZUIA 2B2VA 3U9OA 4I7ZC 2AWOA 1UEAB 1RTNA 1STHA 2RDHA 3VA5A 3RMHA 4EVOA 3TP7A 5M5WB 3CQZB 1PTOB 3SEBA 3RD4A 2B2YC 3T4AC 1B9MA 4ZLTF 4XQNA 3GTJB 5I2XA 1LTAD 4CBVA 1EQVA 1EY0A 1CA6A 2J0TD 4G7ZC 2K5QA 2AUKA 5E4WC 3HOWB 3RLFA 1CM9A 1JE4A 1EQTA 1ESFA 3J80E 1I4RA 4XXEA 2SEBD 4O42A 2L9HA 1I4PA 3MHBA 3AU7A 2F0JA 5C0XJ 3D4DA 2XN9C 1EY7A 4QIWB 1WVLA 4IALA 1Y1VB 3BYYB 2XVSA 2OT2A 2KECA 1BNZA 1BUVT 3KBGA 1SFOB 2BDNA 4X3TA 1SYCA 3S16B 2XNAC 3PUVA 1D2BA 5M9OA 4R8IA 4A3IB 4ID6A 2Q8IB 4ZYSA 1U9RA 1TQOA 1ILQA 2MJ8A 2B2VC 4DNRB 2E75C 4RGNA 3M4YA 1PRTC 1BCPB 1WTPA 3NTIA 5IGDA 1EWHA 5BN5A 1E0BA 5I6YA 3FPUB 4XTCS 4CJ2C 2F0UA 2WIIB 3A7LA 3I70A 4RH6A 1HXYD 3T13A 3OPOA 1MI2A 1Y8OB 2WACA 4NW2A 4KKTA 1ZYRD 2RVLA 3KUPA 1QB5D 1WD0A 2NN6G 4Y7NB 1EL0A 2ZXOA 2K1BA 1SNCA 3GO5A 3GTGB 4CJ1B 2XWJB 3KLRA 1SJHD 1H9KA 4KMUC 3VA7A 3FRPB 1X3PA 3V96A 1TS3A 1VMCA 4V190 2IWHA 3LWUA 1MGSA 1MSGA 4G7OC 1O7LA 4H0LC 3LNNA 1AZQA 3G7LA 4HSVA 3NPPA 2A69D 3FPPA 3DWAA 1G2SA 2PO4A 5C0XH 1RJTA 3PIO3 5KNCA 3N6RA 4RHSA 1F9QA 2KEDA 4M1UB 2N88A 2XRQD 5T1GA 4G7HC 1JWMD 3OMGA 1V1OA 3Q24A 2LKVA 4F87A 2BE5D 1HA5A 4U673 1TR5A 1NR2A 3OWEB 2PZWA 2NVYB 1HFGA 5C5LA 2AQ2B 2G9DA 4IURA 4C2MB 2B2UA 4QB4A 2MHVA 3QIAA 1PFBA 3T53B 4KY6A 2EXZA 4K6LA 1DYQA 5FK9C 3NHHA 1W6JA 3MXUA 5J39A 1BCPC 4KKSA 5D65A 5D3DA 2F0TA 2K5WA 1EU4A 3TN2A 1DD2A 2PYKA 3MZ5A 1SE3A 4PMWA 1UNSA 1HTLD 5IGCA 5J22A 4EQOA 3BVZA 1O78A 1EYDA 1XYIA 2VNUD 2RKSA 3MXPA 4FXDA 4FF1A 5JEAG 4HSPA 4FXGC 4RFBA 3K5MA 3C1EA 1TY2A 1SDFA 3ITPA 4I65A 2Z8LA 3BVMA 2N55A 4XYOA 5C3XA 2A6HC 5COYA 3K5LA 2Y0SB 3T16A 3K5NA 3HGBA 4FP5D 5KYIA 1EIGA 1KLGD 5JPNC 1F2MA 4DK0A 3D6WA 5JPMC 3R93A 2B2TA 3MVVA 4CGYB 5EKIA 5C4JB 4ZKCB 1STNA 4ZRZA 1VCIA 2B2UC 1SYDA 1FNVA 2IX3A 1RHPA 3T51B 4E6IA 1M4VA 3VR4A 3QOLA 4L63B 1GUTA 4RCNA 2ZXRA 3NBHA 1JOQA 4HTHA 5NUCA 5D14A 1ZYRC 5IT9E 3SK5A 1OXUA 2M00A 4QUFA 3M85A 1F9RA 1EEID 4Q0FA 1KDBA 3KBXA 1XX8A 3C3LA 4PNYA 3SK4A 1ZEQX 4RHRA 5DNFA 4F88A 4FF3A 4DA2A 3HOYB 2AQ3B 2R3ZA 3J81L 4LAAA 1HUMA 2VXWA 4LJZC 1HUNA 1I4QA 2R92B 4BS9A 4KK7A 1SMYC 4IFDI 1WTXA 4HMJA 1TT2A 4C3IB 1QWYA 5E4XA 4JK1C 5G3LF 3PMFA 2B8FA 2Z4HA 2QEJC 2EY5A 4C3JB 5FO9B 2E2DC 2J4XA 1SYFA 3GTKB 1JC7A 5ELEA 1GUGA 5C0XI 4KY7A 1OXSC 2JXMB 1GXDC 3RZOB 1MD2D 1NR4A 2A6EC 4N9TA 1PDQA 1LABA 2F0MA 2B2TC 3GTQB 1LT3D 3VYSA 1A2TA 3GV3A 2VUMB 1V43A 1G8ZD 3MA2B 1EY9A 4C1NK 1KTKA 1T5XD 1FNUA 2A5HA 2V4DA 2H1EA 3BDLA 1SNDA 2JSOA 1STBA 2SNSA 3EQLC 4OIKA 1PMRA 2YU9B 1PRTD 3GTLB 3K58A 2NBFA 3NQIA 3SK6A 3J81E 1X3QA 2L5TA 1BQQT 3J7AF 2EPBA 2EYJA 4NKLA 2AQ1B 3MXNA 1B9NA 2F0EA 5KGUA 3BDCA 3GD7A 4IUTA 1TIID 3FDTA 1PTOD 1V1PA 4KHVA 4K5VA 5FO7B 3TZDA 1OXVA 4DFAA 2R93B 2WKCA 3D31A 4KTAA 4RAUC 2EZVA 1KAAA 4C1NI 2EY2A 2FINB 2LFNA 3NUCA 2E2JB 1G6ZA 1JB3A 2OEOA 2O2LD 3GQBA 2F1MA 4MN3A 3J80L 3H3VC 3N52A 3I3CA 4LK1C 4XQQA 1HQRD 1TS2A 3VR5A 2F3WA 2B8GA 5JJZA 2XSCA 3CRLC 3R3OA 1KABA 4OL7A 3MXGA 2K03A 5KNBA 1SYEA 5CBAE 5C3WA 1YNJC 4BWGB 2O4XA 1LV9A 1RDPD 1RODA 1U4PA 2RA4A 3TP6A 2F3VA 5CV5A 5T1IA 3MFGA 3TP8A 3IFDA 3HOXB 3G6JB 4OO1I 2ENBA 2EYHA 4XDXA 3SXHA 3W2DA 1OXTA 4FF2A 3DEPA 1X32A 1SEBD 2F0WA 3NWSA 3ND8A 5JEAH 1EYCA 2NTTA 4KHZA 5TSSA 2C9OA 2Z1CA 3L7ZC 4HN7A 1ONLA 2KOLA 5JVH3 2O5IC 1BCPD 1HA6A 2NWGA 2KHSA 1C8CA 2ID0A 5EBDA 3PV0A 4ME5A 4QMGA 1QNKA 3MTSA 1SNPA 1JCKB 1ZXTA 5IGFA 1HHVA 2WAQB 1Z47A 3I73A 4CKCA 1HFNA 3V2TA 3UI2A 2EY1A 4NP5A 2XWBB 4KD3A 1TVXA 1FYCA 2D62A 4WORA 4V0BA 3QO2A 4CHTB 1GHKA 4OIJA 5IGEA 5EPLA 2LS01 1C48A 3CRKC 5KYLA 2NB0A 2PNRC 1SE2A 4RGTA 1IYUA 1TS4A 5IOCA 2D5DA 5ELCA 1JICA 4C3HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBA E;  3DM1 A;  4HAE A;  3D6W A;  2B2T C;  4DN4 M;  3R93 A;  1LV9 A;  2B2T A;  2Q8R E;  1ROD A;  1RTN A;  2FFK B;  1PFN A;  1U4P A;  2K28 A;  2RA4 A;  1NR2 A;  3GV3 A;  2K01 A;  5EJW A;  4ZKC B;  1WTP A;  2FJ2 A;  1HFG A;  4LMQ D;  1WTQ A;  2B2U C;  5T1I A;  1BO0 A;  1E0B A;  1O7Z A;  2B2U A;  2B2Y C;  2MPM A;  3FPU B;  3IFD A;  4IUR A;  4CJ2 C;  1KNA A;  1RHP A;  2B2Y A;  2HCC A;  1PFB A;  4HED A;  4ZLT F;  1MI2 A;  4XDX A;  5EKI A;  5CMD A;  2XIW A;  1RTO A;  1J9O A;  2H1E A;  2SDF A;  2KVM A;  4NW2 A;  2MP1 A;  1S4Z A;  1WTW A;  1CA6 A;  1SAP A;  2RVL A;  3DEP A;  3KUP A;  4UAI A;  4X3K A;  5D65 A;  1X32 A;  2X6L A;  1WD0 A;  3ONA B;  5D14 A;  4OIK A;  2HCI A;  5COR A;  5E4W C;  2EE1 A;  4QUF A;  4ZAI A;  4X3S A;  2JYO A;  2K05 A;  1G91 A;  3MWY W;  1EL0 A;  1CM9 A;  3IL8 A;  1DOL A;  2D9U A;  2KUM A;  1DOM A;  2JP1 A;  2K1B A;  1F9R A;  1B4O A;  1EOT A;  1BBX C;  1JE4 A;  1EQT A;  1MSH A;  4MHE A;  3TN2 A;  2L12 A;  4XT1 B;  1X3Q A;  5CBE E;  1BF4 A;  3KBX A;  4IUP A;  4CJ1 B;  2EPB A;  1XX8 A;  1B50 A;  1U4M A;  1AZP A;  4O42 A;  2L9H A;  1A15 A;  2L4N A;  2KOL A;  1ICW A;  1IKM A;  2HDM A;  1PLF A;  1X3P A;  1U4R A;  4X3U A;  2KEE A;  3HP3 A;  1VMP A;  5DNF A;  1VMC A;  2MGS A;  2RSO A;  1HA6 A;  5EPK A;  1DOK A;  2NWG A;  2X6G A;  4IUT A;  4IUV A;  4R9W A;  4CJ0 B;  4ZKB B;  4RWS C;  1C8C A;  1J8I A;  5AFW A;  2NZ1 D;  3FDT A;  3GV6 A;  1MGS A;  2R3Z A;  1CA5 A;  1F2L A;  1MSG A;  1WVL A;  1XYI A;  1PFM A;  2B2W C;  2FHT A;  2FMM A;  1NAP A;  1QNK A;  1O7Y A;  1HUM A;  3MTS A;  2VXW A;  1HUN A;  2B2W A;  3I91 A;  1AP0 A;  1AZQ A;  3TZD A;  3G7L A;  1ZXT A;  1Q3L A;  4HSV A;  1ILP A;  1HHV A;  2Q8T A;  4IUU A;  3SVM A;  1DON A;  1G2S A;  2RSN A;  1QG7 A;  1IKL A;  1RJT A;  2KEC A;  1HFN A;  1BNZ A;  5EPJ A;  1GUW A;  1M8A A;  1WTX A;  1SDF A;  2HUG A;  1WTO A;  1IL8 A;  1B3A A;  3F2U A;  4RAU C;  3UI2 A;  2L1B A;  2FIN B;  3I8Z A;  2BDN A;  5E4X A;  1G6Z A;  1NCV A;  1TVX A;  2N55 A;  1B53 A;  1F9Q A;  4U68 A;  2NYZ D;  5EQ0 A;  2KED A;  4X3T A;  2CVR A;  4XT3 B;  1KNE A;  2K04 A;  2N88 A;  3QO2 A;  4HCS A;  1G2T A;  5COY A;  1O80 A;  4MN3 A;  1B2T A;  4IUQ A;  1U4L A;  5T1G A;  1DZ1 A;  4OIJ A;  4RA8 A;  3N52 A;  4R8I A;  5EPL A;  3I3C A;  3I90 A;  1SSO A;  3H91 A;  1WTV A;  1F9S A;  4ZK9 B;  3Q6S A;  2EOT A;  2DY8 A;  1ESR A;  3P7J A;  2J7Z A;  5JJZ A;  1EIG A;  2DY7 A;  1WTR A;  1EIH A;  1QE6 A;  1ML0 D;  1F9P A;  2X69 A;  1HRJ A;  1NR4 A;  2IL8 A;  2HDL A;  1ILQ A;  2MJ8 A;  1WD1 A;  2B2V C;  1JIC A;  4QUC A;  2L11 A;  3DEO A;  2M2L A;  3LWE A;  1PDQ A;  2K03 A;  2B2V A; 
#chains in the Genus database with same CATH topology
 3DM3 A;  5HGT A;  2A6H D;  4BY1 H;  1LTT D;  4J8Q A;  1NUC A;  3DUZ A;  1PFN A;  4A3F G;  1GUS A;  2JA5 G;  4EX5 A;  3NEN A;  3T1Y L;  4KY5 A;  1ICF B;  5EKL A;  1S5D D;  4R1J A;  2F0D A;  4A3J H;  4HMI A;  5C44 H;  3CC7 A;  3TME A;  1SBB B;  1LLR D;  2KCC A;  3S17 B;  3BZK A;  4KN7 C;  5GAD C;  2MP1 A;  5M3F H;  3PO3 B;  1JOK A;  1AN8 A;  4XQJ A;  2R7Z H;  1A0I A;  3NTH A;  3D3R A;  4LF8 L;  4Y52 H;  3IKJ A;  5KEE A;  4BY7 B;  4DV4 Q;  4JI8 L;  4BBS H;  1D5X C;  3K7A H;  4OGQ C;  3IL8 A;  3QWN A;  4LF4 L;  1FR3 A;  1PV4 A;  1J5E L;  2RCN A;  4N9P A;  4MHE A;  2AWN A;  1U5K A;  3FVQ A;  1BF4 A;  4JV5 Q;  4A3B B;  1PFS A;  3A8K E;  3U4Z A;  4DK6 C;  3KLS A;  4X3U A;  2Q2T A;  2ZM6 L;  3OW7 A;  3L0O A;  2VQF L;  3FKI G;  4RWS C;  2WB1 E;  2NZ1 D;  2B29 A;  1K83 H;  1I5F A;  1ZKO A;  3OYY A;  1E2W A;  3WOF A;  1PTO C;  5AJ3 Q;  2C5C A;  4DF7 A;  2I5M X;  4MIU A;  2LXK A;  2I5H A;  1MKH A;  1AE2 A;  2JQO A;  3CPF A;  3CU7 A;  2RSN A;  3NSW A;  2PCF B;  3OWF A;  4P75 A;  4X66 L;  4BBR B;  1B3A A;  1D1I A;  2IHE A;  1IW7 C;  4JI5 L;  1PH7 A;  4EQN A;  3NE5 B;  3DLL A;  2DNC A;  1QVC A;  2DNE A;  2I5L X;  4IQZ A;  5I4D A;  4DAY B;  2WB1 B;  2VB2 X;  4UPA A;  2FXQ A;  4HIO A;  4R4I A;  2A8V A;  3H09 A;  5FKA C;  3S1R H;  2CQA A;  2Q2U A;  1SMY D;  3S2H H;  2PZU A;  1VQD A;  2EOT A;  1KC8 C;  4HJ8 A;  3MC0 B;  4RGO S;  1TS5 A;  4IPC A;  4A3D H;  1HRJ A;  4L5R C;  4YWK A;  1CHP D;  1CQV A;  4DUY Q;  4DAY A;  3RZD H;  4K5W A;  3VYR A;  1ENC A;  3KJP A;  5DM7 3;  4A3C H;  2NVT H;  2EYF A;  3OMC A;  5IY0 A;  2R6G A;  1LTG D;  1YNX A;  5GAE C;  1MBY A;  2BA0 A;  3O13 A;  3I4N B;  1H9S B;  1KDA A;  1WCM H;  1EYA A;  2MPM A;  1Y1W B;  4DXG A;  2NUC A;  3ZYY X;  4PMB A;  4HED A;  2RDG A;  5FLX E;  4BY1 B;  1GVP A;  1H95 A;  2XIW A;  4L6T B;  2A6E D;  1CKN B;  1STA A;  2JN4 A;  1BR9 A;  4P73 A;  3TS0 A;  4DV0 Q;  2V1C C;  1QJO A;  3AQQ A;  2EDG A;  3F2C A;  1DCZ A;  1HPC A;  4K8I A;  4JI0 L;  2HCI A;  4A3J B;  1UE7 A;  3J81 j;  2ICI A;  3JC6 6;  5C44 B;  3DMU A;  4X3S A;  5LMN W;  1H9S A;  5J3B A;  4J6H A;  1FGB D;  3GP7 A;  4OON A;  1EOT A;  1GUN A;  1TKW B;  3CME A;  3BZD B;  4UP9 A;  5M3F B;  4NDX A;  4EGV A;  2R7Z B;  3G6E A;  1CKN A;  3AMU A;  2L4N A;  3K80 C;  1ICW A;  4BBS B;  5GAG C;  1X6O A;  4A3M G;  3K7A B;  1D5M C;  5D3I B;  4AYB E;  4IUN A;  2UXB L;  4RGM A;  4DUZ L;  3D4R A;  1G51 A;  4IN3 A;  3AYH B;  1D1K A;  2PPB C;  1XNQ Q;  3I7F A;  4KJN A;  3QG1 A;  3ERQ A;  2OQ0 A;  1A63 A;  1D7Q A;  4O1N A;  5JOB A;  3SE0 A;  5ISR A;  4LW1 A;  3HOV H;  3S1Q H;  1GUW A;  1M8A A;  3AFQ A;  3B6Y A;  1K83 B;  5FLX c;  1XTC D;  1NTG A;  5IT9 L;  4AYB B;  2NYZ D;  3HG9 A;  1SE4 A;  3S14 H;  1N33 Q;  3K5O A;  3DHQ A;  4HCS A;  5CYU A;  4A3G G;  1LT4 D;  3M3Y H;  4GNX B;  1SSO A;  2VQE Q;  4K14 A;  1A6X A;  1EFW A;  4FNF A;  4ALP A;  2BOS A;  1XPO A;  3NXW A;  1WTR A;  2DY7 A;  1QE6 A;  1ML0 D;  1N32 L;  1EFI D;  1FJG L;  3CKI B;  4DR6 Q;  2CHB D;  5FOB B;  4K2L A;  2R61 A;  4JG2 A;  3S1R B;  4GNX A;  4DV2 Q;  3S2H B;  1IL2 A;  3V05 A;  3HOU H;  4A3D B;  1A3T A;  5A35 A;  1R4Q B;  3HOZ H;  3RZD B;  2B63 G;  4X64 Q;  3SHL A;  3JAM E;  1S5B D;  2F0S A;  4KKU A;  5CMD A;  2Z6B A;  5H1S E;  2NVT B;  3E6Z X;  1TWA H;  4X65 L;  1I94 Q;  3AFP A;  3FP9 A;  1YNJ D;  2E74 C;  2IY5 B;  3TRE A;  5LMN Q;  3ONA B;  3TEH B;  1WCM B;  1B44 D;  2JYO A;  2RCF A;  1XMQ Q;  2DGY A;  2ZT9 C;  5DM6 3;  1IYV A;  1DOM A;  1VQ4 A;  1JR0 D;  2OXP A;  2PQE A;  2I07 B;  5IYD H;  1Q1B A;  5M3M H;  5C3E H;  2HDM A;  3A56 A;  1X65 A;  2KEE A;  3SDZ A;  5I6W A;  2MGS A;  2UUA Q;  4YY3 Q;  1A3V A;  4A93 H;  4KHP L;  5M5Y H;  1KRT A;  1CA5 A;  1A62 A;  3G71 A;  1W6K A;  4A75 A;  1T5E A;  1WOC A;  1NAP A;  2FMM A;  4FDB A;  4WJ4 A;  1O7Y A;  2E76 C;  4OX9 L;  3I91 A;  4JI4 L;  2NVX H;  2YTY A;  4K8J A;  3CCM A;  1ILP A;  4QF4 A;  2Q8T A;  1KL9 A;  4DR5 L;  2JA8 H;  4TQU S;  3TZU A;  1T9H A;  4XYQ A;  3W3A A;  3WDN A;  2OCE A;  1U0L A;  4IO9 A;  1LTB D;  4YWM A;  2L1B A;  2TSS A;  5IIF A;  3KK7 A;  1NCV A;  5JJK A;  4CKE A;  3PUW A;  1A3U A;  1SLJ A;  2QEX A;  1DJR D;  4U68 A;  2OTJ A;  3UE0 A;  4K2K A;  1C0A A;  1TWG H;  3BVG A;  4XT3 B;  1KNE A;  2K04 A;  3PIP 3;  1HZ9 A;  4R4C A;  3HOV B;  4A3F H;  2B3G A;  2JA5 H;  1B2T A;  3CCS A;  3S1Q B;  1H9M A;  4LFB L;  1Q86 C;  1CFM A;  1S3O A;  3CCV A;  4CDD C;  4Z9C B;  3TS2 A;  2EYP A;  1EY6 A;  1I3Q H;  4KJO A;  5C5M A;  3S14 B;  2N8N A;  1SNQ A;  3KF8 B;  4OEM B;  5EBC A;  3E0E A;  3Q0A A;  1E24 A;  3OHX C;  1SNO A;  3H0G G;  2NVQ H;  1GO3 E;  2KA7 A;  1Q90 A;  1QCB D;  3P1H A;  3KJO A;  4QY7 A;  1BXT A;  4HIM A;  2FFK B;  2KHJ A;  2F03 A;  4JYA L;  2FJ2 A;  1CT1 D;  3EJI A;  3KF8 A;  1STY A;  2MO1 A;  3S15 B;  3PGZ A;  5EGT A;  1XPR A;  2F0I A;  1OXX K;  4CDF C;  2PMZ E;  1Y14 B;  1FD7 D;  4BA2 I;  2KVM A;  4LFC L;  1EYG A;  1ASY A;  1S4Z A;  3HOU B;  1Y69 U;  1GHJ A;  1WTW A;  3FKI H;  4X3K A;  3D0F A;  4UAI A;  4Q5V A;  5HGQ A;  2RDF A;  3HOZ B;  2M9V A;  1IBM L;  4CKB A;  1E7Z A;  2NN6 H;  4G4K A;  4DV3 L;  3L3O C;  3NWT A;  2KUM A;  2LY7 A;  4R8N A;  5BN4 A;  1TWA B;  2L12 A;  4IUP A;  2PZT A;  4FF4 A;  1AZP A;  4IFD G;  3A7A B;  1G6P A;  3FHW A;  2PMZ B;  5JEA J;  4ZQ3 A;  4IUV A;  2PI2 E;  1K8M A;  3DWQ A;  5A2Q E;  4R4Q A;  1J8I A;  4G57 A;  3I4M H;  4P74 A;  5K36 G;  4GLA C;  1PFM A;  5M3M B;  5C3E B;  2B2W A;  1LM0 A;  1AP0 A;  1S5F D;  1Q3L A;  3BG3 A;  1VQO A;  1EY4 A;  2RBM A;  3M4O H;  1S5E D;  2Y0S G;  4NXM L;  4A93 B;  5EPJ A;  5M5Y B;  1JOR A;  2A1A A;  3K59 A;  1A2U A;  2SNM A;  1B7Y B;  3MEH A;  4DR3 Q;  3HFZ B;  1JWS D;  3M7G A;  3A54 A;  2NVX B;  2JA8 B;  1WYD A;  1G29 1;  4ZUJ A;  4OWW B;  1U4L A;  1UEB A;  1Q1E A;  4RA8 A;  2EY6 A;  1B3Q A;  4C56 C;  2MQH A;  1BBU A;  4PQX A;  1CI3 M;  4O2D A;  2AMC B;  4ZK9 B;  2N78 A;  2ZJP A;  1TWG B;  1S72 A;  4LF5 L;  1RCV D;  2JEA I;  1IW7 D;  1SXT A;  3PIP A;  3M7N A;  4GS3 A;  4A3F B;  2JA5 B;  4QUC A;  2P5Z X;  1JWU D;  5I9O A;  2K5H A;  2F0H A;  1OO9 B;  3EBE A;  3BDO A;  4IZ8 A;  1I3Q B;  1STG A;  4R4T A;  2IPK D;  5LL6 S;  2A74 C;  4YIJ A;  3VDY A;  1Q82 C;  2K01 A;  3A8I E;  1K8A C;  1K8O A;  3R2I A;  4XIG S;  4ODG A;  3X3M A;  4LF7 Q;  1EUJ A;  2NVQ B;  1BO0 A;  1D5Z C;  2HQE A;  1PVO A;  2HCC A;  4HJ7 A;  1EEF D;  3D4W A;  1XTD A;  4A3M H;  1X55 A;  4K5X A;  2XTI A;  2IJ0 A;  2JA9 A;  3S9W A;  1JOO A;  4DR2 Q;  3K0Y A;  3X3N A;  4DV6 Q;  4DR4 L;  1L0Y B;  3K6O A;  1G91 A;  4L8J A;  4B08 A;  1B4O A;  4RMF A;  4YCU A;  1AW7 A;  4GOP B;  2WKD A;  3FKI B;  3KLS X;  4R4O A;  4WRD A;  1X3G A;  5LHY 1;  3C2P A;  5IGG A;  1MJC A;  1UAP A;  3VR2 A;  4K0K Q;  1U4R A;  4A3E H;  4R9W A;  4CJ0 B;  4JOI A;  3QOJ A;  3GV6 A;  3KYH C;  4B3M L;  4A3G H;  5EKK A;  4C3I G;  2B2W C;  5DEH A;  2F0V A;  2KJX A;  3EA6 A;  3MEF A;  4HJ9 A;  4GOP A;  2QDB A;  1STE A;  2E2H H;  1LT5 D;  5HUR A;  3A74 A;  1XXG A;  2CW0 C;  1WTO A;  4DV7 Q;  1IL8 A;  3F2U A;  3I4M B;  4H13 C;  1HR0 Q;  2KEN A;  2A68 C;  1I4X A;  2K5V A;  1EU3 A;  3TSS A;  1DM0 B;  3M4O B;  1C9O A;  1O80 A;  1Y8N B;  1IBK Q;  4A76 A;  2ZXP A;  4J1M A;  4DV4 L;  4LNQ A;  1TWC H;  1BKB A;  2B63 H;  4ZCK A;  1K3B C;  1LTL A;  1D6E C;  4OO1 G;  1GKH A;  2KBN A;  1BBW A;  5ELF A;  1TY0 A;  4JV5 L;  3NEM A;  5LL6 X;  1LTS D;  1II3 A;  3ULL A;  1WD1 A;  2ZJQ A;  4IFD J;  1AEX A;  3DM1 A;  1PRT F;  2EIF A;  4QJF A;  2ZJR A;  1AH9 A;  5FJ8 G;  3FEW X;  4AH6 A;  4L5T A;  1V8Q A;  5CGK A;  1EZ6 A;  4A3K H;  4LMQ D;  3K57 A;  2CH4 A;  1WTQ A;  1P16 A;  5CV4 A;  5AJ3 L;  1O7Z A;  2IHF A;  4DNT B;  1FNW A;  2O5J C;  1WJJ A;  4KD4 A;  1RL2 A;  4LUV A;  1I4G A;  1VDZ A;  1J9O A;  2WIN B;  1QZH A;  3H6M A;  1BDO A;  2K6A A;  1Z7T A;  1HZA A;  5FO8 B;  1PTO F;  5C4H A;  1CSQ A;  1KAW A;  2I46 A;  2IX1 A;  2MUY A;  1BOS A;  3RR5 A;  2F0L A;  1AE3 A;  4A3M B;  1BBX C;  1MSH A;  4GKJ Q;  4B9W A;  4UY8 C;  5C4Z A;  4X62 Q;  3OIP A;  3SK8 A;  2D2C C;  1K9M C;  1GUO A;  2CQO A;  1A15 A;  3PCO B;  1VQF A;  2JA6 H;  3U9S A;  3KFU A;  3HP3 A;  2E8G A;  4JOI C;  2X6G A;  3A0J A;  4DUY L;  1VQK A;  1EWC A;  2NN6 I;  2JA7 H;  1E2Z A;  4GOP C;  1E2V A;  4A3E B;  3E0J A;  5FLX L;  2ZTE A;  2KQ3 A;  3NQT A;  2B39 A;  1L0X B;  1H9J A;  2NTS A;  3RLO A;  1PZK D;  1N34 Q;  4A3G B;  4OHJ A;  3H0G H;  1DXM A;  2WP8 J;  2ASB A;  3IFT A;  1IYJ B;  1MIU A;  1CK1 A;  4RKB A;  2E2H B;  4DV0 L;  3URY A;  1SYB A;  1YNN C;  1VF7 A;  3I90 A;  2PW5 A;  3GTO H;  4JPB W;  3P20 A;  2RQX A;  3QJY A;  2EQS A;  1ESR A;  3LGJ A;  1VQN A;  3DEO A;  2M2L A;  1TWC B;  2E5L Q;  1ENA A;  2C35 B;  2VL6 A;  4TSS A;  2B63 B;  2ALY B;  3HS0 C;  4DN4 M;  3T56 B;  4RG1 A;  2OF1 A;  4IPG A;  3NBI A;  3HRZ C;  3E9I A;  1GOZ A;  2OTL A;  1XNQ L;  4BA1 I;  1JJG A;  1Q46 A;  4M8A A;  4JI1 Q;  4IFD H;  5LMU Q;  3J81 i;  3I4L A;  1VQC A;  5K5P A;  1BCP F;  2L55 A;  4A3K B;  4PZ8 A;  1K28 A;  1NMF A;  4DK1 A;  3AB9 A;  1I6H H;  1XMO Q;  1KQS A;  1YIT A;  5K36 H;  4ZAI A;  2QIL A;  1N33 L;  4NB3 A;  2SOB A;  2D9U A;  3ER0 A;  3Q23 A;  4F7X A;  3ERS X;  2GA4 B;  2IW3 A;  3EFX D;  4K6D A;  5CBE E;  1JJC B;  1UUP A;  2VQE L;  3HOW G;  1B50 A;  2K33 A;  2ICE C;  2H5X A;  2F0F A;  1VQH A;  2NZH A;  2ZTC A;  1HNZ Q;  4JI3 Q;  3HEJ A;  1NY4 A;  4RCO A;  4POG A;  1VMP A;  5EPK A;  1B1Z A;  4ZKB B;  2IX0 A;  3CPW A;  3VR6 A;  4DR6 L;  3HZX A;  3W1B A;  2E2I H;  3VYT A;  2N49 A;  3OSO A;  3J7Z C;  4DV2 L;  2F0Q A;  2JA6 B;  4DR7 Q;  3SVM A;  3JAM L;  1VQL A;  1DON A;  4GN4 B;  1PYW D;  1P8L A;  3UDI A;  3PUX A;  2HIV A;  1RF2 D;  4JC0 A;  3NP8 A;  2JA7 B;  5C4X H;  4X64 L;  3RUZ A;  1CKO A;  1QNU A;  4X6A H;  1Y1V G;  5EQ0 A;  1SYG A;  4DU9 A;  4LWC A;  1I94 L;  3TP5 A;  5LMN L;  1LTR D;  4C3H G;  1LTI D;  1EY8 A;  2AUJ D;  1XMQ L;  3H0G B;  1ENF A;  1WTV A;  3A55 A;  2CKZ B;  4KN4 C;  4GLV B;  1ET6 A;  5ELB A;  1EZ8 A;  3Q6S A;  1NNX A;  2AHO B;  2QF7 A;  3P7J A;  3SR1 A;  3PO2 H;  5E1F A;  1Q81 C;  1L2F A;  4A3I G;  5JJL A;  5G3L D;  4HAE A;  4HCE A;  3GTO B;  3S1N H;  2FMC A;  2L0C A;  3CCQ A;  2UUA L;  4YY3 L;  3S1M H;  3VYU A;  1R9T H;  2BDO A;  4GN3 B;  4LUZ A;  4APV A;  2EYL A;  4POF A;  1XWE A;  2WV6 D;  3K81 C;  4DGZ A;  4DAP A;  1NSN S;  3J7Y W;  1EOV A;  3TRZ A;  1RTO A;  3STB C;  3CHB D;  3FMC A;  2K32 A;  5BN3 A;  3NK9 A;  4OWX B;  1X9N A;  4IJH A;  5ELD A;  3IRB A;  1PZI D;  5COR A;  2KCN A;  4DR1 Q;  3MWY W;  2F4I A;  3QB3 A;  1W2B A;  1FVI A;  1SR3 A;  4XT1 B;  1PZJ D;  1QIL A;  4P71 A;  5J1Z A;  1UE1 A;  3BYT B;  3CCU A;  1I6H B;  2VZA A;  3TDQ A;  2PQA B;  3GTP H;  2BCO A;  2YYZ A;  1HTP A;  3ERO A;  3J80 i;  3I72 A;  5IYC G;  1VS0 A;  1I6V C;  1YZ6 A;  1PXU A;  4HR7 B;  2LMC B;  5IGB A;  2F0P A;  2UUC Q;  4LF9 Q;  1IHZ A;  5AFW A;  1F2L A;  2MNA A;  2FHT A;  4B3S Q;  2HT1 A;  1F77 A;  2PW7 A;  4L5Q A;  1Q12 A;  4IUU A;  2PQA A;  2WB1 G;  2TMP A;  3I55 A;  3DWP A;  1A8V A;  1IKL A;  4OO1 H;  3IAY A;  4YCV A;  2E2I B;  2G9H D;  2EJG C;  3RN5 A;  4JBW A;  3A8J E;  1B53 A;  1YI2 A;  2JEB I;  5FJ8 H;  2F4V Q;  4EQP A;  3NBH B;  4B3T Q;  3OOC A;  3K7U C;  1DZ1 A;  5C4X B;  3UE1 A;  1TWH H;  3BJU A;  2Z4I A;  4ILW A;  2BA1 A;  1F9S A;  1F2Y A;  4FXK C;  4ULL A;  4UDU C;  1KLU D;  2CW0 D;  1C4Q A;  2VW9 A;  1F9P A;  2X69 A;  5A2Q L;  3I4N G;  1ET9 A;  4PG3 A;  2A68 D;  1I50 H;  4FO2 A;  3OIQ A;  3E5S A;  3BS1 A;  2OWO A;  1NMG A;  3TBI B;  2EXD A;  1WTH A;  1KDC A;  2R7D A;  3PO2 B;  4QGU A;  4B9X A;  2VB3 X;  1TWF H;  4HIK A;  1R4P B;  1RKN A;  2EJM A;  4H02 A;  1YIJ A;  1K73 C;  1KNA A;  1BVS A;  1Z6H A;  3S1N B;  2ATW A;  3S1M B;  2NZO A;  1LAC A;  2SDF A;  3H94 A;  3MFY A;  4WFN 3;  1R9T B;  3M3Y B;  4KI0 A;  3I56 A;  1SAP A;  4DR3 L;  1QOH A;  3PF4 A;  4EQ5 A;  4WJW A;  5CV7 A;  4GNX C;  1HJP A;  5JAV A;  1AFP A;  2K05 A;  4JI2 Q;  5I2Y A;  1DOL A;  2JP1 A;  4A3L G;  2QKI C;  5KRU A;  2F0N A;  2A69 C;  2PNH A;  4H44 C;  4JBK A;  2EYO A;  4F8M A;  1MHW C;  3CP0 A;  1PLF A;  4PV1 C;  3KLW A;  2DN8 A;  2RSO A;  4H7B A;  3HKZ E;  1S5C D;  1DOK A;  2Q2H A;  4DPG A;  2EJF C;  3VR3 A;  4IJL A;  2EVB A;  3GTP B;  1HCZ A;  3C1F A;  5CV6 A;  1CZW A;  1H9R A;  4JBJ A;  1SJE D;  3R2T A;  3S2D H;  4HID A;  4LF7 L;  4P2C B;  1EY5 A;  2F0K A;  3I8Z A;  3GTM H;  2F0G A;  5I9P A;  3HKZ B;  4GN5 A;  5CC4 A;  2BE5 C;  1CTM A;  5M5X H;  1D8L A;  4IUQ A;  4DV6 L;  4DKA C;  4DR2 L;  2CH4 W;  5F2D A;  1SNM A;  4JI7 Q;  4RKL A;  3KOJ A;  4TKO B;  5C0X G;  2N3S A;  5KIX A;  1UWV A;  2J7Z A;  1EIH A;  4QCL A;  3NTK A;  3R8B A;  3P75 A;  3UDG A;  3K0X A;  5M5W H;  4L5S A;  1CZG A;  2HIX A;  3CQZ H;  3CCR A;  2QW7 A;  1PTO H;  1PH1 A;  3ND9 A;  2L11 A;  3LX0 A;  2UXC Q;  1TWH B;  3L9A X;  3LWE A;  4K0K L;  1HQM C;  4NXN Q;  1HR0 W;  4TRD A;  1SN8 A;  4CDC C;  4A3C G;  2CFM A;  4GKK Q;  3GTJ H;  2BH8 A;  2Q8R E;  1YNN D;  2K28 A;  2F0O A;  5EJW A;  1TU2 B;  1V1P B;  1JQY D;  5IOD A;  1F2Z A;  4GZY C;  1VF5 C;  3HOW H;  1I50 B;  2B2Y A;  4ABN A;  5E3F A;  3CCE A;  2JK8 A;  2K7V A;  4DAV A;  1IXR A;  1VQJ A;  1Q8I A;  1RD9 D;  2PI2 A;  1K0S A;  4DV7 L;  4FYD A;  4LF6 Q;  1CHQ D;  4DNI A;  1HR0 L;  2X6L A;  1TWF B;  2K5N A;  1IBL Q;  2EE1 A;  1VQ6 A;  2RF4 A;  3Q22 A;  4NMZ A;  3WOE A;  4MZ9 A;  3MAQ A;  2IT1 A;  3KF6 B;  5CR3 A;  5IP9 G;  2JE6 I;  3EVQ A;  4S3S A;  1IBK L;  3C46 A;  5IE8 A;  3PUY A;  1CKM A;  1LO5 D;  1U4M A;  5E7N A;  2UXD Q;  5CV8 A;  1IKM A;  5KND A;  4AQY Q;  1Y1V H;  5DAU A;  3D6C A;  5GAH C;  4N8X 1;  3KF6 A;  4PZ7 A;  2EYM A;  1GJX A;  1SFO H;  2A73 B;  1QVG A;  2H4O A;  3J7A V;  1I4H A;  5C6A A;  3J81 c;  3HOY G;  1SE8 A;  3S16 H;  4KV6 A;  1CQF A;  1QG7 A;  2XGT A;  2HUG A;  5JVG 3;  4A3I H;  3CF5 A;  2R92 G;  4DV5 Q;  1SMX A;  5IWA Q;  4DXF A;  2CVR A;  1G2T A;  4FVM A;  2K5D A;  3OTO Q;  3S2D B;  2I0Q A;  4JW0 A;  5IP7 G;  3H91 A;  4C3J G;  3GTM B;  5CV9 A;  3W5O A;  1PH2 A;  1PRT B;  3DXJ C;  1CUK A;  3D8G A;  2DY8 A;  4GKJ L;  4TVA B;  1XNR Q;  4B3R Q;  4X62 L;  1LT6 D;  3PUZ A;  1Y8P B;  4LUO A;  1Q8K A;  2IL8 A;  2HDL A;  1Y1W H;  5M5X B;  4PMC A;  1VQP A;  2XRS D;  2QCP X;  4ZUI A;  2B2V A;  3U9O A;  4I7Z C;  3M4P A;  2AWO A;  1UEA B;  4ME3 A;  1RTN A;  1STH A;  2RDH A;  4DV1 Q;  3VA5 A;  3RMH A;  4EVO A;  4O0A A;  1GM5 A;  4J15 A;  3TP7 A;  4MTN A;  5M5W B;  3CQZ B;  1PTO B;  3SEB A;  3RD4 A;  2B2Y C;  4IPH A;  2A19 A;  3T4A C;  4Y7N H;  1B9M A;  4ZLT F;  4XQN A;  3CD6 A;  3GTJ B;  5I2X A;  1LTA D;  5IYC H;  2VUM G;  1VQB A;  2GN5 A;  3U4V A;  4CBV A;  1YJN A;  1YHB A;  1N34 L;  3GTG H;  1EQV A;  1VQI A;  1EY0 A;  5GRO A;  1CA6 A;  2J0T D;  4JI6 Q;  4G7Z C;  2K5Q A;  2AUK A;  5E4W C;  5BR8 Q;  3HOW B;  3RLF A;  1CM9 A;  4LFA Q;  1JB7 A;  1JE4 A;  1EQT A;  1ESF A;  3J80 E;  1I4R A;  4XXE A;  2SEB D;  3BU2 A;  4O42 A;  1FL0 A;  1EIF A;  2L9H A;  1I4P A;  3STB D;  2KCM A;  3MHB A;  3AU7 A;  4UP7 A;  2F0J A;  4UHV A;  5C0X J;  3D4D A;  4A93 G;  2XN9 C;  3S24 A;  1EY7 A;  2E5L L;  4QIW B;  3PSI A;  3TQY A;  1WVL A;  2UU9 Q;  3K8A A;  2UUB Q;  4IAL A;  2Z0S A;  1NE3 A;  1Y1V B;  3BYY B;  2HHH Q;  2XVS A;  2OT2 A;  2KEC A;  1PH8 A;  1BNZ A;  1BUV T;  1HNX Q;  1E1O A;  2CWA A;  3KBG A;  4JI1 L;  1SFO B;  3I4N H;  5JJI A;  1PH4 A;  5LMU L;  2BDN A;  1LUZ A;  4OWT B;  4QL5 A;  4X3T A;  2R93 G;  1SYC A;  3S16 B;  2VY3 A;  2XNA C;  3PUV A;  4YHH Q;  1XMO L;  2YV5 A;  1D2B A;  5M9O A;  3U58 A;  2DUD A;  4R8I A;  4UP8 A;  4A3I B;  4MNO A;  4ID6 A;  2Q8I B;  1V1Q A;  3J80 c;  4ZYS A;  1L1O B;  1HNW Q;  1U9R A;  4BXX G;  1K8G A;  2NVY H;  1TQO A;  1WFQ A;  1ILQ A;  2MJ8 A;  2B2V C;  3F2D A;  4C2M H;  4DNR B;  2E75 C;  1C7Y A;  3G4S A;  2F52 A;  1HNZ L;  4JI3 L;  4RGN A;  3M4Y A;  3H15 A;  1PRT C;  3CC2 A;  1BCP B;  1WTP A;  4A3L H;  3NTI A;  5IGD A;  1EWH A;  1QVF A;  1L1O A;  1E0B A;  3FPU B;  3KDF B;  4XTC S;  4CJ2 C;  4IPD A;  2F0U A;  5BN5 A;  2WII B;  5I6Y A;  3A7L A;  4DR7 L;  3I70 A;  4RH6 A;  4N8F A;  1HXY D;  3T13 A;  3OPO A;  1MI2 A;  1Y8O B;  2WAC A;  4NW2 A;  4KKT A;  1ZYR D;  2RVL A;  3KUP A;  1QB5 D;  1N36 Q;  3HOX G;  1WD0 A;  3T1H Q;  1EIY B;  2NN6 G;  1M1K C;  1Z9F A;  4Y7N B;  1EL0 A;  2ZXO A;  3CW2 C;  2K1B A;  1SNC A;  3KDF A;  4WJ3 M;  3RN2 A;  3GO5 A;  3GTG B;  4CJ1 B;  2XWJ B;  3KLR A;  1SJH D;  1H9K A;  4KMU C;  3VA7 A;  3FRP B;  1B70 B;  1X3P A;  3V96 A;  4AIM A;  1TS3 A;  1YVC A;  1VMC A;  4V19 0;  2IWH A;  3LWU A;  4HJA A;  1MGS A;  3T1Y Q;  3I4M G;  3Q8D A;  1MSG A;  4G7O C;  1O7L A;  5L37 A;  4YCW A;  4H0L C;  3LNN A;  5IYB G;  1AZQ A;  3G7L A;  4HSV A;  3NPP A;  2A69 D;  3FPP A;  1KHI A;  3DWA A;  1YJW A;  1G2S A;  2PO4 A;  5C0X H;  1RJT A;  3PIO 3;  2HD3 A;  5KNC A;  4LF8 Q;  3N6R A;  2WAQ G;  4RHS A;  2K4K A;  1F9Q A;  4JI8 Q;  2KED A;  1VQ9 A;  4M1U B;  2N88 A;  4LF4 Q;  2XRQ D;  5FLM G;  2LSS A;  2Z9H A;  1PHJ A;  1J5E Q;  5T1G A;  4G7H C;  1W3S A;  2F3I A;  4DR1 L;  1JWM D;  3OMG A;  5C4J H;  2ES2 A;  1VQ7 A;  2ZM6 Q;  2VQF Q;  1V1O A;  3Q24 A;  2LKV A;  4IOC A;  4F87 A;  1CSP A;  1NJI C;  2BE5 D;  1HA5 A;  4U67 3;  1TR5 A;  2UUC L;  4LF9 L;  2GVA A;  1NR2 A;  3OWE B;  2PZW A;  2NVY B;  1HFG A;  1L1O C;  5IP9 H;  5C5L A;  2AQ2 B;  2G9D A;  4IUR A;  4B3S L;  4C2M B;  2B2U A;  4X66 Q;  4QB4 A;  2MHV A;  3QIA A;  4JI5 Q;  1PFB A;  3T53 B;  2CWP A;  4KY6 A;  2EXZ A;  4K6L A;  1DYQ A;  1B8A A;  1X56 A;  5FK9 C;  3NHH A;  1W6J A;  3MXU A;  1NBW A;  5J39 A;  1N8R C;  1BCP C;  4KKS A;  5D65 A;  1E1T A;  2DJF C;  1KD1 C;  5D3D A;  3NEL A;  2F0T A;  3EIV A;  1VQM A;  1L0W A;  2K5W A;  1PH9 A;  2F4V L;  3PO3 G;  3I4O A;  1EU4 A;  4B3T L;  3QR8 A;  3TN2 A;  4GLX A;  3HOY H;  1V9P A;  1DD2 A;  2VS1 A;  2PYK A;  4BY7 G;  1QUQ B;  3GDE A;  3MZ5 A;  3W1G A;  1SE3 A;  4PMW A;  1UNS A;  1HH2 P;  1HTL D;  3CXC A;  4A3E G;  5IGC A;  2R92 H;  5J22 A;  4EQO A;  1EQR A;  1KRS A;  3BVZ A;  5EAY A;  3H3V H;  4A3B G;  1JJ2 A;  1O78 A;  1E3P A;  1EYD A;  2Y0S E;  4C3I H;  1XYI A;  2VNU D;  2RKS A;  3MXP A;  1VQG A;  4FXD A;  4FF1 A;  1SRO A;  5JEA G;  5IP7 H;  1QUQ A;  4C3J H;  1E22 A;  3E9H A;  4HSP A;  4FXG C;  4RFB A;  3GTK H;  3K5M A;  1FGU A;  3C1E A;  1TY2 A;  1SDF A;  4MTK A;  3ITP A;  4I65 A;  1RIP A;  3S15 H;  2Z8L A;  4JI0 Q;  2K52 A;  2N55 A;  3BVM A;  4XYO A;  4IOA A;  2DJG C;  1K0R A;  5C3X A;  1QZG A;  3RZO H;  2A6H C;  2YTV A;  5COY A;  4BBR G;  3CCJ A;  1PA6 A;  3K5L A;  2Y0S B;  5ELN A;  3T16 A;  3PQI A;  3PIO A;  4JI2 L;  3K5N A;  3HGB A;  4FP5 D;  3GTQ H;  5KYI A;  1PYB A;  1EIG A;  2CCZ A;  2UXB Q;  2VUM H;  1KLG D;  5ELO A;  4DUZ Q;  1X54 A;  5JPN C;  2Z6K A;  1F2M A;  4DK0 A;  3A5Z B;  3D6W A;  2MFI A;  5JPM C;  3R93 A;  4DAM A;  2B2T A;  3MVV A;  4CGY B;  5EKI A;  1PYS B;  5C4J B;  4ZKC B;  1STN A;  3F2B A;  4A3K G;  3CCL A;  4ZRZ A;  2OQK A;  1VCI A;  4KLK A;  1JE5 A;  2B2U C;  1SYD A;  4HJ5 A;  2YU9 H;  1FNV A;  2IX3 A;  1HZB A;  1RHP A;  3GTL H;  3T51 B;  4E6I A;  1M4V A;  3VR4 A;  3QOL A;  4L63 B;  3HKS A;  1GUT A;  4RCN A;  1VQ8 A;  2ZXR A;  3NBH A;  1JOQ A;  3E3X A;  1Y1W G;  4HTH A;  5NUC A;  5D14 A;  1ZYR C;  5IT9 E;  3SK5 A;  1OXU A;  2M00 A;  4BY1 G;  4QUF A;  3M85 A;  3PF5 A;  1F9R A;  1EEI D;  4QQB X;  1EWI A;  4Q0F A;  1KDB A;  4A3J G;  3KBX A;  1EQQ A;  1FJG Q;  1N32 Q;  5C44 G;  4JI7 L;  3ICE A;  1XX8 A;  3JAM c;  3C3L A;  4PNY A;  2JA6 G;  3SK4 A;  2D0P A;  1ZEQ X;  4RHR A;  5DNF A;  4F88 A;  5M3F G;  4FF3 A;  3CMA A;  2R7Z G;  2R93 H;  4DA2 A;  1DGS A;  4JBM A;  3HOY B;  2AQ3 B;  1ASZ A;  2JA7 G;  2UXC L;  2R3Z A;  3J81 L;  2L15 A;  4NXN L;  4BBS G;  4LAA A;  4A4I A;  2E2J H;  1HUM A;  2JJQ A;  2VXW A;  4LJZ C;  4GKK L;  1HUN A;  1I4Q A;  2R92 B;  1VQA A;  1X3F A;  4BS9 A;  4KK7 A;  1SMY C;  3M9B A;  4BXX H;  3ZJY C;  4IFD I;  3U50 C;  1WTX A;  4HMJ A;  2GVB A;  4X65 Q;  1TT2 A;  4C3I B;  1QWY A;  1VQE A;  5E4X A;  4JK1 C;  2QA4 A;  5G3L F;  3PMF A;  2B8F A;  2Z4H A;  2QEJ C;  2EY5 A;  4C3J B;  5FO9 B;  2E2D C;  2J4X A;  1S40 A;  1JT8 A;  5IT9 c;  1SYF A;  1K3R A;  4LF6 L;  3GTK B;  1VQ5 A;  1JC7 A;  2KHI A;  5ELE A;  1GUG A;  1IBL L;  4AYB G;  5C0X I;  4KY7 A;  1OXS C;  2JXM B;  1GXD C;  3RZO B;  4I7A A;  1MD2 D;  1NR4 A;  4NPS A;  4KHP Q;  2A6E C;  2Z6K C;  4N9T A;  2UXD L;  1LAB A;  1PDQ A;  5HY6 A;  3HOX H;  2F0M A;  4CDE C;  4AQY L;  2B2T C;  4OX9 Q;  4JI4 Q;  3CC4 A;  3GTQ B;  1LT3 D;  3VYS A;  1A2T A;  3GV3 A;  4DR5 Q;  1MJE A;  2D0O A;  3I2Z A;  1WI5 A;  2VUM B;  2KCT A;  1V43 A;  1G8Z D;  3MA2 B;  1EY9 A;  4C1N K;  3ULP A;  2BH2 A;  3UDX A;  1IZ6 A;  1KXL A;  1KTK A;  1T5X D;  1FNU A;  2A5H A;  2V4D A;  4A3D G;  2K75 A;  2H1E A;  3BDL A;  1SND A;  4OXP A;  2JSO A;  1STB A;  1YEZ A;  3F1Z A;  2SNS A;  3MXN B;  1YHQ A;  3EQL C;  4YWL A;  4OIK A;  1PMR A;  2YU9 B;  4LFB Q;  4DV5 L;  1PRT D;  5IWA L;  2AKW B;  3GTL B;  5IYB H;  3K58 A;  2NBF A;  3OTO L;  3NQI A;  3SK6 A;  3J81 E;  4OEL B;  1X3Q A;  2L5T A;  2ZTD A;  1WCM G;  1BQQ T;  3J7A F;  2EPB A;  2EYJ A;  1SRU A;  4NKL A;  2AQ1 B;  3MXN A;  1B9N A;  1XNR L;  4B3R L;  2F0E A;  3BDC A;  5KGU A;  3GD7 A;  1XPU A;  1J6Q A;  4IUT A;  1YBY A;  4JYA Q;  1TII D;  3FDT A;  1PTO D;  5FLM H;  1V1P A;  4KHV A;  4K5V A;  3A5U A;  3G48 A;  5FO7 B;  3TZD A;  1OXV A;  3WWV A;  4DV1 L;  2QDL A;  4DFA A;  1PH5 A;  2R93 B;  4LFC Q;  2WKC A;  3D31 A;  3M4Q A;  4KTA A;  1KIX A;  5C4X G;  4RAU C;  2EZV A;  1KAA A;  4C1N I;  2EY2 A;  2FIN B;  2LFN A;  3NUC A;  2E2J B;  1G6Z A;  1IBM Q;  3H3V I;  5GQO A;  1JB3 A;  2OEO A;  2O2L D;  2MO0 A;  4DV3 Q;  4JVZ A;  3GQB A;  2F1M A;  4JI6 L;  4MN3 A;  4JCV E;  4C3H H;  3J80 L;  5BR8 L;  3H3V C;  3EN2 A;  3N52 A;  3I3C A;  5DLQ E;  4LK1 C;  1N9W A;  4LFA L;  4XQQ A;  1HQR D;  1TS2 A;  3VR5 A;  2F3W A;  3HOV G;  2R7F A;  2B8G A;  5JJZ A;  1XJV A;  1Q7Y C;  3PO2 G;  2XSC A;  1UE5 A;  3RLN A;  2QGQ A;  3R3O A;  3CRL C;  1KAB A;  4OL7 A;  2G5D A;  3MXG A;  2K03 A;  2LXJ A;  5KNB A;  1SYE A;  5CBA E;  1PH3 A;  5C3W A;  1YJ9 A;  1YNJ C;  4BWG B;  2O4X A;  1LV9 A;  1RDP D;  3OW2 A;  3S17 H;  1ROD A;  1U4P A;  3PO3 H;  2RA4 A;  3TP6 A;  2UU9 L;  2F3V A;  4NXM Q;  5CV5 A;  5T1I A;  3MFG A;  4BY7 H;  3TP8 A;  3IFD A;  1HZC A;  2UUB L;  3HOX B;  3G6J B;  4OO1 I;  3BZC A;  3RNU A;  2ENB A;  2EYH A;  4XDX A;  4DK3 C;  3SXH A;  2HHH L;  3F8T A;  1HNX L;  1TXY A;  3W2D A;  1OXT A;  4FF2 A;  3UDF A;  4A3B H;  3DEP A;  3JAM i;  2HQL A;  2K14 A;  1X32 A;  1SEB D;  2F0W A;  3NWS A;  3J7A 5;  3ND8 A;  5JEA H;  3HOU G;  3CAM A;  4YHH L;  1PH6 A;  1EYC A;  2NTT A;  2WAQ E;  4KHZ A;  5TSS A;  2C9O A;  1GD7 A;  3HOZ G;  1LYL A;  4LF5 Q;  3L2P A;  2Z1C A;  3L7Z C;  4HN7 A;  1ONL A;  2KOL A;  5JVH 3;  4PZ6 A;  2O5I C;  1HNW L;  1BCP D;  1HA6 A;  1O7I A;  2KHS A;  2NWG A;  1C8C A;  2ID0 A;  5EBD A;  2K50 A;  2RHS B;  1JMC A;  3PV0 A;  4ME5 A;  4BBR H;  2Q2I A;  4QIW E;  4QMG A;  1QNK A;  3MTS A;  1SNP A;  1JCK B;  3SGI A;  3AEV A;  1ZXT A;  3HKZ G;  5IGF A;  1HHV A;  2WAQ B;  1Z47 A;  3I73 A;  5IYD G;  4CKC A;  1HFN A;  3V2T A;  5M3M G;  5C3E G;  3UI2 A;  2EY1 A;  4NP5 A;  2XWB B;  1OTC A;  4KD3 A;  1TVX A;  1FYC A;  4DR4 Q;  1X3E A;  1YHA A;  2D62 A;  4WOR A;  4V0B A;  3ULJ A;  1UE6 A;  3QO2 A;  4CHT B;  1GHK A;  1N36 L;  3T1H L;  4OIJ A;  5IGE A;  5EPL A;  2LS0 1;  1C48 A;  3CRK C;  5KYL A;  2NB0 A;  2PNR C;  1SE2 A;  4RGT A;  2JA8 G;  2RHQ B;  1IYU A;  2WFW A;  1TS4 A;  5IOC A;  4P72 A;  1M90 C;  2D5D A;  5ELC A;  1JIC A;  4C3H B;  2YTX A;  4B3M Q; 
#chains in the Genus database with same CATH homology
 5HGT A;  2A6H D;  1LTT D;  4J8Q A;  1NUC A;  3DUZ A;  1PFN A;  1GUS A;  4KY5 A;  5EKL A;  1S5D D;  2F0D A;  4HMI A;  3TME A;  1SBB B;  1LLR D;  2KCC A;  3S17 B;  4KN7 C;  3PO3 B;  2MP1 A;  1JOK A;  1AN8 A;  4XQJ A;  3NTH A;  3D3R A;  3IKJ A;  5KEE A;  4BY7 B;  1D5X C;  4OGQ C;  3IL8 A;  3QWN A;  1FR3 A;  4N9P A;  4MHE A;  2AWN A;  3FVQ A;  1BF4 A;  4A3B B;  3A8K E;  3KLS A;  4X3U A;  3OW7 A;  4RWS C;  2NZ1 D;  1ZKO A;  1E2W A;  3WOF A;  1PTO C;  2C5C A;  4DF7 A;  4MIU A;  3CU7 A;  2RSN A;  3NSW A;  2PCF B;  3OWF A;  4BBR B;  1B3A A;  1D1I A;  1IW7 C;  4EQN A;  3NE5 B;  2DNC A;  2DNE A;  4IQZ A;  5I4D A;  2WB1 B;  2VB2 X;  3H09 A;  5FKA C;  2CQA A;  1SMY D;  2PZU A;  2EOT A;  3MC0 B;  4RGO S;  1TS5 A;  1HRJ A;  1CHP D;  1CQV A;  4DAY A;  4K5W A;  3VYR A;  1ENC A;  5DM7 3;  2EYF A;  3OMC A;  2R6G A;  1LTG D;  1MBY A;  2BA0 A;  3O13 A;  3I4N B;  1H9S B;  1KDA A;  2MPM A;  1EYA A;  1Y1W B;  4DXG A;  2NUC A;  3ZYY X;  4PMB A;  4HED A;  2RDG A;  5FLX E;  4BY1 B;  2XIW A;  4L6T B;  2A6E D;  1STA A;  1BR9 A;  1QJO A;  2EDG A;  1DCZ A;  1HPC A;  4K8I A;  2HCI A;  4A3J B;  2ICI A;  5C44 B;  3DMU A;  4X3S A;  1H9S A;  4J6H A;  1FGB D;  3GP7 A;  1EOT A;  1GUN A;  1TKW B;  3BZD B;  5M3F B;  4NDX A;  4EGV A;  2R7Z B;  3AMU A;  2L4N A;  1ICW A;  4BBS B;  3K7A B;  1D5M C;  5D3I B;  4IUN A;  4RGM A;  3D4R A;  4IN3 A;  1D1K A;  2PPB C;  4KJN A;  3QG1 A;  3ERQ A;  4O1N A;  5JOB A;  3SE0 A;  5ISR A;  1GUW A;  1M8A A;  1K83 B;  1XTC D;  5IT9 L;  4AYB B;  2NYZ D;  3HG9 A;  1SE4 A;  3K5O A;  3DHQ A;  4HCS A;  5CYU A;  1LT4 D;  1SSO A;  4K14 A;  1A6X A;  4FNF A;  2BOS A;  3NXW A;  1WTR A;  2DY7 A;  1QE6 A;  1ML0 D;  1EFI D;  3CKI B;  2CHB D;  5FOB B;  4K2L A;  2R61 A;  3S1R B;  3S2H B;  3V05 A;  4A3D B;  1A3T A;  5A35 A;  1R4Q B;  3RZD B;  3SHL A;  3JAM E;  1S5B D;  2F0S A;  4KKU A;  5CMD A;  2NVT B;  3E6Z X;  1YNJ D;  2E74 C;  3ONA B;  1WCM B;  1B44 D;  2JYO A;  2ZT9 C;  5DM6 3;  1IYV A;  1DOM A;  1JR0 D;  2OXP A;  2PQE A;  2I07 B;  1Q1B A;  2HDM A;  3A56 A;  2KEE A;  3SDZ A;  5I6W A;  2MGS A;  1A3V A;  1CA5 A;  1W6K A;  1T5E A;  2FMM A;  1NAP A;  1O7Y A;  2E76 C;  3I91 A;  4K8J A;  1ILP A;  4QF4 A;  2Q8T A;  4TQU S;  3TZU A;  4XYQ A;  3W3A A;  3WDN A;  1LTB D;  2L1B A;  2TSS A;  5IIF A;  3KK7 A;  1NCV A;  4CKE A;  3PUW A;  1A3U A;  1DJR D;  4U68 A;  4K2K A;  4XT3 B;  3BVG A;  1KNE A;  2K04 A;  3PIP 3;  3HOV B;  1B2T A;  3S1Q B;  1H9M A;  1CFM A;  4Z9C B;  2EYP A;  1EY6 A;  4KJO A;  5C5M A;  3S14 B;  1SNQ A;  5EBC A;  3Q0A A;  3OHX C;  1SNO A;  2KA7 A;  1Q90 A;  1QCB D;  3P1H A;  1BXT A;  2FFK B;  2F03 A;  2FJ2 A;  1CT1 D;  3EJI A;  3KF8 A;  1STY A;  3S15 B;  5EGT A;  2F0I A;  1OXX K;  1FD7 D;  4BA2 I;  2KVM A;  1S4Z A;  3HOU B;  1Y69 U;  1GHJ A;  1WTW A;  4X3K A;  4UAI A;  4Q5V A;  2RDF A;  3HOZ B;  2M9V A;  4CKB A;  2NN6 H;  4G4K A;  3L3O C;  3NWT A;  2KUM A;  2LY7 A;  4R8N A;  5BN4 A;  1TWA B;  2L12 A;  4IUP A;  2PZT A;  4FF4 A;  1AZP A;  4IFD G;  3A7A B;  2PMZ B;  5JEA J;  4ZQ3 A;  4IUV A;  5A2Q E;  1K8M A;  3DWQ A;  1J8I A;  4G57 A;  5K36 G;  1PFM A;  5M3M B;  5C3E B;  2B2W A;  1AP0 A;  1S5F D;  1Q3L A;  3BG3 A;  1EY4 A;  2RBM A;  1S5E D;  4A93 B;  1JOR A;  5EPJ A;  5M5Y B;  3K59 A;  1A2U A;  2SNM A;  3MEH A;  1JWS D;  3M7G A;  3A54 A;  2NVX B;  2JA8 B;  1G29 1;  4ZUJ A;  1U4L A;  1Q1E A;  4RA8 A;  2EY6 A;  4C56 C;  4PQX A;  1CI3 M;  4ZK9 B;  1TWG B;  2JEA I;  1RCV D;  1SXT A;  1IW7 D;  3M7N A;  4A3F B;  2JA5 B;  4QUC A;  5I9O A;  1JWU D;  2F0H A;  1OO9 B;  3BDO A;  4IZ8 A;  1I3Q B;  1STG A;  2IPK D;  5LL6 S;  2A74 C;  4YIJ A;  2K01 A;  3A8I E;  1K8O A;  3R2I A;  4XIG S;  4ODG A;  3X3M A;  2NVQ B;  1BO0 A;  1D5Z C;  2HQE A;  2HCC A;  1EEF D;  3D4W A;  4K5X A;  2IJ0 A;  3S9W A;  1JOO A;  3K0Y A;  3X3N A;  1L0Y B;  3K6O A;  1G91 A;  4L8J A;  4B08 A;  1B4O A;  1AW7 A;  2WKD A;  3FKI B;  3KLS X;  4WRD A;  5LHY 1;  3C2P A;  5IGG A;  1UAP A;  3VR2 A;  1U4R A;  4R9W A;  4CJ0 B;  3QOJ A;  3GV6 A;  5EKK A;  4C3I G;  2B2W C;  5DEH A;  2F0V A;  2KJX A;  3EA6 A;  2QDB A;  1STE A;  1LT5 D;  5HUR A;  1XXG A;  2CW0 C;  1WTO A;  1IL8 A;  3F2U A;  3I4M B;  4H13 C;  2A68 C;  1I4X A;  1EU3 A;  3TSS A;  1DM0 B;  3M4O B;  1O80 A;  1Y8N B;  2ZXP A;  4J1M A;  1D6E C;  4OO1 G;  5ELF A;  1TY0 A;  5LL6 X;  1LTS D;  1II3 A;  1WD1 A;  4IFD J;  1AEX A;  3DM1 A;  1PRT F;  3FEW X;  1V8Q A;  5CGK A;  1EZ6 A;  4LMQ D;  3K57 A;  1WTQ A;  5CV4 A;  1O7Z A;  4DNT B;  1FNW A;  2O5J C;  4KD4 A;  1I4G A;  1VDZ A;  1J9O A;  2WIN B;  3H6M A;  1BDO A;  2K6A A;  1Z7T A;  5FO8 B;  1PTO F;  5C4H A;  2I46 A;  2IX1 A;  2MUY A;  1BOS A;  2F0L A;  4A3M B;  1BBX C;  1MSH A;  4B9W A;  5C4Z A;  3OIP A;  3SK8 A;  2D2C C;  1GUO A;  1A15 A;  3U9S A;  3HP3 A;  2X6G A;  1EWC A;  2NN6 I;  1E2Z A;  1E2V A;  4A3E B;  3E0J A;  5FLX L;  2KQ3 A;  3NQT A;  2B39 A;  1L0X B;  1H9J A;  2NTS A;  1PZK D;  4A3G B;  4OHJ A;  1DXM A;  2WP8 J;  3IFT A;  1CK1 A;  4RKB A;  2E2H B;  3URY A;  1SYB A;  1YNN C;  1VF7 A;  3I90 A;  2PW5 A;  3P20 A;  2RQX A;  3QJY A;  1ESR A;  3DEO A;  2M2L A;  1TWC B;  1ENA A;  4TSS A;  2B63 B;  3HS0 C;  4DN4 M;  3T56 B;  2OF1 A;  3NBI A;  3HRZ C;  1GOZ A;  4BA1 I;  4M8A A;  4IFD H;  3I4L A;  5K5P A;  1BCP F;  2L55 A;  4A3K B;  4DK1 A;  3AB9 A;  5K36 H;  4ZAI A;  2QIL A;  2SOB A;  2D9U A;  3Q23 A;  4F7X A;  2GA4 B;  2IW3 A;  3EFX D;  4K6D A;  5CBE E;  1UUP A;  1B50 A;  2K33 A;  2ICE C;  2F0F A;  4RCO A;  3HEJ A;  1VMP A;  5EPK A;  1B1Z A;  4ZKB B;  2IX0 A;  3VR6 A;  3HZX A;  3VYT A;  3OSO A;  2F0Q A;  2JA6 B;  3SVM A;  3JAM L;  1DON A;  1PYW D;  3PUX A;  1RF2 D;  3NP8 A;  2JA7 B;  3RUZ A;  1QNU A;  5EQ0 A;  1SYG A;  4DU9 A;  3TP5 A;  1LTR D;  4C3H G;  1LTI D;  1EY8 A;  2AUJ D;  3H0G B;  1ENF A;  1WTV A;  3A55 A;  4KN4 C;  1ET6 A;  5ELB A;  1EZ8 A;  3Q6S A;  2QF7 A;  3P7J A;  3SR1 A;  5E1F A;  5G3L D;  4HAE A;  4HCE A;  3GTO B;  2FMC A;  2L0C A;  3VYU A;  2BDO A;  2EYL A;  1XWE A;  2WV6 D;  4DGZ A;  4DAP A;  1NSN S;  3J7Y W;  1RTO A;  3CHB D;  3FMC A;  2K32 A;  5BN3 A;  3NK9 A;  5ELD A;  1PZI D;  5COR A;  2KCN A;  3MWY W;  2F4I A;  3QB3 A;  4XT1 B;  1PZJ D;  1QIL A;  5J1Z A;  3BYT B;  1I6H B;  3TDQ A;  2BCO A;  2YYZ A;  1HTP A;  3ERO A;  3I72 A;  1I6V C;  1PXU A;  4HR7 B;  2LMC B;  5IGB A;  2F0P A;  1IHZ A;  5AFW A;  1F2L A;  2FHT A;  1F77 A;  2PW7 A;  1Q12 A;  4IUU A;  2TMP A;  3DWP A;  1IKL A;  4OO1 H;  3IAY A;  2E2I B;  2G9H D;  2EJG C;  4JBW A;  3A8J E;  1B53 A;  2JEB I;  4EQP A;  3OOC A;  1DZ1 A;  5C4X B;  2Z4I A;  4ILW A;  2BA1 A;  1F9S A;  1F2Y A;  4FXK C;  4ULL A;  4UDU C;  1KLU D;  2CW0 D;  1C4Q A;  1F9P A;  2X69 A;  5A2Q L;  1ET9 A;  2A68 D;  4FO2 A;  3OIQ A;  3E5S A;  3BS1 A;  3TBI B;  1KDC A;  3PO2 B;  4B9X A;  2VB3 X;  1R4P B;  1RKN A;  2EJM A;  1KNA A;  1Z6H A;  3S1N B;  3S1M B;  2SDF A;  1LAC A;  3H94 A;  3MFY A;  4WFN 3;  1R9T B;  3M3Y B;  4KI0 A;  1SAP A;  1QOH A;  4WJW A;  5CV7 A;  5JAV A;  1AFP A;  2K05 A;  5I2Y A;  1DOL A;  2JP1 A;  2QKI C;  5KRU A;  2F0N A;  2A69 C;  4H44 C;  2EYO A;  4F8M A;  1PLF A;  4PV1 C;  2DN8 A;  2RSO A;  4H7B A;  1S5C D;  1DOK A;  2EJF C;  3VR3 A;  2EVB A;  3GTP B;  1HCZ A;  3C1F A;  5CV6 A;  1CZW A;  1H9R A;  1SJE D;  3R2T A;  4P2C B;  1EY5 A;  2F0K A;  3I8Z A;  2F0G A;  5I9P A;  3HKZ B;  5CC4 A;  2BE5 C;  1CTM A;  4IUQ A;  5F2D A;  1SNM A;  4RKL A;  4TKO B;  5C0X G;  5KIX A;  2J7Z A;  1EIH A;  4QCL A;  3NTK A;  3R8B A;  3P75 A;  1CZG A;  1PTO H;  3ND9 A;  2L11 A;  3LX0 A;  1TWH B;  3L9A X;  3LWE A;  1HQM C;  4TRD A;  2Q8R E;  1YNN D;  2K28 A;  2F0O A;  5EJW A;  1TU2 B;  1V1P B;  1JQY D;  5IOD A;  1F2Z A;  4GZY C;  1VF5 C;  1I50 B;  2B2Y A;  4ABN A;  5E3F A;  2K7V A;  4DAV A;  1Q8I A;  1RD9 D;  4FYD A;  1CHQ D;  2X6L A;  1TWF B;  2EE1 A;  3Q22 A;  4NMZ A;  3WOE A;  3MAQ A;  2IT1 A;  5CR3 A;  3C46 A;  2JE6 I;  3EVQ A;  4S3S A;  3PUY A;  1LO5 D;  1U4M A;  1IKM A;  5CV8 A;  5KND A;  5DAU A;  3D6C A;  1GJX A;  2EYM A;  2A73 B;  2H4O A;  3J7A V;  1I4H A;  5C6A A;  4KV6 A;  1CQF A;  1QG7 A;  2HUG A;  5JVG 3;  4DXF A;  2CVR A;  1G2T A;  4FVM A;  2K5D A;  3S2D B;  3H91 A;  4C3J G;  3GTM B;  5CV9 A;  1PRT B;  3DXJ C;  3D8G A;  2DY8 A;  1LT6 D;  3PUZ A;  1Y8P B;  2IL8 A;  2HDL A;  5M5X B;  4PMC A;  2XRS D;  2QCP X;  4ZUI A;  2B2V A;  3U9O A;  4I7Z C;  2AWO A;  1UEA B;  1RTN A;  1STH A;  2RDH A;  3VA5 A;  3RMH A;  4EVO A;  3TP7 A;  5M5W B;  3CQZ B;  1PTO B;  3SEB A;  3RD4 A;  2B2Y C;  3T4A C;  1B9M A;  4ZLT F;  4XQN A;  3GTJ B;  5I2X A;  1LTA D;  4CBV A;  1EQV A;  1EY0 A;  1CA6 A;  2J0T D;  4G7Z C;  2K5Q A;  2AUK A;  5E4W C;  3HOW B;  3RLF A;  1CM9 A;  1JE4 A;  1EQT A;  1ESF A;  3J80 E;  1I4R A;  4XXE A;  2SEB D;  4O42 A;  2L9H A;  1I4P A;  3MHB A;  3AU7 A;  2F0J A;  5C0X J;  3D4D A;  2XN9 C;  1EY7 A;  4QIW B;  1WVL A;  4IAL A;  1Y1V B;  3BYY B;  2XVS A;  2OT2 A;  2KEC A;  1BNZ A;  1BUV T;  3KBG A;  1SFO B;  2BDN A;  4X3T A;  1SYC A;  3S16 B;  2XNA C;  3PUV A;  1D2B A;  5M9O A;  4R8I A;  4A3I B;  4ID6 A;  2Q8I B;  4ZYS A;  1U9R A;  1TQO A;  1ILQ A;  2MJ8 A;  2B2V C;  4DNR B;  2E75 C;  4RGN A;  3M4Y A;  1PRT C;  1BCP B;  1WTP A;  3NTI A;  5IGD A;  1EWH A;  5BN5 A;  1E0B A;  5I6Y A;  3FPU B;  4XTC S;  4CJ2 C;  2F0U A;  2WII B;  3A7L A;  3I70 A;  4RH6 A;  1HXY D;  3T13 A;  3OPO A;  1MI2 A;  1Y8O B;  2WAC A;  4NW2 A;  4KKT A;  1ZYR D;  2RVL A;  3KUP A;  1QB5 D;  1WD0 A;  2NN6 G;  4Y7N B;  1EL0 A;  2ZXO A;  2K1B A;  1SNC A;  3GO5 A;  3GTG B;  4CJ1 B;  2XWJ B;  3KLR A;  1SJH D;  1H9K A;  4KMU C;  3VA7 A;  3FRP B;  1X3P A;  3V96 A;  1TS3 A;  1VMC A;  4V19 0;  2IWH A;  3LWU A;  1MGS A;  1MSG A;  4G7O C;  1O7L A;  4H0L C;  3LNN A;  1AZQ A;  3G7L A;  4HSV A;  3NPP A;  2A69 D;  3FPP A;  3DWA A;  1G2S A;  2PO4 A;  5C0X H;  1RJT A;  3PIO 3;  5KNC A;  3N6R A;  4RHS A;  1F9Q A;  2KED A;  4M1U B;  2N88 A;  2XRQ D;  5T1G A;  4G7H C;  1JWM D;  3OMG A;  1V1O A;  3Q24 A;  2LKV A;  4F87 A;  2BE5 D;  1HA5 A;  4U67 3;  1TR5 A;  1NR2 A;  3OWE B;  2PZW A;  2NVY B;  1HFG A;  5C5L A;  2AQ2 B;  2G9D A;  4IUR A;  4C2M B;  2B2U A;  4QB4 A;  2MHV A;  3QIA A;  1PFB A;  3T53 B;  4KY6 A;  2EXZ A;  4K6L A;  1DYQ A;  5FK9 C;  3NHH A;  1W6J A;  3MXU A;  5J39 A;  1BCP C;  4KKS A;  5D65 A;  5D3D A;  2F0T A;  2K5W A;  1EU4 A;  3TN2 A;  1DD2 A;  2PYK A;  3MZ5 A;  1SE3 A;  4PMW A;  1UNS A;  1HTL D;  5IGC A;  5J22 A;  4EQO A;  3BVZ A;  1O78 A;  1EYD A;  1XYI A;  2VNU D;  2RKS A;  3MXP A;  4FXD A;  4FF1 A;  5JEA G;  4HSP A;  4FXG C;  4RFB A;  3K5M A;  3C1E A;  1TY2 A;  1SDF A;  3ITP A;  4I65 A;  2Z8L A;  3BVM A;  2N55 A;  4XYO A;  5C3X A;  2A6H C;  5COY A;  3K5L A;  2Y0S B;  3T16 A;  3K5N A;  3HGB A;  4FP5 D;  5KYI A;  1EIG A;  1KLG D;  5JPN C;  1F2M A;  4DK0 A;  3D6W A;  5JPM C;  3R93 A;  2B2T A;  3MVV A;  4CGY B;  5EKI A;  5C4J B;  4ZKC B;  1STN A;  4ZRZ A;  1VCI A;  2B2U C;  1SYD A;  1FNV A;  2IX3 A;  1RHP A;  3T51 B;  4E6I A;  1M4V A;  3VR4 A;  3QOL A;  4L63 B;  1GUT A;  4RCN A;  2ZXR A;  3NBH A;  1JOQ A;  4HTH A;  5NUC A;  5D14 A;  1ZYR C;  5IT9 E;  3SK5 A;  1OXU A;  2M00 A;  4QUF A;  3M85 A;  1F9R A;  1EEI D;  4Q0F A;  1KDB A;  3KBX A;  1XX8 A;  3C3L A;  4PNY A;  3SK4 A;  1ZEQ X;  4RHR A;  5DNF A;  4F88 A;  4FF3 A;  4DA2 A;  3HOY B;  2AQ3 B;  2R3Z A;  3J81 L;  4LAA A;  1HUM A;  2VXW A;  4LJZ C;  1HUN A;  1I4Q A;  2R92 B;  4BS9 A;  4KK7 A;  1SMY C;  4IFD I;  1WTX A;  4HMJ A;  1TT2 A;  4C3I B;  1QWY A;  5E4X A;  4JK1 C;  5G3L F;  3PMF A;  2B8F A;  2Z4H A;  2QEJ C;  2EY5 A;  4C3J B;  5FO9 B;  2E2D C;  2J4X A;  1SYF A;  3GTK B;  1JC7 A;  5ELE A;  1GUG A;  5C0X I;  4KY7 A;  1OXS C;  2JXM B;  1GXD C;  3RZO B;  1MD2 D;  1NR4 A;  2A6E C;  4N9T A;  1PDQ A;  1LAB A;  2F0M A;  2B2T C;  3GTQ B;  1LT3 D;  3VYS A;  1A2T A;  3GV3 A;  2VUM B;  1V43 A;  1G8Z D;  3MA2 B;  1EY9 A;  4C1N K;  1KTK A;  1T5X D;  1FNU A;  2A5H A;  2V4D A;  2H1E A;  3BDL A;  1SND A;  2JSO A;  1STB A;  2SNS A;  3EQL C;  4OIK A;  1PMR A;  2YU9 B;  1PRT D;  3GTL B;  3K58 A;  2NBF A;  3NQI A;  3SK6 A;  3J81 E;  1X3Q A;  2L5T A;  1BQQ T;  3J7A F;  2EPB A;  2EYJ A;  4NKL A;  2AQ1 B;  3MXN A;  1B9N A;  2F0E A;  5KGU A;  3BDC A;  3GD7 A;  4IUT A;  1TII D;  3FDT A;  1PTO D;  1V1P A;  4KHV A;  4K5V A;  5FO7 B;  3TZD A;  1OXV A;  4DFA A;  2R93 B;  2WKC A;  3D31 A;  4KTA A;  4RAU C;  2EZV A;  1KAA A;  4C1N I;  2EY2 A;  2FIN B;  2LFN A;  3NUC A;  2E2J B;  1G6Z A;  1JB3 A;  2OEO A;  2O2L D;  3GQB A;  2F1M A;  4MN3 A;  3J80 L;  3H3V C;  3N52 A;  3I3C A;  4LK1 C;  4XQQ A;  1HQR D;  1TS2 A;  3VR5 A;  2F3W A;  2B8G A;  5JJZ A;  2XSC A;  3CRL C;  3R3O A;  1KAB A;  4OL7 A;  3MXG A;  2K03 A;  5KNB A;  1SYE A;  5CBA E;  5C3W A;  1YNJ C;  4BWG B;  2O4X A;  1LV9 A;  1RDP D;  1ROD A;  1U4P A;  2RA4 A;  3TP6 A;  2F3V A;  5CV5 A;  5T1I A;  3MFG A;  3TP8 A;  3IFD A;  3HOX B;  3G6J B;  4OO1 I;  2ENB A;  2EYH A;  4XDX A;  3SXH A;  3W2D A;  1OXT A;  4FF2 A;  3DEP A;  1X32 A;  1SEB D;  2F0W A;  3NWS A;  3ND8 A;  5JEA H;  1EYC A;  2NTT A;  4KHZ A;  5TSS A;  2C9O A;  2Z1C A;  3L7Z C;  4HN7 A;  1ONL A;  2KOL A;  5JVH 3;  2O5I C;  1BCP D;  1HA6 A;  2NWG A;  2KHS A;  1C8C A;  2ID0 A;  5EBD A;  3PV0 A;  4ME5 A;  4QMG A;  1QNK A;  3MTS A;  1SNP A;  1JCK B;  1ZXT A;  5IGF A;  1HHV A;  2WAQ B;  1Z47 A;  3I73 A;  4CKC A;  1HFN A;  3V2T A;  3UI2 A;  2EY1 A;  4NP5 A;  2XWB B;  4KD3 A;  1TVX A;  1FYC A;  2D62 A;  4WOR A;  4V0B A;  3QO2 A;  4CHT B;  1GHK A;  4OIJ A;  5IGE A;  5EPL A;  2LS0 1;  1C48 A;  3CRK C;  5KYL A;  2NB0 A;  2PNR C;  1SE2 A;  4RGT A;  1IYU A;  1TS4 A;  5IOC A;  2D5D A;  5ELC A;  1JIC A;  4C3H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...