1NR4A

High resolution crystal structures of thymus and activation-regulated chemokine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
RGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of thymus and activation-regulated chemokine (TARC).
pubmed doi rcsb
molecule keywords Thymus and activation-regulated chemokine
molecule tags Cytokine
total genus 13
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1nr4A00
2K04A 3DEPA 1WD1A 2HDMA 2Q8TA 5CBEE 2K03A 3UI2A 1BF4A 2FFKB 1RTOA 2B2WC 2FINB 3FDTA 1TVXA 1CM9A 2N88A 1GUWA 5EJWA 1U4RA 2Q8RE 1S4ZA 1XYIA 1PFMA 1DZ1A 4XDXA 2D9UA 2K28A 3I3CA 1RODA 1U4MA 2B2TC 3Q6SA 1HFNA 1DOKA 5COYA 1LV9A 2SDFA 3I8ZA 2L9HA 1WVLA 1DONA 1G2SA 1U4LA 4CJ0B 4XT1B 1SSOA 2CVRA 3IL8A 2B2UC 4HSVA 4IUPA 2RSOA 3DEOA 1WTOA 2K1BA 3F2UA 5E4WC 3TN2A 1PFNA 2DY8A 1WD0A 1E0BA 4X3TA 2J7ZA 5EPKA 2KOLA 2FMMA 1B3AA 2KECA 5JJZA 1KNAA 4R8IA 1G6ZA 2M2LA 3IFDA 1MSHA 5T1IA 1VMPA 4HEDA 2B2YA 1NR2A 2L12A 1HUMA 1KNEA 1F9PA 2HUGA 2RSNA 2X6LA 3P7JA 3R93A 1AP0A 1WTQA 1EQTA 2NZ1D 3QO2A 1PFBA 1EOTA 4RAUC 2L11A 3D6WA 2EPBA 1ICWA 2L4NA 4RA8A 1MSGA 1A15A 3LWEA 4X3UA 1SDFA 5D65A 4X3KA 1WTVA 1QG7A 1U4PA 2EE1A 1ESRA 2B2YC 1O80A 2N55A 3I90A 4IUVA 1ML0D 4QUCA 1EIGA 2L1BA 1B50A 1RJTA 2MPMA 2HDLA 1CA6A 5DNFA 4DN4M 1VMCA 4HCSA 2K05A 4XT3B 5CBAE 1HHVA 1BO0A 4IUUA 1G91A 3KBXA 4ZK9B 3I91A 1ZXTA 3GV6A 5CMDA 3GV3A 4X3SA 1O7ZA 3FPUB 1BNZA 1NR4A 1XX8A 2MGSA 1QNKA 2EOTA 1B53A 2DY7A 4IURA 5AFWA 3G7LA 4ZKCB 1NCVA 3H91A 1C8CA 4R9WA 1MGSA 2RVLA 2B2VA 5D14A 1AZPA 1G2TA 1F9QA 1SAPA 3MTSA 2KEDA 1WTXA 1F2LA 1PLFA 2X6GA 1MI2A 1WTPA 2JP1A 5EPJA 4HAEA 3DM1A 2X69A 5EPLA 1DOMA 5EKIA 1X3QA 1X3PA 2FJ2A 1B4OA 3HP3A 4U68A 1NAPA 2B2TA 2B2VC 4QUFA 2KEEA 3KUPA 1AZQA 1IKMA 1EIHA 1JE4A 1J9OA 2VXWA 1WTRA 1HRJA 2MP1A 5CORA 1QE6A 2NYZD 4CJ2C 4ZKBB 1WTWA 4O42A 4OIKA 5E4XA 1DOLA 1HFGA 4ZLTF 1ILPA 1B2TA 4UAIA 2B2UA 3SVMA 4OIJA 1X32A 1RHPA 4LMQD 1CA5A 1F9SA 2R3ZA 4ZAIA 1IL8A 2H1EA 2KUMA 4CJ1B 2IL8A 1HA6A 2HCIA 1PDQA 4NW2A 1RTNA 2XIWA 4MN3A 4RWSC 1EL0A 1Q3LA 4IUQA 2FHTA 5T1GA 1IKLA 1J8IA 2B2WA 1O7YA 5EQ0A 2K01A 4IUTA 1HUNA 2MJ8A 4MHEA 2HCCA 3N52A 2NWGA 2BDNA 2RA4A 2JYOA 3ONAB 1BBXC 1ILQA 3TZDA 1M8AA 3MWYW 1F9RA 2KVMA 1JICA
chains in the Genus database with same CATH superfamily
1HZBA 4A3KB 1BF4A 3OIQA 1YJ9A 1GUWA 2VW9A 1NUCA 1X9NA 1PH6A 4L5SA 3KLWA 4QJFA 4B9WA 1YHQA 3S15H 2B39A 1GVPA 4HMJA 3NPPA 3I73A 1T5EA 2CH4A 1G2SA 2F0NA 4QMGA 3L0OA 3K0YA 2CH4W 1XWEA 3C3LA 1Y1WG 3L2PA 3F2BA 5C3WA 3OTOQ 2LKVA 2RKSA 3KLSX 4GS3A 5HGTA 3KK7A 3RZDH 3HEJA 4GZYC 3K7AH 3NWTA 3HOXB 1T5XD 3S14B 2JA8B 5G3LD 3QO2A 4BS9A 2NTTA 3CQZB 2EPBA 5EBCA 5KNCA 3I4NB 1YZ6A 2NTSA 3E0EA 5FJ8G 1TIID 2BOSA 3I2ZA 2LS01 4QCLA 3GTPB 3H09A 1B50A 2KJXA 1OXTA 3HOWB 2NVQB 4CDFC 4U673 1HHVA 3VYUA 4JI7L 3BVZA 3NSWA 4DUYQ 4JC0A 2Z4IA 3GV3A 2A6HC 3SEBA 3TP7A 1QNKA 5KIXA 1PTOH 2CFMA 3G7LA 4AQYL 2H5XA 3S1MH 2F1MA 4R9WA 2LY7A 2RVLA 3HOVB 2AWNA 1SYFA 2F0DA 1F9QA 1SAPA 4IJLA 2E76C 1MI2A 2PW5A 4IFDG 1SYDA 2XWBB 2JJQA 2G9HD 1TS3A 3VYTA 4PNYA 3W5OA 5ISRA 4C2MB 4KKSA 5GAEC 3HOYH 2E2HB 4X62Q 3LNNA 4A3DB 2XRSD 3M4OB 3S1RH 3CCMA 2YU9B 2A6HD 2L0CA 1NBWA 1ASZA 3J7AV 1NTGA 2K52A 3PO2B 1K8MA 1Q12A 2SNSA 2NWGA 1AE2A 1EWCA 1STHA 3T1YL 2F3VA 2HT1A 2UXDL 1DD2A 5C5MA 4EQ5A 3DEPA 1VQMA 2N78A 3STBD 1LTSD 1TVXA 4QGUA 4IFDJ 1U4RA 1S4ZA 1K28A 2ZXRA 1WYDA 2B2TC 3Q24A 4J15A 1NNXA 3ND8A 5I4DA 1R9TB 1EY6A 4C3JG 1KRSA 1HZAA 4YHHL 1HCZA 2RHQB 4CDCC 1SSOA 3ERSX 1LTRD 3V96A 3K7AB 1N34Q 4DR4L 1EWIA 1SXTA 4C3IH 4QY7A 1SYGA 1MJCA 1X6OA 2N3SA 3J80i 1PH2A 1B3AA 2IJ0A 3HKZG 4FVMA 4K5VA 5CV8A 5KGUA 1CI3M 3NBIA 3L9AX 2X6LA 5JVG3 3JC66 3K59A 2R7ZH 2VQEL 4NP5A 4JI2Q 3ULPA 3NXWA 3A8KE 1FR3A 3NTHA 4RAUC 3SK4A 5IIFA 4IPGA 2F3WA 4WFN3 1CTMA 3D4WA 2O2LD 1FJGQ 1H9KA 2C35B 2DUDA 4OX9L 2I5LX 1FVIA 1LTAD 1NR4A 1XX8A 4H0LC 2DY7A 3R2IA 4DV4Q 1Q86C 1Y1WH 1TWAH 2LMCB 2VB3X 3PMFA 4IOCA 1KHIA 5ELFA 2JK8A 1ZEQX 2A1AA 2HIXA 2Q2UA 2K50A 1ICFB 4YWMA 5LMNW 1LTTD 3HOYB 2F0WA 4YWLA 2FJ2A 4MTKA 1S5DD 3HP3A 2PW7A 1XNQQ 1L0YB 2EXZA 4R4OA 4FDBA 5FJ8H 1K0SA 2PCFB 4EQPA 5IGDA 4F8MA 1XPUA 3WDNA 1XNRQ 1EY4A 4JI4Q 3RZOB 2VNUD 2A68C 4ZAIA 4DKAC 1IL8A 4JI5L 2ES2A 2E5LQ 3T53B 2AHOB 2HCIA 2XIWA 4EQOA 5GADC 1IKLA 4BBRG 5IYCG 4LF8Q 1CT1D 4K0KL 2K75A 3HGBA 4PMCA 2OTLA 1I3QB 1GXDC 3MXGA 1EFWA 1JB7A 1S5BD 1SE2A 4EQNA 3A5UA 4IFDH 2B2WC 1NMFA 1F77A 2N88A 3T56B 1XYIA 3RLFA 4A3JB 2WB1B 5C3EB 2WKCA 1E1TA 1JWMD 3TEHB 5IYDG 4ODGA 1ET6A 2A68D 2Z4HA 2R93B 3U9SA 3H6MA 3NTIA 1HNZQ 2ZXOA 1CKMA 2UXCQ 1LLRD 4R8IA 2VL6A 4OWTB 3S2DB 3BG3A 2AQ2B 3K8AA 1ENFA 3D6WA 2OF1A 4X3UA 1RL2A 4L8JA 2KCTA 4X3KA 1QG7A 1J6QA 1P8LA 4CKCA 4IOAA 5LMUQ 3DWPA 4OO1I 3BVGA 2Q2IA 1VQPA 3TS0A 4UP9A 2F0PA 3PIO3 2IX0A 4JK1C 5CMDA 4C3JH 5JPMC 5IWAQ 5A2QE 3M9BA 4DNRB 2R92B 3HZXA 3NQTA 1EYAA 2NVTB 3T1HQ 1BBWA 4GOPA 2KEDA 1PMRA 4JBWA 3D4RA 4A3BG 4KHPQ 5GAGC 2EYLA 5H1SE 4B3ML 4Q0FA 1EZ8A 1MIUA 4K14A 4HIDA 1D2BA 3CHBD 4A3GG 1JE5A 1LACA 1X3EA 1SFOH 4L5RC 4NKLA 4KN4C 4KHVA 1EIYB 1IW7C 4WORA 3T16A 4HJ5A 1CA5A 1LTID 2MUYA 5KNDA 5I2XA 4JI0Q 1GHJA 1YBYA 1DGSA 2D5DA 1Q3LA 5EGTA 1J8IA 1D8LA 3FMCA 4XQJA 2OQKA 5GROA 1UE7A 3HKZE 3LX0A 3BS1A 1EOVA 5JJIA 1Y8OB 2EYPA 4A3KG 3CCVA 4R8NA 1NE3A 2HDMA 3CCEA 3DWAA 4A3EG 1YNND 4A93B 1PFSA 3FDTA 4HTHA 2N8NA 2Q8RE 1O78A 5CV6A 2RBMA 1VCIA 2HIVA 1LM0A 2EJGC 2PNHA 4G57A 5K5PA 1YJWA 1Z7TA 4GKKQ 1SR3A 4LWCA 4DV4L 4WJ3M 2UXBQ 2AUKA 2F0KA 3S1NB 2RQXA 3FHWA 5EPKA 4APVA 2KENA 3PF4A 4NB3A 1VMPA 4JI3L 2B2YA 4BBRH 5IYCH 3HOXG 1KAWA 2L12A 5JEAG 2PZWA 2JA8G 2JA5B 1TS4A 1KLGD 3X3NA 3I4NG 1HNXL 1VQ5A 1TU2B 1SLJA 4OL7A 4DV2Q 1FNVA 1GO3E 1N36L 1PYSB 3U4VA 4C3JB 1RJTA 4PG3A 3D8GA 2EYOA 3RLOA 4ME3A 3I55A 1YI2A 1WJJA 2Z6KC 2DNEA 4C1NK 3OMGA 3S17H 1VQIA 3GTOH 2D62A 2N49A 2QCPX 5FLXE 5IYDH 4LF8L 4YWKA 2EY5A 3MZ5A 1MHWC 3G6JB 5M5WH 3PIOA 1B3QA 4DV1L 4GOPB 5GAHC 3HOVG 1S5CD 3KYHC 2PMZE 4HIMA 3EFXD 2E2JH 4LAAA 2UUCL 1WTPA 5DM73 3U4ZA 4XQNA 4OGQC 3JAML 1PH4A 2UUBL 4GN3B 5JEAJ 1HNWL 1HR0Q 1K73C 1J9OA 4XQQA 1H9SA 5M5YH 3OOCA 2LSSA 1PH5A 2I5MX 4ZKBB 5M3MB 1V1QA 4ABNA 4ZLTF 1B2TA 5CV4A 1AFPA 2NVYH 2F0EA 4A3DG 1D1KA 2RHSB 1WCMB 1LT4D 4X64L 1I4RA 4I7ZC 2K4KA 4NW2A 2OEOA 1CKNA 5C44G 2NN6I 3EN2A 4GN4B 4WJ4A 3CW2C 3K5LA 3PO2G 2Z0SA 4GN5A 1HUNA 1FD7D 4DU9A 5BN4A 1YITA 1XJVA 3EJIA 4PV1C 2F03A 1JICA 2YTXA 4A3BH 2Q8TA 3UI2A 1UE5A 1D5XC 4P2CB 4AIMA 2BDOA 4Q5VA 3VDYA 3SK8A 4J1MA 3CKIB 2D9UA 4V0BA 4B3RL 5TSSA 3VR2A 4A3GH 4DV6L 1X3GA 1K8AC 2SDFA 3K6OA 4JI7Q 1X3FA 4DXFA 1YNJC 2QF7A 4HSPA 2RSOA 3DEOA 3GTQB 1L0XB 4LUVA 2DY8A 1WD0A 1TWHB 4AQYQ 2EYHA 1A2TA 3CP0A 4KHPL 3VR3A 1MSHA 4HEDA 1N8RC 2WAQE 4O1NA 4BY7G 2KCCA 3S24A 3AMUA 2OTJA 2L4NA 2V1CC 1SE8A 4GNXA 4A3KH 1WTVA 1I5FA 1U4PA 3CD6A 2CKZB 1Q8KA 2EE1A 4A3EH 3GTOB 5DLQE 1EIGA 5DNFA 5IODA 5C4JB 4HJ7A 3C2PA 2KA7A 4JW0A 3CCJA 3M3YB 1JJCB 4H02A 2MFIA 4KV6A 3FPUB 4G7HC 2EOTA 5AFWA 4LF4L 5IT9L 2I07B 2F4VQ 3H91A 1C8CA 2QEXA 4DR7L 2ALYB 2YTVA 3F2DA 3T1YQ 1Y14B 2X6GA 3HOXH 4DXGA 1VQHA 3S14H 1PVOA 5JEAH 2JA8H 1H9SB 1B4OA 1PZID 3CQZH 4BBSB 3I4NH 2DGYA 3QB3A 1WTRA 1KIXA 5J22A 1JWUD 1C4QA 1IZ6A 1EQQA 3GTPH 1DOLA 3D3RA 5FK9C 1CFMA 1AN8A 2IHFA 1X32A 4KK7A 1CKNB 4CGYB 2NVQH 2KUMA 4DR4Q 3X3MA 1E3PA 1JOKA 3VA7A 2WAQB 2DNCA 3KLSA 2OT2A 3B6YA 3CRLC 3U9OA 2EVBA 1QB5D 1IXRA 1V43A 3DM3A 3HOVH 1FGUA 2VQEQ 4CBVA 1BBXC 1PTOD 1IYJB 2K04A 4RCOA 1WI5A 2KHSA 2FINB 5LHY1 1ONLA 5DM63 1PRTB 2XNAC 1STNA 4A3JG 2G9DA 4K2KA 4B08A 3CCSA 3P1HA 2WB1G 5C3EG 2RCFA 4OX9Q 1GOZA 3URYA 1K3BC 3EQLC 4M8AA 2E2HH 3MFGA 3GP7A 2R93G 4A3DH 3M4OH 3NBHA 2YU9H 3TP6A 3G71A 1XMQL 1U9RA 3ITPA 4IQZA 4POFA 5C44H 3KBGA 4DV5L 1SE3A 1HZ9A 2RSNA 1KNEA 3BZDB 2WV6D 4EX5A 4A3EB 2Q2TA 1TWGB 4KKUA 1EY0A 4KI0A 4PZ7A 1JMCA 1Z47A 4GNXB 5IGBA 3J81j 1Z6HA 1HR0L 4DR1L 4HIKA 2CCZA 2TSSA 4POGA 2EIFA 2LFNA 5E7NA 1TWCB 3NK9A 3OW2A 1VMCA 3P20A 4C56C 5M5XB 1CHQD 3U50C 4JI5Q 4LK1C 3I56A 2VUMB 1G91A 3EIVA 1R9TH 1F2ZA 1PXUA 2GA4B 3GV6A 4KHZA 2K5VA 3GTKH 2R92G 4DV0Q 1ENCA 4K0KQ 3SR1A 1DM0B 3IFTA 5E3FA 3MVVA 1L1OA 5G3LF 4JI1L 2R7DA 1S40A 1G2TA 1GM5A 3C1FA 5IYBG 2Z1CA 3ERQA 3OWFA 3I4LA 4BY7H 1S3OA 4N9PA 1H9RA 2UUAL 1EY9A 2ICEC 3G48A 5D3IB 4HJ9A 2E75C 1BBUA 4ZUJA 3OW7A 5AJ3L 5ELDA 4RG1A 4Y7NH 3QOJA 1XMOL 2WKDA 3I4MB 1GUTA 1AE3A 4NDXA 1HA6A 2EXDA 3DLLA 2L5TA 4DFAA 1ASYA 4RGNA 3CCUA 1VQNA 5EKKA 4ZYSA 1V1PA 2NB0A 3DHQA 3N52A 4LJZC 3ONAB 5IGEA 2LXKA 3PUXA 3A8JE 4A93G 3W1GA 1RTOA 1QWYA 1BQQT 3PV0A 2MO0A 2K28A 1RODA 1U4MA 2QEJC 3ULJA 2RCNA 3NBHB 4PZ6A 4IO9A 4FF2A 1BDOA 2K5DA 5IT9c 5C44B 1KXLA 1KTKA 1U4LA 3RZOH 2B2UC 2F4VL 4UDUC 1FYCA 3IAYA 2M9VA 5JOBA 5CC4A 1GJXA 4X6AH 2FMMA 1MKHA 4S3SA 1C7YA 1NR2A 4IZ8A 1I50B 5I6WA 1I3QH 1AP0A 2JA5G 2A8VA 1YVCA 1NSNS 4FF4A 3RD4A 4DAPA 2BCOA 4B3MQ 3AEVA 1VQ7A 3WWVA 4ZUIA 1LT3D 2IWHA 1K0RA 1JWSD 2UU9L 1S72A 4OELB 1SMXA 2HQLA 5E1FA 3GTKB 5D3DA 4YCVA 5LL6S 4A3JH 3ICEA 4HCSA 5C3EH 1TR5A 1VQOA 2F0MA 3TQYA 4RH6A 1V1OA 2R93H 1L1OB 3J81E 1UE6A 4IURA 5IP7G 3GTMH 3UE0A 3RR5A 1IBLL 4BY7B 4A3IB 5ELNA 1KABA 2AQ3B 3M85A 5JJLA 1PLFA 2PI2A 3S2DH 5EPJA 1P16A 1STAA 4AYBB 4Y7NB 2C5CA 2KCMA 1IL2A 4U68A 1AZQA 3ND9A 2MP1A 4GOPC 5M3MG 4OWWB 4CJ2C 2AUJD 1Q46A 4JI6L 2EJFC 2RDFA 2WB1E 2BA1A 2ZM6L 4YY3L 3UDXA 2R3ZA 1WCMG 4CJ1B 3PO3B 4DK1A 2F0HA 4F7XA 1RIPA 3NQIA 1EYCA 3BYTB 1V1PB 4UY8C 3H0GB 2IPKD 5K36G 2ASBA 2R92H 4JI3Q 1BCPB 3A74A 1S5FD 3KJOA 1QILA 2A19A 5CV5A 2PPBC 2NVTH 1EZ6A 1KDBA 1GKHA 3OYYA 2F0TA 1VQ4A 2JN4A 4Z9CB 1D5ZC 1F9RA 1HNXQ 3PF5A 3DWQA 2FFKB 5IYBH 1VQ6A 2QDBA 1E2WA 1N36Q 1STGA 2K5WA 1SNCA 4KJNA 5CR3A 3AQQA 3SK6A 3E5SA 1HXYD 1RKNA 4OXPA 1DOKA 4QQBX 1Q1EA 3I8ZA 2L9HA 3UDFA 1DONA 4F87A 4DV0L 4CJ0B 3CRKC 3TDQA 1QZHA 4DV1Q 4GKJL 1PFNA 1B9NA 3H15A 2HHHL 2ZXPA 4FNFA 3O13A 1PYWD 1HA5A 2KECA 1QVCA 2M2LA 3EVQA 3NENA 1IBML 2UUCQ 3HKSA 3CCLA 1H9MA 2E2DC 1F9PA 2GN5A 1A3TA 3HOZG 3JAMi 1LT6D 1EY8A 2NZ1D 1PFBA 2UUBQ 3TP5A 2XN9C 4JV5L 1HNWQ 3J7AF 4A93H 1CZGA 2B2YC 4F88A 2L15A 2NZHA 3N6RA 3PGZA 3CU7A 5EAYA 1XTDA 3GTMB 3KBXA 4ZK9B 4X64Q 3TZUA 3CC7A 4X3SA 3PSIA 3A7LA 2F0VA 3NEMA 3K57A 3S1NH 1MGSA 3AFQA 5KEEA 3R3OA 2R6GA 1AZPA 1A62A 1UE1A 1WTXA 1I94L 4UP7A 2ZJQA 3HG9A 2VB2X 3R2TA 2JA5H 2RF4A 4IPHA 1HZCA 2BA0A 3F2CA 4BBSG 3GTGB 2B2TA 5DAUA 3IKJA 3VR6A 4A3MB 1G51A 5CORA 1OXUA 4B3RQ 3A56A 4DV6Q 4AH6A 3J80E 1A0IA 1GD7A 5I6YA 5LMNL 4L5QA 1VQBA 2H1EA 1I4QA 2WAQG 1EEID 1SNQA 3NTKA 3PIPA 1E1OA 2GVBA 4HJAA 1SYEA 1SNPA 1WTHA 5IP7H 4A3LG 3FRPB 3H3VC 1JORA 4G7OC 2YV5A 2F0GA 1W6JA 4ULLA 2PZUA 4JOIA 2E8GA 3K81C 3SGIA 1IYVA 3QIAA 5NUCA 3OPOA 4BY1B 1EWHA 1ZYRC 2XTIA 4KY7A 2YTYA 1OXVA 1LV9A 5COYA 5M3MH 3KLRA 1DCZA 1I4GA 1HQRD 4DF7A 3F1ZA 4NPSA 5E4WC 1WCMH 4QF4A 1IBKQ 2JEBI 4LF4Q 3K5OA 2IW3A 4LF9L 1QVGA 1KNAA 1PRTC 4DR7Q 5K36H 2K33A 3FKIB 1X55A 3PUWA 4J6HA 5L37A 5A2QL 4QIWE 1QNUA 4K5WA 3W2DA 4C1NI 1D5MC 1JB3A 1UAPA 2D0PA 1IW7D 3BJUA 4HJ8A 3I90A 5IOCA 2JEAI 1N32Q 1Y1VB 3VR5A 3WOEA 4LF6Q 3CAMA 4KD3A 4UP8A 2VUMG 5CV9A 2QKIC 2Z9HA 5I9PA 3BZCA 1ZXTA 4GNXC 4IPDA 3FVQA 3GTQH 2ZTCA 3KF6A 3SHLA 2K32A 3S9WA 4ZKCB 1Q82C 1NCVA 4A3FG 1VF5C 4DNTB 1TWHH 1IHZA 3MHBA 1CK1A 4NXNL 1EU4A 3AFPA 3Q0AA 3MTSA 3LGJA 2CHBD 1B9MA 2NZOA 3J81c 3GTJH 3HOZH 3ER0A 4DR5L 4RGOS 4KD4A 1NAPA 4P75A 1STYA 2F0UA 1HRJA 4LUOA 4GLAC 1DJRD 2AWOA 2NYZD 3EROA 2O5JC 4A75A 1NY4A 1RHPA 3I4MG 5C4JH 2F52A 4DNIA 1EEFD 3Q22A 3BDLA 3M3YH 1SMYC 4IALA 3KF8A 4JI8L 1PH9A 4M1UB 4DAVA 1PH7A 1XMQQ 1O7YA 4DV5Q 4IUTA 1XTCD 4QIWB 1EUJA 3BVMA 4IPCA 2JYOA 1ENAA 4DR1Q 3MWYW 1IKMA 4LFCL 3CPWA 1H95A 3E9IA 3HRZC 2K03A 1WOCA 5J39A 3UDIA 4BBSH 1PFMA 1DZ1A 3IRBA 4XDXA 1XPRA 3S1QB 4DR2L 1KL9A 2IX3A 3UE1A 3H3VH 1K83B 1QJOA 3PCOB 4JBJA 1VS0A 3TRZA 4MTNA 3DMUA 4HSVA 4FP5D 1SMYD 3TN2A 1CUKA 4C3HB 1V9PA 1STEA 2RDHA 2XVSA 5C0XG 4JI1Q 5C4HA 2Q8IB 2RDGA 3EBEA 1KDAA 4A76A 3R93A 1W3SA 1VDZA 4H13C 3K5MA 4A3LH 5FLXL 5FO8B 1N33L 2D0OA 3M4PA 4GLVB 2UUAQ 2QW7A 2E2IB 3E0JA 3GDEA 4YCWA 3SE0A 1ESRA 2A6EC 4QUCA 4TSSA 5AJ3Q 2BH2A 3A0JA 2MPMA 1XMOQ 4DN4M 2JA6B 1N9WA 4XT3B 1VQFA 3KF6B 3I91A 1EY5A 5C4XB 1FL0A 2C9OA 4NMZA 3TMEA 4PMBA 1TS2A 3GTJB 4G7ZC 4A3IG 3HOZB 4YCUA 4I7AA 2B2VA 2GVAA 2JXMB 4AYBG 4HAEA 1TWGH 5C0XJ 1JQYD 2X69A 4IJHA 1Y8PB 2K5NA 1L1OC 1VQLA 1G291 4B3TQ 4A3CG 3HOUB 5EKLA 1TWFB 1YNJD 3Q8DA 4EGVA 1E22A 1TWCH 3SVMA 4LMQD 1VF7A 2WP8J 3KF8B 4K8JA 1IBKL 5C6AA 3PO3G 5M5XH 2EYMA 5J1ZA 3R8BA 2VUMH 4JYAL 1SNOA 4HIOA 1PDQA 4RWSC 1O7LA 3H0GG 4HCEA 1FNWA 2I0QA 4CHTB 4NXML 5IE8A 1A3UA 1LTGD 4X65L 3MAQA 1HR0W 2MJ8A 1EQVA 4MHEA 4A3FH 4K5XA 1B44D 2KCNA 3NELA 3CCQA 2HD3A 3C1EA 4N8FA 4RKLA 2A69C 1JT8A 2K14A 1N32L 3VA5A 2UU9Q 4JPBW 2CW0C 4LF6L 2Z6KA 5KNBA 2JA7B 5FO7B 5FLMG 2YYZA 4JVZA 4R4IA 2F0LA 2EY6A 2P5ZX 1BCPC 1X65A 4DV7L 1MJEA 4O2DA 1GUOA 1D7QA 2SNMA 3I4MH 2K1BA 4YIJA 3DUZA 3T51B 2NVXB 1V8QA 1IBLQ 1M90C 3CCRA 1VQEA 1G6ZA 2VQFL 1PTOF 1RD9D 1E7ZA 2HUGA 1M1KC 1C0AA 1TT2A 2JE6I 3GD7A 3A8IE 2L11A 3MXUA 2A69D 5M3FB 1JR0D 3LWEA 3OIPA 3M7NA 2CW0D 1R4QB 4IUVA 3L3OC 1M4VA 4TVAB 1SNMA 4JI6Q 5EBDA 2CWPA 2DN8A 1BCPD 4FXGC 2ZM6Q 2K05A 4YY3Q 3ZYYX 5ELOA 4IUUA 3G6EA 3PUZA 1SNDA 2ENBA 1OO9B 2B29A 4XIGS 4CKEA 1BNZA 1GUGA 5F2DA 4DR6L 2KQ3A 1B53A 1Q90A 3ZJYC 4DUZL 4DK6C 1EFID 5C0XH 1BXTA 2EYFA 5GQOA 1I50H 1CHPD 2D2CC 1A2UA 3DM1A 4FF1A 1TXYA 5ELBA 1X3PA 1OXSC 1W2BA 4P73A 1U0LA 3DXJC 3A5ZB 3K58A 2KEEA 4ILWA 5HY6A 4A3MG 1EIHA 1JE4A 1QOHA 2F3IA 4PMWA 1TKWB 1QE6A 1CQFA 4O42A 4OIKA 5KRUA 3NP8A 1ILPA 2I46A 1II3A 4LFAQ 1Q7YC 3D0FA 5JVH3 1J5EQ 4HR7B 4A3FB 4GKJQ 1PH1A 3HS0C 2HHHQ 3P75A 4MNOA 4DR3L 2Y0SG 3K5NA 4DAMA 4IUQA 2A5HA 4MZ9A 5FLXc 1PH8A 1KDCA 4CDEC 2XSCA 5CGKA 1IBMQ 4A3IH 2JQOA 3NWSA 2DJGC 4OEMB 3RNUA 4DV3L 1HFGA 4RHSA 3MA2B 1WD1A 5CBEE 2B63B 3CC2A 4JV5Q 3KOJA 4BY1G 4FF3A 3I4OA 4H7BA 4R4QA 1Q81C 3KDFA 3CXCA 2AQ1B 3I7FA 4A3CH 4FXDA 3AYHB 1BOSA 2EY1A 3GQBA 3QWNA 4JCVE 5C5LA 3TS2A 3K80C 1UEBA 3PO3H 4FXKC 1EIFA 2XRQD 2J7ZA 2K5HA 2F0IA 4BA1I 3H0GH 2O4XA 2VS1A 3FKIG 1I94Q 3F8TA 5BR8L 2QDLA 4B3TL 2O5IC 4AYBE 4K8IA 2N55A 1ML0D 1Y1VG 2MO1A 2L1BA 4Y52H 3STBC 4KTAA 1T9HA 5LMNQ 4IFDI 5FLMH 4B3SL 2ATWA 3SDZA 4RFBA 2WACA 1LABA 2A74C 3K7UC 3G4SA 4ALPA 3E9HA 1EU3A 1JCKB 4X66L 2BH8A 3FEWX 4KJOA 3MEFA 4RGTA 1X54A 1DOMA 2WINB 1SRUA 4K2LA 5M9OA 2Z8LA 5IY0A 2ZTDA 1OTCA 3S15B 2F0JA 2KHIA 1VQCA 2VXWA 5E4XA 2PQAA 4LF7L 4UAIA 2ZT9C 4OIJA 4QB4A 1RCVD 2I5HA 3RLNA 4A4IA 1DXMA 4HN7A 1K8GA 4IUNA 4MN3A 3RZDB 4LF9Q 2JA9A 2HCCA 4KKTA 2EDGA 1JC7A 1C9OA 4BXXG 3TZDA 1O7IA 2ICIA 3E6ZX 2IT1A 1SEBD 3KDFB 1B1ZA 1ESFA 5C4ZA 2B8GA 2K6AA 1JOOA 3GTGH 1C48A 3PIP3 4A3MH 1F2MA 4LF5Q 1D1IA 4JOIC 5HURA 4XT1B 3IL8A 1EQRA 1JJ2A 2AKWB 3M4YA 4C3HG 2EJMA 2MQHA 1PTOB 3S1MB 1QZGA 2B3GA 3OMCA 4MIUA 5IGFA 1I6VC 1UNSA 2KOLA 1PV4A 2IY5B 3MFYA 4NXNQ 2PI2E 4DAYA 1LT5D 5IP9G 1WTQA 4LFBL 1QCBD 1CSPA 3GO5A 3PQIA 1OXXK 4KN7C 4RMFA 3J81L 4DR5Q 3BU2A 4KY5A 1MSGA 5D65A 1SYBA 4DGZA 4LFAL 1O80A 2F0OA 1HTPA 5BN3A 1NMGA 4BY1H 2JA6G 1S5ED 1HTLD 3S1RB 1J5EL 1TS5A 1Q8IA 1VQKA 2XWJB 4KLKA 4TQUS 5C4XG 3OHXC 1VQGA 1PH3A 4JI8Q 3TP8A 4JBMA 3AB9A 2Y0SE 3OTOL 3GTLH 1FNUA 1BUVT 1KC8C 2VZAA 2XGTA 3V2TA 3M7GA 3D6CA 1Q1BA 3D4DA 3FKIH 4LFCQ 5EPLA 3QG1A 2CQOA 2F4IA 5I9OA 2PQAB 3KUPA 1I6HH 3HOUG 3A54A 5CYUA 4DR2Q 1CKOA 1I4PA 1STBA 1Y69U 1E24A 4ME5A 1Y1VH 2B2UA 3EA6A 3V05A 1B8AA 5DEHA 1F9SA 4C3IB 3Q23A 4DK0A 1X56A 4DUYL 2E74C 4BA2I 2B8FA 5T1GA 4RCNA 4OO1G 1HH2P 5CV7A 3UDGA 2R7ZB 1E2VA 2PO4A 1HPCA 1N33Q 1M8AA 2HQEA 1E2ZA 1U5KA 4WJWA 2QA4A 1CM9A 2JA7G 5FOBB 4E6IA 1RF2D 3Q6SA 5I2YA 2OXPA 4DA2A 4EVOA 1FGBD 1Z9FA 1ZKOA 4X62L 1WVLA 4JBKA 2Y0SB 1VQ8A 2V4DA 1VQAA 2MNAA 3T13A 3NUCA 4BWGB 1Y1WB 4X3TA 1TWAB 3WOFA 1LO5D 4DAYB 5JJZA 3NE5B 3PUYA 3J7ZC 1AH9A 5IGCA 2J0TD 3H3VI 1NJIC 3MXNA 1F2YA 3TBIB 3HFZB 3QJYA 1ICWA 5M3FG 4BXXH 1BR9A 3RN5A 2R7FA 2R61A 1XPOA 3S16H 3MC0B 1G6PA 1YNNC 1CA6A 4K6LA 5JAVA 1A8VA 1I4XA 3CMAA 3GTLB 2ZJPA 3S1QH 4RKBA 2OWOA 4OONA 4TRDA 1K83H 1YNXA 4JYAQ 1SYCA 1N34L 4RGMA 2MGSA 4NXMQ 4DK3C 4C3HH 1SE4A 4N9TA 3ULLA 4X65Q 4B9XA 1MBYA 2DJFC 2WIIB 3RUZA 4L5TA 5D14A 3W3AA 3J80L 5JJKA 3J7A5 2ZTEA 2WFWA 3BYYB 4PQXA 2JSOA 4R4TA 4O0AA 1I6HB 1F2LA 1SN8A 4R4CA 1G8ZD 5IP9H 4V190 4JI2L 5EKIA 1ZYRD 4ZCKA 1VQDA 3I70A 4G4KA 4QUFA 2B2VC 2QILA 1LYLA 1PZJD 4LF5L 2E2IH 3S2HH 2OCEA 1FJGL 4DV7Q 1LUZA 5KYLA 3A55A 1TY2A 1CQVA 2EY2A 2JA6H 3AU7A 1XXGA 1PA6A 1BKBA 1PRTD 3JAME 5C4XH 1W6KA 1PRTF 4CKBA 1EL0A 3U58A 2FHTA 2SEBD 4FO2A 2F0FA 4OWXB 2B2WA 2Q2HA 3CPFA 1DYQA 1AW7A 1K9MC 2VQFQ 1AEXA 3MXPA 1ILQA 1SDFA 3BDCA 3QOLA 1UEAB 2B63G 1B7YB 2OQ0A 3H94A 1XNQL 1ET9A 3PO2H 3E3XA 5A35A 3I3CA 4XTCS 1HFNA 3HOUH 2M00A 1TWFH 1GUNA 1SJED 1XNRL 3SK5A 5LL6X 4JI4L 4R1JA 4L63B 2CVRA 3HOWG 1WTOA 2E5LL 3F2UA 4DR6Q 1K3RA 3RN2A 1EYDA 4DUZQ 4LNQA 2FMCA 2H4OA 3HKZB 1RDPD 3MXNB 5T1IA 3CMEA 4OO1H 1BVSA 1HUMA 3P7JA 3VR4A 3S16B 2EQSA 3FPPA 1EQTA 4UPAA 4TKOB 4XYOA 1QUQA 2NN6G 4RA8A 1A15A 4LW1A 2VY3A 2EZVA 4P74A 1SFOB 5FKAC 4OHJA 4GLXA 4I65A 5J3BA 1WFQA 2JA7H 2HDLA 3PUVA 2A73B 5CBAE 1I4HA 1BO0A 1QVFA 5FO9B 1O7ZA 4DR3Q 1KQSA 3BZKA 3KJPA 1UUPA 4DPGA 1HNZL 2PNRC 2NVXH 2UXCL 1PHJA 1LTBD 2IHEA 2TMPA 1L2FA 3S2HB 1IYUA 4DV3Q 1K8OA 1A6XA 1KD1C 4J8QA 2BE5C 3TREA 3D31A 4LUZA 2L55A 2F0SA 4K6DA 5M3FH 3NHHA 5KYIA 5HGQA 5IT9E 5LMUL 2AMCB 1KRTA 5C0XI 3K0XA 3CC4A 5ELCA 2IL8A 4QL5A 1EY7A 5IWAL 3L7ZC 1SBBB 2PMZB 4BBRB 3RMHA 1CSQA 4P72A 4XXEA 3T1HL 2KBNA 3VYSA 2Z6BA 2BDNA 2CWAA 1VQ9A 1GHKA 5BR8Q 1YIJA 5BN5A 2A6ED 2BE5D 2IX1A 1A3VA 3OSOA 2SOBA 5EJWA 1YEZA 3BDOA 3QR8A 1A63A 4KMUC 1SJHD 4PZ8A 4P71A 3S17B 2EYJA 4B3SQ 2ID0A 3LWUA 4XYQA 3W1BA 2FXQA 2QGQA 5M5WB 4IUPA 4JG2A 3J80c 5JPNC 1LTLA 3T4AC 1Y8NB 1E0BA 4ZQ3A 4JI0L 2KHJA 1D6EC 2E2JB 3TSSA 1GUSA 3IFDA 3CF5A 1QUQB 4X66Q 1L0WA 1KAAA 1YHAA 2PZTA 3FP9A 2PYKA 1EOTA 1HJPA 1PYBA 1CZWA 2UXDQ 2B63H 5M5YB 3SXHA 1PTOC 3HOYG 4RHRA 2NUCA 3C46A 4L6TB 2NVYB 4LF7Q 3I72A 1JOQA 1SROA 4FYDA 4GKKL 1VQJA 1KLUD 1TQOA 4H44C 3KFUA 1MD2D 2UXBL 4YHHQ 3HOWH 1TY0A 1UWVA 4UHVA 1YHBA 4IN3A 5C3XA 2K7VA 4N8X1 4WRDA 1EYGA 4A3BB 2JP1A 2CQAA 3M4QA 1X3QA 4CDDC 5ELEA 4ZRZA 4ID6A 1B70B 4KY6A 3A7AB 2NN6H 4DV2L 1BCPF 1JJGA 1R4PB 4A3GB 1WTWA 3VYRA 2F0QA 3OWEB 4C3IG 2J4XA 4C2MH 1PZKD 2K5QA 1HQMC 1RTNA 3J7YW 5EQ0A 2K01A 2R7ZG 3MEHA 1YJNA 1H9JA 2G5DA 4LFBQ 2LXJA 2NBFA 2RA4A 2ZJRA 4HMIA 3J81i 5IGGA 3JAMc 2KVMA 2PQEA 2MHVA
chains in the Genus database with same CATH topology
4A3KB 1BF4A 3OIQA 1GUWA 1NUCA 4B9WA 2B39A 4HMJA 3NPPA 3I73A 1T5EA 1G2SA 2F0NA 4QMGA 3K0YA 1XWEA 3C3LA 5C3WA 2LKVA 2RKSA 3KLSX 5HGTA 3KK7A 3HEJA 4GZYC 3NWTA 3HOXB 1T5XD 3S14B 2JA8B 5G3LD 3QO2A 4BS9A 2NTTA 3CQZB 2EPBA 5EBCA 5KNCA 3I4NB 2NTSA 1TIID 2BOSA 2LS01 4QCLA 3GTPB 3H09A 1B50A 2KJXA 1OXTA 3HOWB 2NVQB 4U673 1HHVA 3VYUA 3BVZA 3NSWA 2Z4IA 3GV3A 2A6HC 3SEBA 3TP7A 1QNKA 5KIXA 1PTOH 3G7LA 2F1MA 4R9WA 2LY7A 2RVLA 3HOVB 2AWNA 1SYFA 2F0DA 1F9QA 1SAPA 2E76C 1MI2A 2PW5A 4IFDG 1SYDA 2XWBB 2G9HD 1TS3A 3VYTA 4PNYA 5ISRA 4C2MB 4KKSA 2E2HB 3LNNA 4A3DB 2XRSD 3M4OB 2YU9B 2A6HD 2L0CA 3J7AV 3PO2B 1K8MA 1Q12A 2SNSA 2NWGA 1EWCA 1STHA 2F3VA 1DD2A 5C5MA 3DEPA 1LTSD 1TVXA 4IFDJ 1U4RA 1S4ZA 2ZXRA 2B2TC 3Q24A 3ND8A 5I4DA 1R9TB 1EY6A 4C3JG 1HCZA 1SSOA 3V96A 1LTRD 3K7AB 1SXTA 1SYGA 1B3AA 2IJ0A 4FVMA 4K5VA 5CV8A 5KGUA 1CI3M 3NBIA 3L9AX 2X6LA 5JVG3 3K59A 4NP5A 3NXWA 3A8KE 1FR3A 3NTHA 4RAUC 3SK4A 5IIFA 2F3WA 4WFN3 1CTMA 3D4WA 2O2LD 1H9KA 1LTAD 1NR4A 1XX8A 4H0LC 2DY7A 3R2IA 2LMCB 2VB3X 3PMFA 5ELFA 1ZEQX 1LTTD 3HOYB 2F0WA 2FJ2A 1S5DD 3HP3A 2PW7A 1L0YB 2EXZA 2PCFB 4EQPA 5IGDA 4F8MA 3WDNA 1EY4A 3RZOB 2VNUD 2A68C 4ZAIA 1IL8A 3T53B 2HCIA 2XIWA 4EQOA 1IKLA 1CT1D 3HGBA 4PMCA 1I3QB 1GXDC 3MXGA 1S5BD 1SE2A 4EQNA 4IFDH 2B2WC 1F77A 2N88A 3T56B 1XYIA 3RLFA 4A3JB 2WB1B 5C3EB 2WKCA 1JWMD 4ODGA 1ET6A 2A68D 2Z4HA 2R93B 3U9SA 3H6MA 3NTIA 2ZXOA 1LLRD 4R8IA 3S2DB 3BG3A 2AQ2B 1ENFA 3D6WA 2OF1A 4X3UA 4L8JA 4X3KA 1QG7A 4CKCA 3DWPA 4OO1I 3BVGA 2F0PA 3PIO3 2IX0A 4JK1C 5CMDA 5JPMC 5A2QE 4DNRB 2R92B 3HZXA 3NQTA 1EYAA 2NVTB 2KEDA 1PMRA 4JBWA 3D4RA 2EYLA 4Q0FA 1EZ8A 4K14A 1D2BA 3CHBD 1LACA 4NKLA 4KN4C 4KHVA 1IW7C 4WORA 3T16A 1CA5A 1LTID 2MUYA 5KNDA 5I2XA 1GHJA 2D5DA 1Q3LA 5EGTA 1J8IA 3FMCA 4XQJA 3LX0A 3BS1A 1Y8OB 2EYPA 4R8NA 2HDMA 3DWAA 1YNND 4A93B 3FDTA 4HTHA 2Q8RE 1O78A 5CV6A 2RBMA 1VCIA 2EJGC 4G57A 5K5PA 1Z7TA 2AUKA 2F0KA 3S1NB 2RQXA 5EPKA 1VMPA 2B2YA 2L12A 5JEAG 2PZWA 2JA5B 1TS4A 1KLGD 3X3NA 1TU2B 4OL7A 1FNVA 4C3JB 1RJTA 3D8GA 2EYOA 2DNEA 4C1NK 3OMGA 2D62A 2QCPX 5FLXE 2EY5A 3MZ5A 3G6JB 1S5CD 3EFXD 4LAAA 1WTPA 5DM73 4XQNA 4OGQC 3JAML 5JEAJ 1J9OA 4XQQA 1H9SA 3OOCA 4ZKBB 5M3MB 4ABNA 4ZLTF 1B2TA 5CV4A 1AFPA 2F0EA 1D1KA 1WCMB 1LT4D 1I4RA 4I7ZC 4NW2A 2OEOA 2NN6I 3K5LA 1HUNA 1FD7D 4DU9A 5BN4A 3EJIA 4PV1C 2F03A 1JICA 2Q8TA 3UI2A 1D5XC 4P2CB 2BDOA 4Q5VA 3SK8A 4J1MA 3CKIB 2D9UA 4V0BA 5TSSA 3VR2A 2SDFA 3K6OA 4DXFA 1YNJC 2QF7A 4HSPA 2RSOA 3DEOA 3GTQB 1L0XB 2DY8A 1WD0A 1TWHB 2EYHA 1A2TA 3VR3A 1MSHA 4HEDA 4O1NA 2KCCA 3AMUA 2L4NA 1WTVA 1U4PA 2EE1A 3GTOB 1EIGA 5DNFA 5IODA 5C4JB 3C2PA 2KA7A 3M3YB 4KV6A 3FPUB 4G7HC 2EOTA 5AFWA 5IT9L 2I07B 3H91A 1C8CA 2X6GA 4DXGA 5JEAH 1H9SB 1B4OA 1PZID 4BBSB 3QB3A 1WTRA 5J22A 1JWUD 1C4QA 1DOLA 3D3RA 5FK9C 1CFMA 1AN8A 1X32A 4KK7A 4CGYB 2KUMA 3X3MA 1JOKA 3VA7A 2WAQB 2DNCA 3KLSA 2OT2A 3CRLC 3U9OA 2EVBA 1QB5D 1V43A 4CBVA 1BBXC 1PTOD 2K04A 4RCOA 2KHSA 2FINB 5LHY1 1ONLA 5DM63 1PRTB 2XNAC 1STNA 2G9DA 4K2KA 4B08A 3P1HA 1GOZA 3URYA 3EQLC 4M8AA 3MFGA 3GP7A 3NBHA 3TP6A 1U9RA 3ITPA 4IQZA 3KBGA 1SE3A 2RSNA 1KNEA 3BZDB 2WV6D 4A3EB 1TWGB 4KKUA 1EY0A 4KI0A 1Z47A 5IGBA 1Z6HA 2TSSA 2LFNA 1TWCB 3NK9A 1VMCA 3P20A 4C56C 5M5XB 1CHQD 4LK1C 2VUMB 1G91A 1F2ZA 1PXUA 2GA4B 3GV6A 4KHZA 1ENCA 3SR1A 1DM0B 3IFTA 5E3FA 3MVVA 5G3LF 1G2TA 3C1FA 2Z1CA 3ERQA 3OWFA 3I4LA 4N9PA 1H9RA 1EY9A 2ICEC 5D3IB 2E75C 4ZUJA 3OW7A 5ELDA 3QOJA 2WKDA 3I4MB 1GUTA 4NDXA 1HA6A 2L5TA 4DFAA 4RGNA 5EKKA 4ZYSA 1V1PA 2NB0A 3DHQA 3N52A 4LJZC 3ONAB 5IGEA 3PUXA 3A8JE 1RTOA 1QWYA 1BQQT 3PV0A 2K28A 1RODA 1U4MA 2QEJC 4FF2A 1BDOA 2K5DA 5C44B 1KTKA 1U4LA 2B2UC 4UDUC 1FYCA 3IAYA 2M9VA 5JOBA 5CC4A 1GJXA 2FMMA 4S3SA 1NR2A 4IZ8A 1I50B 5I6WA 1AP0A 1NSNS 4FF4A 3RD4A 4DAPA 2BCOA 4ZUIA 1LT3D 2IWHA 1JWSD 5E1FA 3GTKB 5D3DA 5LL6S 4HCSA 1TR5A 2F0MA 4RH6A 1V1OA 3J81E 4IURA 4BY7B 4A3IB 1KABA 2AQ3B 3M85A 1PLFA 5EPJA 4AYBB 1STAA 4Y7NB 2C5CA 4U68A 1AZQA 3ND9A 2MP1A 4CJ2C 2AUJD 2EJFC 2RDFA 2BA1A 2R3ZA 4CJ1B 3PO3B 4DK1A 2F0HA 4F7XA 3NQIA 1EYCA 3BYTB 1V1PB 3H0GB 2IPKD 5K36G 1BCPB 1S5FD 1QILA 5CV5A 2PPBC 1EZ6A 1KDBA 2F0TA 4Z9CB 1D5ZC 1F9RA 3DWQA 2FFKB 2QDBA 1E2WA 1STGA 2K5WA 1SNCA 4KJNA 5CR3A 3SK6A 3E5SA 1HXYD 1RKNA 1DOKA 1Q1EA 3I8ZA 2L9HA 1DONA 4F87A 4CJ0B 3CRKC 3TDQA 1PFNA 1B9NA 2ZXPA 3O13A 4FNFA 1PYWD 1HA5A 2KECA 2M2LA 3EVQA 1H9MA 2E2DC 1F9PA 1A3TA 1LT6D 1EY8A 2NZ1D 1PFBA 3TP5A 2XN9C 3J7AF 1CZGA 2B2YC 4F88A 3N6RA 3CU7A 3GTMB 4ZK9B 3KBXA 3TZUA 4X3SA 3A7LA 2F0VA 3K57A 1MGSA 5KEEA 3R3OA 2R6GA 1AZPA 1WTXA 3HG9A 2VB2X 3R2TA 2BA0A 3GTGB 2B2TA 5DAUA 3IKJA 3VR6A 4A3MB 5CORA 1OXUA 3A56A 3J80E 5I6YA 2H1EA 1I4QA 1EEID 1SNQA 3NTKA 1SYEA 1SNPA 3FRPB 3H3VC 1JORA 4G7OC 2F0GA 1W6JA 4ULLA 2PZUA 1IYVA 3QIAA 5NUCA 3OPOA 4BY1B 1EWHA 1ZYRC 4KY7A 1OXVA 1LV9A 5COYA 3KLRA 1DCZA 1I4GA 1HQRD 4DF7A 5E4WC 4QF4A 2JEBI 3K5OA 2IW3A 1KNAA 1PRTC 5K36H 2K33A 3FKIB 3PUWA 4J6HA 5A2QL 1QNUA 4K5WA 3W2DA 4C1NI 1D5MC 1JB3A 1UAPA 1IW7D 3I90A 5IOCA 2JEAI 1Y1VB 3VR5A 3WOEA 4KD3A 5CV9A 2QKIC 5I9PA 1ZXTA 3FVQA 3SHLA 2K32A 3S9WA 4ZKCB 1NCVA 1VF5C 4DNTB 3MHBA 1IHZA 1CK1A 1EU4A 3Q0AA 3MTSA 2CHBD 1B9MA 4RGOS 4KD4A 1NAPA 1STYA 2F0UA 1HRJA 1DJRD 2AWOA 2NYZD 3EROA 2O5JC 1RHPA 1EEFD 3Q22A 3BDLA 1SMYC 4IALA 3KF8A 4M1UB 4DAVA 1O7YA 4IUTA 1XTCD 4QIWB 3BVMA 2JYOA 1ENAA 1IKMA 3MWYW 3HRZC 2K03A 5J39A 1PFMA 1DZ1A 4XDXA 3S1QB 2IX3A 1K83B 1QJOA 3DMUA 4HSVA 4FP5D 1SMYD 3TN2A 4C3HB 1STEA 2RDHA 2XVSA 5C0XG 5C4HA 2Q8IB 2RDGA 1KDAA 3R93A 1VDZA 4H13C 3K5MA 5FLXL 5FO8B 2E2IB 3E0JA 3SE0A 1ESRA 2A6EC 4QUCA 4TSSA 2MPMA 4DN4M 2JA6B 4XT3B 3I91A 1EY5A 5C4XB 2C9OA 4NMZA 3TMEA 4PMBA 1TS2A 3GTJB 4G7ZC 3HOZB 2B2VA 2JXMB 4HAEA 5C0XJ 1JQYD 2X69A 1Y8PB 1G291 3HOUB 5EKLA 1TWFB 1YNJD 4EGVA 3SVMA 4LMQD 1VF7A 2WP8J 4K8JA 5C6AA 2EYMA 5J1ZA 3R8BA 1SNOA 1PDQA 4RWSC 1O7LA 4HCEA 1FNWA 4CHTB 1A3UA 1LTGD 3MAQA 2MJ8A 1EQVA 4MHEA 4K5XA 1B44D 2KCNA 3C1EA 4RKLA 2A69C 3VA5A 2CW0C 2JA7B 5KNBA 5FO7B 2YYZA 2F0LA 2EY6A 1BCPC 1GUOA 2SNMA 2K1BA 4YIJA 3DUZA 3T51B 2NVXB 1V8QA 1G6ZA 1PTOF 1RD9D 2HUGA 1TT2A 2JE6I 3GD7A 3A8IE 2L11A 3MXUA 2A69D 5M3FB 1JR0D 3LWEA 3OIPA 3M7NA 2CW0D 1R4QB 4IUVA 3L3OC 1M4VA 1SNMA 5EBDA 2DN8A 1BCPD 4FXGC 2K05A 3ZYYX 4IUUA 3PUZA 1SNDA 2ENBA 1OO9B 4XIGS 4CKEA 1BNZA 1GUGA 5F2DA 2KQ3A 1B53A 1Q90A 1EFID 5C0XH 1BXTA 2EYFA 1CHPD 2D2CC 1A2UA 3DM1A 4FF1A 5ELBA 1X3PA 1OXSC 3DXJC 3K58A 2KEEA 4ILWA 1EIHA 1JE4A 1QOHA 4PMWA 1TKWB 1QE6A 1CQFA 4O42A 4OIKA 5KRUA 3NP8A 1ILPA 2I46A 1II3A 5JVH3 4HR7B 4A3FB 3HS0C 3P75A 3K5NA 4IUQA 2A5HA 1KDCA 5CGKA 2XSCA 3NWSA 1HFGA 4RHSA 3MA2B 1WD1A 5CBEE 2B63B 4FF3A 4H7BA 2AQ1B 4FXDA 1BOSA 2EY1A 3GQBA 3QWNA 5C5LA 4FXKC 2XRQD 2J7ZA 2F0IA 4BA1I 2O4XA 2O5IC 4K8IA 2N55A 1ML0D 2L1BA 4KTAA 4IFDI 3SDZA 4RFBA 2WACA 1LABA 2A74C 1EU3A 1JCKB 3FEWX 4KJOA 4RGTA 1DOMA 2WINB 5M9OA 4K2LA 2Z8LA 3S15B 2F0JA 2VXWA 5E4XA 4UAIA 2ZT9C 4OIJA 4QB4A 1RCVD 1DXMA 4HN7A 4IUNA 4MN3A 3RZDB 2HCCA 4KKTA 2EDGA 1JC7A 3TZDA 2ICIA 3E6ZX 2IT1A 1SEBD 1B1ZA 1ESFA 5C4ZA 2B8GA 2K6AA 1JOOA 1C48A 3PIP3 1F2MA 1D1IA 5HURA 4XT1B 3IL8A 3M4YA 4C3HG 2EJMA 1PTOB 3S1MB 3OMCA 4MIUA 5IGFA 1I6VC 1UNSA 2KOLA 3MFYA 4DAYA 1LT5D 1WTQA 1QCBD 3GO5A 1OXXK 4KN7C 3J81L 4KY5A 1MSGA 5D65A 1SYBA 4DGZA 1O80A 2F0OA 1HTPA 5BN3A 1S5ED 1HTLD 3S1RB 1TS5A 1Q8IA 2XWJB 4TQUS 3OHXC 3TP8A 3AB9A 1FNUA 1BUVT 3V2TA 3M7GA 3D6CA 1Q1BA 3D4DA 5EPLA 3QG1A 2F4IA 5I9OA 3KUPA 3A54A 5CYUA 1I4PA 1STBA 1Y69U 4ME5A 2B2UA 3EA6A 3V05A 5DEHA 1F9SA 4C3IB 3Q23A 4DK0A 2E74C 4BA2I 2B8FA 5T1GA 4RCNA 4OO1G 5CV7A 2R7ZB 1E2VA 2PO4A 1HPCA 1M8AA 2HQEA 1E2ZA 4WJWA 1CM9A 5FOBB 4E6IA 1RF2D 3Q6SA 5I2YA 2OXPA 4DA2A 4EVOA 1FGBD 1ZKOA 1WVLA 2Y0SB 2V4DA 3T13A 3NUCA 4BWGB 1Y1WB 4X3TA 1TWAB 3WOFA 1LO5D 5JJZA 3NE5B 3PUYA 5IGCA 2J0TD 3MXNA 1F2YA 3TBIB 3QJYA 1ICWA 1BR9A 2R61A 3MC0B 1YNNC 1CA6A 4K6LA 5JAVA 1I4XA 3GTLB 4RKBA 4TRDA 1SYCA 4RGMA 2MGSA 1SE4A 4N9TA 4B9XA 1MBYA 2WIIB 3RUZA 5D14A 3W3AA 3J80L 3BYYB 4PQXA 2JSOA 1I6HB 1F2LA 1G8ZD 4V190 5EKIA 1ZYRD 3I70A 4G4KA 4QUFA 2B2VC 2QILA 1PZJD 5KYLA 3A55A 1TY2A 1CQVA 2EY2A 3AU7A 1XXGA 1PRTD 3JAME 1W6KA 1PRTF 4CKBA 1EL0A 2FHTA 2SEBD 4FO2A 2F0FA 2B2WA 1DYQA 1AW7A 1AEXA 3MXPA 1ILQA 1SDFA 3BDCA 3QOLA 1UEAB 3H94A 1ET9A 5A35A 3I3CA 4XTCS 1HFNA 2M00A 1GUNA 1SJED 3SK5A 5LL6X 4L63B 2CVRA 1WTOA 3F2UA 1EYDA 2FMCA 2H4OA 3HKZB 1RDPD 5T1IA 4OO1H 1HUMA 3P7JA 3VR4A 3S16B 3FPPA 1EQTA 4TKOB 4XYOA 2NN6G 4RA8A 1A15A 2EZVA 1SFOB 5FKAC 4OHJA 4I65A 2HDLA 3PUVA 2A73B 5CBAE 1I4HA 1BO0A 5FO9B 1O7ZA 1UUPA 2PNRC 1LTBD 2TMPA 3S2HB 1IYUA 1K8OA 1A6XA 4J8QA 2BE5C 3D31A 2L55A 2F0SA 4K6DA 3NHHA 5KYIA 5IT9E 5C0XI 5ELCA 2IL8A 1EY7A 3L7ZC 1SBBB 2PMZB 4BBRB 3RMHA 4XXEA 3VYSA 2BDNA 1GHKA 5BN5A 2A6ED 2BE5D 2IX1A 1A3VA 3OSOA 2SOBA 5EJWA 3BDOA 4KMUC 1SJHD 3S17B 2EYJA 2ID0A 3LWUA 4XYQA 5M5WB 4IUPA 5JPNC 3T4AC 1Y8NB 1E0BA 4ZQ3A 1D6EC 2E2JB 3TSSA 1GUSA 3IFDA 1KAAA 2PZTA 2PYKA 1EOTA 1CZWA 5M5YB 3SXHA 1PTOC 4RHRA 2NUCA 3C46A 4L6TB 2NVYB 3I72A 1JOQA 4FYDA 1KLUD 1TQOA 4H44C 1MD2D 1TY0A 4IN3A 5C3XA 2K7VA 4WRDA 4A3BB 2JP1A 2CQAA 1X3QA 5ELEA 4ZRZA 4ID6A 4KY6A 3A7AB 2NN6H 1BCPF 1R4PB 4A3GB 1WTWA 3VYRA 2F0QA 3OWEB 4C3IG 2J4XA 1PZKD 2K5QA 1HQMC 1RTNA 3J7YW 5EQ0A 2K01A 3MEHA 1H9JA 2NBFA 2RA4A 4HMIA 5IGGA 2KVMA 2PQEA 2MHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K04 A;  3DEP A;  1WD1 A;  2HDM A;  2Q8T A;  5CBE E;  2K03 A;  3UI2 A;  1BF4 A;  2FFK B;  1RTO A;  2B2W C;  2FIN B;  3FDT A;  1TVX A;  1CM9 A;  2N88 A;  1GUW A;  5EJW A;  1U4R A;  2Q8R E;  1S4Z A;  1XYI A;  1PFM A;  1DZ1 A;  4XDX A;  2D9U A;  2K28 A;  3I3C A;  1ROD A;  1U4M A;  2B2T C;  3Q6S A;  1HFN A;  1DOK A;  5COY A;  1LV9 A;  2SDF A;  3I8Z A;  2L9H A;  1WVL A;  1DON A;  1G2S A;  1U4L A;  4CJ0 B;  4XT1 B;  1SSO A;  2CVR A;  3IL8 A;  2B2U C;  4HSV A;  4IUP A;  2RSO A;  3DEO A;  1WTO A;  2K1B A;  3F2U A;  5E4W C;  3TN2 A;  1PFN A;  2DY8 A;  1WD0 A;  1E0B A;  4X3T A;  2J7Z A;  5EPK A;  2KOL A;  2FMM A;  1B3A A;  2KEC A;  5JJZ A;  1KNA A;  4R8I A;  1G6Z A;  2M2L A;  3IFD A;  1MSH A;  5T1I A;  1VMP A;  4HED A;  2B2Y A;  1NR2 A;  2L12 A;  1HUM A;  1KNE A;  1F9P A;  2HUG A;  2RSN A;  2X6L A;  3P7J A;  3R93 A;  1AP0 A;  1WTQ A;  1EQT A;  2NZ1 D;  3QO2 A;  1PFB A;  1EOT A;  4RAU C;  2L11 A;  3D6W A;  2EPB A;  1ICW A;  2L4N A;  4RA8 A;  1MSG A;  1A15 A;  3LWE A;  4X3U A;  1SDF A;  5D65 A;  4X3K A;  1WTV A;  1QG7 A;  1U4P A;  2EE1 A;  1ESR A;  2B2Y C;  1O80 A;  2N55 A;  3I90 A;  4IUV A;  1ML0 D;  4QUC A;  1EIG A;  2L1B A;  1B50 A;  1RJT A;  2MPM A;  2HDL A;  1CA6 A;  5DNF A;  4DN4 M;  1VMC A;  4HCS A;  2K05 A;  4XT3 B;  5CBA E;  1HHV A;  1BO0 A;  4IUU A;  1G91 A;  3KBX A;  4ZK9 B;  3I91 A;  1ZXT A;  3GV6 A;  5CMD A;  3GV3 A;  4X3S A;  1O7Z A;  3FPU B;  1BNZ A;  1NR4 A;  1XX8 A;  2MGS A;  1QNK A;  2EOT A;  1B53 A;  2DY7 A;  4IUR A;  5AFW A;  3G7L A;  4ZKC B;  1NCV A;  3H91 A;  1C8C A;  4R9W A;  1MGS A;  2RVL A;  2B2V A;  5D14 A;  1AZP A;  1G2T A;  1F9Q A;  1SAP A;  3MTS A;  2KED A;  1WTX A;  1F2L A;  1PLF A;  2X6G A;  1MI2 A;  1WTP A;  2JP1 A;  5EPJ A;  4HAE A;  3DM1 A;  2X69 A;  5EPL A;  1DOM A;  5EKI A;  1X3Q A;  1X3P A;  2FJ2 A;  1B4O A;  3HP3 A;  4U68 A;  1NAP A;  2B2T A;  2B2V C;  4QUF A;  2KEE A;  3KUP A;  1AZQ A;  1IKM A;  1EIH A;  1JE4 A;  1J9O A;  2VXW A;  1WTR A;  1HRJ A;  2MP1 A;  5COR A;  1QE6 A;  2NYZ D;  4CJ2 C;  4ZKB B;  1WTW A;  4O42 A;  4OIK A;  5E4X A;  1DOL A;  1HFG A;  4ZLT F;  1ILP A;  1B2T A;  4UAI A;  2B2U A;  3SVM A;  4OIJ A;  1X32 A;  1RHP A;  4LMQ D;  1CA5 A;  1F9S A;  2R3Z A;  4ZAI A;  1IL8 A;  2H1E A;  2KUM A;  4CJ1 B;  2IL8 A;  1HA6 A;  2HCI A;  1PDQ A;  4NW2 A;  1RTN A;  2XIW A;  4MN3 A;  4RWS C;  1EL0 A;  1Q3L A;  4IUQ A;  2FHT A;  5T1G A;  1IKL A;  1J8I A;  2B2W A;  1O7Y A;  5EQ0 A;  2K01 A;  4IUT A;  1HUN A;  2MJ8 A;  4MHE A;  2HCC A;  3N52 A;  2NWG A;  2BDN A;  2RA4 A;  2JYO A;  3ONA B;  1BBX C;  1ILQ A;  3TZD A;  1M8A A;  3MWY W;  1F9R A;  2KVM A;  1JIC A; 
#chains in the Genus database with same CATH topology
 1HZB A;  4A3K B;  1BF4 A;  3OIQ A;  1YJ9 A;  1GUW A;  2VW9 A;  1NUC A;  1X9N A;  1PH6 A;  4L5S A;  3KLW A;  4QJF A;  4B9W A;  1YHQ A;  3S15 H;  2B39 A;  1GVP A;  4HMJ A;  3NPP A;  3I73 A;  1T5E A;  2CH4 A;  1G2S A;  2F0N A;  4QMG A;  3L0O A;  3K0Y A;  2CH4 W;  1XWE A;  3C3L A;  1Y1W G;  3L2P A;  3F2B A;  5C3W A;  3OTO Q;  2LKV A;  2RKS A;  3KLS X;  4GS3 A;  5HGT A;  3KK7 A;  3RZD H;  3HEJ A;  4GZY C;  3K7A H;  3NWT A;  3HOX B;  1T5X D;  3S14 B;  2JA8 B;  5G3L D;  3QO2 A;  4BS9 A;  2NTT A;  3CQZ B;  2EPB A;  5EBC A;  5KNC A;  3I4N B;  1YZ6 A;  2NTS A;  3E0E A;  5FJ8 G;  1TII D;  2BOS A;  3I2Z A;  2LS0 1;  4QCL A;  3GTP B;  3H09 A;  1B50 A;  2KJX A;  1OXT A;  3HOW B;  2NVQ B;  4CDF C;  4U67 3;  1HHV A;  3VYU A;  4JI7 L;  3BVZ A;  3NSW A;  4DUY Q;  4JC0 A;  2Z4I A;  3GV3 A;  2A6H C;  3SEB A;  3TP7 A;  1QNK A;  5KIX A;  1PTO H;  2CFM A;  3G7L A;  4AQY L;  2H5X A;  3S1M H;  2F1M A;  4R9W A;  2LY7 A;  2RVL A;  3HOV B;  2AWN A;  1SYF A;  2F0D A;  1F9Q A;  1SAP A;  4IJL A;  2E76 C;  1MI2 A;  2PW5 A;  4IFD G;  1SYD A;  2XWB B;  2JJQ A;  2G9H D;  1TS3 A;  3VYT A;  4PNY A;  3W5O A;  5ISR A;  4C2M B;  4KKS A;  5GAE C;  3HOY H;  2E2H B;  4X62 Q;  3LNN A;  4A3D B;  2XRS D;  3M4O B;  3S1R H;  3CCM A;  2YU9 B;  2A6H D;  2L0C A;  1NBW A;  1ASZ A;  3J7A V;  1NTG A;  2K52 A;  3PO2 B;  1K8M A;  1Q12 A;  2SNS A;  2NWG A;  1AE2 A;  1EWC A;  1STH A;  3T1Y L;  2F3V A;  2HT1 A;  2UXD L;  1DD2 A;  5C5M A;  4EQ5 A;  3DEP A;  1VQM A;  2N78 A;  3STB D;  1LTS D;  1TVX A;  4QGU A;  4IFD J;  1U4R A;  1S4Z A;  1K28 A;  2ZXR A;  1WYD A;  2B2T C;  3Q24 A;  4J15 A;  1NNX A;  3ND8 A;  5I4D A;  1R9T B;  1EY6 A;  4C3J G;  1KRS A;  1HZA A;  4YHH L;  1HCZ A;  2RHQ B;  4CDC C;  1SSO A;  3ERS X;  1LTR D;  3V96 A;  3K7A B;  1N34 Q;  4DR4 L;  1EWI A;  1SXT A;  4C3I H;  4QY7 A;  1SYG A;  1MJC A;  1X6O A;  2N3S A;  3J80 i;  1PH2 A;  1B3A A;  2IJ0 A;  3HKZ G;  4FVM A;  4K5V A;  5CV8 A;  5KGU A;  1CI3 M;  3NBI A;  3L9A X;  2X6L A;  5JVG 3;  3JC6 6;  3K59 A;  2R7Z H;  2VQE L;  4NP5 A;  4JI2 Q;  3ULP A;  3NXW A;  3A8K E;  1FR3 A;  3NTH A;  4RAU C;  3SK4 A;  5IIF A;  4IPG A;  2F3W A;  4WFN 3;  1CTM A;  3D4W A;  2O2L D;  1FJG Q;  1H9K A;  2C35 B;  2DUD A;  4OX9 L;  2I5L X;  1FVI A;  1LTA D;  1NR4 A;  1XX8 A;  4H0L C;  2DY7 A;  3R2I A;  4DV4 Q;  1Q86 C;  1Y1W H;  1TWA H;  2LMC B;  2VB3 X;  3PMF A;  4IOC A;  1KHI A;  5ELF A;  2JK8 A;  1ZEQ X;  2A1A A;  2HIX A;  2Q2U A;  2K50 A;  1ICF B;  4YWM A;  5LMN W;  1LTT D;  3HOY B;  2F0W A;  4YWL A;  2FJ2 A;  4MTK A;  1S5D D;  3HP3 A;  2PW7 A;  1XNQ Q;  1L0Y B;  2EXZ A;  4R4O A;  4FDB A;  5FJ8 H;  1K0S A;  2PCF B;  4EQP A;  5IGD A;  4F8M A;  1XPU A;  3WDN A;  1XNR Q;  1EY4 A;  4JI4 Q;  3RZO B;  2VNU D;  2A68 C;  4ZAI A;  4DKA C;  1IL8 A;  4JI5 L;  2ES2 A;  2E5L Q;  3T53 B;  2AHO B;  2HCI A;  2XIW A;  4EQO A;  5GAD C;  1IKL A;  4BBR G;  5IYC G;  4LF8 Q;  1CT1 D;  4K0K L;  2K75 A;  3HGB A;  4PMC A;  2OTL A;  1I3Q B;  1GXD C;  3MXG A;  1EFW A;  1JB7 A;  1S5B D;  1SE2 A;  4EQN A;  3A5U A;  4IFD H;  2B2W C;  1NMF A;  1F77 A;  2N88 A;  3T56 B;  1XYI A;  3RLF A;  4A3J B;  2WB1 B;  5C3E B;  2WKC A;  1E1T A;  1JWM D;  3TEH B;  5IYD G;  4ODG A;  1ET6 A;  2A68 D;  2Z4H A;  2R93 B;  3U9S A;  3H6M A;  3NTI A;  1HNZ Q;  2ZXO A;  1CKM A;  2UXC Q;  1LLR D;  4R8I A;  2VL6 A;  4OWT B;  3S2D B;  3BG3 A;  2AQ2 B;  3K8A A;  1ENF A;  3D6W A;  2OF1 A;  4X3U A;  1RL2 A;  4L8J A;  2KCT A;  4X3K A;  1QG7 A;  1J6Q A;  1P8L A;  4CKC A;  4IOA A;  5LMU Q;  3DWP A;  4OO1 I;  3BVG A;  2Q2I A;  1VQP A;  3TS0 A;  4UP9 A;  2F0P A;  3PIO 3;  2IX0 A;  4JK1 C;  5CMD A;  4C3J H;  5JPM C;  5IWA Q;  5A2Q E;  3M9B A;  4DNR B;  2R92 B;  3HZX A;  3NQT A;  1EYA A;  2NVT B;  3T1H Q;  1BBW A;  4GOP A;  2KED A;  1PMR A;  4JBW A;  3D4R A;  4A3B G;  4KHP Q;  5GAG C;  2EYL A;  5H1S E;  4B3M L;  4Q0F A;  1EZ8 A;  1MIU A;  4K14 A;  4HID A;  1D2B A;  3CHB D;  4A3G G;  1JE5 A;  1LAC A;  1X3E A;  1SFO H;  4L5R C;  4NKL A;  4KN4 C;  4KHV A;  1EIY B;  1IW7 C;  4WOR A;  3T16 A;  4HJ5 A;  1CA5 A;  1LTI D;  2MUY A;  5KND A;  5I2X A;  4JI0 Q;  1GHJ A;  1YBY A;  1DGS A;  2D5D A;  1Q3L A;  5EGT A;  1J8I A;  1D8L A;  3FMC A;  4XQJ A;  2OQK A;  5GRO A;  1UE7 A;  3HKZ E;  3LX0 A;  3BS1 A;  1EOV A;  5JJI A;  1Y8O B;  2EYP A;  4A3K G;  3CCV A;  4R8N A;  1NE3 A;  2HDM A;  3CCE A;  3DWA A;  4A3E G;  1YNN D;  4A93 B;  1PFS A;  3FDT A;  4HTH A;  2N8N A;  2Q8R E;  1O78 A;  5CV6 A;  2RBM A;  1VCI A;  2HIV A;  1LM0 A;  2EJG C;  2PNH A;  4G57 A;  5K5P A;  1YJW A;  1Z7T A;  4GKK Q;  1SR3 A;  4LWC A;  4DV4 L;  4WJ3 M;  2UXB Q;  2AUK A;  2F0K A;  3S1N B;  2RQX A;  3FHW A;  5EPK A;  4APV A;  2KEN A;  3PF4 A;  4NB3 A;  1VMP A;  4JI3 L;  2B2Y A;  4BBR H;  5IYC H;  3HOX G;  1KAW A;  2L12 A;  5JEA G;  2PZW A;  2JA8 G;  2JA5 B;  1TS4 A;  1KLG D;  3X3N A;  3I4N G;  1HNX L;  1VQ5 A;  1TU2 B;  1SLJ A;  4OL7 A;  4DV2 Q;  1FNV A;  1GO3 E;  1N36 L;  1PYS B;  3U4V A;  4C3J B;  1RJT A;  4PG3 A;  3D8G A;  2EYO A;  3RLO A;  4ME3 A;  3I55 A;  1YI2 A;  1WJJ A;  2Z6K C;  2DNE A;  4C1N K;  3OMG A;  3S17 H;  1VQI A;  3GTO H;  2D62 A;  2N49 A;  2QCP X;  5FLX E;  5IYD H;  4LF8 L;  4YWK A;  2EY5 A;  3MZ5 A;  1MHW C;  3G6J B;  5M5W H;  3PIO A;  1B3Q A;  4DV1 L;  4GOP B;  5GAH C;  3HOV G;  1S5C D;  3KYH C;  2PMZ E;  4HIM A;  3EFX D;  2E2J H;  4LAA A;  2UUC L;  1WTP A;  5DM7 3;  3U4Z A;  4XQN A;  4OGQ C;  3JAM L;  1PH4 A;  2UUB L;  4GN3 B;  5JEA J;  1HNW L;  1HR0 Q;  1K73 C;  1J9O A;  4XQQ A;  1H9S A;  5M5Y H;  3OOC A;  2LSS A;  1PH5 A;  2I5M X;  4ZKB B;  5M3M B;  1V1Q A;  4ABN A;  4ZLT F;  1B2T A;  5CV4 A;  1AFP A;  2NVY H;  2F0E A;  4A3D G;  1D1K A;  2RHS B;  1WCM B;  1LT4 D;  4X64 L;  1I4R A;  4I7Z C;  2K4K A;  4NW2 A;  2OEO A;  1CKN A;  5C44 G;  2NN6 I;  3EN2 A;  4GN4 B;  4WJ4 A;  3CW2 C;  3K5L A;  3PO2 G;  2Z0S A;  4GN5 A;  1HUN A;  1FD7 D;  4DU9 A;  5BN4 A;  1YIT A;  1XJV A;  3EJI A;  4PV1 C;  2F03 A;  1JIC A;  2YTX A;  4A3B H;  2Q8T A;  3UI2 A;  1UE5 A;  1D5X C;  4P2C B;  4AIM A;  2BDO A;  4Q5V A;  3VDY A;  3SK8 A;  4J1M A;  3CKI B;  2D9U A;  4V0B A;  4B3R L;  5TSS A;  3VR2 A;  4A3G H;  4DV6 L;  1X3G A;  1K8A C;  2SDF A;  3K6O A;  4JI7 Q;  1X3F A;  4DXF A;  1YNJ C;  2QF7 A;  4HSP A;  2RSO A;  3DEO A;  3GTQ B;  1L0X B;  4LUV A;  2DY8 A;  1WD0 A;  1TWH B;  4AQY Q;  2EYH A;  1A2T A;  3CP0 A;  4KHP L;  3VR3 A;  1MSH A;  4HED A;  1N8R C;  2WAQ E;  4O1N A;  4BY7 G;  2KCC A;  3S24 A;  3AMU A;  2OTJ A;  2L4N A;  2V1C C;  1SE8 A;  4GNX A;  4A3K H;  1WTV A;  1I5F A;  1U4P A;  3CD6 A;  2CKZ B;  1Q8K A;  2EE1 A;  4A3E H;  3GTO B;  5DLQ E;  1EIG A;  5DNF A;  5IOD A;  5C4J B;  4HJ7 A;  3C2P A;  2KA7 A;  4JW0 A;  3CCJ A;  3M3Y B;  1JJC B;  4H02 A;  2MFI A;  4KV6 A;  3FPU B;  4G7H C;  2EOT A;  5AFW A;  4LF4 L;  5IT9 L;  2I07 B;  2F4V Q;  3H91 A;  1C8C A;  2QEX A;  4DR7 L;  2ALY B;  2YTV A;  3F2D A;  3T1Y Q;  1Y14 B;  2X6G A;  3HOX H;  4DXG A;  1VQH A;  3S14 H;  1PVO A;  5JEA H;  2JA8 H;  1H9S B;  1B4O A;  1PZI D;  3CQZ H;  4BBS B;  3I4N H;  2DGY A;  3QB3 A;  1WTR A;  1KIX A;  5J22 A;  1JWU D;  1C4Q A;  1IZ6 A;  1EQQ A;  3GTP H;  1DOL A;  3D3R A;  5FK9 C;  1CFM A;  1AN8 A;  2IHF A;  1X32 A;  4KK7 A;  1CKN B;  4CGY B;  2NVQ H;  2KUM A;  4DR4 Q;  3X3M A;  1E3P A;  1JOK A;  3VA7 A;  2WAQ B;  2DNC A;  3KLS A;  2OT2 A;  3B6Y A;  3CRL C;  3U9O A;  2EVB A;  1QB5 D;  1IXR A;  1V43 A;  3DM3 A;  3HOV H;  1FGU A;  2VQE Q;  4CBV A;  1BBX C;  1PTO D;  1IYJ B;  2K04 A;  4RCO A;  1WI5 A;  2KHS A;  2FIN B;  5LHY 1;  1ONL A;  5DM6 3;  1PRT B;  2XNA C;  1STN A;  4A3J G;  2G9D A;  4K2K A;  4B08 A;  3CCS A;  3P1H A;  2WB1 G;  5C3E G;  2RCF A;  4OX9 Q;  1GOZ A;  3URY A;  1K3B C;  3EQL C;  4M8A A;  2E2H H;  3MFG A;  3GP7 A;  2R93 G;  4A3D H;  3M4O H;  3NBH A;  2YU9 H;  3TP6 A;  3G71 A;  1XMQ L;  1U9R A;  3ITP A;  4IQZ A;  4POF A;  5C44 H;  3KBG A;  4DV5 L;  1SE3 A;  1HZ9 A;  2RSN A;  1KNE A;  3BZD B;  2WV6 D;  4EX5 A;  4A3E B;  2Q2T A;  1TWG B;  4KKU A;  1EY0 A;  4KI0 A;  4PZ7 A;  1JMC A;  1Z47 A;  4GNX B;  5IGB A;  3J81 j;  1Z6H A;  1HR0 L;  4DR1 L;  4HIK A;  2CCZ A;  2TSS A;  4POG A;  2EIF A;  2LFN A;  5E7N A;  1TWC B;  3NK9 A;  3OW2 A;  1VMC A;  3P20 A;  4C56 C;  5M5X B;  1CHQ D;  3U50 C;  4JI5 Q;  4LK1 C;  3I56 A;  2VUM B;  1G91 A;  3EIV A;  1R9T H;  1F2Z A;  1PXU A;  2GA4 B;  3GV6 A;  4KHZ A;  2K5V A;  3GTK H;  2R92 G;  4DV0 Q;  1ENC A;  4K0K Q;  3SR1 A;  1DM0 B;  3IFT A;  5E3F A;  3MVV A;  1L1O A;  5G3L F;  4JI1 L;  2R7D A;  1S40 A;  1G2T A;  1GM5 A;  3C1F A;  5IYB G;  2Z1C A;  3ERQ A;  3OWF A;  3I4L A;  4BY7 H;  1S3O A;  4N9P A;  1H9R A;  2UUA L;  1EY9 A;  2ICE C;  3G48 A;  5D3I B;  4HJ9 A;  2E75 C;  1BBU A;  4ZUJ A;  3OW7 A;  5AJ3 L;  5ELD A;  4RG1 A;  4Y7N H;  3QOJ A;  1XMO L;  2WKD A;  3I4M B;  1GUT A;  1AE3 A;  4NDX A;  1HA6 A;  2EXD A;  3DLL A;  2L5T A;  4DFA A;  1ASY A;  4RGN A;  3CCU A;  1VQN A;  5EKK A;  4ZYS A;  1V1P A;  2NB0 A;  3DHQ A;  3N52 A;  4LJZ C;  3ONA B;  5IGE A;  2LXK A;  3PUX A;  3A8J E;  4A93 G;  3W1G A;  1RTO A;  1QWY A;  1BQQ T;  3PV0 A;  2MO0 A;  2K28 A;  1ROD A;  1U4M A;  2QEJ C;  3ULJ A;  2RCN A;  3NBH B;  4PZ6 A;  4IO9 A;  4FF2 A;  1BDO A;  2K5D A;  5IT9 c;  5C44 B;  1KXL A;  1KTK A;  1U4L A;  3RZO H;  2B2U C;  2F4V L;  4UDU C;  1FYC A;  3IAY A;  2M9V A;  5JOB A;  5CC4 A;  1GJX A;  4X6A H;  2FMM A;  1MKH A;  4S3S A;  1C7Y A;  1NR2 A;  4IZ8 A;  1I50 B;  5I6W A;  1I3Q H;  1AP0 A;  2JA5 G;  2A8V A;  1YVC A;  1NSN S;  4FF4 A;  3RD4 A;  4DAP A;  2BCO A;  4B3M Q;  3AEV A;  1VQ7 A;  3WWV A;  4ZUI A;  1LT3 D;  2IWH A;  1K0R A;  1JWS D;  2UU9 L;  1S72 A;  4OEL B;  1SMX A;  2HQL A;  5E1F A;  3GTK B;  5D3D A;  4YCV A;  5LL6 S;  4A3J H;  3ICE A;  4HCS A;  5C3E H;  1TR5 A;  1VQO A;  2F0M A;  3TQY A;  4RH6 A;  1V1O A;  2R93 H;  1L1O B;  3J81 E;  1UE6 A;  4IUR A;  5IP7 G;  3GTM H;  3UE0 A;  3RR5 A;  1IBL L;  4BY7 B;  4A3I B;  5ELN A;  1KAB A;  2AQ3 B;  3M85 A;  5JJL A;  1PLF A;  2PI2 A;  3S2D H;  5EPJ A;  1P16 A;  1STA A;  4AYB B;  4Y7N B;  2C5C A;  2KCM A;  1IL2 A;  4U68 A;  1AZQ A;  3ND9 A;  2MP1 A;  4GOP C;  5M3M G;  4OWW B;  4CJ2 C;  2AUJ D;  1Q46 A;  4JI6 L;  2EJF C;  2RDF A;  2WB1 E;  2BA1 A;  2ZM6 L;  4YY3 L;  3UDX A;  2R3Z A;  1WCM G;  4CJ1 B;  3PO3 B;  4DK1 A;  2F0H A;  4F7X A;  1RIP A;  3NQI A;  1EYC A;  3BYT B;  1V1P B;  4UY8 C;  3H0G B;  2IPK D;  5K36 G;  2ASB A;  2R92 H;  4JI3 Q;  1BCP B;  3A74 A;  1S5F D;  3KJO A;  1QIL A;  2A19 A;  5CV5 A;  2PPB C;  2NVT H;  1EZ6 A;  1KDB A;  1GKH A;  3OYY A;  2F0T A;  1VQ4 A;  2JN4 A;  4Z9C B;  1D5Z C;  1F9R A;  1HNX Q;  3PF5 A;  3DWQ A;  2FFK B;  5IYB H;  1VQ6 A;  2QDB A;  1E2W A;  1N36 Q;  1STG A;  2K5W A;  1SNC A;  4KJN A;  5CR3 A;  3AQQ A;  3SK6 A;  3E5S A;  1HXY D;  1RKN A;  4OXP A;  1DOK A;  4QQB X;  1Q1E A;  3I8Z A;  2L9H A;  3UDF A;  1DON A;  4F87 A;  4DV0 L;  4CJ0 B;  3CRK C;  3TDQ A;  1QZH A;  4DV1 Q;  4GKJ L;  1PFN A;  1B9N A;  3H15 A;  2HHH L;  2ZXP A;  4FNF A;  3O13 A;  1PYW D;  1HA5 A;  2KEC A;  1QVC A;  2M2L A;  3EVQ A;  3NEN A;  1IBM L;  2UUC Q;  3HKS A;  3CCL A;  1H9M A;  2E2D C;  1F9P A;  2GN5 A;  1A3T A;  3HOZ G;  3JAM i;  1LT6 D;  1EY8 A;  2NZ1 D;  1PFB A;  2UUB Q;  3TP5 A;  2XN9 C;  4JV5 L;  1HNW Q;  3J7A F;  4A93 H;  1CZG A;  2B2Y C;  4F88 A;  2L15 A;  2NZH A;  3N6R A;  3PGZ A;  3CU7 A;  5EAY A;  1XTD A;  3GTM B;  3KBX A;  4ZK9 B;  4X64 Q;  3TZU A;  3CC7 A;  4X3S A;  3PSI A;  3A7L A;  2F0V A;  3NEM A;  3K57 A;  3S1N H;  1MGS A;  3AFQ A;  5KEE A;  3R3O A;  2R6G A;  1AZP A;  1A62 A;  1UE1 A;  1WTX A;  1I94 L;  4UP7 A;  2ZJQ A;  3HG9 A;  2VB2 X;  3R2T A;  2JA5 H;  2RF4 A;  4IPH A;  1HZC A;  2BA0 A;  3F2C A;  4BBS G;  3GTG B;  2B2T A;  5DAU A;  3IKJ A;  3VR6 A;  4A3M B;  1G51 A;  5COR A;  1OXU A;  4B3R Q;  3A56 A;  4DV6 Q;  4AH6 A;  3J80 E;  1A0I A;  1GD7 A;  5I6Y A;  5LMN L;  4L5Q A;  1VQB A;  2H1E A;  1I4Q A;  2WAQ G;  1EEI D;  1SNQ A;  3NTK A;  3PIP A;  1E1O A;  2GVB A;  4HJA A;  1SYE A;  1SNP A;  1WTH A;  5IP7 H;  4A3L G;  3FRP B;  3H3V C;  1JOR A;  4G7O C;  2YV5 A;  2F0G A;  1W6J A;  4ULL A;  2PZU A;  4JOI A;  2E8G A;  3K81 C;  3SGI A;  1IYV A;  3QIA A;  5NUC A;  3OPO A;  4BY1 B;  1EWH A;  1ZYR C;  2XTI A;  4KY7 A;  2YTY A;  1OXV A;  1LV9 A;  5COY A;  5M3M H;  3KLR A;  1DCZ A;  1I4G A;  1HQR D;  4DF7 A;  3F1Z A;  4NPS A;  5E4W C;  1WCM H;  4QF4 A;  1IBK Q;  2JEB I;  4LF4 Q;  3K5O A;  2IW3 A;  4LF9 L;  1QVG A;  1KNA A;  1PRT C;  4DR7 Q;  5K36 H;  2K33 A;  3FKI B;  1X55 A;  3PUW A;  4J6H A;  5L37 A;  5A2Q L;  4QIW E;  1QNU A;  4K5W A;  3W2D A;  4C1N I;  1D5M C;  1JB3 A;  1UAP A;  2D0P A;  1IW7 D;  3BJU A;  4HJ8 A;  3I90 A;  5IOC A;  2JEA I;  1N32 Q;  1Y1V B;  3VR5 A;  3WOE A;  4LF6 Q;  3CAM A;  4KD3 A;  4UP8 A;  2VUM G;  5CV9 A;  2QKI C;  2Z9H A;  5I9P A;  3BZC A;  1ZXT A;  4GNX C;  4IPD A;  3FVQ A;  3GTQ H;  2ZTC A;  3KF6 A;  3SHL A;  2K32 A;  3S9W A;  4ZKC B;  1Q82 C;  1NCV A;  4A3F G;  1VF5 C;  4DNT B;  1TWH H;  1IHZ A;  3MHB A;  1CK1 A;  4NXN L;  1EU4 A;  3AFP A;  3Q0A A;  3MTS A;  3LGJ A;  2CHB D;  1B9M A;  2NZO A;  3J81 c;  3GTJ H;  3HOZ H;  3ER0 A;  4DR5 L;  4RGO S;  4KD4 A;  1NAP A;  4P75 A;  1STY A;  2F0U A;  1HRJ A;  4LUO A;  4GLA C;  1DJR D;  2AWO A;  2NYZ D;  3ERO A;  2O5J C;  4A75 A;  1NY4 A;  1RHP A;  3I4M G;  5C4J H;  2F52 A;  4DNI A;  1EEF D;  3Q22 A;  3BDL A;  3M3Y H;  1SMY C;  4IAL A;  3KF8 A;  4JI8 L;  1PH9 A;  4M1U B;  4DAV A;  1PH7 A;  1XMQ Q;  1O7Y A;  4DV5 Q;  4IUT A;  1XTC D;  4QIW B;  1EUJ A;  3BVM A;  4IPC A;  2JYO A;  1ENA A;  4DR1 Q;  3MWY W;  1IKM A;  4LFC L;  3CPW A;  1H95 A;  3E9I A;  3HRZ C;  2K03 A;  1WOC A;  5J39 A;  3UDI A;  4BBS H;  1PFM A;  1DZ1 A;  3IRB A;  4XDX A;  1XPR A;  3S1Q B;  4DR2 L;  1KL9 A;  2IX3 A;  3UE1 A;  3H3V H;  1K83 B;  1QJO A;  3PCO B;  4JBJ A;  1VS0 A;  3TRZ A;  4MTN A;  3DMU A;  4HSV A;  4FP5 D;  1SMY D;  3TN2 A;  1CUK A;  4C3H B;  1V9P A;  1STE A;  2RDH A;  2XVS A;  5C0X G;  4JI1 Q;  5C4H A;  2Q8I B;  2RDG A;  3EBE A;  1KDA A;  4A76 A;  3R93 A;  1W3S A;  1VDZ A;  4H13 C;  3K5M A;  4A3L H;  5FLX L;  5FO8 B;  1N33 L;  2D0O A;  3M4P A;  4GLV B;  2UUA Q;  2QW7 A;  2E2I B;  3E0J A;  3GDE A;  4YCW A;  3SE0 A;  1ESR A;  2A6E C;  4QUC A;  4TSS A;  5AJ3 Q;  2BH2 A;  3A0J A;  2MPM A;  1XMO Q;  4DN4 M;  2JA6 B;  1N9W A;  4XT3 B;  1VQF A;  3KF6 B;  3I91 A;  1EY5 A;  5C4X B;  1FL0 A;  2C9O A;  4NMZ A;  3TME A;  4PMB A;  1TS2 A;  3GTJ B;  4G7Z C;  4A3I G;  3HOZ B;  4YCU A;  4I7A A;  2B2V A;  2GVA A;  2JXM B;  4AYB G;  4HAE A;  1TWG H;  5C0X J;  1JQY D;  2X69 A;  4IJH A;  1Y8P B;  2K5N A;  1L1O C;  1VQL A;  1G29 1;  4B3T Q;  4A3C G;  3HOU B;  5EKL A;  1TWF B;  1YNJ D;  3Q8D A;  4EGV A;  1E22 A;  1TWC H;  3SVM A;  4LMQ D;  1VF7 A;  2WP8 J;  3KF8 B;  4K8J A;  1IBK L;  5C6A A;  3PO3 G;  5M5X H;  2EYM A;  5J1Z A;  3R8B A;  2VUM H;  4JYA L;  1SNO A;  4HIO A;  1PDQ A;  4RWS C;  1O7L A;  3H0G G;  4HCE A;  1FNW A;  2I0Q A;  4CHT B;  4NXM L;  5IE8 A;  1A3U A;  1LTG D;  4X65 L;  3MAQ A;  1HR0 W;  2MJ8 A;  1EQV A;  4MHE A;  4A3F H;  4K5X A;  1B44 D;  2KCN A;  3NEL A;  3CCQ A;  2HD3 A;  3C1E A;  4N8F A;  4RKL A;  2A69 C;  1JT8 A;  2K14 A;  1N32 L;  3VA5 A;  2UU9 Q;  4JPB W;  2CW0 C;  4LF6 L;  2Z6K A;  5KNB A;  2JA7 B;  5FO7 B;  5FLM G;  2YYZ A;  4JVZ A;  4R4I A;  2F0L A;  2EY6 A;  2P5Z X;  1BCP C;  1X65 A;  4DV7 L;  1MJE A;  4O2D A;  1GUO A;  1D7Q A;  2SNM A;  3I4M H;  2K1B A;  4YIJ A;  3DUZ A;  3T51 B;  2NVX B;  1V8Q A;  1IBL Q;  1M90 C;  3CCR A;  1VQE A;  1G6Z A;  2VQF L;  1PTO F;  1RD9 D;  1E7Z A;  2HUG A;  1M1K C;  1C0A A;  1TT2 A;  2JE6 I;  3GD7 A;  3A8I E;  2L11 A;  3MXU A;  2A69 D;  5M3F B;  1JR0 D;  3LWE A;  3OIP A;  3M7N A;  2CW0 D;  1R4Q B;  4IUV A;  3L3O C;  1M4V A;  4TVA B;  1SNM A;  4JI6 Q;  5EBD A;  2CWP A;  2DN8 A;  1BCP D;  4FXG C;  2ZM6 Q;  2K05 A;  4YY3 Q;  3ZYY X;  5ELO A;  4IUU A;  3G6E A;  3PUZ A;  1SND A;  2ENB A;  1OO9 B;  2B29 A;  4XIG S;  4CKE A;  1BNZ A;  1GUG A;  5F2D A;  4DR6 L;  2KQ3 A;  1B53 A;  1Q90 A;  3ZJY C;  4DUZ L;  4DK6 C;  1EFI D;  5C0X H;  1BXT A;  2EYF A;  5GQO A;  1I50 H;  1CHP D;  2D2C C;  1A2U A;  3DM1 A;  4FF1 A;  1TXY A;  5ELB A;  1X3P A;  1OXS C;  1W2B A;  4P73 A;  1U0L A;  3DXJ C;  3A5Z B;  3K58 A;  2KEE A;  4ILW A;  5HY6 A;  4A3M G;  1EIH A;  1JE4 A;  1QOH A;  2F3I A;  4PMW A;  1TKW B;  1QE6 A;  1CQF A;  4O42 A;  4OIK A;  5KRU A;  3NP8 A;  1ILP A;  2I46 A;  1II3 A;  4LFA Q;  1Q7Y C;  3D0F A;  5JVH 3;  1J5E Q;  4HR7 B;  4A3F B;  4GKJ Q;  1PH1 A;  3HS0 C;  2HHH Q;  3P75 A;  4MNO A;  4DR3 L;  2Y0S G;  3K5N A;  4DAM A;  4IUQ A;  2A5H A;  4MZ9 A;  5FLX c;  1PH8 A;  1KDC A;  4CDE C;  2XSC A;  5CGK A;  1IBM Q;  4A3I H;  2JQO A;  3NWS A;  2DJG C;  4OEM B;  3RNU A;  4DV3 L;  1HFG A;  4RHS A;  3MA2 B;  1WD1 A;  5CBE E;  2B63 B;  3CC2 A;  4JV5 Q;  3KOJ A;  4BY1 G;  4FF3 A;  3I4O A;  4H7B A;  4R4Q A;  1Q81 C;  3KDF A;  3CXC A;  2AQ1 B;  3I7F A;  4A3C H;  4FXD A;  3AYH B;  1BOS A;  2EY1 A;  3GQB A;  3QWN A;  4JCV E;  5C5L A;  3TS2 A;  3K80 C;  1UEB A;  3PO3 H;  4FXK C;  1EIF A;  2XRQ D;  2J7Z A;  2K5H A;  2F0I A;  4BA1 I;  3H0G H;  2O4X A;  2VS1 A;  3FKI G;  1I94 Q;  3F8T A;  5BR8 L;  2QDL A;  4B3T L;  2O5I C;  4AYB E;  4K8I A;  2N55 A;  1ML0 D;  1Y1V G;  2MO1 A;  2L1B A;  4Y52 H;  3STB C;  4KTA A;  1T9H A;  5LMN Q;  4IFD I;  5FLM H;  4B3S L;  2ATW A;  3SDZ A;  4RFB A;  2WAC A;  1LAB A;  2A74 C;  3K7U C;  3G4S A;  4ALP A;  3E9H A;  1EU3 A;  1JCK B;  4X66 L;  2BH8 A;  3FEW X;  4KJO A;  3MEF A;  4RGT A;  1X54 A;  1DOM A;  2WIN B;  1SRU A;  4K2L A;  5M9O A;  2Z8L A;  5IY0 A;  2ZTD A;  1OTC A;  3S15 B;  2F0J A;  2KHI A;  1VQC A;  2VXW A;  5E4X A;  2PQA A;  4LF7 L;  4UAI A;  2ZT9 C;  4OIJ A;  4QB4 A;  1RCV D;  2I5H A;  3RLN A;  4A4I A;  1DXM A;  4HN7 A;  1K8G A;  4IUN A;  4MN3 A;  3RZD B;  4LF9 Q;  2JA9 A;  2HCC A;  4KKT A;  2EDG A;  1JC7 A;  1C9O A;  4BXX G;  3TZD A;  1O7I A;  2ICI A;  3E6Z X;  2IT1 A;  1SEB D;  3KDF B;  1B1Z A;  1ESF A;  5C4Z A;  2B8G A;  2K6A A;  1JOO A;  3GTG H;  1C48 A;  3PIP 3;  4A3M H;  1F2M A;  4LF5 Q;  1D1I A;  4JOI C;  5HUR A;  4XT1 B;  3IL8 A;  1EQR A;  1JJ2 A;  2AKW B;  3M4Y A;  4C3H G;  2EJM A;  2MQH A;  1PTO B;  3S1M B;  1QZG A;  2B3G A;  3OMC A;  4MIU A;  5IGF A;  1I6V C;  1UNS A;  2KOL A;  1PV4 A;  2IY5 B;  3MFY A;  4NXN Q;  2PI2 E;  4DAY A;  1LT5 D;  5IP9 G;  1WTQ A;  4LFB L;  1QCB D;  1CSP A;  3GO5 A;  3PQI A;  1OXX K;  4KN7 C;  4RMF A;  3J81 L;  4DR5 Q;  3BU2 A;  4KY5 A;  1MSG A;  5D65 A;  1SYB A;  4DGZ A;  4LFA L;  1O80 A;  2F0O A;  1HTP A;  5BN3 A;  1NMG A;  4BY1 H;  2JA6 G;  1S5E D;  1HTL D;  3S1R B;  1J5E L;  1TS5 A;  1Q8I A;  1VQK A;  2XWJ B;  4KLK A;  4TQU S;  5C4X G;  3OHX C;  1VQG A;  1PH3 A;  4JI8 Q;  3TP8 A;  4JBM A;  3AB9 A;  2Y0S E;  3OTO L;  3GTL H;  1FNU A;  1BUV T;  1KC8 C;  2VZA A;  2XGT A;  3V2T A;  3M7G A;  3D6C A;  1Q1B A;  3D4D A;  3FKI H;  4LFC Q;  5EPL A;  3QG1 A;  2CQO A;  2F4I A;  5I9O A;  2PQA B;  3KUP A;  1I6H H;  3HOU G;  3A54 A;  5CYU A;  4DR2 Q;  1CKO A;  1I4P A;  1STB A;  1Y69 U;  1E24 A;  4ME5 A;  1Y1V H;  2B2U A;  3EA6 A;  3V05 A;  1B8A A;  5DEH A;  1F9S A;  4C3I B;  3Q23 A;  4DK0 A;  1X56 A;  4DUY L;  2E74 C;  4BA2 I;  2B8F A;  5T1G A;  4RCN A;  4OO1 G;  1HH2 P;  5CV7 A;  3UDG A;  2R7Z B;  1E2V A;  2PO4 A;  1HPC A;  1N33 Q;  1M8A A;  2HQE A;  1E2Z A;  1U5K A;  4WJW A;  2QA4 A;  1CM9 A;  2JA7 G;  5FOB B;  4E6I A;  1RF2 D;  3Q6S A;  5I2Y A;  2OXP A;  4DA2 A;  4EVO A;  1FGB D;  1Z9F A;  1ZKO A;  4X62 L;  1WVL A;  4JBK A;  2Y0S B;  1VQ8 A;  2V4D A;  1VQA A;  2MNA A;  3T13 A;  3NUC A;  4BWG B;  1Y1W B;  4X3T A;  1TWA B;  3WOF A;  1LO5 D;  4DAY B;  5JJZ A;  3NE5 B;  3PUY A;  3J7Z C;  1AH9 A;  5IGC A;  2J0T D;  3H3V I;  1NJI C;  3MXN A;  1F2Y A;  3TBI B;  3HFZ B;  3QJY A;  1ICW A;  5M3F G;  4BXX H;  1BR9 A;  3RN5 A;  2R7F A;  2R61 A;  1XPO A;  3S16 H;  3MC0 B;  1G6P A;  1YNN C;  1CA6 A;  4K6L A;  5JAV A;  1A8V A;  1I4X A;  3CMA A;  3GTL B;  2ZJP A;  3S1Q H;  4RKB A;  2OWO A;  4OON A;  4TRD A;  1K83 H;  1YNX A;  4JYA Q;  1SYC A;  1N34 L;  4RGM A;  2MGS A;  4NXM Q;  4DK3 C;  4C3H H;  1SE4 A;  4N9T A;  3ULL A;  4X65 Q;  4B9X A;  1MBY A;  2DJF C;  2WII B;  3RUZ A;  4L5T A;  5D14 A;  3W3A A;  3J80 L;  5JJK A;  3J7A 5;  2ZTE A;  2WFW A;  3BYY B;  4PQX A;  2JSO A;  4R4T A;  4O0A A;  1I6H B;  1F2L A;  1SN8 A;  4R4C A;  1G8Z D;  5IP9 H;  4V19 0;  4JI2 L;  5EKI A;  1ZYR D;  4ZCK A;  1VQD A;  3I70 A;  4G4K A;  4QUF A;  2B2V C;  2QIL A;  1LYL A;  1PZJ D;  4LF5 L;  2E2I H;  3S2H H;  2OCE A;  1FJG L;  4DV7 Q;  1LUZ A;  5KYL A;  3A55 A;  1TY2 A;  1CQV A;  2EY2 A;  2JA6 H;  3AU7 A;  1XXG A;  1PA6 A;  1BKB A;  1PRT D;  3JAM E;  5C4X H;  1W6K A;  1PRT F;  4CKB A;  1EL0 A;  3U58 A;  2FHT A;  2SEB D;  4FO2 A;  2F0F A;  4OWX B;  2B2W A;  2Q2H A;  3CPF A;  1DYQ A;  1AW7 A;  1K9M C;  2VQF Q;  1AEX A;  3MXP A;  1ILQ A;  1SDF A;  3BDC A;  3QOL A;  1UEA B;  2B63 G;  1B7Y B;  2OQ0 A;  3H94 A;  1XNQ L;  1ET9 A;  3PO2 H;  3E3X A;  5A35 A;  3I3C A;  4XTC S;  1HFN A;  3HOU H;  2M00 A;  1TWF H;  1GUN A;  1SJE D;  1XNR L;  3SK5 A;  5LL6 X;  4JI4 L;  4R1J A;  4L63 B;  2CVR A;  3HOW G;  1WTO A;  2E5L L;  3F2U A;  4DR6 Q;  1K3R A;  3RN2 A;  1EYD A;  4DUZ Q;  4LNQ A;  2FMC A;  2H4O A;  3HKZ B;  1RDP D;  3MXN B;  5T1I A;  3CME A;  4OO1 H;  1BVS A;  1HUM A;  3P7J A;  3VR4 A;  3S16 B;  2EQS A;  3FPP A;  1EQT A;  4UPA A;  4TKO B;  4XYO A;  1QUQ A;  2NN6 G;  4RA8 A;  1A15 A;  4LW1 A;  2VY3 A;  2EZV A;  4P74 A;  1SFO B;  5FKA C;  4OHJ A;  4GLX A;  4I65 A;  5J3B A;  1WFQ A;  2JA7 H;  2HDL A;  3PUV A;  2A73 B;  5CBA E;  1I4H A;  1BO0 A;  1QVF A;  5FO9 B;  1O7Z A;  4DR3 Q;  1KQS A;  3BZK A;  3KJP A;  1UUP A;  4DPG A;  1HNZ L;  2PNR C;  2NVX H;  2UXC L;  1PHJ A;  1LTB D;  2IHE A;  2TMP A;  1L2F A;  3S2H B;  1IYU A;  4DV3 Q;  1K8O A;  1A6X A;  1KD1 C;  4J8Q A;  2BE5 C;  3TRE A;  3D31 A;  4LUZ A;  2L55 A;  2F0S A;  4K6D A;  5M3F H;  3NHH A;  5KYI A;  5HGQ A;  5IT9 E;  5LMU L;  2AMC B;  1KRT A;  5C0X I;  3K0X A;  3CC4 A;  5ELC A;  2IL8 A;  4QL5 A;  1EY7 A;  5IWA L;  3L7Z C;  1SBB B;  2PMZ B;  4BBR B;  3RMH A;  1CSQ A;  4P72 A;  4XXE A;  3T1H L;  2KBN A;  3VYS A;  2Z6B A;  2BDN A;  2CWA A;  1VQ9 A;  1GHK A;  5BR8 Q;  1YIJ A;  5BN5 A;  2A6E D;  2BE5 D;  2IX1 A;  1A3V A;  3OSO A;  2SOB A;  5EJW A;  1YEZ A;  3BDO A;  3QR8 A;  1A63 A;  4KMU C;  1SJH D;  4PZ8 A;  4P71 A;  3S17 B;  2EYJ A;  4B3S Q;  2ID0 A;  3LWU A;  4XYQ A;  3W1B A;  2FXQ A;  2QGQ A;  5M5W B;  4IUP A;  4JG2 A;  3J80 c;  5JPN C;  1LTL A;  3T4A C;  1Y8N B;  1E0B A;  4ZQ3 A;  4JI0 L;  2KHJ A;  1D6E C;  2E2J B;  3TSS A;  1GUS A;  3IFD A;  3CF5 A;  1QUQ B;  4X66 Q;  1L0W A;  1KAA A;  1YHA A;  2PZT A;  3FP9 A;  2PYK A;  1EOT A;  1HJP A;  1PYB A;  1CZW A;  2UXD Q;  2B63 H;  5M5Y B;  3SXH A;  1PTO C;  3HOY G;  4RHR A;  2NUC A;  3C46 A;  4L6T B;  2NVY B;  4LF7 Q;  3I72 A;  1JOQ A;  1SRO A;  4FYD A;  4GKK L;  1VQJ A;  1KLU D;  1TQO A;  4H44 C;  3KFU A;  1MD2 D;  2UXB L;  4YHH Q;  3HOW H;  1TY0 A;  1UWV A;  4UHV A;  1YHB A;  4IN3 A;  5C3X A;  2K7V A;  4N8X 1;  4WRD A;  1EYG A;  4A3B B;  2JP1 A;  2CQA A;  3M4Q A;  1X3Q A;  4CDD C;  5ELE A;  4ZRZ A;  4ID6 A;  1B70 B;  4KY6 A;  3A7A B;  2NN6 H;  4DV2 L;  1BCP F;  1JJG A;  1R4P B;  4A3G B;  1WTW A;  3VYR A;  2F0Q A;  3OWE B;  4C3I G;  2J4X A;  4C2M H;  1PZK D;  2K5Q A;  1HQM C;  1RTN A;  3J7Y W;  5EQ0 A;  2K01 A;  2R7Z G;  3MEH A;  1YJN A;  1H9J A;  2G5D A;  4LFB Q;  2LXJ A;  2NBF A;  2RA4 A;  2ZJR A;  4HMI A;  3J81 i;  5IGG A;  3JAM c;  2KVM A;  2PQE A;  2MHV A; 
#chains in the Genus database with same CATH homology
 4A3K B;  1BF4 A;  3OIQ A;  1GUW A;  1NUC A;  4B9W A;  2B39 A;  4HMJ A;  3NPP A;  3I73 A;  1T5E A;  1G2S A;  2F0N A;  4QMG A;  3K0Y A;  1XWE A;  3C3L A;  5C3W A;  2LKV A;  2RKS A;  3KLS X;  5HGT A;  3KK7 A;  3HEJ A;  4GZY C;  3NWT A;  3HOX B;  1T5X D;  3S14 B;  2JA8 B;  5G3L D;  3QO2 A;  4BS9 A;  2NTT A;  3CQZ B;  2EPB A;  5EBC A;  5KNC A;  3I4N B;  2NTS A;  1TII D;  2BOS A;  2LS0 1;  4QCL A;  3GTP B;  3H09 A;  1B50 A;  2KJX A;  1OXT A;  3HOW B;  2NVQ B;  4U67 3;  1HHV A;  3VYU A;  3BVZ A;  3NSW A;  2Z4I A;  3GV3 A;  2A6H C;  3SEB A;  3TP7 A;  1QNK A;  5KIX A;  1PTO H;  3G7L A;  2F1M A;  4R9W A;  2LY7 A;  2RVL A;  3HOV B;  2AWN A;  1SYF A;  2F0D A;  1F9Q A;  1SAP A;  2E76 C;  1MI2 A;  2PW5 A;  4IFD G;  1SYD A;  2XWB B;  2G9H D;  1TS3 A;  3VYT A;  4PNY A;  5ISR A;  4C2M B;  4KKS A;  2E2H B;  3LNN A;  4A3D B;  2XRS D;  3M4O B;  2YU9 B;  2A6H D;  2L0C A;  3J7A V;  3PO2 B;  1K8M A;  1Q12 A;  2SNS A;  2NWG A;  1EWC A;  1STH A;  2F3V A;  1DD2 A;  5C5M A;  3DEP A;  1LTS D;  1TVX A;  4IFD J;  1U4R A;  1S4Z A;  2ZXR A;  2B2T C;  3Q24 A;  3ND8 A;  5I4D A;  1R9T B;  1EY6 A;  4C3J G;  1HCZ A;  1SSO A;  3V96 A;  1LTR D;  3K7A B;  1SXT A;  1SYG A;  1B3A A;  2IJ0 A;  4FVM A;  4K5V A;  5CV8 A;  5KGU A;  1CI3 M;  3NBI A;  3L9A X;  2X6L A;  5JVG 3;  3K59 A;  4NP5 A;  3NXW A;  3A8K E;  1FR3 A;  3NTH A;  4RAU C;  3SK4 A;  5IIF A;  2F3W A;  4WFN 3;  1CTM A;  3D4W A;  2O2L D;  1H9K A;  1LTA D;  1NR4 A;  1XX8 A;  4H0L C;  2DY7 A;  3R2I A;  2LMC B;  2VB3 X;  3PMF A;  5ELF A;  1ZEQ X;  1LTT D;  3HOY B;  2F0W A;  2FJ2 A;  1S5D D;  3HP3 A;  2PW7 A;  1L0Y B;  2EXZ A;  2PCF B;  4EQP A;  5IGD A;  4F8M A;  3WDN A;  1EY4 A;  3RZO B;  2VNU D;  2A68 C;  4ZAI A;  1IL8 A;  3T53 B;  2HCI A;  2XIW A;  4EQO A;  1IKL A;  1CT1 D;  3HGB A;  4PMC A;  1I3Q B;  1GXD C;  3MXG A;  1S5B D;  1SE2 A;  4EQN A;  4IFD H;  2B2W C;  1F77 A;  2N88 A;  3T56 B;  1XYI A;  3RLF A;  4A3J B;  2WB1 B;  5C3E B;  2WKC A;  1JWM D;  4ODG A;  1ET6 A;  2A68 D;  2Z4H A;  2R93 B;  3U9S A;  3H6M A;  3NTI A;  2ZXO A;  1LLR D;  4R8I A;  3S2D B;  3BG3 A;  2AQ2 B;  1ENF A;  3D6W A;  2OF1 A;  4X3U A;  4L8J A;  4X3K A;  1QG7 A;  4CKC A;  3DWP A;  4OO1 I;  3BVG A;  2F0P A;  3PIO 3;  2IX0 A;  4JK1 C;  5CMD A;  5JPM C;  5A2Q E;  4DNR B;  2R92 B;  3HZX A;  3NQT A;  1EYA A;  2NVT B;  2KED A;  1PMR A;  4JBW A;  3D4R A;  2EYL A;  4Q0F A;  1EZ8 A;  4K14 A;  1D2B A;  3CHB D;  1LAC A;  4NKL A;  4KN4 C;  4KHV A;  1IW7 C;  4WOR A;  3T16 A;  1CA5 A;  1LTI D;  2MUY A;  5KND A;  5I2X A;  1GHJ A;  2D5D A;  1Q3L A;  5EGT A;  1J8I A;  3FMC A;  4XQJ A;  3LX0 A;  3BS1 A;  1Y8O B;  2EYP A;  4R8N A;  2HDM A;  3DWA A;  1YNN D;  4A93 B;  3FDT A;  4HTH A;  2Q8R E;  1O78 A;  5CV6 A;  2RBM A;  1VCI A;  2EJG C;  4G57 A;  5K5P A;  1Z7T A;  2AUK A;  2F0K A;  3S1N B;  2RQX A;  5EPK A;  1VMP A;  2B2Y A;  2L12 A;  5JEA G;  2PZW A;  2JA5 B;  1TS4 A;  1KLG D;  3X3N A;  1TU2 B;  4OL7 A;  1FNV A;  4C3J B;  1RJT A;  3D8G A;  2EYO A;  2DNE A;  4C1N K;  3OMG A;  2D62 A;  2QCP X;  5FLX E;  2EY5 A;  3MZ5 A;  3G6J B;  1S5C D;  3EFX D;  4LAA A;  1WTP A;  5DM7 3;  4XQN A;  4OGQ C;  3JAM L;  5JEA J;  1J9O A;  4XQQ A;  1H9S A;  3OOC A;  4ZKB B;  5M3M B;  4ABN A;  4ZLT F;  1B2T A;  5CV4 A;  1AFP A;  2F0E A;  1D1K A;  1WCM B;  1LT4 D;  1I4R A;  4I7Z C;  4NW2 A;  2OEO A;  2NN6 I;  3K5L A;  1HUN A;  1FD7 D;  4DU9 A;  5BN4 A;  3EJI A;  4PV1 C;  2F03 A;  1JIC A;  2Q8T A;  3UI2 A;  1D5X C;  4P2C B;  2BDO A;  4Q5V A;  3SK8 A;  4J1M A;  3CKI B;  2D9U A;  4V0B A;  5TSS A;  3VR2 A;  2SDF A;  3K6O A;  4DXF A;  1YNJ C;  2QF7 A;  4HSP A;  2RSO A;  3DEO A;  3GTQ B;  1L0X B;  2DY8 A;  1WD0 A;  1TWH B;  2EYH A;  1A2T A;  3VR3 A;  1MSH A;  4HED A;  4O1N A;  2KCC A;  3AMU A;  2L4N A;  1WTV A;  1U4P A;  2EE1 A;  3GTO B;  1EIG A;  5DNF A;  5IOD A;  5C4J B;  3C2P A;  2KA7 A;  3M3Y B;  4KV6 A;  3FPU B;  4G7H C;  2EOT A;  5AFW A;  5IT9 L;  2I07 B;  3H91 A;  1C8C A;  2X6G A;  4DXG A;  5JEA H;  1H9S B;  1B4O A;  1PZI D;  4BBS B;  3QB3 A;  1WTR A;  5J22 A;  1JWU D;  1C4Q A;  1DOL A;  3D3R A;  5FK9 C;  1CFM A;  1AN8 A;  1X32 A;  4KK7 A;  4CGY B;  2KUM A;  3X3M A;  1JOK A;  3VA7 A;  2WAQ B;  2DNC A;  3KLS A;  2OT2 A;  3CRL C;  3U9O A;  2EVB A;  1QB5 D;  1V43 A;  4CBV A;  1BBX C;  1PTO D;  2K04 A;  4RCO A;  2KHS A;  2FIN B;  5LHY 1;  1ONL A;  5DM6 3;  1PRT B;  2XNA C;  1STN A;  2G9D A;  4K2K A;  4B08 A;  3P1H A;  1GOZ A;  3URY A;  3EQL C;  4M8A A;  3MFG A;  3GP7 A;  3NBH A;  3TP6 A;  1U9R A;  3ITP A;  4IQZ A;  3KBG A;  1SE3 A;  2RSN A;  1KNE A;  3BZD B;  2WV6 D;  4A3E B;  1TWG B;  4KKU A;  1EY0 A;  4KI0 A;  1Z47 A;  5IGB A;  1Z6H A;  2TSS A;  2LFN A;  1TWC B;  3NK9 A;  1VMC A;  3P20 A;  4C56 C;  5M5X B;  1CHQ D;  4LK1 C;  2VUM B;  1G91 A;  1F2Z A;  1PXU A;  2GA4 B;  3GV6 A;  4KHZ A;  1ENC A;  3SR1 A;  1DM0 B;  3IFT A;  5E3F A;  3MVV A;  5G3L F;  1G2T A;  3C1F A;  2Z1C A;  3ERQ A;  3OWF A;  3I4L A;  4N9P A;  1H9R A;  1EY9 A;  2ICE C;  5D3I B;  2E75 C;  4ZUJ A;  3OW7 A;  5ELD A;  3QOJ A;  2WKD A;  3I4M B;  1GUT A;  4NDX A;  1HA6 A;  2L5T A;  4DFA A;  4RGN A;  5EKK A;  4ZYS A;  1V1P A;  2NB0 A;  3DHQ A;  3N52 A;  4LJZ C;  3ONA B;  5IGE A;  3PUX A;  3A8J E;  1RTO A;  1QWY A;  1BQQ T;  3PV0 A;  2K28 A;  1ROD A;  1U4M A;  2QEJ C;  4FF2 A;  1BDO A;  2K5D A;  5C44 B;  1KTK A;  1U4L A;  2B2U C;  4UDU C;  1FYC A;  3IAY A;  2M9V A;  5JOB A;  5CC4 A;  1GJX A;  2FMM A;  4S3S A;  1NR2 A;  4IZ8 A;  1I50 B;  5I6W A;  1AP0 A;  1NSN S;  4FF4 A;  3RD4 A;  4DAP A;  2BCO A;  4ZUI A;  1LT3 D;  2IWH A;  1JWS D;  5E1F A;  3GTK B;  5D3D A;  5LL6 S;  4HCS A;  1TR5 A;  2F0M A;  4RH6 A;  1V1O A;  3J81 E;  4IUR A;  4BY7 B;  4A3I B;  1KAB A;  2AQ3 B;  3M85 A;  1PLF A;  5EPJ A;  4AYB B;  1STA A;  4Y7N B;  2C5C A;  4U68 A;  1AZQ A;  3ND9 A;  2MP1 A;  4CJ2 C;  2AUJ D;  2EJF C;  2RDF A;  2BA1 A;  2R3Z A;  4CJ1 B;  3PO3 B;  4DK1 A;  2F0H A;  4F7X A;  3NQI A;  1EYC A;  3BYT B;  1V1P B;  3H0G B;  2IPK D;  5K36 G;  1BCP B;  1S5F D;  1QIL A;  5CV5 A;  2PPB C;  1EZ6 A;  1KDB A;  2F0T A;  4Z9C B;  1D5Z C;  1F9R A;  3DWQ A;  2FFK B;  2QDB A;  1E2W A;  1STG A;  2K5W A;  1SNC A;  4KJN A;  5CR3 A;  3SK6 A;  3E5S A;  1HXY D;  1RKN A;  1DOK A;  1Q1E A;  3I8Z A;  2L9H A;  1DON A;  4F87 A;  4CJ0 B;  3CRK C;  3TDQ A;  1PFN A;  1B9N A;  2ZXP A;  3O13 A;  4FNF A;  1PYW D;  1HA5 A;  2KEC A;  2M2L A;  3EVQ A;  1H9M A;  2E2D C;  1F9P A;  1A3T A;  1LT6 D;  1EY8 A;  2NZ1 D;  1PFB A;  3TP5 A;  2XN9 C;  3J7A F;  1CZG A;  2B2Y C;  4F88 A;  3N6R A;  3CU7 A;  3GTM B;  4ZK9 B;  3KBX A;  3TZU A;  4X3S A;  3A7L A;  2F0V A;  3K57 A;  1MGS A;  5KEE A;  3R3O A;  2R6G A;  1AZP A;  1WTX A;  3HG9 A;  2VB2 X;  3R2T A;  2BA0 A;  3GTG B;  2B2T A;  5DAU A;  3IKJ A;  3VR6 A;  4A3M B;  5COR A;  1OXU A;  3A56 A;  3J80 E;  5I6Y A;  2H1E A;  1I4Q A;  1EEI D;  1SNQ A;  3NTK A;  1SYE A;  1SNP A;  3FRP B;  3H3V C;  1JOR A;  4G7O C;  2F0G A;  1W6J A;  4ULL A;  2PZU A;  1IYV A;  3QIA A;  5NUC A;  3OPO A;  4BY1 B;  1EWH A;  1ZYR C;  4KY7 A;  1OXV A;  1LV9 A;  5COY A;  3KLR A;  1DCZ A;  1I4G A;  1HQR D;  4DF7 A;  5E4W C;  4QF4 A;  2JEB I;  3K5O A;  2IW3 A;  1KNA A;  1PRT C;  5K36 H;  2K33 A;  3FKI B;  3PUW A;  4J6H A;  5A2Q L;  1QNU A;  4K5W A;  3W2D A;  4C1N I;  1D5M C;  1JB3 A;  1UAP A;  1IW7 D;  3I90 A;  5IOC A;  2JEA I;  1Y1V B;  3VR5 A;  3WOE A;  4KD3 A;  5CV9 A;  2QKI C;  5I9P A;  1ZXT A;  3FVQ A;  3SHL A;  2K32 A;  3S9W A;  4ZKC B;  1NCV A;  1VF5 C;  4DNT B;  3MHB A;  1IHZ A;  1CK1 A;  1EU4 A;  3Q0A A;  3MTS A;  2CHB D;  1B9M A;  4RGO S;  4KD4 A;  1NAP A;  1STY A;  2F0U A;  1HRJ A;  1DJR D;  2AWO A;  2NYZ D;  3ERO A;  2O5J C;  1RHP A;  1EEF D;  3Q22 A;  3BDL A;  1SMY C;  4IAL A;  3KF8 A;  4M1U B;  4DAV A;  1O7Y A;  4IUT A;  1XTC D;  4QIW B;  3BVM A;  2JYO A;  1ENA A;  1IKM A;  3MWY W;  3HRZ C;  2K03 A;  5J39 A;  1PFM A;  1DZ1 A;  4XDX A;  3S1Q B;  2IX3 A;  1K83 B;  1QJO A;  3DMU A;  4HSV A;  4FP5 D;  1SMY D;  3TN2 A;  4C3H B;  1STE A;  2RDH A;  2XVS A;  5C0X G;  5C4H A;  2Q8I B;  2RDG A;  1KDA A;  3R93 A;  1VDZ A;  4H13 C;  3K5M A;  5FLX L;  5FO8 B;  2E2I B;  3E0J A;  3SE0 A;  1ESR A;  2A6E C;  4QUC A;  4TSS A;  2MPM A;  4DN4 M;  2JA6 B;  4XT3 B;  3I91 A;  1EY5 A;  5C4X B;  2C9O A;  4NMZ A;  3TME A;  4PMB A;  1TS2 A;  3GTJ B;  4G7Z C;  3HOZ B;  2B2V A;  2JXM B;  4HAE A;  5C0X J;  1JQY D;  2X69 A;  1Y8P B;  1G29 1;  3HOU B;  5EKL A;  1TWF B;  1YNJ D;  4EGV A;  3SVM A;  4LMQ D;  1VF7 A;  2WP8 J;  4K8J A;  5C6A A;  2EYM A;  5J1Z A;  3R8B A;  1SNO A;  1PDQ A;  4RWS C;  1O7L A;  4HCE A;  1FNW A;  4CHT B;  1A3U A;  1LTG D;  3MAQ A;  2MJ8 A;  1EQV A;  4MHE A;  4K5X A;  1B44 D;  2KCN A;  3C1E A;  4RKL A;  2A69 C;  3VA5 A;  2CW0 C;  2JA7 B;  5KNB A;  5FO7 B;  2YYZ A;  2F0L A;  2EY6 A;  1BCP C;  1GUO A;  2SNM A;  2K1B A;  4YIJ A;  3DUZ A;  3T51 B;  2NVX B;  1V8Q A;  1G6Z A;  1PTO F;  1RD9 D;  2HUG A;  1TT2 A;  2JE6 I;  3GD7 A;  3A8I E;  2L11 A;  3MXU A;  2A69 D;  5M3F B;  1JR0 D;  3LWE A;  3OIP A;  3M7N A;  2CW0 D;  1R4Q B;  4IUV A;  3L3O C;  1M4V A;  1SNM A;  5EBD A;  2DN8 A;  1BCP D;  4FXG C;  2K05 A;  3ZYY X;  4IUU A;  3PUZ A;  1SND A;  2ENB A;  1OO9 B;  4XIG S;  4CKE A;  1BNZ A;  1GUG A;  5F2D A;  2KQ3 A;  1B53 A;  1Q90 A;  1EFI D;  5C0X H;  1BXT A;  2EYF A;  1CHP D;  2D2C C;  1A2U A;  3DM1 A;  4FF1 A;  5ELB A;  1X3P A;  1OXS C;  3DXJ C;  3K58 A;  2KEE A;  4ILW A;  1EIH A;  1JE4 A;  1QOH A;  4PMW A;  1TKW B;  1QE6 A;  1CQF A;  4O42 A;  4OIK A;  5KRU A;  3NP8 A;  1ILP A;  2I46 A;  1II3 A;  5JVH 3;  4HR7 B;  4A3F B;  3HS0 C;  3P75 A;  3K5N A;  4IUQ A;  2A5H A;  1KDC A;  5CGK A;  2XSC A;  3NWS A;  1HFG A;  4RHS A;  3MA2 B;  1WD1 A;  5CBE E;  2B63 B;  4FF3 A;  4H7B A;  2AQ1 B;  4FXD A;  1BOS A;  2EY1 A;  3GQB A;  3QWN A;  5C5L A;  4FXK C;  2XRQ D;  2J7Z A;  2F0I A;  4BA1 I;  2O4X A;  2O5I C;  4K8I A;  2N55 A;  1ML0 D;  2L1B A;  4KTA A;  4IFD I;  3SDZ A;  4RFB A;  2WAC A;  1LAB A;  2A74 C;  1EU3 A;  1JCK B;  3FEW X;  4KJO A;  4RGT A;  1DOM A;  2WIN B;  5M9O A;  4K2L A;  2Z8L A;  3S15 B;  2F0J A;  2VXW A;  5E4X A;  4UAI A;  2ZT9 C;  4OIJ A;  4QB4 A;  1RCV D;  1DXM A;  4HN7 A;  4IUN A;  4MN3 A;  3RZD B;  2HCC A;  4KKT A;  2EDG A;  1JC7 A;  3TZD A;  2ICI A;  3E6Z X;  2IT1 A;  1SEB D;  1B1Z A;  1ESF A;  5C4Z A;  2B8G A;  2K6A A;  1JOO A;  1C48 A;  3PIP 3;  1F2M A;  1D1I A;  5HUR A;  4XT1 B;  3IL8 A;  3M4Y A;  4C3H G;  2EJM A;  1PTO B;  3S1M B;  3OMC A;  4MIU A;  5IGF A;  1I6V C;  1UNS A;  2KOL A;  3MFY A;  4DAY A;  1LT5 D;  1WTQ A;  1QCB D;  3GO5 A;  1OXX K;  4KN7 C;  3J81 L;  4KY5 A;  1MSG A;  5D65 A;  1SYB A;  4DGZ A;  1O80 A;  2F0O A;  1HTP A;  5BN3 A;  1S5E D;  1HTL D;  3S1R B;  1TS5 A;  1Q8I A;  2XWJ B;  4TQU S;  3OHX C;  3TP8 A;  3AB9 A;  1FNU A;  1BUV T;  3V2T A;  3M7G A;  3D6C A;  1Q1B A;  3D4D A;  5EPL A;  3QG1 A;  2F4I A;  5I9O A;  3KUP A;  3A54 A;  5CYU A;  1I4P A;  1STB A;  1Y69 U;  4ME5 A;  2B2U A;  3EA6 A;  3V05 A;  5DEH A;  1F9S A;  4C3I B;  3Q23 A;  4DK0 A;  2E74 C;  4BA2 I;  2B8F A;  5T1G A;  4RCN A;  4OO1 G;  5CV7 A;  2R7Z B;  1E2V A;  2PO4 A;  1HPC A;  1M8A A;  2HQE A;  1E2Z A;  4WJW A;  1CM9 A;  5FOB B;  4E6I A;  1RF2 D;  3Q6S A;  5I2Y A;  2OXP A;  4DA2 A;  4EVO A;  1FGB D;  1ZKO A;  1WVL A;  2Y0S B;  2V4D A;  3T13 A;  3NUC A;  4BWG B;  1Y1W B;  4X3T A;  1TWA B;  3WOF A;  1LO5 D;  5JJZ A;  3NE5 B;  3PUY A;  5IGC A;  2J0T D;  3MXN A;  1F2Y A;  3TBI B;  3QJY A;  1ICW A;  1BR9 A;  2R61 A;  3MC0 B;  1YNN C;  1CA6 A;  4K6L A;  5JAV A;  1I4X A;  3GTL B;  4RKB A;  4TRD A;  1SYC A;  4RGM A;  2MGS A;  1SE4 A;  4N9T A;  4B9X A;  1MBY A;  2WII B;  3RUZ A;  5D14 A;  3W3A A;  3J80 L;  3BYY B;  4PQX A;  2JSO A;  1I6H B;  1F2L A;  1G8Z D;  4V19 0;  5EKI A;  1ZYR D;  3I70 A;  4G4K A;  4QUF A;  2B2V C;  2QIL A;  1PZJ D;  5KYL A;  3A55 A;  1TY2 A;  1CQV A;  2EY2 A;  3AU7 A;  1XXG A;  1PRT D;  3JAM E;  1W6K A;  1PRT F;  4CKB A;  1EL0 A;  2FHT A;  2SEB D;  4FO2 A;  2F0F A;  2B2W A;  1DYQ A;  1AW7 A;  1AEX A;  3MXP A;  1ILQ A;  1SDF A;  3BDC A;  3QOL A;  1UEA B;  3H94 A;  1ET9 A;  5A35 A;  3I3C A;  4XTC S;  1HFN A;  2M00 A;  1GUN A;  1SJE D;  3SK5 A;  5LL6 X;  4L63 B;  2CVR A;  1WTO A;  3F2U A;  1EYD A;  2FMC A;  2H4O A;  3HKZ B;  1RDP D;  5T1I A;  4OO1 H;  1HUM A;  3P7J A;  3VR4 A;  3S16 B;  3FPP A;  1EQT A;  4TKO B;  4XYO A;  2NN6 G;  4RA8 A;  1A15 A;  2EZV A;  1SFO B;  5FKA C;  4OHJ A;  4I65 A;  2HDL A;  3PUV A;  2A73 B;  5CBA E;  1I4H A;  1BO0 A;  5FO9 B;  1O7Z A;  1UUP A;  2PNR C;  1LTB D;  2TMP A;  3S2H B;  1IYU A;  1K8O A;  1A6X A;  4J8Q A;  2BE5 C;  3D31 A;  2L55 A;  2F0S A;  4K6D A;  3NHH A;  5KYI A;  5IT9 E;  5C0X I;  5ELC A;  2IL8 A;  1EY7 A;  3L7Z C;  1SBB B;  2PMZ B;  4BBR B;  3RMH A;  4XXE A;  3VYS A;  2BDN A;  1GHK A;  5BN5 A;  2A6E D;  2BE5 D;  2IX1 A;  1A3V A;  3OSO A;  2SOB A;  5EJW A;  3BDO A;  4KMU C;  1SJH D;  3S17 B;  2EYJ A;  2ID0 A;  3LWU A;  4XYQ A;  5M5W B;  4IUP A;  5JPN C;  3T4A C;  1Y8N B;  1E0B A;  4ZQ3 A;  1D6E C;  2E2J B;  3TSS A;  1GUS A;  3IFD A;  1KAA A;  2PZT A;  2PYK A;  1EOT A;  1CZW A;  5M5Y B;  3SXH A;  1PTO C;  4RHR A;  2NUC A;  3C46 A;  4L6T B;  2NVY B;  3I72 A;  1JOQ A;  4FYD A;  1KLU D;  1TQO A;  4H44 C;  1MD2 D;  1TY0 A;  4IN3 A;  5C3X A;  2K7V A;  4WRD A;  4A3B B;  2JP1 A;  2CQA A;  1X3Q A;  5ELE A;  4ZRZ A;  4ID6 A;  4KY6 A;  3A7A B;  2NN6 H;  1BCP F;  1R4P B;  4A3G B;  1WTW A;  3VYR A;  2F0Q A;  3OWE B;  4C3I G;  2J4X A;  1PZK D;  2K5Q A;  1HQM C;  1RTN A;  3J7Y W;  5EQ0 A;  2K01 A;  3MEH A;  1H9J A;  2NBF A;  2RA4 A;  4HMI A;  5IGG A;  2KVM A;  2PQE A;  2MHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...