1NR4A

High resolution crystal structures of thymus and activation-regulated chemokine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
b'RGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymus and activation-regulated chemokine
publication title Structures of thymus and activation-regulated chemokine (TARC).
pubmed doi rcsb
molecule tags Cytokine
total genus 13
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1nr4A00
1QNKA 3TN2A 1X3PA 2B2YA 1WD0A 2RSNA 1SAPA 3I91A 1RJTA 1F9RA 4OIJA 4IURA 4O42A 1NR4A 1BBXC 2X6GA 4CJ0B 1B50A 1G2TA 1ESRA 2B2WC 2SDFA 5EPLA 5E4WC 1JE4A 3I90A 4LMQD 2B2UA 3I3CA 4MHEA 3N52A 1A15A 1HUNA 4QUCA 3KBXA 3GV6A 4XDXA 2B2VC 4UAIA 1U4LA 2L1BA 2HDLA 4IUPA 5JJZA 3GV3A 2L12A 2L4NA 3FPUB 3MTSA 2BDNA 3G7LA 2MGSA 3IFDA 2K28A 5AFWA 1MSHA 2MP1A 4MN3A 5EQ0A 2B2TC 2X6LA 1DOLA 2CVRA 1WTQA 5CBEE 2RVLA 2NZ1D 1ICWA 1WD1A 1SDFA 1MI2A 2D9UA 1GUWA 1BO0A 3LWEA 5D14A 4CJ1B 1B2TA 1MGSA 1G6ZA 1WTPA 1HA6A 2FMMA 2KVMA 1S4ZA 3FDTA 1VMCA 2FJ2A 2NWGA 5E4XA 1WTXA 2JYOA 1KNEA 2DY8A 4HEDA 4R8IA 4HAEA 3F2UA 3DEOA 1SSOA 2M2LA 1CA6A 4ZK9B 5COYA 1TVXA 4R9WA 4DN4M 5DNFA 1ILPA 1J9OA 1RODA 1G2SA 1B4OA 4IUTA 3KUPA 2EOTA 3TZDA 5CMDA 2MPMA 3Q6SA 4IUUA 1IL8A 1DONA 2N88A 1WTWA 1NAPA 2RA4A 3SVMA 1U4PA 3IL8A 1RTNA 2KUMA 1O7ZA 1O7YA 1CM9A 2K03A 1Q3LA 1EOTA 1RTOA 2B2WA 2KEEA 3DEPA 3P7JA 1VMPA 2MJ8A 4NW2A 4ZAIA 2R3ZA 5CBAE 2KEDA 2DY7A 1J8IA 5D65A 4RA8A 1HHVA 2HUGA 1WVLA 2EPBA 4HSVA 3D6WA 2HCIA 1X3QA 1C8CA 1F2LA 1QE6A 4X3UA 2B2VA 3I8ZA 2J7ZA 4IUQA 1ILQA 5CORA 1EIHA 1EL0A 4OIKA 1HRJA 3MWYW 1HUMA 1PDQA 1XX8A 3HP3A 4RWSC 3DM1A 1EIGA 1F9PA 2HDMA 2FHTA 2K04A 4X3TA 1O80A 5T1GA 2JP1A 3QO2A 4XT1B 2B2TA 1QG7A 2N55A 2XIWA 3R93A 3UI2A 4X3SA 3ONAB 2K1BA 4QUFA 1IKLA 4U68A 1JICA 2RSOA 1HFNA 1EQTA 2IL8A 2KOLA 4XT3B 1MSGA 2HCCA 1RHPA 1PFNA 5EKIA 5EJWA 2EE1A 4IUVA 2K05A 1AZQA 4RAUC 1U4RA 2FINB 4ZLTF 1BNZA 1G91A 1F9QA 1ML0D 1B53A 1F9SA 1B3AA 1NR2A 2KECA 4CJ2C 2B2YC 2K01A 2L9HA 4HCSA 1PFMA 1PFBA 1IKMA 1E0BA 2X69A 1PLFA 2FFKB 1LV9A 2NYZD 1DZ1A 1HFGA 1XYIA 1AZPA 2L11A 5EPJA 1BF4A 4ZKCB 4ZKBB 1AP0A 2B2UC 2Q8TA 1U4MA 1CA5A 1DOKA 2VXWA 1WTVA 2H1EA 4X3KA 1ZXTA 5T1IA 1WTOA 2Q8RE 1DOMA 1KNAA 3H91A 1WTRA 1M8AA 1X32A 5EPKA 1NCVA
chains in the Genus database with same CATH superfamily
4DV4L 3MFYA 2I46A 4JI6L 1WCMG 1W6KA 3H0GG 4PMCA 3ERSX 1X3FA 3I90A 5JPMC 2P5ZX 2K32A 1A15A 1LABA 3KBGA 1U5KA 2IPKD 4JBJA 2L1BA 3SHLA 3NXWA 1QVGA 1XWEA 4OELB 5IODA 5FLXL 1V43A 2EIFA 1SYBA 1NNXA 4ZRZA 4KJOA 2AQ1B 2NVYB 2Q8IB 1TY0A 5D14A 1KIXA 4BA2I 4POFA 1PH4A 5KGUA 4L8JA 3R2IA 2FJ2A 1PRTD 3WOFA 5C44B 1FL0A 3HOVH 1C48A 1XXGA 2DY8A 4EQOA 4L63B 2M2LA 1CA6A 3FP9A 4FNFA 4ZK9B 1D5ZC 4JI1Q 1KLUD 1K8MA 3BZDB 4DR3Q 3PMFA 4G57A 1HTPA 2DN8A 3KFUA 4CKCA 2ZTCA 4C3HB 5DM63 5M5XB 2B3GA 2N88A 4OWWB 2OT2A 2YTYA 4DR4Q 1CKNA 4DV7L 3I4MG 1N36L 4KLKA 4NW2A 1CKMA 4LFCQ 4K0KQ 2VB2X 2E2JH 2UU9Q 1HHVA 4A3JH 3KF6B 4A3EB 5GROA 2NVXH 1K28A 3I4LA 5C3EB 3TRZA 1EL0A 1TWHH 4HN7A 2YYZA 5FLXc 1Z7TA 1K83H 5K5PA 4ZQ3A 3ULLA 1SNMA 2K5WA 3FVQA 4BA1I 4DNTB 1SN8A 2B2TA 1X6OA 3CCMA 3VR4A 3FRPB 1SJHD 1V1QA 4A93B 3CCJA 5IP7G 4DV5L 1PHJA 1NE3A 2VW9A 2PPBC 1FR3A 4FP5D 1MKHA 2JN4A 1EY7A 3S1MH 3K7AB 5FK9C 5LMNL 1H9RA 1YNXA 4ZKBB 2JA6B 2MQHA 4I7AA 1EY6A 1WTVA 4CDDC 2PI2E 1VQFA 4UP9A 1ONLA 1PTOC 1GJXA 3TN2A 2LY7A 1EU3A 4KV6A 2UXBL 1HZBA 1SAPA 3T1HL 4OO1H 1UEBA 2EXDA 1F9RA 4RG1A 1TWCB 4O42A 2PMZB 4A3DG 1XTDA 4YCVA 4FYDA 4O1NA 3JAML 3VR5A 1PA6A 2VZAA 3EIVA 4KI0A 4MTKA 3HS0C 5IT9L 3HFZB 1HUNA 4GN3B 1A8VA 1B1ZA 1E7ZA 1FYCA 1U4LA 1YJ9A 4LF5Q 2CW0D 3U9SA 5IP9H 5IWAQ 1U0LA 3K5OA 1JJCB 3W3AA 4EQNA 3PO3B 5ELEA 5CBEE 4EQ5A 1QUQB 2TMPA 3OW2A 2EJMA 2JA5G 4XQQA 4F87A 3JC66 2F0HA 2D2CC 2CH4W 4DXGA 3H3VI 1KNEA 4P71A 1CI3M 1SNPA 4BBSB 3AB9A 4NXNQ 1PH1A 3NQTA 1KDCA 4RHSA 4BY1G 1Y8OB 3IL8A 4BWGB 5ELDA 1B3QA 1O7ZA 2KUMA 3CQZH 3JAMc 4A75A 2RDGA 5IYCG 1Q8IA 2GVAA 5IT9c 1J5EL 2R92G 4A4IA 3J81L 1K8OA 1F2LA 1I50H 4DGZA 2F0PA 4B3ML 2XN9C 1A62A 4H7BA 1EIGA 1VQDA 2R7FA 3LNNA 4J15A 1LLRD 3PF5A 4LFBQ 2XIWA 4DK6C 2A19A 4X3SA 2K1BA 2Q2HA 4JI2L 2PQAA 2RCFA 4L5RC 3HOVB 1Y69U 3NBHB 3V2TA 1U4RA 3KLSA 4AIMA 1PH5A 2CHBD 5LMNW 2K5QA 5GAEC 2B29A 4Y7NH 4DV1Q 3M4OH 5J3BA 4EX5A 4KHVA 1PFMA 1LACA 1CTMA 5IYDH 1VCIA 3E0JA 2YTVA 2M00A 3M3YB 5JEAG 5EPJA 1I4PA 2PZWA 1BF4A 1AP0A 4IFDI 1YNJC 2EYLA 2H5XA 2AHOB 1Y1WG 2HQLA 2WACA 3J81c 2E2JB 1T9HA 1SMYC 1X32A 4A3JB 3IKJA 1TY2A 2B2YA 2AUKA 3I91A 2K6AA 4Z9CB 1DYQA 1TWHB 2CKZB 4A3LH 1K83B 4DA2A 1KAAA 4JI1L 5TSSA 4DR3L 3I3CA 1Q12A 2Z1CA 4BY7G 2PMZE 1SNOA 2VB3X 2CWPA 3TDQA 2UXCQ 1LTGD 4UP8A 1RL2A 2NVTH 2PCFB 4DR4L 3VA7A 1MJCA 3RLOA 4A3KG 4WFN3 3AMUA 1F2MA 3E6ZX 4LFCL 1BBUA 3M7GA 1EYGA 2UU9L 1CKOA 1K9MC 1MI2A 3PF4A 3PIO3 4GLXA 1VQ5A 2FMMA 3S1MB 3A55A 3T16A 4MZ9A 3DWQA 3DEOA 4ALPA 1NMGA 2F3VA 3G6EA 1WJJA 4J1MA 4L6TB 3QG1A 1J9OA 4IPDA 4NXMQ 5CMDA 1AFPA 1QUQA 1Z47A 4AYBB 3ICEA 4EQPA 3S24A 3HOYH 5BN5A 1EYCA 2I0QA 2XVSA 3RR5A 3GTKH 4ILWA 1BKBA 1C7YA 1QE6A 5FO7B 4BBRH 5FLXE 2F0IA 3HOXH 3NELA 4OIKA 4QIWB 1I6HH 1BCPB 1Y8NB 3EFXD 4QY7A 2AKWB 1PZKD 2E75C 1ENAA 2L0CA 5I2YA 4O2DA 3ERQA 3RZOH 2F0WA 5J22A 1XPRA 3PIPA 1SNCA 1MSGA 2EY5A 3I73A 4ID6A 1F9QA 1BDOA 1ML0D 3GO5A 1QOHA 3GTQB 4B9XA 1G6PA 3NSWA 5LL6S 1V1PB 1DZ1A 1STYA 4LF5L 1LTSD 1S5BD 1PTOD 3BYTB 4OHJA 5IWAL 5KEEA 4P2CB 2CH4A 2V4DA 2SNSA 1SROA 4KJNA 1D1IA 3CQZB 4X3KA 2Q8RE 3NBHA 3BJUA 3VA5A 3S2DH 1EY0A 1HPCA 3EN2A 2O5JC 4A3IG 4CGYB 1BVSA 1OXUA 4DUZQ 2PO4A 1B50A 1HH2P 2ES2A 3KLRA 1G8ZD 4PZ6A 5JPNC 4NXNL 1A0IA 4KY5A 4A3MH 5EBCA 1XJVA 2I5HA 3Q24A 3HGBA 4IUPA 5JJZA 3S14H 1EEFD 2RHQB 1PFSA 3IFDA 2NN6G 1EYDA 4RKLA 2E5LQ 4HMJA 2B2TC 3S9WA 3VDYA 2JA8H 1M90C 2NZ1D 3M4OB 2DNCA 1VS0A 1B2TA 5LL6X 4DV0Q 1WTPA 3Q22A 3A0JA 1YZ6A 1SYFA 2OF1A 2JYOA 4DK3C 4R8NA 1D7QA 4IZ8A 3PO2H 3I2ZA 4XXEA 4JBMA 2EZVA 2LSSA 3E9IA 1PMRA 5COYA 4GNXB 4LFBL 1TVXA 2R7ZH 4JC0A 2HQEA 4IUTA 5D3IB 1QB5D 1F2ZA 4H0LC 4O0AA 3VYRA 1CHPD 4GOPA 2N8NA 3JAME 3F2DA 3RNUA 4C3JG 3CU7A 5C4XH 1P16A 4DV1L 5IT9E 1PYBA 3SK6A 1YI2A 3NENA 5KIXA 1PYSB 2DY7A 1EOVA 2Z4HA 4AYBE 1C8CA 1II3A 4F88A 5FKAC 3TP6A 2EYJA 1E3PA 1HRJA 1XX8A 1Y8PB 2JEBI 1IW7C 4CDFC 1QG7A 4PZ7A 4QIWE 4PZ8A 5E1FA 1GXDC 1YEZA 2RDFA 3CF5A 4KY7A 1RHPA 5C0XH 1AZQA 2FINB 3OIQA 5FLMH 4TRDA 4IFDJ 2AMCB 4IJLA 1YNJD 5ELNA 2UXCL 4BS9A 4M8AA 1SMYD 3HEJA 5J39A 2F4IA 2KQ3A 3V96A 1W3SA 1Y1VG 2VXWA 3HOYB 1B9MA 5D3DA 2NUCA 2KJXA 2QDBA 3GTKB 4A3CH 4TQUS 1BR9A 3VR2A 2OCEA 4BBRB 3HOXB 1V1PA 2HIXA 1HQRD 4J6HA 4CJ0B 4DUYL 1N36Q 1L0XB 2NVYH 4RGOS 1I4HA 3TP8A 1UNSA 1C4QA 4MHEA 4A3FG 4NXML 3TREA 1PH8A 3A5ZB 4CBVA 3SK4A 1UE6A 5G3LD 3RZOB 4X6AH 3FPUB 3PGZA 5AFWA 1VQNA 2NN6I 3TMEA 3ITPA 3LX0A 1XPOA 4LWCA 2CVRA 1JWUD 1JCKB 3L0OA 2JE6I 3K5MA 1BBWA 1ASZA 1BO0A 3LWEA 2Z8LA 4YIJA 3HOZH 1S4ZA 2F0TA 5M3FG 1XNQQ 3J80i 4PV1C 2JEAI 2B63G 1VQKA 1BQQT 4HR7B 1EWHA 2GN5A 4B3TQ 1L1OB 2A6ED 5KYIA 4LUZA 3S2DB 4RHRA 3GDEA 1GD7A 1B9NA 5EKKA 4LF4Q 4DFAA 3D4DA 1EUJA 1MHWC 1HCZA 3A8KE 3CD6A 1RTOA 4ZAIA 1H9MA 1LTID 4NP5A 5KNDA 3CW2C 5D65A 4GN5A 2DJGC 4RA8A 3IAYA 4A76A 4A3MB 1TT2A 1AEXA 2VUMG 2EY1A 3T1HQ 3NTKA 3MWYW 1UEAB 4ZYSA 5BR8L 1G291 2KHJA 3S14B 2AWNA 4HCEA 3CCUA 1ENCA 1PZID 1IYJB 4LFAQ 1PH3A 2JA8B 2G9HD 1JC7A 5LHY1 2PYKA 1CFMA 4DUZL 3A7LA 3K6OA 1CUKA 2M9VA 1EQTA 1TIID 2F4VQ 4XT3B 5K36H 1OXXK 3H3VH 1PYWD 2VY3A 4ZLTF 4LW1A 5JEAJ 3PO2B 2F0SA 1SE3A 3A7AB 3NE5B 2R7ZB 2J0TD 4R4TA 1IKMA 2HT1A 4G7ZC 1PLFA 2EYMA 1EQVA 4JK1C 3SXHA 2DGYA 2L11A 4TKOB 4KD4A 1V8QA 4IOAA 2KBNA 1GUOA 4QF4A 1DOKA 1P8LA 5C4XB 3C1FA 1HA5A 4NB3A 4FVMA 4P74A 3D31A 1E24A 4X62Q 4DV0L 3RD4A 1EY9A 1STAA 1AE2A 1RJTA 4OIJA 4JBWA 2BE5D 2BOSA 1JWMD 1I94Q 4FDBA 4A3BB 4P72A 4B08A 2IJ0A 3KBXA 1VQEA 5C44G 1AW7A 5CV7A 2L55A 2I07B 2L12A 4BXXG 4PG3A 3PUZA 1UAPA 4IUNA 3S1NH 4WJ3M 2CQOA 3UDFA 1CZWA 2PZTA 4C3HG 1SDFA 3BDLA 3NWSA 4KTAA 5FO9B 4JI2Q 2WFWA 4JYAQ 1SE2A 3CC4A 1KQSA 4IFDH 3DLLA 1Z6HA 4OONA 4NKLA 1JB3A 4A3EG 4GKJQ 1QJOA 1YHAA 3M9BA 5C3EG 1PRTB 1WI5A 5C4HA 2OWOA 1HZAA 2Z6KC 1I5FA 1JR0D 5M3MH 4HIMA 1MJEA 2OQ0A 3TS2A 3HOUH 1CQFA 3DEPA 2RQXA 3ND8A 4CHTB 1I4XA 1J8IA 1IW7D 1WVLA 4A93G 3S1QH 1NBWA 1BCPF 1ILQA 1L1OA 2BDOA 3VR6A 1LT6D 3HP3A 4M1UB 1F9PA 4X3TA 4ODGA 5A35A 3MAQA 1SJED 4IO9A 3BG3A 2BH2A 1DCZA 3CP0A 3M3YH 2Z0SA 3HOZB 2JA6G 1LTTD 1PH6A 4DAPA 1T5XD 4N9TA 5JAVA 4JI5Q 4RAUC 4ZCKA 5DLQE 2MNAA 2PQAB 3DWPA 4I7ZC 1H95A 3SDZA 1DJRD 4OXPA 2L5TA 3R3OA 1E0BA 3MZ5A 2K5HA 2QEJC 4EVOA 1EQRA 2BCOA 2B2UC 2VL6A 1IZ6A 1JOQA 4E6IA 5CGKA 2QA4A 3NQIA 1QNKA 2UUCL 1XNQL 5IIFA 3KJOA 1GUTA 2AQ2B 1J6QA 3PO3G 5EPLA 4G4KA 2EJFC 3DXJC 4B3TL 1D5MC 3EVQA 3MXUA 3RZDH 3GD7A 1HNZQ 2R6GA 3FKIH 4IPGA 4LF4L 4UY8C 2L4NA 3K0XA 5DM73 4BBSG 2E76C 2K28A 2MP1A 3KJPA 3X3MA 1STNA 1MD2D 2X6LA 1DOLA 1WD1A 3T1YL 2QKIC 4JOIC 1EU4A 2VNUD 3W5OA 1MGSA 2F52A 3N6RA 1WTXA 3CPWA 2HD3A 5JEAH 1BCPC 1SSOA 2KCMA 4LFAL 5KYLA 3T13A 1I3QH 5IYBH 3G71A 2IX1A 2KHSA 2I5MX 2F4VL 3NWTA 5BN3A 3K8AA 2JJQA 4X64Q 5F2DA 1PXUA 3D3RA 2MJ8A 3E3XA 3AYHB 1K73C 2R3ZA 5C4ZA 3CCRA 2KCTA 3FPPA 3J80L 1GHKA 2TSSA 3HOVG 4KHZA 4OL7A 1O78A 3CMAA 4MNOA 3GTQH 3S1NB 3SR1A 3J7ZC 3QO2A 4C2MB 2L15A 3A74A 4X62L 5IGGA 1UE5A 4QJFA 4JI3L 2BA0A 3H15A 1HZCA 3S15H 1I94L 4KN7C 1ET9A 1B53A 1X55A 1SEBD 4A3JG 1QILA 4HCSA 5BN4A 3D0FA 5CV4A 1Q86C 5KNBA 5LMUL 2AQ3B 3L2PA 2K5DA 1VQBA 3OHXC 5M3MB 1JQYD 1CA5A 3HOUB 1GHJA 4DV2Q 3UDGA 5HURA 1H9KA 3J80c 4GN4B 5GAGC 2RHSB 3I72A 3K58A 3S1QB 4JYAL 3EA6A 1RD9D 1IXRA 5M9OA 3TBIB 2K5VA 3FHWA 1STEA 3SGIA 3U58A 4IOCA 4DR1L 3NUCA 1KL9A 3RUZA 2F03A 4FF4A 4GKJL 1A6XA 1U9RA 5C6AA 3PV0A 4RGNA 4GNXC 2WINB 2XRQD 3HOWH 1X3EA 2C9OA 3MEHA 2ASBA 3T51B 4F7XA 2EVBA 2A73B 4QGUA 3GTMH 1QWYA 3CCEA 4LF6Q 2WV6D 3D4WA 3PIOA 1TS3A 3I7FA 4QB4A 1GUWA 4AYBG 2QCPX 4OO1G 5CR3A 2NWGA 5JOBA 3PSIA 4RH6A 4GLAC 3QWNA 2A1AA 2F0GA 1N32L 3TS0A 1EIYB 2F0OA 4PMBA 2JA7H 3OMCA 2F0JA 2IHEA 1I4GA 1LTBD 2V1CC 4APVA 5IP9G 1VQCA 4JI5L 1EQQA 4DR7Q 3NHHA 1YHQA 2R93H 1VQPA 1TQOA 4GOPB 1W2BA 3E9HA 2HUGA 3RZDB 2K50A 1EIHA 3I8ZA 3FKIB 1ZYRC 1H9JA 3TP5A 4A3GG 4DUYQ 3Q0AA 3RN5A 2HDMA 2KHIA 4IPHA 2N3SA 1V1OA 2RCNA 1CSPA 2YU9H 3BU2A 2LS01 4DV6Q 3CXCA 4U68A 3ZYYX 2KOLA 5EKIA 1CSQA 5EJWA 4ABNA 4IUVA 4JG2A 3H94A 1MBYA 1JOOA 2XTIA 1FVIA 1KXLA 1F9SA 1EWCA 2CQAA 1HNZL 3M4YA 1I3QB 2X69A 3QIAA 1CT1D 3CPFA 4R4IA 1DXMA 4C3IH 4ZKCB 1WTHA 2H1EA 4QMGA 4L5TA 3DM3A 3M85A 3HKSA 4XYOA 2RF4A 2Z4IA 1CZGA 2K4KA 3QOLA 4I65A 4Y52H 4L5SA 1GUNA 2NTTA 1QNUA 1XTCD 3KF8B 1OXVA 5IYDG 1TS4A 1L1OC 4OWXB 3FEWX 5BR8Q 4X64L 2C35B 3S15B 3EROA 2IW3A 3HZXA 3I4NH 3J7AF 5IGBA 1VQ8A 5IOCA 4HIDA 2VS1A 2RVLA 1I4RA 3ULJA 1KD1C 1G6ZA 4DAMA 1VQ9A 2G5DA 4PMWA 4A3LG 3W1BA 5CC4A 1WFQA 1PRTF 1SLJA 1TKWB 3D6CA 4KMUC 1QZGA 1XPUA 4PQXA 1RODA 1G2SA 1GO3E 2ICEC 1E2WA 3KUPA 3T53B 1EWIA 4YWKA 1K8GA 2F0KA 1LTRD 1JMCA 4KHPQ 2JSOA 2IX0A 2K5NA 3NEMA 2OTJA 4IJHA 1EOTA 1HJPA 1PH7A 2EYFA 5HY6A 1K0RA 4DR2Q 1VQGA 2EPBA 1X3QA 2B2VA 3HOWB 3OWFA 1FNUA 3ER0A 5CV8A 1TWAB 4XQNA 1N34Q 2ZJQA 4DV2L 5E7NA 4QL5A 1SBBB 3GTMB 1KABA 5ELFA 4JPBW 3R93A 1B44D 4JV5Q 2LXKA 2N49A 2E2HH 3GTOH 3GTPH 1L0YB 1PFNA 3HOYG 1NR2A 1S5DD 5HGTA 1YHBA 2GA4B 5EKLA 5M5YH 4HSPA 2Q2IA 2E74C 3A8IE 4BBRG 2JA7B 3HOXG 3SK5A 4A3BH 2WB1B 2YTXA 4LF6L 2R93B 1FD7D 3J80E 2K75A 3OTOL 3K5NA 1TWFH 1AH9A 1TS5A 4QCLA 4HIOA 4IURA 3KDFB 1DM0B 5IGEA 4GKKL 2QDLA 5EAYA 1LTAD 3I70A 2ATWA 5IGCA 1A3TA 3H6MA 1KLGD 5FJ8H 3BVMA 2A69C 4JCVE 4ZUIA 2YU9B 3GV3A 4DR7L 1EY4A 2BDNA 3AEVA 1EZ8A 4R4OA 3OSOA 3J81E 1N33Q 1G51A 1IBLQ 2F0FA 2ZM6Q 4KK7A 4QQBX 1IYVA 3KF8A 4FXGC 1JB7A 3I4OA 5CV6A 3BDOA 3NTHA 4C3IB 4FF2A 2Y0SB 3W1GA 3OW7A 3S2HH 1QZHA 1GVPA 4A3MG 1ILPA 5DNFA 3VYUA 3X3NA 1K0SA 1UUPA 2EY2A 2UUAL 2EOTA 4DV6L 4V0BA 2K14A 2O4XA 1T5EA 1ZYRD 3NTIA 1EFWA 3EJIA 2JA8G 5CBAE 2PQEA 3OYYA 1BUVT 2F0VA 1E2VA 4X3UA 2UUCQ 2J7ZA 4HJ7A 1TXYA 1KRTA 5J1ZA 1LTLA 1SMXA 3PO2G 3AQQA 2K04A 3I4NB 4N8X1 2E2IH 2R7ZG 4OGQC 5FOBB 3WWVA 1L2FA 3HKZB 1HR0Q 3K81C 4GZYC 4MIUA 1R9TH 5EBDA 4JI8Q 2OQKA 1VQOA 3VR3A 1VQAA 1D5XC 5C4XG 1WCMH 3C1EA 1SYDA 5CV9A 3H0GH 3A8JE 4YWMA 4CJ2C 2B2YC 3MXGA 3T1YQ 2NZOA 1N9WA 1PH2A 4JI7L 4L5QA 3F2BA 1HFGA 5C3WA 1S40A 4HJAA 2PNHA 1PH9A 2FXQA 2ZT9C 3STBC 1SNDA 1Q8KA 1ZXTA 3H3VC 4DU9A 3NK9A 1O7IA 1YVCA 2WB1E 2RSNA 5C0XG 1C9OA 1G2TA 1ESRA 2SDFA 1H9SB 5E4WC 5JVH3 3T56B 2MUYA 1EIFA 1E22A 3IRBA 3NP8A 5IE8A 3DUZA 4UAIA 4KHPL 2IWHA 3MTSA 3GTOB 3GTPB 3P20A 2E2HB 2F3IA 4MN3A 3K80C 1A3VA 4CDCC 4DR2L 3I4MH 3KDFA 1FJGQ 1WTQA 2OXPA 4XTCS 3C3LA 1EYAA 3R8BA 2ICIA 5M5YB 1LM0A 4K5XA 4A3CG 4JI3Q 1JWSD 3RN2A 1N34L 2UXDQ 3URYA 4HEDA 2WKDA 4N8FA 5ELOA 4GLVB 1NUCA 2F0UA 1IBKL 5JJLA 1X9NA 4JV5L 1TWFB 3TZDA 2PW5A 5DEHA 3UE1A 2QW7A 3GTJH 1IL8A 3MA2B 5LMUQ 3NBIA 2Y0SE 4UP7A 1SFOH 4LNQA 3J7AV 4WORA 4C2MH 3KK7A 5IP7H 3P7JA 5H1SE 1VF7A 2WAQB 1KDBA 3CHBD 2ALYB 4FO2A 3HOZG 1NMFA 3BVGA 1IYUA 1OO9B 3O13A 3VYSA 1SRUA 4DR1Q 2D0PA 4B3RQ 4LF8Q 3P75A 1EY8A 4X65Q 2O2LD 1VQHA 3ONAB 4IPCA 3BZKA 1IKLA 1PV4A 3CCQA 1VQMA 2F0MA 3TZUA 4A3DH 4DR5Q 3HKZE 1G91A 4RKBA 3J7A5 2KECA 3S2HB 2A74C 2OTLA 3CC7A 1PFBA 2RKSA 2XWBB 4PNYA 2LXJA 1JJ2A 1N33L 2Q8TA 4TSSA 1IBLL 1PTOF 3HG9A 3R2TA 2ZM6L 1N32Q 2B39A 2HIVA 1M8AA 5EPKA 3PUVA 2JA5H 3CAMA 4YCUA 2K52A 4LF7Q 5AJ3Q 5K36G 2EYPA 1VQLA 1N8RC 5C0XI 2A69D 3F2CA 1KAWA 4RFBA 2J4XA 1XMOQ 2E2IB 3RLNA 1YIJA 4CKEA 1NJIC 4OEMB 4XDXA 4OX9Q 2B2VC 1DGSA 2A68C 1SYEA 1R9TB 2HDLA 1XMQL 2A8VA 2EYOA 2WKCA 4FXKC 2RBMA 4BY1H 2MGSA 2F0LA 1C0AA 5EQ0A 1WCMB 3H0GB 5IYCH 4V190 1H9SA 4GOPC 1R4PB 2NBFA 2R92H 4RCOA 4IALA 2ZTDA 4XYQA 1CK1A 1PZJD 3S1RH 1O7LA 2NTSA 1HR0L 3A5UA 1B4OA 2ID0A 3K5LA 4JI8L 5C3XA 3Q6SA 1LT5D 1NAPA 4H13C 4NDXA 1CM9A 1Q3LA 3UE0A 2B2WA 2KEEA 1RCVD 1VMPA 4X66Q 2PZUA 2R61A 1Q1EA 4DV3Q 4HSVA 3D6WA 2EYHA 4FF1A 2FMCA 5CORA 5NUCA 4K14A 5EGTA 4JI0Q 1HUMA 1QVFA 1S72A 2MHVA 2OEOA 4RWSC 2WAQE 3M4QA 4IFDG 2K7VA 1B70B 1S3OA 2JP1A 4XT1B 2IX3A 4R4QA 3GTGH 3I4MB 3K0YA 1Y1WH 1RF2D 2N55A 2I5LX 3MXNA 1ET6A 3TSSA 3CMEA 4QUFA 5M3MG 1HFNA 2O5IC 5JVG3 2HCCA 3HOUG 1D8LA 1BNZA 1OXTA 2A6HC 1HQMC 1PTOH 2PI2A 2YV5A 2H4OA 4WJWA 5GAHC 4R1JA 4Q5VA 3A54A 3STBD 4BY7H 2FFKB 3CC2A 5C5LA 3GTJB 3AU7A 4A3KH 1SFOB 4ME3A 5HGQA 1D2BA 1FJGL 1MIUA 4CDEC 1WYDA 1IBMQ 4DAYB 3Q8DA 1K3BC 1KNAA 5IGDA 2JQOA 2BH8A 3RLFA 3K57A 3L7ZC 4F8MA 1YJWA 1FNVA 4KD3A 1V9PA 3M7NA 5C4JH 2UXDL 4DPGA 1A2TA 5GQOA 4A3GH 2KCCA 1JE4A 4H02A 1FNWA 4FXDA 1ICFB 1LUZA 3N52A 3E5SA 2NVQH 2Q2TA 4QUCA 2EY6A 1Q81C 2GVBA 4LJZC 2D62A 4RCNA 1S5FD 3GTLH 1MSHA 1SNQA 4A3DB 2PW7A 5G3LF 4AH6A 3KLWA 4K2LA 5JJIA 1TU2B 1FGBD 1STHA 4C56C 1JE5A 5I4DA 4NMZA 4CJ1B 1WOCA 4YHHL 3CCSA 3FDTA 1HR0W 4YCWA 3U4VA 1QCBD 4R8IA 5FO8B 3F2UA 4UDUC 4B3RL 4N9PA 4LF8L 4FF3A 4R9WA 4X65L 2SNMA 1E2ZA 3FKIG 1TWAH 1TWGH 4IUUA 4AQYQ 2JA5B 3SVMA 4LK1C 1JT8A 3KF6A 4DR5L 4DAVA 3DHQA 2SOBA 3OTOQ 1Q46A 1ZKOA 2QILA 2QF7A 2EJGC 3B6YA 2WIIB 1NTGA 5A2QL 1HTLD 3BYYB 3PQIA 4YY3Q 3CCLA 4BY1B 4GKKQ 3J7YW 2ZXOA 2ZJRA 5IYBG 4DK0A 3KOJA 2Z6BA 1NY4A 2N78A 4HJ8A 1VDZA 1Y14B 4LF7L 5AJ3L 2R92B 4A3IH 2NVXB 1LYLA 1LT3D 2K05A 4DNRB 4G7HC 4UHVA 3S1RB 1XMOL 5ISRA 1RKNA 2XSCA 4OX9L 2K01A 2L9HA 2JXMB 2F3WA 2CCZA 2NYZD 5I9PA 1Q90A 5E3FA 1AZPA 1SYCA 2EXZA 2NN6H 5C0XJ 1F2YA 1WTOA 4K0KL 4K5VA 4IN3A 3A56A 2R7DA 4C1NI 2IHFA 4XIGS 3TP7A 2UUAQ 1IL2A 4JI4Q 3S17H 1K3RA 1EZ6A 1NR4A 2A68D 1BBXC 2E8GA 5CYUA 5IGFA 2F0EA 4Q0FA 1B7YB 1X3GA 5C5MA 4KKSA 2ENBA 4RGTA 3GTGB 4DAYA 1Y1WB 3GV6A 2EDGA 2ZJPA 3DWAA 4X66L 4C3JH 1JOKA 3S16H 3ND9A 2XRSD 1CQVA 2A6EC 1PTOB 5ELBA 4DV3L 1ICWA 3SE0A 2HHHQ 1SE4A 1JORA 1GUGA 1K8AC 4BY7B 3MEFA 3I56A 2CFMA 4JI0L 1HA6A 2ZTEA 4JBKA 3KYHC 1E1OA 4HAEA 1SYGA 4A3KB 2KENA 1CHQD 2UUBQ 4DN4M 3C2PA 3BDCA 3D4RA 3HOWG 1AN8A 4JI7Q 2MPMA 1DONA 1A63A 1VQJA 2EQSA 1U4PA 3G4SA 2DJFC 5C4JB 3CRKC 4YWLA 2VQEQ 1BCPD 4HMIA 4A3GB 2KEDA 4MTNA 4EGVA 3EQLC 2MFIA 2XGTA 2F0QA 4GS3A 4CKBA 2NVQB 1Q82C 3GQBA 4OO1I 4IUQA 4DR6Q 3LGJA 1PDQA 3DM1A 2Z6KA 1IBML 3K7UC 3GTLB 1Y1VH 1HNWQ 3OMGA 1L0WA 2E2DC 3OWEB 2A6HD 4K8JA 2JA7G 3G6JB 5I9OA 3TQYA 3BS1A 3WOEA 3U9OA 3OIPA 4K8IA 1YBYA 3EBEA 2RSOA 2WB1G 1VQ7A 3K59A 1I50B 2EE1A 2Z9HA 5M5WH 3PIP3 4B3SQ 2R93G 2LMCB 4HJ9A 1KC8C 4A3FH 1YNNC 1TWGB 3LWUA 2VQFQ 2BE5C 4NPSA 1XYIA 1SXTA 4K6LA 2AWOA 1A2UA 1LT4D 3BVZA 1IBKQ 5T1IA 2DUDA 3QB3A 1WTRA 2KA7A 1I4QA 4Y7NB 3ULPA 3TEHB 2JA9A 1WD0A 5GADC 1IHZA 3AFQA 5M3FH 2B2WC 4ME5A 1XNRQ 2D0OA 2B63H 1ESFA 3NPPA 4LF9Q 2B2UA 3PUYA 4HIKA 3CRLC 4AQYL 3QJYA 1VQIA 4R4CA 1OXSC 4C3IG 3L3OC 4G7OC 2RDHA 3G7LA 2D5DA 4A3IB 1JJGA 2Y0SG 2A5HA 1S5ED 3W2DA 4ZUJA 3RMHA 1HNXQ 5KNCA 2D9UA 1Q7YC 2B8FA 2VUMH 2LKVA 4DV4Q 2KVMA 4DK1A 1VMCA 5E4XA 4DXFA 4LUVA 4YY3L 1PVOA 1EEID 4KY6A 4POGA 2NVTB 4JI6Q 1A3UA 2DNEA 3PUWA 3HRZC 2CWAA 4U673 3F8TA 1PRTC 3S17B 3P1HA 4S3SA 2RA4A 3KLSX 4JOIA 2XNAC 4XQJA 1STBA 4KKUA 1RTNA 5DAUA 1O7YA 3I4NG 1SR3A 2KCNA 2K03A 5CV5A 3T4AC 1B8AA 3H09A 3HKZG 4DKAC 3MHBA 3FMCA 3PCOB 4WRDA 4OWTB 2ZXRA 2AUJD 1R4QB 3OPOA 1YITA 1ZEQX 4IQZA 3MXPA 1OTCA 4J8QA 5T1GA 2FHTA 4C3JB 3G48A 3S16B 1UE7A 1AE3A 4JI4L 3UI2A 3UDIA 3OOCA 3MC0B 4RMFA 2B8GA 4B9WA 1XMQQ 3ZJYC 1JICA 2IL8A 2LFNA 2K33A 5I6WA 1F77A 5I2XA 1DD2A 3QR8A 1HZ9A 1I6HB 3C46A 1I6VC 4DV7Q 1B3AA 1QVCA 1KRSA 1ASYA 2QEXA 3CCVA 2MO0A 3JAMi 4JW0A 3DMUA 3SK8A 4LUOA 5C44H 1KHIA 2F0DA 1BOSA 4P73A 4HJ5A 4BXXH 1GM5A 1TR5A 3IFTA 4C1NK 1U4MA 1X56A 2QGQA 1DOMA 2HHHL 1RDPD 1STGA 3H91A 2MO1A 4DF7A 4K2KA 4C3HH 3D8GA 1NCVA 5M5XH 5A2QE 1VQ4A 1X3PA 1Q1BA 1UWVA 1YJNA 2X6GA 4HTHA 2UUBL 1X54A 4DV5Q 3QOJA 4RGMA 3L9AX 4LMQD 1Y1VB 4A3EH 2IT1A 4UPAA 4TVAB 2F1MA 5C3EH 1TS2A 3M4PA 4LAAA 3WDNA 3PUXA 2IY5B 5LMNQ 2NZHA 2VQEL 4A3BG 1GKHA 3U4ZA 3CKIB 5M5WB 1HXYD 5ELCA 2G9DA 1X65A 4WJ4A 3MVVA 1KTKA 1Z9FA 4A3FB 4A93H 4ULLA 2CW0C 1CKNB 1E1TA 4DR6L 1GUSA 4GNXA 5I6YA 2UXBQ 3F1ZA 1W6JA 5FLMG 1D6EC 1M4VA 3J81i 1HNWL 2WAQG 3V05A 1UE1A 4K6DA 1ENFA 4P75A 5FJ8G 3K7AH 3Q23A 1WTWA 5L37A 2BA1A 5JJKA 4B3SL 2JA6H 5M3FB 3SEBA 1RIPA 2B63B 1LO5D 4KKTA 4JVZA 1KDAA 1NSNS 2HCIA 2PNRC 2XWJB 4KN4C 2VQFL 2F0NA 1TWCH 1EFID 5KRUA 3J81j 1M1KC 2WP8J 2E5LL 1GOZA 1O80A 2ZXPA 3AFPA 3VYTA 4DNIA 5IY0A 2C5CA 3E0EA 1D1KA 2VUMB 3U50C 1SE8A 1YNND 1VF5C 1XNRL 3MXNB 2Q2UA 4LF9L 3PO3H 1VQ6A 1FGUA 3I55A 1J5EQ 1EY5A 1LV9A 4YHHQ 2JK8A 4H44C 2SEBD 3UDXA 4K5WA 3MFGA 4B3MQ 4BBSH 1S5CD 3BZCA 3GP7A 1HNXL 1BXTA 2NB0A
chains in the Genus database with same CATH topology
3MFYA 2I46A 1W6KA 4PMCA 3I90A 5JPMC 2K32A 1A15A 1LABA 3KBGA 2IPKD 2L1BA 3SHLA 3NXWA 1XWEA 5IODA 5FLXL 1V43A 1SYBA 4ZRZA 4KJOA 2AQ1B 2NVYB 2Q8IB 1TY0A 5D14A 4BA2I 5KGUA 4L8JA 3R2IA 2FJ2A 1PRTD 3WOFA 5C44B 1C48A 1XXGA 2DY8A 4EQOA 4L63B 2M2LA 1CA6A 4FNFA 4ZK9B 1D5ZC 1KLUD 1K8MA 3BZDB 3PMFA 4G57A 1HTPA 2DN8A 4CKCA 4C3HB 5DM63 5M5XB 2N88A 2OT2A 4NW2A 2VB2X 1HHVA 4A3EB 3I4LA 5C3EB 1EL0A 4HN7A 2YYZA 1Z7TA 5K5PA 4ZQ3A 1SNMA 2K5WA 3FVQA 4BA1I 4DNTB 2B2TA 3VR4A 3FRPB 1SJHD 4A93B 2PPBC 1FR3A 4FP5D 1EY7A 3K7AB 5FK9C 1H9RA 4ZKBB 2JA6B 1EY6A 1WTVA 1ONLA 1PTOC 1GJXA 3TN2A 2LY7A 1EU3A 4KV6A 1SAPA 4OO1H 1F9RA 1TWCB 4O42A 2PMZB 4FYDA 4O1NA 3JAML 3VR5A 4KI0A 3HS0C 5IT9L 1HUNA 1B1ZA 1FYCA 1U4LA 2CW0D 3U9SA 3K5OA 3W3AA 4EQNA 3PO3B 5ELEA 5CBEE 2TMPA 2EJMA 4XQQA 4F87A 2F0HA 2D2CC 4DXGA 1KNEA 1CI3M 1SNPA 4BBSB 3AB9A 3NQTA 1KDCA 4RHSA 1Y8OB 3IL8A 4BWGB 5ELDA 2KUMA 1O7ZA 2RDGA 1Q8IA 3J81L 1K8OA 1F2LA 4DGZA 2F0PA 2XN9C 4H7BA 1EIGA 3LNNA 1LLRD 2XIWA 4X3SA 2K1BA 3HOVB 1Y69U 3V2TA 1U4RA 3KLSA 2CHBD 2K5QA 4KHVA 1PFMA 1LACA 1CTMA 1VCIA 3E0JA 2M00A 3M3YB 5JEAG 5EPJA 1I4PA 2PZWA 1BF4A 1AP0A 4IFDI 1YNJC 2EYLA 2WACA 2E2JB 1SMYC 1X32A 4A3JB 3IKJA 1TY2A 2B2YA 2AUKA 3I91A 2K6AA 4Z9CB 1DYQA 1TWHB 1K83B 4DA2A 1KAAA 5TSSA 3I3CA 1Q12A 2Z1CA 1SNOA 2VB3X 3TDQA 1LTGD 2PCFB 3VA7A 4WFN3 3AMUA 1F2MA 3E6ZX 3M7GA 1MI2A 3PIO3 2FMMA 3S1MB 3A55A 3T16A 3DWQA 3DEOA 2F3VA 4J1MA 4L6TB 3QG1A 1J9OA 5CMDA 1AFPA 1Z47A 4AYBB 4EQPA 5BN5A 1EYCA 2XVSA 4ILWA 1QE6A 5FO7B 5FLXE 2F0IA 4OIKA 4QIWB 1BCPB 1Y8NB 3EFXD 1PZKD 2E75C 1ENAA 2L0CA 5I2YA 3ERQA 2F0WA 5J22A 1SNCA 1MSGA 2EY5A 3I73A 4ID6A 1F9QA 1BDOA 1ML0D 3GO5A 1QOHA 3GTQB 4B9XA 3NSWA 5LL6S 1V1PB 1DZ1A 1STYA 1LTSD 1S5BD 1PTOD 3BYTB 4OHJA 5KEEA 4P2CB 2V4DA 2SNSA 4KJNA 1D1IA 3CQZB 4X3KA 2Q8RE 3NBHA 3VA5A 1EY0A 1HPCA 2O5JC 4CGYB 1OXUA 2PO4A 1B50A 3KLRA 1G8ZD 5JPNC 4KY5A 5EBCA 3Q24A 3HGBA 4IUPA 5JJZA 1EEFD 3IFDA 2NN6G 1EYDA 4RKLA 4HMJA 2B2TC 3S9WA 2NZ1D 3M4OB 2DNCA 1B2TA 5LL6X 1WTPA 3Q22A 1SYFA 2OF1A 2JYOA 4R8NA 4IZ8A 4XXEA 2EZVA 1PMRA 5COYA 1TVXA 4IUTA 2HQEA 5D3IB 1QB5D 1F2ZA 4H0LC 3VYRA 1CHPD 3JAME 4C3JG 3CU7A 5IT9E 3SK6A 5KIXA 2Z4HA 2DY7A 1C8CA 1II3A 4F88A 5FKAC 3TP6A 2EYJA 1HRJA 1XX8A 1Y8PB 2JEBI 1IW7C 1QG7A 5E1FA 1GXDC 2RDFA 4KY7A 1RHPA 5C0XH 1AZQA 2FINB 3OIQA 4TRDA 4IFDJ 1YNJD 4BS9A 4M8AA 1SMYD 3HEJA 5J39A 2F4IA 2KQ3A 3V96A 2VXWA 3HOYB 1B9MA 5D3DA 2NUCA 2KJXA 2QDBA 3GTKB 4TQUS 1BR9A 3VR2A 4BBRB 3HOXB 1V1PA 4J6HA 1HQRD 4CJ0B 1L0XB 4RGOS 1I4HA 3TP8A 1UNSA 1C4QA 4MHEA 4CBVA 3SK4A 5G3LD 3RZOB 3FPUB 5AFWA 2NN6I 3TMEA 3ITPA 3LX0A 2CVRA 1JWUD 1JCKB 3K5MA 2JE6I 1BO0A 3LWEA 2Z8LA 4YIJA 1S4ZA 2F0TA 4PV1C 2JEAI 1BQQT 4HR7B 1EWHA 2A6ED 5KYIA 3S2DB 4RHRA 1B9NA 5EKKA 4DFAA 3D4DA 1HCZA 3A8KE 1RTOA 4ZAIA 1H9MA 1LTID 4NP5A 5KNDA 5D65A 4RA8A 3IAYA 4A3MB 1TT2A 1AEXA 2EY1A 3NTKA 3MWYW 1UEAB 4ZYSA 1G291 3S14B 2AWNA 4HCEA 1ENCA 1PZID 2JA8B 2G9HD 1JC7A 5LHY1 2PYKA 1CFMA 3A7LA 3K6OA 2M9VA 1EQTA 1TIID 5K36H 4XT3B 1OXXK 1PYWD 4ZLTF 5JEAJ 3PO2B 2F0SA 1SE3A 3A7AB 3NE5B 2R7ZB 2J0TD 1IKMA 4G7ZC 1PLFA 2EYMA 1EQVA 4JK1C 3SXHA 4TKOB 2L11A 4KD4A 1V8QA 1GUOA 4QF4A 1DOKA 5C4XB 3C1FA 1HA5A 4FVMA 3D31A 3RD4A 1EY9A 1STAA 1RJTA 4OIJA 4JBWA 2BE5D 2BOSA 1JWMD 4A3BB 4B08A 2IJ0A 3KBXA 1AW7A 5CV7A 2L55A 2I07B 2L12A 3PUZA 1UAPA 4IUNA 1CZWA 2PZTA 4C3HG 1SDFA 3BDLA 3NWSA 4KTAA 5FO9B 1SE2A 4IFDH 1Z6HA 4NKLA 1JB3A 1QJOA 1PRTB 5C4HA 1JR0D 1CQFA 3DEPA 2RQXA 3ND8A 4CHTB 1I4XA 1J8IA 1IW7D 1WVLA 1BCPF 1ILQA 2BDOA 3VR6A 1LT6D 3HP3A 4M1UB 1F9PA 4X3TA 4ODGA 5A35A 3MAQA 1SJED 3BG3A 1DCZA 3HOZB 1LTTD 4DAPA 1T5XD 4N9TA 5JAVA 4RAUC 3DWPA 4I7ZC 3SDZA 1DJRD 2L5TA 3R3OA 1E0BA 3MZ5A 2QEJC 4EVOA 2BCOA 2B2UC 1JOQA 4E6IA 5CGKA 3NQIA 1QNKA 5IIFA 1GUTA 2AQ2B 5EPLA 4G4KA 2EJFC 3DXJC 1D5MC 3EVQA 3MXUA 3GD7A 2R6GA 2L4NA 5DM73 2E76C 2K28A 2MP1A 3X3MA 1STNA 1MD2D 2X6LA 1DOLA 1WD1A 2QKIC 1EU4A 2VNUD 1MGSA 3N6RA 1WTXA 5JEAH 1BCPC 1SSOA 5KYLA 3T13A 2IX1A 2KHSA 3NWTA 5BN3A 5F2DA 1PXUA 3D3RA 2MJ8A 2R3ZA 5C4ZA 3FPPA 3J80L 1GHKA 2TSSA 4KHZA 4OL7A 1O78A 3S1NB 3SR1A 3QO2A 4C2MB 5IGGA 2BA0A 4KN7C 1ET9A 1B53A 1SEBD 1QILA 4HCSA 5BN4A 5CV4A 5KNBA 2AQ3B 2K5DA 3OHXC 5M3MB 1JQYD 1CA5A 3HOUB 1GHJA 5HURA 1H9KA 3I72A 3K58A 3S1QB 3EA6A 1RD9D 5M9OA 3TBIB 1STEA 3NUCA 4FF4A 3RUZA 2F03A 1A6XA 1U9RA 5C6AA 3PV0A 4RGNA 2WINB 2XRQD 2C9OA 3MEHA 3T51B 4F7XA 2EVBA 2A73B 1QWYA 2WV6D 3D4WA 1TS3A 4QB4A 1GUWA 2QCPX 4OO1G 5CR3A 2NWGA 5JOBA 4RH6A 3QWNA 2F0GA 2F0OA 4PMBA 3OMCA 2F0JA 1I4GA 1LTBD 3NHHA 1TQOA 2HUGA 3RZDB 1EIHA 3I8ZA 3FKIB 1ZYRC 1H9JA 3TP5A 3Q0AA 2HDMA 1V1OA 2LS01 4U68A 3ZYYX 2KOLA 5EKIA 5EJWA 4ABNA 4IUVA 3H94A 1MBYA 1JOOA 1F9SA 1EWCA 2CQAA 3M4YA 1I3QB 2X69A 3QIAA 1CT1D 1DXMA 4ZKCB 2H1EA 4QMGA 3M85A 4XYOA 2Z4IA 1CZGA 3QOLA 4I65A 1GUNA 2NTTA 1QNUA 1XTCD 1OXVA 1TS4A 3FEWX 3S15B 3EROA 2IW3A 3HZXA 3J7AF 5IGBA 5IOCA 2RVLA 1I4RA 1G6ZA 4PMWA 5CC4A 3D6CA 1PRTF 1TKWB 4KMUC 4PQXA 1RODA 1G2SA 2ICEC 1E2WA 3KUPA 3T53B 2F0KA 1LTRD 2JSOA 2IX0A 1EOTA 2EYFA 2EPBA 1X3QA 2B2VA 3HOWB 3OWFA 1FNUA 5CV8A 1TWAB 4XQNA 1SBBB 3GTMB 1KABA 5ELFA 3R93A 1B44D 1L0YB 1PFNA 1NR2A 1S5DD 5HGTA 2GA4B 5EKLA 4HSPA 2E74C 3A8IE 2JA7B 3SK5A 2WB1B 2R93B 1FD7D 3J80E 3K5NA 1TS5A 4QCLA 4IURA 1DM0B 5IGEA 1LTAD 3I70A 5IGCA 1A3TA 3H6MA 1KLGD 3BVMA 2A69C 2YU9B 4ZUIA 3GV3A 1EY4A 2BDNA 1EZ8A 3OSOA 3J81E 2F0FA 4KK7A 1IYVA 3KF8A 4FXGC 5CV6A 3BDOA 3NTHA 4C3IB 4FF2A 2Y0SB 3OW7A 1ILPA 5DNFA 3VYUA 3X3NA 1UUPA 2EY2A 2EOTA 4V0BA 2O4XA 1T5EA 1ZYRD 3NTIA 3EJIA 5CBAE 2PQEA 1BUVT 2F0VA 1E2VA 4X3UA 2J7ZA 5J1ZA 2K04A 3I4NB 4OGQC 5FOBB 3HKZB 4GZYC 4MIUA 5EBDA 3VR3A 1D5XC 3C1EA 1SYDA 5CV9A 3A8JE 4CJ2C 2B2YC 3MXGA 1HFGA 5C3WA 2ZT9C 1SNDA 1ZXTA 3H3VC 4DU9A 3NK9A 2RSNA 5C0XG 1G2TA 1ESRA 2SDFA 1H9SB 5E4WC 5JVH3 3T56B 2MUYA 3NP8A 3DUZA 4UAIA 2IWHA 3MTSA 3GTOB 3GTPB 3P20A 2E2HB 4MN3A 1A3VA 1WTQA 2OXPA 4XTCS 3C3LA 1EYAA 3R8BA 2ICIA 5M5YB 4K5XA 1JWSD 3URYA 4HEDA 2WKDA 1NUCA 2F0UA 1TWFB 3TZDA 2PW5A 5DEHA 1IL8A 3MA2B 3NBIA 3J7AV 4WORA 3KK7A 3P7JA 1VF7A 2WAQB 1KDBA 3CHBD 4FO2A 3BVGA 1IYUA 1OO9B 3O13A 3VYSA 3P75A 1EY8A 2O2LD 3ONAB 1IKLA 2F0MA 3TZUA 1G91A 4RKBA 2KECA 3S2HB 2A74C 1PFBA 2RKSA 2XWBB 4PNYA 2Q8TA 4TSSA 1PTOF 3HG9A 3R2TA 2B39A 1M8AA 5EPKA 3PUVA 5K36G 2EYPA 5C0XI 2A69D 4RFBA 2J4XA 2E2IB 4CKEA 4XDXA 2B2VC 2A68C 1SYEA 1R9TB 2HDLA 2EYOA 2WKCA 4FXKC 2RBMA 2MGSA 2F0LA 5EQ0A 1WCMB 3H0GB 4V190 1H9SA 1R4PB 2NBFA 4RCOA 4IALA 4XYQA 1CK1A 1PZJD 1O7LA 2NTSA 1B4OA 2ID0A 3K5LA 5C3XA 3Q6SA 1LT5D 1NAPA 4H13C 4NDXA 1CM9A 1Q3LA 2B2WA 2KEEA 1RCVD 1VMPA 2PZUA 2R61A 1Q1EA 4HSVA 3D6WA 2EYHA 4FF1A 2FMCA 5CORA 5NUCA 4K14A 5EGTA 1HUMA 2MHVA 2OEOA 4RWSC 4IFDG 2K7VA 2JP1A 4XT1B 2IX3A 3I4MB 3K0YA 1RF2D 2N55A 3MXNA 1ET6A 3TSSA 4QUFA 1HFNA 2O5IC 5JVG3 2HCCA 1BNZA 1OXTA 2A6HC 1HQMC 1PTOH 2H4OA 4WJWA 4Q5VA 3A54A 2FFKB 5C5LA 3GTJB 3AU7A 1SFOB 1D2BA 1KNAA 5IGDA 3RLFA 3K57A 3L7ZC 4F8MA 1FNVA 4KD3A 3M7NA 1A2TA 2KCCA 1JE4A 1FNWA 4FXDA 3N52A 3E5SA 4QUCA 2EY6A 4LJZC 2D62A 4RCNA 1S5FD 1MSHA 1SNQA 4A3DB 2PW7A 5G3LF 4K2LA 1TU2B 1FGBD 1STHA 4C56C 5I4DA 4NMZA 4CJ1B 3FDTA 1QCBD 4R8IA 5FO8B 3F2UA 4UDUC 4N9PA 4FF3A 4R9WA 2SNMA 1E2ZA 4IUUA 2JA5B 3SVMA 4LK1C 4DAVA 3DHQA 2SOBA 1ZKOA 2QILA 2QF7A 2EJGC 2WIIB 5A2QL 1HTLD 3BYYB 4BY1B 3J7YW 2ZXOA 4DK0A 1VDZA 2R92B 2NVXB 1LT3D 2K05A 4DNRB 4G7HC 3S1RB 5ISRA 1RKNA 2XSCA 2K01A 2L9HA 2JXMB 2F3WA 2NYZD 5I9PA 1Q90A 5E3FA 1AZPA 1SYCA 2EXZA 2NN6H 5C0XJ 1F2YA 1WTOA 4K5VA 4IN3A 3A56A 4C1NI 4XIGS 3TP7A 1EZ6A 1NR4A 2A68D 1BBXC 5CYUA 5IGFA 2F0EA 4Q0FA 5C5MA 4KKSA 2ENBA 4RGTA 3GTGB 4DAYA 1Y1WB 3GV6A 2EDGA 3DWAA 1JOKA 3ND9A 2XRSD 1CQVA 2A6EC 1PTOB 5ELBA 1ICWA 3SE0A 1SE4A 1JORA 1GUGA 4BY7B 1HA6A 4HAEA 1SYGA 4A3KB 1CHQD 4DN4M 3C2PA 3BDCA 3D4RA 1AN8A 2MPMA 1DONA 1U4PA 5C4JB 3CRKC 1BCPD 4HMIA 4A3GB 2KEDA 4EGVA 3EQLC 2F0QA 4CKBA 2NVQB 3GQBA 4OO1I 4IUQA 1PDQA 3DM1A 3GTLB 3OMGA 2E2DC 3OWEB 2A6HD 4K8JA 3G6JB 5I9OA 3BS1A 3WOEA 3U9OA 3OIPA 4K8IA 2RSOA 3K59A 1I50B 2EE1A 3PIP3 2LMCB 1YNNC 1TWGB 3LWUA 2BE5C 1XYIA 1SXTA 4K6LA 2AWOA 1A2UA 1LT4D 3BVZA 5T1IA 3QB3A 1WTRA 2KA7A 1I4QA 4Y7NB 1WD0A 1IHZA 2B2WC 4ME5A 1ESFA 3NPPA 2B2UA 3PUYA 3CRLC 3QJYA 1OXSC 4C3IG 3L3OC 4G7OC 2RDHA 3G7LA 2D5DA 4A3IB 2A5HA 1S5ED 3W2DA 4ZUJA 3RMHA 5KNCA 2D9UA 2B8FA 2LKVA 2KVMA 4DK1A 1VMCA 5E4XA 4DXFA 1EEID 4KY6A 2NVTB 1A3UA 2DNEA 3PUWA 3HRZC 4U673 1PRTC 3S17B 3P1HA 4S3SA 2RA4A 3KLSX 2XNAC 4XQJA 1STBA 4KKUA 1RTNA 5DAUA 1O7YA 2KCNA 2K03A 5CV5A 3T4AC 3H09A 3MHBA 3FMCA 4WRDA 2ZXRA 2AUJD 1R4QB 3OPOA 1ZEQX 4IQZA 3MXPA 4J8QA 5T1GA 2FHTA 4C3JB 3S16B 3UI2A 3OOCA 3MC0B 2B8GA 4B9WA 1JICA 2IL8A 2LFNA 2K33A 5I6WA 1F77A 5I2XA 1DD2A 1I6HB 3C46A 1I6VC 1B3AA 3DMUA 3SK8A 2F0DA 1BOSA 1TR5A 3IFTA 4C1NK 1U4MA 1DOMA 1RDPD 1STGA 3H91A 4DF7A 4K2KA 3D8GA 1NCVA 5A2QE 1X3PA 1Q1BA 2X6GA 4HTHA 3QOJA 4RGMA 3L9AX 4LMQD 1Y1VB 2IT1A 2F1MA 1TS2A 4LAAA 3WDNA 3PUXA 3CKIB 5M5WB 1HXYD 5ELCA 2G9DA 3MVVA 1KTKA 4A3FB 4ULLA 2CW0C 1GUSA 5I6YA 1W6JA 1D6EC 1M4VA 3V05A 4K6DA 1ENFA 3Q23A 1WTWA 2BA1A 5M3FB 3SEBA 2B63B 1LO5D 4KKTA 1KDAA 1NSNS 2HCIA 2PNRC 2XWJB 4KN4C 2F0NA 1EFID 5KRUA 2WP8J 1GOZA 1O80A 2ZXPA 3VYTA 2C5CA 1D1KA 2VUMB 1YNND 1VF5C 1EY5A 1LV9A 4H44C 2SEBD 4K5WA 3MFGA 1S5CD 3GP7A 1BXTA 2NB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QNK A;  3TN2 A;  1X3P A;  2B2Y A;  1WD0 A;  2RSN A;  1SAP A;  3I91 A;  1RJT A;  1F9R A;  4OIJ A;  4IUR A;  4O42 A;  1NR4 A;  1BBX C;  2X6G A;  4CJ0 B;  1B50 A;  1G2T A;  1ESR A;  2B2W C;  2SDF A;  5EPL A;  5E4W C;  1JE4 A;  3I90 A;  4LMQ D;  2B2U A;  3I3C A;  4MHE A;  3N52 A;  1A15 A;  1HUN A;  4QUC A;  3KBX A;  3GV6 A;  4XDX A;  2B2V C;  4UAI A;  1U4L A;  2L1B A;  2HDL A;  4IUP A;  5JJZ A;  3GV3 A;  2L12 A;  2L4N A;  3FPU B;  3MTS A;  2BDN A;  3G7L A;  2MGS A;  3IFD A;  2K28 A;  5AFW A;  1MSH A;  2MP1 A;  4MN3 A;  5EQ0 A;  2B2T C;  2X6L A;  1DOL A;  2CVR A;  1WTQ A;  5CBE E;  2RVL A;  2NZ1 D;  1ICW A;  1WD1 A;  1SDF A;  1MI2 A;  2D9U A;  1GUW A;  1BO0 A;  3LWE A;  5D14 A;  4CJ1 B;  1B2T A;  1MGS A;  1G6Z A;  1WTP A;  1HA6 A;  2FMM A;  2KVM A;  1S4Z A;  3FDT A;  1VMC A;  2FJ2 A;  2NWG A;  5E4X A;  1WTX A;  2JYO A;  1KNE A;  2DY8 A;  4HED A;  4R8I A;  4HAE A;  3F2U A;  3DEO A;  1SSO A;  2M2L A;  1CA6 A;  4ZK9 B;  5COY A;  1TVX A;  4R9W A;  4DN4 M;  5DNF A;  1ILP A;  1J9O A;  1ROD A;  1G2S A;  1B4O A;  4IUT A;  3KUP A;  2EOT A;  3TZD A;  5CMD A;  2MPM A;  3Q6S A;  4IUU A;  1IL8 A;  1DON A;  2N88 A;  1WTW A;  1NAP A;  2RA4 A;  3SVM A;  1U4P A;  3IL8 A;  1RTN A;  2KUM A;  1O7Z A;  1O7Y A;  1CM9 A;  2K03 A;  1Q3L A;  1EOT A;  1RTO A;  2B2W A;  2KEE A;  3DEP A;  3P7J A;  1VMP A;  2MJ8 A;  4NW2 A;  4ZAI A;  2R3Z A;  5CBA E;  2KED A;  2DY7 A;  1J8I A;  5D65 A;  4RA8 A;  1HHV A;  2HUG A;  1WVL A;  2EPB A;  4HSV A;  3D6W A;  2HCI A;  1X3Q A;  1C8C A;  1F2L A;  1QE6 A;  4X3U A;  2B2V A;  3I8Z A;  2J7Z A;  4IUQ A;  1ILQ A;  5COR A;  1EIH A;  1EL0 A;  4OIK A;  1HRJ A;  3MWY W;  1HUM A;  1PDQ A;  1XX8 A;  3HP3 A;  4RWS C;  3DM1 A;  1EIG A;  1F9P A;  2HDM A;  2FHT A;  2K04 A;  4X3T A;  1O80 A;  5T1G A;  2JP1 A;  3QO2 A;  4XT1 B;  2B2T A;  1QG7 A;  2N55 A;  2XIW A;  3R93 A;  3UI2 A;  4X3S A;  3ONA B;  2K1B A;  4QUF A;  1IKL A;  4U68 A;  1JIC A;  2RSO A;  1HFN A;  1EQT A;  2IL8 A;  2KOL A;  4XT3 B;  1MSG A;  2HCC A;  1RHP A;  1PFN A;  5EKI A;  5EJW A;  2EE1 A;  4IUV A;  2K05 A;  1AZQ A;  4RAU C;  1U4R A;  2FIN B;  4ZLT F;  1BNZ A;  1G91 A;  1F9Q A;  1ML0 D;  1B53 A;  1F9S A;  1B3A A;  1NR2 A;  2KEC A;  4CJ2 C;  2B2Y C;  2K01 A;  2L9H A;  4HCS A;  1PFM A;  1PFB A;  1IKM A;  1E0B A;  2X69 A;  1PLF A;  2FFK B;  1LV9 A;  2NYZ D;  1DZ1 A;  1HFG A;  1XYI A;  1AZP A;  2L11 A;  5EPJ A;  1BF4 A;  4ZKC B;  4ZKB B;  1AP0 A;  2B2U C;  2Q8T A;  1U4M A;  1CA5 A;  1DOK A;  2VXW A;  1WTV A;  2H1E A;  4X3K A;  1ZXT A;  5T1I A;  1WTO A;  2Q8R E;  1DOM A;  1KNA A;  3H91 A;  1WTR A;  1M8A A;  1X32 A;  5EPK A;  1NCV A; 
#chains in the Genus database with same CATH topology
 4DV4 L;  3MFY A;  2I46 A;  4JI6 L;  1WCM G;  1W6K A;  3H0G G;  4PMC A;  3ERS X;  1X3F A;  3I90 A;  5JPM C;  2P5Z X;  2K32 A;  1A15 A;  1LAB A;  3KBG A;  1U5K A;  2IPK D;  4JBJ A;  2L1B A;  3SHL A;  3NXW A;  1QVG A;  1XWE A;  4OEL B;  5IOD A;  5FLX L;  1V43 A;  2EIF A;  1SYB A;  1NNX A;  4ZRZ A;  4KJO A;  2AQ1 B;  2NVY B;  2Q8I B;  1TY0 A;  5D14 A;  1KIX A;  4BA2 I;  4POF A;  1PH4 A;  5KGU A;  4L8J A;  3R2I A;  2FJ2 A;  1PRT D;  3WOF A;  5C44 B;  1FL0 A;  3HOV H;  1C48 A;  1XXG A;  2DY8 A;  4EQO A;  4L63 B;  2M2L A;  1CA6 A;  3FP9 A;  4FNF A;  4ZK9 B;  1D5Z C;  4JI1 Q;  1KLU D;  1K8M A;  3BZD B;  4DR3 Q;  3PMF A;  4G57 A;  1HTP A;  2DN8 A;  3KFU A;  4CKC A;  2ZTC A;  4C3H B;  5DM6 3;  5M5X B;  2B3G A;  2N88 A;  4OWW B;  2OT2 A;  2YTY A;  4DR4 Q;  1CKN A;  4DV7 L;  3I4M G;  1N36 L;  4KLK A;  4NW2 A;  1CKM A;  4LFC Q;  4K0K Q;  2VB2 X;  2E2J H;  2UU9 Q;  1HHV A;  4A3J H;  3KF6 B;  4A3E B;  5GRO A;  2NVX H;  1K28 A;  3I4L A;  5C3E B;  3TRZ A;  1EL0 A;  1TWH H;  4HN7 A;  2YYZ A;  5FLX c;  1Z7T A;  1K83 H;  5K5P A;  4ZQ3 A;  3ULL A;  1SNM A;  2K5W A;  3FVQ A;  4BA1 I;  4DNT B;  1SN8 A;  2B2T A;  1X6O A;  3CCM A;  3VR4 A;  3FRP B;  1SJH D;  1V1Q A;  4A93 B;  3CCJ A;  5IP7 G;  4DV5 L;  1PHJ A;  1NE3 A;  2VW9 A;  2PPB C;  1FR3 A;  4FP5 D;  1MKH A;  2JN4 A;  1EY7 A;  3S1M H;  3K7A B;  5FK9 C;  5LMN L;  1H9R A;  1YNX A;  4ZKB B;  2JA6 B;  2MQH A;  4I7A A;  1EY6 A;  1WTV A;  4CDD C;  2PI2 E;  1VQF A;  4UP9 A;  1ONL A;  1PTO C;  1GJX A;  3TN2 A;  2LY7 A;  1EU3 A;  4KV6 A;  2UXB L;  1HZB A;  1SAP A;  3T1H L;  4OO1 H;  1UEB A;  2EXD A;  1F9R A;  4RG1 A;  1TWC B;  4O42 A;  2PMZ B;  4A3D G;  1XTD A;  4YCV A;  4FYD A;  4O1N A;  3JAM L;  3VR5 A;  1PA6 A;  2VZA A;  3EIV A;  4KI0 A;  4MTK A;  3HS0 C;  5IT9 L;  3HFZ B;  1HUN A;  4GN3 B;  1A8V A;  1B1Z A;  1E7Z A;  1FYC A;  1U4L A;  1YJ9 A;  4LF5 Q;  2CW0 D;  3U9S A;  5IP9 H;  5IWA Q;  1U0L A;  3K5O A;  1JJC B;  3W3A A;  4EQN A;  3PO3 B;  5ELE A;  5CBE E;  4EQ5 A;  1QUQ B;  2TMP A;  3OW2 A;  2EJM A;  2JA5 G;  4XQQ A;  4F87 A;  3JC6 6;  2F0H A;  2D2C C;  2CH4 W;  4DXG A;  3H3V I;  1KNE A;  4P71 A;  1CI3 M;  1SNP A;  4BBS B;  3AB9 A;  4NXN Q;  1PH1 A;  3NQT A;  1KDC A;  4RHS A;  4BY1 G;  1Y8O B;  3IL8 A;  4BWG B;  5ELD A;  1B3Q A;  1O7Z A;  2KUM A;  3CQZ H;  3JAM c;  4A75 A;  2RDG A;  5IYC G;  1Q8I A;  2GVA A;  5IT9 c;  1J5E L;  2R92 G;  4A4I A;  3J81 L;  1K8O A;  1F2L A;  1I50 H;  4DGZ A;  2F0P A;  4B3M L;  2XN9 C;  1A62 A;  4H7B A;  1EIG A;  1VQD A;  2R7F A;  3LNN A;  4J15 A;  1LLR D;  3PF5 A;  4LFB Q;  2XIW A;  4DK6 C;  2A19 A;  4X3S A;  2K1B A;  2Q2H A;  4JI2 L;  2PQA A;  2RCF A;  4L5R C;  3HOV B;  1Y69 U;  3NBH B;  3V2T A;  1U4R A;  3KLS A;  4AIM A;  1PH5 A;  2CHB D;  5LMN W;  2K5Q A;  5GAE C;  2B29 A;  4Y7N H;  4DV1 Q;  3M4O H;  5J3B A;  4EX5 A;  4KHV A;  1PFM A;  1LAC A;  1CTM A;  5IYD H;  1VCI A;  3E0J A;  2YTV A;  2M00 A;  3M3Y B;  5JEA G;  5EPJ A;  1I4P A;  2PZW A;  1BF4 A;  1AP0 A;  4IFD I;  1YNJ C;  2EYL A;  2H5X A;  2AHO B;  1Y1W G;  2HQL A;  2WAC A;  3J81 c;  2E2J B;  1T9H A;  1SMY C;  1X32 A;  4A3J B;  3IKJ A;  1TY2 A;  2B2Y A;  2AUK A;  3I91 A;  2K6A A;  4Z9C B;  1DYQ A;  1TWH B;  2CKZ B;  4A3L H;  1K83 B;  4DA2 A;  1KAA A;  4JI1 L;  5TSS A;  4DR3 L;  3I3C A;  1Q12 A;  2Z1C A;  4BY7 G;  2PMZ E;  1SNO A;  2VB3 X;  2CWP A;  3TDQ A;  2UXC Q;  1LTG D;  4UP8 A;  1RL2 A;  2NVT H;  2PCF B;  4DR4 L;  3VA7 A;  1MJC A;  3RLO A;  4A3K G;  4WFN 3;  3AMU A;  1F2M A;  3E6Z X;  4LFC L;  1BBU A;  3M7G A;  1EYG A;  2UU9 L;  1CKO A;  1K9M C;  1MI2 A;  3PF4 A;  3PIO 3;  4GLX A;  1VQ5 A;  2FMM A;  3S1M B;  3A55 A;  3T16 A;  4MZ9 A;  3DWQ A;  3DEO A;  4ALP A;  1NMG A;  2F3V A;  3G6E A;  1WJJ A;  4J1M A;  4L6T B;  3QG1 A;  1J9O A;  4IPD A;  4NXM Q;  5CMD A;  1AFP A;  1QUQ A;  1Z47 A;  4AYB B;  3ICE A;  4EQP A;  3S24 A;  3HOY H;  5BN5 A;  1EYC A;  2I0Q A;  2XVS A;  3RR5 A;  3GTK H;  4ILW A;  1BKB A;  1C7Y A;  1QE6 A;  5FO7 B;  4BBR H;  5FLX E;  2F0I A;  3HOX H;  3NEL A;  4OIK A;  4QIW B;  1I6H H;  1BCP B;  1Y8N B;  3EFX D;  4QY7 A;  2AKW B;  1PZK D;  2E75 C;  1ENA A;  2L0C A;  5I2Y A;  4O2D A;  3ERQ A;  3RZO H;  2F0W A;  5J22 A;  1XPR A;  3PIP A;  1SNC A;  1MSG A;  2EY5 A;  3I73 A;  4ID6 A;  1F9Q A;  1BDO A;  1ML0 D;  3GO5 A;  1QOH A;  3GTQ B;  4B9X A;  1G6P A;  3NSW A;  5LL6 S;  1V1P B;  1DZ1 A;  1STY A;  4LF5 L;  1LTS D;  1S5B D;  1PTO D;  3BYT B;  4OHJ A;  5IWA L;  5KEE A;  4P2C B;  2CH4 A;  2V4D A;  2SNS A;  1SRO A;  4KJN A;  1D1I A;  3CQZ B;  4X3K A;  2Q8R E;  3NBH A;  3BJU A;  3VA5 A;  3S2D H;  1EY0 A;  1HPC A;  3EN2 A;  2O5J C;  4A3I G;  4CGY B;  1BVS A;  1OXU A;  4DUZ Q;  2PO4 A;  1B50 A;  1HH2 P;  2ES2 A;  3KLR A;  1G8Z D;  4PZ6 A;  5JPN C;  4NXN L;  1A0I A;  4KY5 A;  4A3M H;  5EBC A;  1XJV A;  2I5H A;  3Q24 A;  3HGB A;  4IUP A;  5JJZ A;  3S14 H;  1EEF D;  2RHQ B;  1PFS A;  3IFD A;  2NN6 G;  1EYD A;  4RKL A;  2E5L Q;  4HMJ A;  2B2T C;  3S9W A;  3VDY A;  2JA8 H;  1M90 C;  2NZ1 D;  3M4O B;  2DNC A;  1VS0 A;  1B2T A;  5LL6 X;  4DV0 Q;  1WTP A;  3Q22 A;  3A0J A;  1YZ6 A;  1SYF A;  2OF1 A;  2JYO A;  4DK3 C;  4R8N A;  1D7Q A;  4IZ8 A;  3PO2 H;  3I2Z A;  4XXE A;  4JBM A;  2EZV A;  2LSS A;  3E9I A;  1PMR A;  5COY A;  4GNX B;  4LFB L;  1TVX A;  2R7Z H;  4JC0 A;  2HQE A;  4IUT A;  5D3I B;  1QB5 D;  1F2Z A;  4H0L C;  4O0A A;  3VYR A;  1CHP D;  4GOP A;  2N8N A;  3JAM E;  3F2D A;  3RNU A;  4C3J G;  3CU7 A;  5C4X H;  1P16 A;  4DV1 L;  5IT9 E;  1PYB A;  3SK6 A;  1YI2 A;  3NEN A;  5KIX A;  1PYS B;  2DY7 A;  1EOV A;  2Z4H A;  4AYB E;  1C8C A;  1II3 A;  4F88 A;  5FKA C;  3TP6 A;  2EYJ A;  1E3P A;  1HRJ A;  1XX8 A;  1Y8P B;  2JEB I;  1IW7 C;  4CDF C;  1QG7 A;  4PZ7 A;  4QIW E;  4PZ8 A;  5E1F A;  1GXD C;  1YEZ A;  2RDF A;  3CF5 A;  4KY7 A;  1RHP A;  5C0X H;  1AZQ A;  2FIN B;  3OIQ A;  5FLM H;  4TRD A;  4IFD J;  2AMC B;  4IJL A;  1YNJ D;  5ELN A;  2UXC L;  4BS9 A;  4M8A A;  1SMY D;  3HEJ A;  5J39 A;  2F4I A;  2KQ3 A;  3V96 A;  1W3S A;  1Y1V G;  2VXW A;  3HOY B;  1B9M A;  5D3D A;  2NUC A;  2KJX A;  2QDB A;  3GTK B;  4A3C H;  4TQU S;  1BR9 A;  3VR2 A;  2OCE A;  4BBR B;  3HOX B;  1V1P A;  2HIX A;  1HQR D;  4J6H A;  4CJ0 B;  4DUY L;  1N36 Q;  1L0X B;  2NVY H;  4RGO S;  1I4H A;  3TP8 A;  1UNS A;  1C4Q A;  4MHE A;  4A3F G;  4NXM L;  3TRE A;  1PH8 A;  3A5Z B;  4CBV A;  3SK4 A;  1UE6 A;  5G3L D;  3RZO B;  4X6A H;  3FPU B;  3PGZ A;  5AFW A;  1VQN A;  2NN6 I;  3TME A;  3ITP A;  3LX0 A;  1XPO A;  4LWC A;  2CVR A;  1JWU D;  1JCK B;  3L0O A;  2JE6 I;  3K5M A;  1BBW A;  1ASZ A;  1BO0 A;  3LWE A;  2Z8L A;  4YIJ A;  3HOZ H;  1S4Z A;  2F0T A;  5M3F G;  1XNQ Q;  3J80 i;  4PV1 C;  2JEA I;  2B63 G;  1VQK A;  1BQQ T;  4HR7 B;  1EWH A;  2GN5 A;  4B3T Q;  1L1O B;  2A6E D;  5KYI A;  4LUZ A;  3S2D B;  4RHR A;  3GDE A;  1GD7 A;  1B9N A;  5EKK A;  4LF4 Q;  4DFA A;  3D4D A;  1EUJ A;  1MHW C;  1HCZ A;  3A8K E;  3CD6 A;  1RTO A;  4ZAI A;  1H9M A;  1LTI D;  4NP5 A;  5KND A;  3CW2 C;  5D65 A;  4GN5 A;  2DJG C;  4RA8 A;  3IAY A;  4A76 A;  4A3M B;  1TT2 A;  1AEX A;  2VUM G;  2EY1 A;  3T1H Q;  3NTK A;  3MWY W;  1UEA B;  4ZYS A;  5BR8 L;  1G29 1;  2KHJ A;  3S14 B;  2AWN A;  4HCE A;  3CCU A;  1ENC A;  1PZI D;  1IYJ B;  4LFA Q;  1PH3 A;  2JA8 B;  2G9H D;  1JC7 A;  5LHY 1;  2PYK A;  1CFM A;  4DUZ L;  3A7L A;  3K6O A;  1CUK A;  2M9V A;  1EQT A;  1TII D;  2F4V Q;  4XT3 B;  5K36 H;  1OXX K;  3H3V H;  1PYW D;  2VY3 A;  4ZLT F;  4LW1 A;  5JEA J;  3PO2 B;  2F0S A;  1SE3 A;  3A7A B;  3NE5 B;  2R7Z B;  2J0T D;  4R4T A;  1IKM A;  2HT1 A;  4G7Z C;  1PLF A;  2EYM A;  1EQV A;  4JK1 C;  3SXH A;  2DGY A;  2L11 A;  4TKO B;  4KD4 A;  1V8Q A;  4IOA A;  2KBN A;  1GUO A;  4QF4 A;  1DOK A;  1P8L A;  5C4X B;  3C1F A;  1HA5 A;  4NB3 A;  4FVM A;  4P74 A;  3D31 A;  1E24 A;  4X62 Q;  4DV0 L;  3RD4 A;  1EY9 A;  1STA A;  1AE2 A;  1RJT A;  4OIJ A;  4JBW A;  2BE5 D;  2BOS A;  1JWM D;  1I94 Q;  4FDB A;  4A3B B;  4P72 A;  4B08 A;  2IJ0 A;  3KBX A;  1VQE A;  5C44 G;  1AW7 A;  5CV7 A;  2L55 A;  2I07 B;  2L12 A;  4BXX G;  4PG3 A;  3PUZ A;  1UAP A;  4IUN A;  3S1N H;  4WJ3 M;  2CQO A;  3UDF A;  1CZW A;  2PZT A;  4C3H G;  1SDF A;  3BDL A;  3NWS A;  4KTA A;  5FO9 B;  4JI2 Q;  2WFW A;  4JYA Q;  1SE2 A;  3CC4 A;  1KQS A;  4IFD H;  3DLL A;  1Z6H A;  4OON A;  4NKL A;  1JB3 A;  4A3E G;  4GKJ Q;  1QJO A;  1YHA A;  3M9B A;  5C3E G;  1PRT B;  1WI5 A;  5C4H A;  2OWO A;  1HZA A;  2Z6K C;  1I5F A;  1JR0 D;  5M3M H;  4HIM A;  1MJE A;  2OQ0 A;  3TS2 A;  3HOU H;  1CQF A;  3DEP A;  2RQX A;  3ND8 A;  4CHT B;  1I4X A;  1J8I A;  1IW7 D;  1WVL A;  4A93 G;  3S1Q H;  1NBW A;  1BCP F;  1ILQ A;  1L1O A;  2BDO A;  3VR6 A;  1LT6 D;  3HP3 A;  4M1U B;  1F9P A;  4X3T A;  4ODG A;  5A35 A;  3MAQ A;  1SJE D;  4IO9 A;  3BG3 A;  2BH2 A;  1DCZ A;  3CP0 A;  3M3Y H;  2Z0S A;  3HOZ B;  2JA6 G;  1LTT D;  1PH6 A;  4DAP A;  1T5X D;  4N9T A;  5JAV A;  4JI5 Q;  4RAU C;  4ZCK A;  5DLQ E;  2MNA A;  2PQA B;  3DWP A;  4I7Z C;  1H95 A;  3SDZ A;  1DJR D;  4OXP A;  2L5T A;  3R3O A;  1E0B A;  3MZ5 A;  2K5H A;  2QEJ C;  4EVO A;  1EQR A;  2BCO A;  2B2U C;  2VL6 A;  1IZ6 A;  1JOQ A;  4E6I A;  5CGK A;  2QA4 A;  3NQI A;  1QNK A;  2UUC L;  1XNQ L;  5IIF A;  3KJO A;  1GUT A;  2AQ2 B;  1J6Q A;  3PO3 G;  5EPL A;  4G4K A;  2EJF C;  3DXJ C;  4B3T L;  1D5M C;  3EVQ A;  3MXU A;  3RZD H;  3GD7 A;  1HNZ Q;  2R6G A;  3FKI H;  4IPG A;  4LF4 L;  4UY8 C;  2L4N A;  3K0X A;  5DM7 3;  4BBS G;  2E76 C;  2K28 A;  2MP1 A;  3KJP A;  3X3M A;  1STN A;  1MD2 D;  2X6L A;  1DOL A;  1WD1 A;  3T1Y L;  2QKI C;  4JOI C;  1EU4 A;  2VNU D;  3W5O A;  1MGS A;  2F52 A;  3N6R A;  1WTX A;  3CPW A;  2HD3 A;  5JEA H;  1BCP C;  1SSO A;  2KCM A;  4LFA L;  5KYL A;  3T13 A;  1I3Q H;  5IYB H;  3G71 A;  2IX1 A;  2KHS A;  2I5M X;  2F4V L;  3NWT A;  5BN3 A;  3K8A A;  2JJQ A;  4X64 Q;  5F2D A;  1PXU A;  3D3R A;  2MJ8 A;  3E3X A;  3AYH B;  1K73 C;  2R3Z A;  5C4Z A;  3CCR A;  2KCT A;  3FPP A;  3J80 L;  1GHK A;  2TSS A;  3HOV G;  4KHZ A;  4OL7 A;  1O78 A;  3CMA A;  4MNO A;  3GTQ H;  3S1N B;  3SR1 A;  3J7Z C;  3QO2 A;  4C2M B;  2L15 A;  3A74 A;  4X62 L;  5IGG A;  1UE5 A;  4QJF A;  4JI3 L;  2BA0 A;  3H15 A;  1HZC A;  3S15 H;  1I94 L;  4KN7 C;  1ET9 A;  1B53 A;  1X55 A;  1SEB D;  4A3J G;  1QIL A;  4HCS A;  5BN4 A;  3D0F A;  5CV4 A;  1Q86 C;  5KNB A;  5LMU L;  2AQ3 B;  3L2P A;  2K5D A;  1VQB A;  3OHX C;  5M3M B;  1JQY D;  1CA5 A;  3HOU B;  1GHJ A;  4DV2 Q;  3UDG A;  5HUR A;  1H9K A;  3J80 c;  4GN4 B;  5GAG C;  2RHS B;  3I72 A;  3K58 A;  3S1Q B;  4JYA L;  3EA6 A;  1RD9 D;  1IXR A;  5M9O A;  3TBI B;  2K5V A;  3FHW A;  1STE A;  3SGI A;  3U58 A;  4IOC A;  4DR1 L;  3NUC A;  1KL9 A;  3RUZ A;  2F03 A;  4FF4 A;  4GKJ L;  1A6X A;  1U9R A;  5C6A A;  3PV0 A;  4RGN A;  4GNX C;  2WIN B;  2XRQ D;  3HOW H;  1X3E A;  2C9O A;  3MEH A;  2ASB A;  3T51 B;  4F7X A;  2EVB A;  2A73 B;  4QGU A;  3GTM H;  1QWY A;  3CCE A;  4LF6 Q;  2WV6 D;  3D4W A;  3PIO A;  1TS3 A;  3I7F A;  4QB4 A;  1GUW A;  4AYB G;  2QCP X;  4OO1 G;  5CR3 A;  2NWG A;  5JOB A;  3PSI A;  4RH6 A;  4GLA C;  3QWN A;  2A1A A;  2F0G A;  1N32 L;  3TS0 A;  1EIY B;  2F0O A;  4PMB A;  2JA7 H;  3OMC A;  2F0J A;  2IHE A;  1I4G A;  1LTB D;  2V1C C;  4APV A;  5IP9 G;  1VQC A;  4JI5 L;  1EQQ A;  4DR7 Q;  3NHH A;  1YHQ A;  2R93 H;  1VQP A;  1TQO A;  4GOP B;  1W2B A;  3E9H A;  2HUG A;  3RZD B;  2K50 A;  1EIH A;  3I8Z A;  3FKI B;  1ZYR C;  1H9J A;  3TP5 A;  4A3G G;  4DUY Q;  3Q0A A;  3RN5 A;  2HDM A;  2KHI A;  4IPH A;  2N3S A;  1V1O A;  2RCN A;  1CSP A;  2YU9 H;  3BU2 A;  2LS0 1;  4DV6 Q;  3CXC A;  4U68 A;  3ZYY X;  2KOL A;  5EKI A;  1CSQ A;  5EJW A;  4ABN A;  4IUV A;  4JG2 A;  3H94 A;  1MBY A;  1JOO A;  2XTI A;  1FVI A;  1KXL A;  1F9S A;  1EWC A;  2CQA A;  1HNZ L;  3M4Y A;  1I3Q B;  2X69 A;  3QIA A;  1CT1 D;  3CPF A;  4R4I A;  1DXM A;  4C3I H;  4ZKC B;  1WTH A;  2H1E A;  4QMG A;  4L5T A;  3DM3 A;  3M85 A;  3HKS A;  4XYO A;  2RF4 A;  2Z4I A;  1CZG A;  2K4K A;  3QOL A;  4I65 A;  4Y52 H;  4L5S A;  1GUN A;  2NTT A;  1QNU A;  1XTC D;  3KF8 B;  1OXV A;  5IYD G;  1TS4 A;  1L1O C;  4OWX B;  3FEW X;  5BR8 Q;  4X64 L;  2C35 B;  3S15 B;  3ERO A;  2IW3 A;  3HZX A;  3I4N H;  3J7A F;  5IGB A;  1VQ8 A;  5IOC A;  4HID A;  2VS1 A;  2RVL A;  1I4R A;  3ULJ A;  1KD1 C;  1G6Z A;  4DAM A;  1VQ9 A;  2G5D A;  4PMW A;  4A3L G;  3W1B A;  5CC4 A;  1WFQ A;  1PRT F;  1SLJ A;  1TKW B;  3D6C A;  4KMU C;  1QZG A;  1XPU A;  4PQX A;  1ROD A;  1G2S A;  1GO3 E;  2ICE C;  1E2W A;  3KUP A;  3T53 B;  1EWI A;  4YWK A;  1K8G A;  2F0K A;  1LTR D;  1JMC A;  4KHP Q;  2JSO A;  2IX0 A;  2K5N A;  3NEM A;  2OTJ A;  4IJH A;  1EOT A;  1HJP A;  1PH7 A;  2EYF A;  5HY6 A;  1K0R A;  4DR2 Q;  1VQG A;  2EPB A;  1X3Q A;  2B2V A;  3HOW B;  3OWF A;  1FNU A;  3ER0 A;  5CV8 A;  1TWA B;  4XQN A;  1N34 Q;  2ZJQ A;  4DV2 L;  5E7N A;  4QL5 A;  1SBB B;  3GTM B;  1KAB A;  5ELF A;  4JPB W;  3R93 A;  1B44 D;  4JV5 Q;  2LXK A;  2N49 A;  2E2H H;  3GTO H;  3GTP H;  1L0Y B;  1PFN A;  3HOY G;  1NR2 A;  1S5D D;  5HGT A;  1YHB A;  2GA4 B;  5EKL A;  5M5Y H;  4HSP A;  2Q2I A;  2E74 C;  3A8I E;  4BBR G;  2JA7 B;  3HOX G;  3SK5 A;  4A3B H;  2WB1 B;  2YTX A;  4LF6 L;  2R93 B;  1FD7 D;  3J80 E;  2K75 A;  3OTO L;  3K5N A;  1TWF H;  1AH9 A;  1TS5 A;  4QCL A;  4HIO A;  4IUR A;  3KDF B;  1DM0 B;  5IGE A;  4GKK L;  2QDL A;  5EAY A;  1LTA D;  3I70 A;  2ATW A;  5IGC A;  1A3T A;  3H6M A;  1KLG D;  5FJ8 H;  3BVM A;  2A69 C;  4JCV E;  4ZUI A;  2YU9 B;  3GV3 A;  4DR7 L;  1EY4 A;  2BDN A;  3AEV A;  1EZ8 A;  4R4O A;  3OSO A;  3J81 E;  1N33 Q;  1G51 A;  1IBL Q;  2F0F A;  2ZM6 Q;  4KK7 A;  4QQB X;  1IYV A;  3KF8 A;  4FXG C;  1JB7 A;  3I4O A;  5CV6 A;  3BDO A;  3NTH A;  4C3I B;  4FF2 A;  2Y0S B;  3W1G A;  3OW7 A;  3S2H H;  1QZH A;  1GVP A;  4A3M G;  1ILP A;  5DNF A;  3VYU A;  3X3N A;  1K0S A;  1UUP A;  2EY2 A;  2UUA L;  2EOT A;  4DV6 L;  4V0B A;  2K14 A;  2O4X A;  1T5E A;  1ZYR D;  3NTI A;  1EFW A;  3EJI A;  2JA8 G;  5CBA E;  2PQE A;  3OYY A;  1BUV T;  2F0V A;  1E2V A;  4X3U A;  2UUC Q;  2J7Z A;  4HJ7 A;  1TXY A;  1KRT A;  5J1Z A;  1LTL A;  1SMX A;  3PO2 G;  3AQQ A;  2K04 A;  3I4N B;  4N8X 1;  2E2I H;  2R7Z G;  4OGQ C;  5FOB B;  3WWV A;  1L2F A;  3HKZ B;  1HR0 Q;  3K81 C;  4GZY C;  4MIU A;  1R9T H;  5EBD A;  4JI8 Q;  2OQK A;  1VQO A;  3VR3 A;  1VQA A;  1D5X C;  5C4X G;  1WCM H;  3C1E A;  1SYD A;  5CV9 A;  3H0G H;  3A8J E;  4YWM A;  4CJ2 C;  2B2Y C;  3MXG A;  3T1Y Q;  2NZO A;  1N9W A;  1PH2 A;  4JI7 L;  4L5Q A;  3F2B A;  1HFG A;  5C3W A;  1S40 A;  4HJA A;  2PNH A;  1PH9 A;  2FXQ A;  2ZT9 C;  3STB C;  1SND A;  1Q8K A;  1ZXT A;  3H3V C;  4DU9 A;  3NK9 A;  1O7I A;  1YVC A;  2WB1 E;  2RSN A;  5C0X G;  1C9O A;  1G2T A;  1ESR A;  2SDF A;  1H9S B;  5E4W C;  5JVH 3;  3T56 B;  2MUY A;  1EIF A;  1E22 A;  3IRB A;  3NP8 A;  5IE8 A;  3DUZ A;  4UAI A;  4KHP L;  2IWH A;  3MTS A;  3GTO B;  3GTP B;  3P20 A;  2E2H B;  2F3I A;  4MN3 A;  3K80 C;  1A3V A;  4CDC C;  4DR2 L;  3I4M H;  3KDF A;  1FJG Q;  1WTQ A;  2OXP A;  4XTC S;  3C3L A;  1EYA A;  3R8B A;  2ICI A;  5M5Y B;  1LM0 A;  4K5X A;  4A3C G;  4JI3 Q;  1JWS D;  3RN2 A;  1N34 L;  2UXD Q;  3URY A;  4HED A;  2WKD A;  4N8F A;  5ELO A;  4GLV B;  1NUC A;  2F0U A;  1IBK L;  5JJL A;  1X9N A;  4JV5 L;  1TWF B;  3TZD A;  2PW5 A;  5DEH A;  3UE1 A;  2QW7 A;  3GTJ H;  1IL8 A;  3MA2 B;  5LMU Q;  3NBI A;  2Y0S E;  4UP7 A;  1SFO H;  4LNQ A;  3J7A V;  4WOR A;  4C2M H;  3KK7 A;  5IP7 H;  3P7J A;  5H1S E;  1VF7 A;  2WAQ B;  1KDB A;  3CHB D;  2ALY B;  4FO2 A;  3HOZ G;  1NMF A;  3BVG A;  1IYU A;  1OO9 B;  3O13 A;  3VYS A;  1SRU A;  4DR1 Q;  2D0P A;  4B3R Q;  4LF8 Q;  3P75 A;  1EY8 A;  4X65 Q;  2O2L D;  1VQH A;  3ONA B;  4IPC A;  3BZK A;  1IKL A;  1PV4 A;  3CCQ A;  1VQM A;  2F0M A;  3TZU A;  4A3D H;  4DR5 Q;  3HKZ E;  1G91 A;  4RKB A;  3J7A 5;  2KEC A;  3S2H B;  2A74 C;  2OTL A;  3CC7 A;  1PFB A;  2RKS A;  2XWB B;  4PNY A;  2LXJ A;  1JJ2 A;  1N33 L;  2Q8T A;  4TSS A;  1IBL L;  1PTO F;  3HG9 A;  3R2T A;  2ZM6 L;  1N32 Q;  2B39 A;  2HIV A;  1M8A A;  5EPK A;  3PUV A;  2JA5 H;  3CAM A;  4YCU A;  2K52 A;  4LF7 Q;  5AJ3 Q;  5K36 G;  2EYP A;  1VQL A;  1N8R C;  5C0X I;  2A69 D;  3F2C A;  1KAW A;  4RFB A;  2J4X A;  1XMO Q;  2E2I B;  3RLN A;  1YIJ A;  4CKE A;  1NJI C;  4OEM B;  4XDX A;  4OX9 Q;  2B2V C;  1DGS A;  2A68 C;  1SYE A;  1R9T B;  2HDL A;  1XMQ L;  2A8V A;  2EYO A;  2WKC A;  4FXK C;  2RBM A;  4BY1 H;  2MGS A;  2F0L A;  1C0A A;  5EQ0 A;  1WCM B;  3H0G B;  5IYC H;  4V19 0;  1H9S A;  4GOP C;  1R4P B;  2NBF A;  2R92 H;  4RCO A;  4IAL A;  2ZTD A;  4XYQ A;  1CK1 A;  1PZJ D;  3S1R H;  1O7L A;  2NTS A;  1HR0 L;  3A5U A;  1B4O A;  2ID0 A;  3K5L A;  4JI8 L;  5C3X A;  3Q6S A;  1LT5 D;  1NAP A;  4H13 C;  4NDX A;  1CM9 A;  1Q3L A;  3UE0 A;  2B2W A;  2KEE A;  1RCV D;  1VMP A;  4X66 Q;  2PZU A;  2R61 A;  1Q1E A;  4DV3 Q;  4HSV A;  3D6W A;  2EYH A;  4FF1 A;  2FMC A;  5COR A;  5NUC A;  4K14 A;  5EGT A;  4JI0 Q;  1HUM A;  1QVF A;  1S72 A;  2MHV A;  2OEO A;  4RWS C;  2WAQ E;  3M4Q A;  4IFD G;  2K7V A;  1B70 B;  1S3O A;  2JP1 A;  4XT1 B;  2IX3 A;  4R4Q A;  3GTG H;  3I4M B;  3K0Y A;  1Y1W H;  1RF2 D;  2N55 A;  2I5L X;  3MXN A;  1ET6 A;  3TSS A;  3CME A;  4QUF A;  5M3M G;  1HFN A;  2O5I C;  5JVG 3;  2HCC A;  3HOU G;  1D8L A;  1BNZ A;  1OXT A;  2A6H C;  1HQM C;  1PTO H;  2PI2 A;  2YV5 A;  2H4O A;  4WJW A;  5GAH C;  4R1J A;  4Q5V A;  3A54 A;  3STB D;  4BY7 H;  2FFK B;  3CC2 A;  5C5L A;  3GTJ B;  3AU7 A;  4A3K H;  1SFO B;  4ME3 A;  5HGQ A;  1D2B A;  1FJG L;  1MIU A;  4CDE C;  1WYD A;  1IBM Q;  4DAY B;  3Q8D A;  1K3B C;  1KNA A;  5IGD A;  2JQO A;  2BH8 A;  3RLF A;  3K57 A;  3L7Z C;  4F8M A;  1YJW A;  1FNV A;  4KD3 A;  1V9P A;  3M7N A;  5C4J H;  2UXD L;  4DPG A;  1A2T A;  5GQO A;  4A3G H;  2KCC A;  1JE4 A;  4H02 A;  1FNW A;  4FXD A;  1ICF B;  1LUZ A;  3N52 A;  3E5S A;  2NVQ H;  2Q2T A;  4QUC A;  2EY6 A;  1Q81 C;  2GVB A;  4LJZ C;  2D62 A;  4RCN A;  1S5F D;  3GTL H;  1MSH A;  1SNQ A;  4A3D B;  2PW7 A;  5G3L F;  4AH6 A;  3KLW A;  4K2L A;  5JJI A;  1TU2 B;  1FGB D;  1STH A;  4C56 C;  1JE5 A;  5I4D A;  4NMZ A;  4CJ1 B;  1WOC A;  4YHH L;  3CCS A;  3FDT A;  1HR0 W;  4YCW A;  3U4V A;  1QCB D;  4R8I A;  5FO8 B;  3F2U A;  4UDU C;  4B3R L;  4N9P A;  4LF8 L;  4FF3 A;  4R9W A;  4X65 L;  2SNM A;  1E2Z A;  3FKI G;  1TWA H;  1TWG H;  4IUU A;  4AQY Q;  2JA5 B;  3SVM A;  4LK1 C;  1JT8 A;  3KF6 A;  4DR5 L;  4DAV A;  3DHQ A;  2SOB A;  3OTO Q;  1Q46 A;  1ZKO A;  2QIL A;  2QF7 A;  2EJG C;  3B6Y A;  2WII B;  1NTG A;  5A2Q L;  1HTL D;  3BYY B;  3PQI A;  4YY3 Q;  3CCL A;  4BY1 B;  4GKK Q;  3J7Y W;  2ZXO A;  2ZJR A;  5IYB G;  4DK0 A;  3KOJ A;  2Z6B A;  1NY4 A;  2N78 A;  4HJ8 A;  1VDZ A;  1Y14 B;  4LF7 L;  5AJ3 L;  2R92 B;  4A3I H;  2NVX B;  1LYL A;  1LT3 D;  2K05 A;  4DNR B;  4G7H C;  4UHV A;  3S1R B;  1XMO L;  5ISR A;  1RKN A;  2XSC A;  4OX9 L;  2K01 A;  2L9H A;  2JXM B;  2F3W A;  2CCZ A;  2NYZ D;  5I9P A;  1Q90 A;  5E3F A;  1AZP A;  1SYC A;  2EXZ A;  2NN6 H;  5C0X J;  1F2Y A;  1WTO A;  4K0K L;  4K5V A;  4IN3 A;  3A56 A;  2R7D A;  4C1N I;  2IHF A;  4XIG S;  3TP7 A;  2UUA Q;  1IL2 A;  4JI4 Q;  3S17 H;  1K3R A;  1EZ6 A;  1NR4 A;  2A68 D;  1BBX C;  2E8G A;  5CYU A;  5IGF A;  2F0E A;  4Q0F A;  1B7Y B;  1X3G A;  5C5M A;  4KKS A;  2ENB A;  4RGT A;  3GTG B;  4DAY A;  1Y1W B;  3GV6 A;  2EDG A;  2ZJP A;  3DWA A;  4X66 L;  4C3J H;  1JOK A;  3S16 H;  3ND9 A;  2XRS D;  1CQV A;  2A6E C;  1PTO B;  5ELB A;  4DV3 L;  1ICW A;  3SE0 A;  2HHH Q;  1SE4 A;  1JOR A;  1GUG A;  1K8A C;  4BY7 B;  3MEF A;  3I56 A;  2CFM A;  4JI0 L;  1HA6 A;  2ZTE A;  4JBK A;  3KYH C;  1E1O A;  4HAE A;  1SYG A;  4A3K B;  2KEN A;  1CHQ D;  2UUB Q;  4DN4 M;  3C2P A;  3BDC A;  3D4R A;  3HOW G;  1AN8 A;  4JI7 Q;  2MPM A;  1DON A;  1A63 A;  1VQJ A;  2EQS A;  1U4P A;  3G4S A;  2DJF C;  5C4J B;  3CRK C;  4YWL A;  2VQE Q;  1BCP D;  4HMI A;  4A3G B;  2KED A;  4MTN A;  4EGV A;  3EQL C;  2MFI A;  2XGT A;  2F0Q A;  4GS3 A;  4CKB A;  2NVQ B;  1Q82 C;  3GQB A;  4OO1 I;  4IUQ A;  4DR6 Q;  3LGJ A;  1PDQ A;  3DM1 A;  2Z6K A;  1IBM L;  3K7U C;  3GTL B;  1Y1V H;  1HNW Q;  3OMG A;  1L0W A;  2E2D C;  3OWE B;  2A6H D;  4K8J A;  2JA7 G;  3G6J B;  5I9O A;  3TQY A;  3BS1 A;  3WOE A;  3U9O A;  3OIP A;  4K8I A;  1YBY A;  3EBE A;  2RSO A;  2WB1 G;  1VQ7 A;  3K59 A;  1I50 B;  2EE1 A;  2Z9H A;  5M5W H;  3PIP 3;  4B3S Q;  2R93 G;  2LMC B;  4HJ9 A;  1KC8 C;  4A3F H;  1YNN C;  1TWG B;  3LWU A;  2VQF Q;  2BE5 C;  4NPS A;  1XYI A;  1SXT A;  4K6L A;  2AWO A;  1A2U A;  1LT4 D;  3BVZ A;  1IBK Q;  5T1I A;  2DUD A;  3QB3 A;  1WTR A;  2KA7 A;  1I4Q A;  4Y7N B;  3ULP A;  3TEH B;  2JA9 A;  1WD0 A;  5GAD C;  1IHZ A;  3AFQ A;  5M3F H;  2B2W C;  4ME5 A;  1XNR Q;  2D0O A;  2B63 H;  1ESF A;  3NPP A;  4LF9 Q;  2B2U A;  3PUY A;  4HIK A;  3CRL C;  4AQY L;  3QJY A;  1VQI A;  4R4C A;  1OXS C;  4C3I G;  3L3O C;  4G7O C;  2RDH A;  3G7L A;  2D5D A;  4A3I B;  1JJG A;  2Y0S G;  2A5H A;  1S5E D;  3W2D A;  4ZUJ A;  3RMH A;  1HNX Q;  5KNC A;  2D9U A;  1Q7Y C;  2B8F A;  2VUM H;  2LKV A;  4DV4 Q;  2KVM A;  4DK1 A;  1VMC A;  5E4X A;  4DXF A;  4LUV A;  4YY3 L;  1PVO A;  1EEI D;  4KY6 A;  4POG A;  2NVT B;  4JI6 Q;  1A3U A;  2DNE A;  3PUW A;  3HRZ C;  2CWA A;  4U67 3;  3F8T A;  1PRT C;  3S17 B;  3P1H A;  4S3S A;  2RA4 A;  3KLS X;  4JOI A;  2XNA C;  4XQJ A;  1STB A;  4KKU A;  1RTN A;  5DAU A;  1O7Y A;  3I4N G;  1SR3 A;  2KCN A;  2K03 A;  5CV5 A;  3T4A C;  1B8A A;  3H09 A;  3HKZ G;  4DKA C;  3MHB A;  3FMC A;  3PCO B;  4WRD A;  4OWT B;  2ZXR A;  2AUJ D;  1R4Q B;  3OPO A;  1YIT A;  1ZEQ X;  4IQZ A;  3MXP A;  1OTC A;  4J8Q A;  5T1G A;  2FHT A;  4C3J B;  3G48 A;  3S16 B;  1UE7 A;  1AE3 A;  4JI4 L;  3UI2 A;  3UDI A;  3OOC A;  3MC0 B;  4RMF A;  2B8G A;  4B9W A;  1XMQ Q;  3ZJY C;  1JIC A;  2IL8 A;  2LFN A;  2K33 A;  5I6W A;  1F77 A;  5I2X A;  1DD2 A;  3QR8 A;  1HZ9 A;  1I6H B;  3C46 A;  1I6V C;  4DV7 Q;  1B3A A;  1QVC A;  1KRS A;  1ASY A;  2QEX A;  3CCV A;  2MO0 A;  3JAM i;  4JW0 A;  3DMU A;  3SK8 A;  4LUO A;  5C44 H;  1KHI A;  2F0D A;  1BOS A;  4P73 A;  4HJ5 A;  4BXX H;  1GM5 A;  1TR5 A;  3IFT A;  4C1N K;  1U4M A;  1X56 A;  2QGQ A;  1DOM A;  2HHH L;  1RDP D;  1STG A;  3H91 A;  2MO1 A;  4DF7 A;  4K2K A;  4C3H H;  3D8G A;  1NCV A;  5M5X H;  5A2Q E;  1VQ4 A;  1X3P A;  1Q1B A;  1UWV A;  1YJN A;  2X6G A;  4HTH A;  2UUB L;  1X54 A;  4DV5 Q;  3QOJ A;  4RGM A;  3L9A X;  4LMQ D;  1Y1V B;  4A3E H;  2IT1 A;  4UPA A;  4TVA B;  2F1M A;  5C3E H;  1TS2 A;  3M4P A;  4LAA A;  3WDN A;  3PUX A;  2IY5 B;  5LMN Q;  2NZH A;  2VQE L;  4A3B G;  1GKH A;  3U4Z A;  3CKI B;  5M5W B;  1HXY D;  5ELC A;  2G9D A;  1X65 A;  4WJ4 A;  3MVV A;  1KTK A;  1Z9F A;  4A3F B;  4A93 H;  4ULL A;  2CW0 C;  1CKN B;  1E1T A;  4DR6 L;  1GUS A;  4GNX A;  5I6Y A;  2UXB Q;  3F1Z A;  1W6J A;  5FLM G;  1D6E C;  1M4V A;  3J81 i;  1HNW L;  2WAQ G;  3V05 A;  1UE1 A;  4K6D A;  1ENF A;  4P75 A;  5FJ8 G;  3K7A H;  3Q23 A;  1WTW A;  5L37 A;  2BA1 A;  5JJK A;  4B3S L;  2JA6 H;  5M3F B;  3SEB A;  1RIP A;  2B63 B;  1LO5 D;  4KKT A;  4JVZ A;  1KDA A;  1NSN S;  2HCI A;  2PNR C;  2XWJ B;  4KN4 C;  2VQF L;  2F0N A;  1TWC H;  1EFI D;  5KRU A;  3J81 j;  1M1K C;  2WP8 J;  2E5L L;  1GOZ A;  1O80 A;  2ZXP A;  3AFP A;  3VYT A;  4DNI A;  5IY0 A;  2C5C A;  3E0E A;  1D1K A;  2VUM B;  3U50 C;  1SE8 A;  1YNN D;  1VF5 C;  1XNR L;  3MXN B;  2Q2U A;  4LF9 L;  3PO3 H;  1VQ6 A;  1FGU A;  3I55 A;  1J5E Q;  1EY5 A;  1LV9 A;  4YHH Q;  2JK8 A;  4H44 C;  2SEB D;  3UDX A;  4K5W A;  3MFG A;  4B3M Q;  4BBS H;  1S5C D;  3BZC A;  3GP7 A;  1HNX L;  1BXT A;  2NB0 A; 
#chains in the Genus database with same CATH homology
 3MFY A;  2I46 A;  1W6K A;  4PMC A;  3I90 A;  5JPM C;  2K32 A;  1A15 A;  1LAB A;  3KBG A;  2IPK D;  2L1B A;  3SHL A;  3NXW A;  1XWE A;  5IOD A;  5FLX L;  1V43 A;  1SYB A;  4ZRZ A;  4KJO A;  2AQ1 B;  2NVY B;  2Q8I B;  1TY0 A;  5D14 A;  4BA2 I;  5KGU A;  4L8J A;  3R2I A;  2FJ2 A;  1PRT D;  3WOF A;  5C44 B;  1C48 A;  1XXG A;  2DY8 A;  4EQO A;  4L63 B;  2M2L A;  1CA6 A;  4FNF A;  4ZK9 B;  1D5Z C;  1KLU D;  1K8M A;  3BZD B;  3PMF A;  4G57 A;  1HTP A;  2DN8 A;  4CKC A;  4C3H B;  5DM6 3;  5M5X B;  2N88 A;  2OT2 A;  4NW2 A;  2VB2 X;  1HHV A;  4A3E B;  3I4L A;  5C3E B;  1EL0 A;  4HN7 A;  2YYZ A;  1Z7T A;  5K5P A;  4ZQ3 A;  1SNM A;  2K5W A;  3FVQ A;  4BA1 I;  4DNT B;  2B2T A;  3VR4 A;  3FRP B;  1SJH D;  4A93 B;  2PPB C;  1FR3 A;  4FP5 D;  1EY7 A;  3K7A B;  5FK9 C;  1H9R A;  4ZKB B;  2JA6 B;  1EY6 A;  1WTV A;  1ONL A;  1PTO C;  1GJX A;  3TN2 A;  2LY7 A;  1EU3 A;  4KV6 A;  1SAP A;  4OO1 H;  1F9R A;  1TWC B;  4O42 A;  2PMZ B;  4FYD A;  4O1N A;  3JAM L;  3VR5 A;  4KI0 A;  3HS0 C;  5IT9 L;  1HUN A;  1B1Z A;  1FYC A;  1U4L A;  2CW0 D;  3U9S A;  3K5O A;  3W3A A;  4EQN A;  3PO3 B;  5ELE A;  5CBE E;  2TMP A;  2EJM A;  4XQQ A;  4F87 A;  2F0H A;  2D2C C;  4DXG A;  1KNE A;  1CI3 M;  1SNP A;  4BBS B;  3AB9 A;  3NQT A;  1KDC A;  4RHS A;  1Y8O B;  3IL8 A;  4BWG B;  5ELD A;  2KUM A;  1O7Z A;  2RDG A;  1Q8I A;  3J81 L;  1K8O A;  1F2L A;  4DGZ A;  2F0P A;  2XN9 C;  4H7B A;  1EIG A;  3LNN A;  1LLR D;  2XIW A;  4X3S A;  2K1B A;  3HOV B;  1Y69 U;  3V2T A;  1U4R A;  3KLS A;  2CHB D;  2K5Q A;  4KHV A;  1PFM A;  1LAC A;  1CTM A;  1VCI A;  3E0J A;  2M00 A;  3M3Y B;  5JEA G;  5EPJ A;  1I4P A;  2PZW A;  1BF4 A;  1AP0 A;  4IFD I;  1YNJ C;  2EYL A;  2WAC A;  2E2J B;  1SMY C;  1X32 A;  4A3J B;  3IKJ A;  1TY2 A;  2B2Y A;  2AUK A;  3I91 A;  2K6A A;  4Z9C B;  1DYQ A;  1TWH B;  1K83 B;  4DA2 A;  1KAA A;  5TSS A;  3I3C A;  1Q12 A;  2Z1C A;  1SNO A;  2VB3 X;  3TDQ A;  1LTG D;  2PCF B;  3VA7 A;  4WFN 3;  3AMU A;  1F2M A;  3E6Z X;  3M7G A;  1MI2 A;  3PIO 3;  2FMM A;  3S1M B;  3A55 A;  3T16 A;  3DWQ A;  3DEO A;  2F3V A;  4J1M A;  4L6T B;  3QG1 A;  1J9O A;  5CMD A;  1AFP A;  1Z47 A;  4AYB B;  4EQP A;  5BN5 A;  1EYC A;  2XVS A;  4ILW A;  1QE6 A;  5FO7 B;  5FLX E;  2F0I A;  4OIK A;  4QIW B;  1BCP B;  1Y8N B;  3EFX D;  1PZK D;  2E75 C;  1ENA A;  2L0C A;  5I2Y A;  3ERQ A;  2F0W A;  5J22 A;  1SNC A;  1MSG A;  2EY5 A;  3I73 A;  4ID6 A;  1F9Q A;  1BDO A;  1ML0 D;  3GO5 A;  1QOH A;  3GTQ B;  4B9X A;  3NSW A;  5LL6 S;  1V1P B;  1DZ1 A;  1STY A;  1LTS D;  1S5B D;  1PTO D;  3BYT B;  4OHJ A;  5KEE A;  4P2C B;  2V4D A;  2SNS A;  4KJN A;  1D1I A;  3CQZ B;  4X3K A;  2Q8R E;  3NBH A;  3VA5 A;  1EY0 A;  1HPC A;  2O5J C;  4CGY B;  1OXU A;  2PO4 A;  1B50 A;  3KLR A;  1G8Z D;  5JPN C;  4KY5 A;  5EBC A;  3Q24 A;  3HGB A;  4IUP A;  5JJZ A;  1EEF D;  3IFD A;  2NN6 G;  1EYD A;  4RKL A;  4HMJ A;  2B2T C;  3S9W A;  2NZ1 D;  3M4O B;  2DNC A;  1B2T A;  5LL6 X;  1WTP A;  3Q22 A;  1SYF A;  2OF1 A;  2JYO A;  4R8N A;  4IZ8 A;  4XXE A;  2EZV A;  1PMR A;  5COY A;  1TVX A;  4IUT A;  2HQE A;  5D3I B;  1QB5 D;  1F2Z A;  4H0L C;  3VYR A;  1CHP D;  3JAM E;  4C3J G;  3CU7 A;  5IT9 E;  3SK6 A;  5KIX A;  2Z4H A;  2DY7 A;  1C8C A;  1II3 A;  4F88 A;  5FKA C;  3TP6 A;  2EYJ A;  1HRJ A;  1XX8 A;  1Y8P B;  2JEB I;  1IW7 C;  1QG7 A;  5E1F A;  1GXD C;  2RDF A;  4KY7 A;  1RHP A;  5C0X H;  1AZQ A;  2FIN B;  3OIQ A;  4TRD A;  4IFD J;  1YNJ D;  4BS9 A;  4M8A A;  1SMY D;  3HEJ A;  5J39 A;  2F4I A;  2KQ3 A;  3V96 A;  2VXW A;  3HOY B;  1B9M A;  5D3D A;  2NUC A;  2KJX A;  2QDB A;  3GTK B;  4TQU S;  1BR9 A;  3VR2 A;  4BBR B;  3HOX B;  1V1P A;  4J6H A;  1HQR D;  4CJ0 B;  1L0X B;  4RGO S;  1I4H A;  3TP8 A;  1UNS A;  1C4Q A;  4MHE A;  4CBV A;  3SK4 A;  5G3L D;  3RZO B;  3FPU B;  5AFW A;  2NN6 I;  3TME A;  3ITP A;  3LX0 A;  2CVR A;  1JWU D;  1JCK B;  3K5M A;  2JE6 I;  1BO0 A;  3LWE A;  2Z8L A;  4YIJ A;  1S4Z A;  2F0T A;  4PV1 C;  2JEA I;  1BQQ T;  4HR7 B;  1EWH A;  2A6E D;  5KYI A;  3S2D B;  4RHR A;  1B9N A;  5EKK A;  4DFA A;  3D4D A;  1HCZ A;  3A8K E;  1RTO A;  4ZAI A;  1H9M A;  1LTI D;  4NP5 A;  5KND A;  5D65 A;  4RA8 A;  3IAY A;  4A3M B;  1TT2 A;  1AEX A;  2EY1 A;  3NTK A;  3MWY W;  1UEA B;  4ZYS A;  1G29 1;  3S14 B;  2AWN A;  4HCE A;  1ENC A;  1PZI D;  2JA8 B;  2G9H D;  1JC7 A;  5LHY 1;  2PYK A;  1CFM A;  3A7L A;  3K6O A;  2M9V A;  1EQT A;  1TII D;  5K36 H;  4XT3 B;  1OXX K;  1PYW D;  4ZLT F;  5JEA J;  3PO2 B;  2F0S A;  1SE3 A;  3A7A B;  3NE5 B;  2R7Z B;  2J0T D;  1IKM A;  4G7Z C;  1PLF A;  2EYM A;  1EQV A;  4JK1 C;  3SXH A;  4TKO B;  2L11 A;  4KD4 A;  1V8Q A;  1GUO A;  4QF4 A;  1DOK A;  5C4X B;  3C1F A;  1HA5 A;  4FVM A;  3D31 A;  3RD4 A;  1EY9 A;  1STA A;  1RJT A;  4OIJ A;  4JBW A;  2BE5 D;  2BOS A;  1JWM D;  4A3B B;  4B08 A;  2IJ0 A;  3KBX A;  1AW7 A;  5CV7 A;  2L55 A;  2I07 B;  2L12 A;  3PUZ A;  1UAP A;  4IUN A;  1CZW A;  2PZT A;  4C3H G;  1SDF A;  3BDL A;  3NWS A;  4KTA A;  5FO9 B;  1SE2 A;  4IFD H;  1Z6H A;  4NKL A;  1JB3 A;  1QJO A;  1PRT B;  5C4H A;  1JR0 D;  1CQF A;  3DEP A;  2RQX A;  3ND8 A;  4CHT B;  1I4X A;  1J8I A;  1IW7 D;  1WVL A;  1BCP F;  1ILQ A;  2BDO A;  3VR6 A;  1LT6 D;  3HP3 A;  4M1U B;  1F9P A;  4X3T A;  4ODG A;  5A35 A;  3MAQ A;  1SJE D;  3BG3 A;  1DCZ A;  3HOZ B;  1LTT D;  4DAP A;  1T5X D;  4N9T A;  5JAV A;  4RAU C;  3DWP A;  4I7Z C;  3SDZ A;  1DJR D;  2L5T A;  3R3O A;  1E0B A;  3MZ5 A;  2QEJ C;  4EVO A;  2BCO A;  2B2U C;  1JOQ A;  4E6I A;  5CGK A;  3NQI A;  1QNK A;  5IIF A;  1GUT A;  2AQ2 B;  5EPL A;  4G4K A;  2EJF C;  3DXJ C;  1D5M C;  3EVQ A;  3MXU A;  3GD7 A;  2R6G A;  2L4N A;  5DM7 3;  2E76 C;  2K28 A;  2MP1 A;  3X3M A;  1STN A;  1MD2 D;  2X6L A;  1DOL A;  1WD1 A;  2QKI C;  1EU4 A;  2VNU D;  1MGS A;  3N6R A;  1WTX A;  5JEA H;  1BCP C;  1SSO A;  5KYL A;  3T13 A;  2IX1 A;  2KHS A;  3NWT A;  5BN3 A;  5F2D A;  1PXU A;  3D3R A;  2MJ8 A;  2R3Z A;  5C4Z A;  3FPP A;  3J80 L;  1GHK A;  2TSS A;  4KHZ A;  4OL7 A;  1O78 A;  3S1N B;  3SR1 A;  3QO2 A;  4C2M B;  5IGG A;  2BA0 A;  4KN7 C;  1ET9 A;  1B53 A;  1SEB D;  1QIL A;  4HCS A;  5BN4 A;  5CV4 A;  5KNB A;  2AQ3 B;  2K5D A;  3OHX C;  5M3M B;  1JQY D;  1CA5 A;  3HOU B;  1GHJ A;  5HUR A;  1H9K A;  3I72 A;  3K58 A;  3S1Q B;  3EA6 A;  1RD9 D;  5M9O A;  3TBI B;  1STE A;  3NUC A;  4FF4 A;  3RUZ A;  2F03 A;  1A6X A;  1U9R A;  5C6A A;  3PV0 A;  4RGN A;  2WIN B;  2XRQ D;  2C9O A;  3MEH A;  3T51 B;  4F7X A;  2EVB A;  2A73 B;  1QWY A;  2WV6 D;  3D4W A;  1TS3 A;  4QB4 A;  1GUW A;  2QCP X;  4OO1 G;  5CR3 A;  2NWG A;  5JOB A;  4RH6 A;  3QWN A;  2F0G A;  2F0O A;  4PMB A;  3OMC A;  2F0J A;  1I4G A;  1LTB D;  3NHH A;  1TQO A;  2HUG A;  3RZD B;  1EIH A;  3I8Z A;  3FKI B;  1ZYR C;  1H9J A;  3TP5 A;  3Q0A A;  2HDM A;  1V1O A;  2LS0 1;  4U68 A;  3ZYY X;  2KOL A;  5EKI A;  5EJW A;  4ABN A;  4IUV A;  3H94 A;  1MBY A;  1JOO A;  1F9S A;  1EWC A;  2CQA A;  3M4Y A;  1I3Q B;  2X69 A;  3QIA A;  1CT1 D;  1DXM A;  4ZKC B;  2H1E A;  4QMG A;  3M85 A;  4XYO A;  2Z4I A;  1CZG A;  3QOL A;  4I65 A;  1GUN A;  2NTT A;  1QNU A;  1XTC D;  1OXV A;  1TS4 A;  3FEW X;  3S15 B;  3ERO A;  2IW3 A;  3HZX A;  3J7A F;  5IGB A;  5IOC A;  2RVL A;  1I4R A;  1G6Z A;  4PMW A;  5CC4 A;  3D6C A;  1PRT F;  1TKW B;  4KMU C;  4PQX A;  1ROD A;  1G2S A;  2ICE C;  1E2W A;  3KUP A;  3T53 B;  2F0K A;  1LTR D;  2JSO A;  2IX0 A;  1EOT A;  2EYF A;  2EPB A;  1X3Q A;  2B2V A;  3HOW B;  3OWF A;  1FNU A;  5CV8 A;  1TWA B;  4XQN A;  1SBB B;  3GTM B;  1KAB A;  5ELF A;  3R93 A;  1B44 D;  1L0Y B;  1PFN A;  1NR2 A;  1S5D D;  5HGT A;  2GA4 B;  5EKL A;  4HSP A;  2E74 C;  3A8I E;  2JA7 B;  3SK5 A;  2WB1 B;  2R93 B;  1FD7 D;  3J80 E;  3K5N A;  1TS5 A;  4QCL A;  4IUR A;  1DM0 B;  5IGE A;  1LTA D;  3I70 A;  5IGC A;  1A3T A;  3H6M A;  1KLG D;  3BVM A;  2A69 C;  2YU9 B;  4ZUI A;  3GV3 A;  1EY4 A;  2BDN A;  1EZ8 A;  3OSO A;  3J81 E;  2F0F A;  4KK7 A;  1IYV A;  3KF8 A;  4FXG C;  5CV6 A;  3BDO A;  3NTH A;  4C3I B;  4FF2 A;  2Y0S B;  3OW7 A;  1ILP A;  5DNF A;  3VYU A;  3X3N A;  1UUP A;  2EY2 A;  2EOT A;  4V0B A;  2O4X A;  1T5E A;  1ZYR D;  3NTI A;  3EJI A;  5CBA E;  2PQE A;  1BUV T;  2F0V A;  1E2V A;  4X3U A;  2J7Z A;  5J1Z A;  2K04 A;  3I4N B;  4OGQ C;  5FOB B;  3HKZ B;  4GZY C;  4MIU A;  5EBD A;  3VR3 A;  1D5X C;  3C1E A;  1SYD A;  5CV9 A;  3A8J E;  4CJ2 C;  2B2Y C;  3MXG A;  1HFG A;  5C3W A;  2ZT9 C;  1SND A;  1ZXT A;  3H3V C;  4DU9 A;  3NK9 A;  2RSN A;  5C0X G;  1G2T A;  1ESR A;  2SDF A;  1H9S B;  5E4W C;  5JVH 3;  3T56 B;  2MUY A;  3NP8 A;  3DUZ A;  4UAI A;  2IWH A;  3MTS A;  3GTO B;  3GTP B;  3P20 A;  2E2H B;  4MN3 A;  1A3V A;  1WTQ A;  2OXP A;  4XTC S;  3C3L A;  1EYA A;  3R8B A;  2ICI A;  5M5Y B;  4K5X A;  1JWS D;  3URY A;  4HED A;  2WKD A;  1NUC A;  2F0U A;  1TWF B;  3TZD A;  2PW5 A;  5DEH A;  1IL8 A;  3MA2 B;  3NBI A;  3J7A V;  4WOR A;  3KK7 A;  3P7J A;  1VF7 A;  2WAQ B;  1KDB A;  3CHB D;  4FO2 A;  3BVG A;  1IYU A;  1OO9 B;  3O13 A;  3VYS A;  3P75 A;  1EY8 A;  2O2L D;  3ONA B;  1IKL A;  2F0M A;  3TZU A;  1G91 A;  4RKB A;  2KEC A;  3S2H B;  2A74 C;  1PFB A;  2RKS A;  2XWB B;  4PNY A;  2Q8T A;  4TSS A;  1PTO F;  3HG9 A;  3R2T A;  2B39 A;  1M8A A;  5EPK A;  3PUV A;  5K36 G;  2EYP A;  5C0X I;  2A69 D;  4RFB A;  2J4X A;  2E2I B;  4CKE A;  4XDX A;  2B2V C;  2A68 C;  1SYE A;  1R9T B;  2HDL A;  2EYO A;  2WKC A;  4FXK C;  2RBM A;  2MGS A;  2F0L A;  5EQ0 A;  1WCM B;  3H0G B;  4V19 0;  1H9S A;  1R4P B;  2NBF A;  4RCO A;  4IAL A;  4XYQ A;  1CK1 A;  1PZJ D;  1O7L A;  2NTS A;  1B4O A;  2ID0 A;  3K5L A;  5C3X A;  3Q6S A;  1LT5 D;  1NAP A;  4H13 C;  4NDX A;  1CM9 A;  1Q3L A;  2B2W A;  2KEE A;  1RCV D;  1VMP A;  2PZU A;  2R61 A;  1Q1E A;  4HSV A;  3D6W A;  2EYH A;  4FF1 A;  2FMC A;  5COR A;  5NUC A;  4K14 A;  5EGT A;  1HUM A;  2MHV A;  2OEO A;  4RWS C;  4IFD G;  2K7V A;  2JP1 A;  4XT1 B;  2IX3 A;  3I4M B;  3K0Y A;  1RF2 D;  2N55 A;  3MXN A;  1ET6 A;  3TSS A;  4QUF A;  1HFN A;  2O5I C;  5JVG 3;  2HCC A;  1BNZ A;  1OXT A;  2A6H C;  1HQM C;  1PTO H;  2H4O A;  4WJW A;  4Q5V A;  3A54 A;  2FFK B;  5C5L A;  3GTJ B;  3AU7 A;  1SFO B;  1D2B A;  1KNA A;  5IGD A;  3RLF A;  3K57 A;  3L7Z C;  4F8M A;  1FNV A;  4KD3 A;  3M7N A;  1A2T A;  2KCC A;  1JE4 A;  1FNW A;  4FXD A;  3N52 A;  3E5S A;  4QUC A;  2EY6 A;  4LJZ C;  2D62 A;  4RCN A;  1S5F D;  1MSH A;  1SNQ A;  4A3D B;  2PW7 A;  5G3L F;  4K2L A;  1TU2 B;  1FGB D;  1STH A;  4C56 C;  5I4D A;  4NMZ A;  4CJ1 B;  3FDT A;  1QCB D;  4R8I A;  5FO8 B;  3F2U A;  4UDU C;  4N9P A;  4FF3 A;  4R9W A;  2SNM A;  1E2Z A;  4IUU A;  2JA5 B;  3SVM A;  4LK1 C;  4DAV A;  3DHQ A;  2SOB A;  1ZKO A;  2QIL A;  2QF7 A;  2EJG C;  2WII B;  5A2Q L;  1HTL D;  3BYY B;  4BY1 B;  3J7Y W;  2ZXO A;  4DK0 A;  1VDZ A;  2R92 B;  2NVX B;  1LT3 D;  2K05 A;  4DNR B;  4G7H C;  3S1R B;  5ISR A;  1RKN A;  2XSC A;  2K01 A;  2L9H A;  2JXM B;  2F3W A;  2NYZ D;  5I9P A;  1Q90 A;  5E3F A;  1AZP A;  1SYC A;  2EXZ A;  2NN6 H;  5C0X J;  1F2Y A;  1WTO A;  4K5V A;  4IN3 A;  3A56 A;  4C1N I;  4XIG S;  3TP7 A;  1EZ6 A;  1NR4 A;  2A68 D;  1BBX C;  5CYU A;  5IGF A;  2F0E A;  4Q0F A;  5C5M A;  4KKS A;  2ENB A;  4RGT A;  3GTG B;  4DAY A;  1Y1W B;  3GV6 A;  2EDG A;  3DWA A;  1JOK A;  3ND9 A;  2XRS D;  1CQV A;  2A6E C;  1PTO B;  5ELB A;  1ICW A;  3SE0 A;  1SE4 A;  1JOR A;  1GUG A;  4BY7 B;  1HA6 A;  4HAE A;  1SYG A;  4A3K B;  1CHQ D;  4DN4 M;  3C2P A;  3BDC A;  3D4R A;  1AN8 A;  2MPM A;  1DON A;  1U4P A;  5C4J B;  3CRK C;  1BCP D;  4HMI A;  4A3G B;  2KED A;  4EGV A;  3EQL C;  2F0Q A;  4CKB A;  2NVQ B;  3GQB A;  4OO1 I;  4IUQ A;  1PDQ A;  3DM1 A;  3GTL B;  3OMG A;  2E2D C;  3OWE B;  2A6H D;  4K8J A;  3G6J B;  5I9O A;  3BS1 A;  3WOE A;  3U9O A;  3OIP A;  4K8I A;  2RSO A;  3K59 A;  1I50 B;  2EE1 A;  3PIP 3;  2LMC B;  1YNN C;  1TWG B;  3LWU A;  2BE5 C;  1XYI A;  1SXT A;  4K6L A;  2AWO A;  1A2U A;  1LT4 D;  3BVZ A;  5T1I A;  3QB3 A;  1WTR A;  2KA7 A;  1I4Q A;  4Y7N B;  1WD0 A;  1IHZ A;  2B2W C;  4ME5 A;  1ESF A;  3NPP A;  2B2U A;  3PUY A;  3CRL C;  3QJY A;  1OXS C;  4C3I G;  3L3O C;  4G7O C;  2RDH A;  3G7L A;  2D5D A;  4A3I B;  2A5H A;  1S5E D;  3W2D A;  4ZUJ A;  3RMH A;  5KNC A;  2D9U A;  2B8F A;  2LKV A;  2KVM A;  4DK1 A;  1VMC A;  5E4X A;  4DXF A;  1EEI D;  4KY6 A;  2NVT B;  1A3U A;  2DNE A;  3PUW A;  3HRZ C;  4U67 3;  1PRT C;  3S17 B;  3P1H A;  4S3S A;  2RA4 A;  3KLS X;  2XNA C;  4XQJ A;  1STB A;  4KKU A;  1RTN A;  5DAU A;  1O7Y A;  2KCN A;  2K03 A;  5CV5 A;  3T4A C;  3H09 A;  3MHB A;  3FMC A;  4WRD A;  2ZXR A;  2AUJ D;  1R4Q B;  3OPO A;  1ZEQ X;  4IQZ A;  3MXP A;  4J8Q A;  5T1G A;  2FHT A;  4C3J B;  3S16 B;  3UI2 A;  3OOC A;  3MC0 B;  2B8G A;  4B9W A;  1JIC A;  2IL8 A;  2LFN A;  2K33 A;  5I6W A;  1F77 A;  5I2X A;  1DD2 A;  1I6H B;  3C46 A;  1I6V C;  1B3A A;  3DMU A;  3SK8 A;  2F0D A;  1BOS A;  1TR5 A;  3IFT A;  4C1N K;  1U4M A;  1DOM A;  1RDP D;  1STG A;  3H91 A;  4DF7 A;  4K2K A;  3D8G A;  1NCV A;  5A2Q E;  1X3P A;  1Q1B A;  2X6G A;  4HTH A;  3QOJ A;  4RGM A;  3L9A X;  4LMQ D;  1Y1V B;  2IT1 A;  2F1M A;  1TS2 A;  4LAA A;  3WDN A;  3PUX A;  3CKI B;  5M5W B;  1HXY D;  5ELC A;  2G9D A;  3MVV A;  1KTK A;  4A3F B;  4ULL A;  2CW0 C;  1GUS A;  5I6Y A;  1W6J A;  1D6E C;  1M4V A;  3V05 A;  4K6D A;  1ENF A;  3Q23 A;  1WTW A;  2BA1 A;  5M3F B;  3SEB A;  2B63 B;  1LO5 D;  4KKT A;  1KDA A;  1NSN S;  2HCI A;  2PNR C;  2XWJ B;  4KN4 C;  2F0N A;  1EFI D;  5KRU A;  2WP8 J;  1GOZ A;  1O80 A;  2ZXP A;  3VYT A;  2C5C A;  1D1K A;  2VUM B;  1YNN D;  1VF5 C;  1EY5 A;  1LV9 A;  4H44 C;  2SEB D;  4K5W A;  3MFG A;  1S5C D;  3GP7 A;  1BXT A;  2NB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...