1NR4A

High resolution crystal structures of thymus and activation-regulated chemokine
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
67
structure length
67
Chain Sequence
b'RGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymus and activation-regulated chemokine
molecule tags Cytokine
publication title Structures of thymus and activation-regulated chemokine (TARC).
pubmed doi rcsb
total genus 13
structure length 67
sequence length 67
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2003-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1nr4A00
3I8ZA 4LMQD 4R8IA 1M8AA 1EIGA 1BBXC 1BF4A 2HDMA 3IFDA 2L11A 1XX8A 2K01A 1WTXA 3ONAB 1HHVA 4ZLTF 2B2WC 1PFBA 1G91A 1E0BA 1ICWA 4OIKA 2DY7A 1HFNA 1MI2A 1NAPA 5CORA 2L1BA 2B2TC 4QUFA 2FFKB 1X3QA 4IUQA 5D14A 2NWGA 2MJ8A 5EPLA 3KBXA 4ZKBB 1WD0A 1AP0A 1F9SA 1O7ZA 1U4LA 2MGSA 1PDQA 2N55A 3I90A 4RWSC 3UI2A 1ILPA 1B50A 1C8CA 1X3PA 2L12A 1WD1A 1PFNA 1G2TA 1ESRA 1JICA 4X3SA 1WTVA 1EQTA 2EE1A 4HSVA 3MWYW 2NYZD 1X32A 1QG7A 1F9RA 1IL8A 2KEEA 4CJ2C 5AFWA 2L4NA 2KUMA 3LWEA 3TZDA 4X3KA 2RSNA 1DOMA 3GV3A 4XT1B 1LV9A 4IURA 4XT3B 3P7JA 1RODA 3TN2A 1NR4A 2X69A 2H1EA 1Q3LA 3HP3A 4NW2A 1RJTA 1CA5A 1IKLA 1KNEA 5JJZA 5CBAE 2FHTA 2HCCA 3FDTA 4IUPA 1WTRA 1QNKA 2BDNA 1AZQA 1MSHA 1DOKA 2K1BA 1J9OA 1QE6A 2SDFA 4ZAIA 1WTOA 5E4XA 1PLFA 4IUVA 1DZ1A 4ZK9B 2K05A 1RTOA 3G7LA 2HCIA 5EPKA 1O7YA 4IUTA 1PFMA 1SDFA 1S4ZA 2DY8A 4QUCA 4R9WA 1RHPA 2D9UA 1SSOA 2B2YA 1B53A 3D6WA 5T1IA 2B2UC 1B2TA 5EQ0A 2JP1A 4HCSA 5EPJA 5E4WC 1HRJA 2KEDA 4CJ1B 1MGSA 1U4MA 2K28A 4OIJA 3KUPA 1G6ZA 1ML0D 5T1GA 3N52A 1ILQA 1GUWA 2B2UA 2XIWA 4RA8A 1HUMA 2M2LA 2FINB 2Q8RE 2FJ2A 2MPMA 1DONA 1WTPA 1HUNA 4DN4M 4UAIA 5CMDA 2FMMA 3R93A 2J7ZA 3SVMA 4IUUA 3H91A 1U4RA 2B2VC 2K04A 2JYOA 4HEDA 1NCVA 3FPUB 1NR2A 4X3TA 3DEOA 4RAUC 4U68A 2KVMA 1BO0A 1BNZA 3IL8A 2VXWA 1B3AA 4XDXA 4ZKCB 1DOLA 1EL0A 2B2WA 1ZXTA 4HAEA 5EJWA 1JE4A 1WVLA 1B4OA 2R3ZA 1J8IA 1SAPA 2L9HA 4X3UA 1F9QA 1F2LA 1A15A 1AZPA 5D65A 2N88A 2B2TA 2HUGA 4MN3A 1F9PA 4O42A 3I3CA 2B2YC 1WTWA 2KOLA 2MP1A 1VMPA 2KECA 1EOTA 2X6LA 3DM1A 3MTSA 4MHEA 1U4PA 3DEPA 3I91A 2EPBA 1VMCA 2K03A 1KNAA 2EOTA 2IL8A 3F2UA 5EKIA 1XYIA 1IKMA 1HA6A 2HDLA 2RA4A 3GV6A 2RVLA 2NZ1D 1G2SA 3QO2A 5CBEE 5DNFA 1HFGA 5COYA 1TVXA 1O80A 2RSOA 1WTQA 1CA6A 2CVRA 3Q6SA 1MSGA 1RTNA 2X6GA 4CJ0B 2B2VA 1CM9A 1EIHA 2Q8TA
chains in the Genus database with same CATH superfamily
3A8KE 1M8AA 3PCOB 1BBXC 2HDMA 2VL6A 4NMZA 2EYHA 4QF4A 1DD2A 4J15A 3D4DA 1XMOQ 5GROA 1GOZA 4HJ8A 2RDGA 2MJ8A 2VB2X 1NMGA 2K5QA 3I90A 2XGTA 1PH6A 4FF2A 3QJYA 1HCZA 3BJUA 5EBCA 4IPHA 2R92B 4IZ8A 1JC7A 4CDDC 3AB9A 4EGVA 3S2DH 1YITA 2P5ZX 2G9DA 1WCMH 1N9WA 1Q7YC 1AN8A 5KNBA 5GADC 3HOVH 2E2IB 3HOZG 5C4XB 1WTOA 4KTAA 1LTLA 1XWEA 3VA5A 4DR6L 3G7LA 2QGQA 4RHSA 1HNXL 5J3BA 1Q90A 2WB1B 1PTOD 2R7DA 2EYJA 4A3IH 2B2YA 5M5YB 3E6ZX 4K6DA 1F2MA 1HRJA 4CJ1B 4L8JA 5IGCA 1MGSA 3HFZB 3CC4A 1HNZL 5IYDG 4EVOA 1K9MC 4KHPL 1VF5C 1LTID 4AYBG 4EX5A 2MPMA 1DONA 2VUMG 4NB3A 1SNMA 1PA6A 4H13C 1TS5A 1I50H 5BR8Q 1K8OA 3WWVA 2ZM6L 3SXHA 2EYMA 4LFAQ 4DNIA 1N32Q 1YI2A 2MQHA 2A69D 2JA7G 4LF5L 1SE3A 3K7AH 1B4OA 2R3ZA 1J8IA 3G6JB 1G51A 3L9AX 4DFAA 4HTHA 3A0JA 1WJJA 2NVYB 4LF9Q 2B2TA 5ELNA 3DWQA 1EOTA 4UDUC 1OXTA 2QDLA 5CV4A 2EPBA 4ME5A 3OMCA 2RKSA 1C0AA 1HNWQ 4GLXA 1RIPA 4BS9A 3DXJC 3PIOA 2YYZA 1VQFA 4A3JG 2X6GA 4ABNA 4A3DB 3FKIG 1EY5A 4R8IA 1GD7A 5L37A 3ONAB 3Q0AA 4IJHA 4JV5L 1STBA 4OIKA 3H3VI 5C3XA 5C4XH 3D0FA 1KL9A 5JVH3 5IT9L 4WJWA 1X3QA 4ODGA 1WD0A 2DN8A 5FJ8G 3NBIA 2PCFB 5IT9c 4A3MG 1JB7A 2KHJA 1X3FA 3I4MG 2E2IH 2B63G 1JICA 2D0PA 2NZHA 2Z4HA 3C1FA 3QG1A 5KYLA 3G71A 3H15A 3NSWA 3IAYA 4OO1I 4DV7Q 2NVTH 3VYUA 2LS01 2WKCA 4OO1H 4UY8C 1STNA 4DXFA 3N6RA 5IY0A 2E75C 3OMGA 3T1HQ 2NN6I 1I3QH 3HOWG 3A7LA 3NHHA 4POFA 1LT4D 4IUPA 4JI0L 3K8AA 2UXDL 3GTOB 4IFDI 4KN4C 4FF4A 4A3EB 5DM73 1FNVA 4NXML 1I50B 1V8QA 2DJFC 5FJ8H 4BXXG 4LF8L 2QF7A 4HSPA 1CKMA 3GTQB 3S14H 3VA7A 1EU4A 1MIUA 3BZKA 3EA6A 3N52A 5C5LA 1SFOB 2LMCB 4LF6Q 1ZYRD 4PMBA 4DR4Q 1D6EC 2WINB 1B70B 4DV6L 3MFGA 5D3DA 3UDXA 1CKNB 2IW3A 4IUUA 3HOVB 1D1KA 2JYOA 4J1MA 2QA4A 4QY7A 1PH9A 1L0WA 2VUMB 4ZKCB 4RGMA 5KNDA 4AH6A 1HJPA 2GA4B 4X3UA 1F2LA 1YBYA 4G4KA 1LLRD 2AKWB 4S3SA 1EOVA 3P75A 2B3GA 3MHBA 2DGYA 4TQUS 1M4VA 2UU9L 5IP7H 3EFXD 5ELOA 1OXVA 2LSSA 3CP0A 1KRSA 2ALYB 3PUVA 2BE5D 2B2VA 1Q8IA 4X64L 1SE4A 3DM3A 4C1NK 1AH9A 3LNNA 3T1YL 1JOKA 2KCCA 5CGKA 5BN4A 2BA1A 4B3SL 3OPOA 5D14A 3HKZG 5I2YA 1W2BA 1R9TB 3S1NH 1DYQA 1ILPA 2L55A 1C8CA 2K14A 4C2MB 1H9RA 1Q12A 1K0SA 1TWCH 4YCUA 3RZOH 4X62Q 1IL8A 1H9JA 5AFWA 2AUJD 2B63B 4DR5Q 2XTIA 3RR5A 3T4AC 1V1QA 3MC0B 1YJ9A 4F7XA 1BVSA 1E3PA 4DUYQ 3GTMH 1SNDA 1I6HH 3FRPB 1QUQB 3K5OA 4IOAA 1CHQD 1EEFD 5LMNQ 3AQQA 2JE6I 2CW0C 4UP9A 4JI7L 1JOOA 4QMGA 1B3QA 1O7YA 4C3IB 1WOCA 4GLAC 1DJRD 2D9UA 3JAMi 2OEOA 4DR3Q 2B2UC 2O2LD 4WORA 3BU2A 1VQPA 2R61A 3KJPA 3FPPA 1JCKB 1A2UA 4HIKA 2PMZB 3STBD 4A3FG 4K0KQ 1SJHD 3NENA 4JPBW 3D31A 1J5EL 4I7AA 1SBBB 2AWNA 4KKTA 4BA1I 4IALA 5C4JH 3ND8A 3NBHB 1NCVA 5DEHA 3C46A 5I9PA 3J7AF 4KK7A 4L5SA 1JR0D 1E22A 3GTPB 5D65A 1EY4A 3PIPA 3KFUA 3DEPA 3S14B 1KNAA 1FVIA 1N34Q 2I5MX 2Z6KC 2EYLA 3TBIB 4DV1Q 5DM63 2R7FA 3RZOB 1QWYA 1MSGA 2PZTA 2A69C 4KY7A 3CCSA 2PMZE 1XMQQ 2EVBA 3K5NA 3FKIB 2RHSB 4LF7Q 3H0GB 3MXGA 2UUAL 4C1NI 4K5VA 2JQOA 2B2TC 5ISRA 5C3WA 3HKZE 4BXXH 3HOYB 1A3TA 2MGSA 1CSQA 2NTTA 5ELDA 2OTJA 2N55A 3S15B 4A3IG 1FJGL 3FKIH 1EZ6A 3VR5A 1IBML 3MWYW 4DNTB 1ZKOA 2DNEA 1SNCA 1UWVA 1CTMA 3CPWA 1QUQA 4FXKC 5F2DA 4X6AH 4BA2I 3PO2G 4R4OA 1I3QB 4DA2A 5C3EB 4RGNA 3HOYH 4PV1C 2V4DA 4A3BH 1PVOA 2F0UA 4R8NA 3ER0A 5FLXE 3TEHB 1XNQL 1BQQT 3CCUA 1R9TH 4LAAA 4APVA 3BZDB 1HNXQ 3IRBA 1SDFA 1B9NA 2BH8A 2K4KA 1SSOA 2A6HD 1B2TA 1PH1A 3OW2A 2XRQD 1PH4A 1Y1VG 3KDFB 2KHSA 1TU2B 2XIWA 5CV8A 4JYAQ 4BY1H 2FMMA 5EAYA 3CCVA 1L2FA 4RKBA 3NUCA 4TRDA 4LFCL 1YNXA 1BO0A 1PZID 3EVQA 3K58A 3C2PA 1VQ9A 2HT1A 1QILA 4QCLA 1II3A 3P20A 4JI1Q 4AYBE 3GTKH 1JOQA 1GO3E 1JORA 4N8X1 1N8RC 1K28A 4DUZL 2K5VA 3KF8A 3MXNA 2F0FA 3ULJA 2NN6H 3QB3A 1STAA 3W5OA 3CMEA 2F3VA 4DV5L 1HFGA 5COYA 5M5WH 1B7YB 2RSOA 1UEBA 3S17B 3VYSA 2AHOB 1E24A 3M9BA 3PUYA 1B1ZA 3SK4A 1CM9A 5J39A 4B3MQ 2ZJRA 4IOCA 3R3OA 3EBEA 5IP9G 3OIPA 4FNFA 1XX8A 1GXDC 1KLGD 4KY6A 2PQAA 1MD2D 2L1BA 1I4PA 1ONLA 3W1GA 4XIGS 5IP7G 1VQOA 2F0JA 2NWGA 2ATWA 3TS2A 2IWHA 3UDGA 4A3GH 3LX0A 4JI5Q 5K36H 2NVXH 1D5MC 1G6PA 2EYFA 3M3YB 2AWOA 4Q0FA 1BXTA 2BH2A 4FXDA 2NN6G 1ZEQX 3UE0A 4X3KA 3PUXA 1R4QB 3CCRA 1Y1WB 4Y7NH 4HIMA 3T1HL 1IKLA 1KNEA 1EZ8A 1CI3M 3FDTA 1TS3A 1UE1A 1ENCA 3OOCA 3RZDB 1SYGA 3NP8A 2KHIA 5C3EG 2XNAC 5FKAC 1XTDA 4FDBA 5ELBA 5JEAJ 4P75A 4A3GG 1OXXK 4LF5Q 2YU9B 2YTYA 5KNCA 1JQYD 4LF8Q 5K36G 3TRZA 1AFPA 1N33Q 2R93H 4EQPA 2YV5A 1ET6A 4DV4L 4OX9Q 1PV4A 2Q8RE 4A3FB 4LF6L 1TQOA 1WTPA 2I07B 2G9HD 5M5XB 3CRLC 2J7ZA 4HN7A 1M90C 2FMCA 4X66Q 4DR6Q 2PPBC 3PIO3 3KLSX 3PO2B 2AUKA 3X3NA 4NKLA 2VQFQ 4LUZA 5LL6S 2OQ0A 3URYA 3I70A 4JI8L 4PZ6A 1JE4A 4KD3A 1C48A 4CKBA 3I4MB 4A3DH 2QDBA 1QVFA 4NDXA 4MHEA 4C3HB 5FLMG 1MBYA 1WCMG 3TP7A 2JA6G 3F2UA 1LM0A 1V1PB 5BR8L 2HHHQ 1EIYB 1G2SA 1GM5A 1C7YA 4LFAL 1EWIA 4HJ5A 3X3MA 1Y1VB 4LNQA 4ZUIA 2O5IC 3GO5A 3SR1A 2B8GA 1BBWA 1EIGA 2L11A 3H0GH 2Y0SB 5M3MH 2F0TA 4BBSB 5IIFA 4A93H 1TR5A 1XMOL 1O7LA 2ASBA 1HFNA 1P8LA 1S40A 1CFMA 5IE8A 3KBXA 5GAHC 4YWLA 2E5LQ 1WTHA 1SR3A 2EY5A 2KENA 2RDHA 1L1OA 3BVZA 3CAMA 3NWSA 2UUBL 2ENBA 3JAMc 2CH4W 1I94L 2D0OA 1QCBD 2AQ3B 2D5DA 1KLUD 1TIID 2L4NA 3TZDA 3T16A 1K8GA 1DOMA 3MXUA 4L6TB 2E2DC 5M5XH 4XT3B 1QVCA 3P7JA 2X69A 1QJOA 1ENAA 4CDCC 2HCCA 4HIDA 4V0BA 4XQNA 1AZQA 4HMJA 1QVGA 1LTRD 3T13A 4HMIA 4IUVA 2K32A 5JPMC 4GOPA 4X65Q 3MFYA 3S1MH 4IUTA 1S4ZA 3FMCA 3D4WA 4EQOA 5IGFA 5EPJA 4JI4L 1PZKD 4MZ9A 1L0YB 3VDYA 3U9OA 1U0LA 2K28A 1HNZQ 4IO9A 1S3OA 3AFPA 2MO1A 3SEBA 1K8AC 1A8VA 1Q1EA 4DNRB 2M2LA 5BN3A 1KHIA 2NVYH 1ASZA 4WFN3 2Z6BA 4GN3B 1NBWA 3S1MB 1W3SA 1SMYC 3RUZA 3DEOA 3NWTA 4U68A 4KMUC 2PNRC 3IL8A 1EYDA 3TREA 5M3MB 4BBSH 3DUZA 2OF1A 2L15A 1STGA 1YVCA 4X64Q 3LWUA 2CH4A 3I7FA 1AZPA 1O78A 5M5YH 2BE5C 1A3VA 3OWEB 3I4NH 2DNCA 2E2JB 3GD7A 1IYVA 4BY7G 1VCIA 3RLOA 4P2CB 5KIXA 2J0TD 2N3SA 1EY8A 4PMCA 1TVXA 1W6JA 5KEEA 1E2VA 2F0HA 3PO2H 1U5KA 4A3CG 1GHKA 1XMQL 3BG3A 3HOXB 3J80E 2Q2HA 3IFDA 1HXYD 4ZLTF 1LO5D 1SXTA 2J4XA 1D8LA 3KDFA 1PRTF 4LW1A 4YCVA 5HY6A 3CF5A 5CORA 1EEID 1K83B 4C2MH 4DUYL 3OW7A 5I6WA 2R6GA 3MEFA 4DK1A 4L5RC 1BCPF 2F0QA 4B3TL 4P71A 1PDQA 3F2DA 4DXGA 1I4RA 3AEVA 3CMAA 2Z6KA 4DF7A 1S5DD 4JVZA 5IP9H 1X32A 2BOSA 1Y1VH 1G291 2JA6B 1T9HA 1PH5A 1KDCA 4DK6C 1JWSD 3G6EA 1RODA 4RFBA 1TWFB 3KK7A 5IT9E 4A93B 4RH6A 1H9KA 1SEBD 4K0KL 1P16A 4RGOS 3H94A 2A8VA 2BDNA 3ICEA 2SDFA 1STYA 5FK9C 3K0YA 2EXZA 4ZK9B 4WJ4A 3CCQA 4LF4Q 4RCNA 2F0DA 1BCPC 5EQ0A 3DWPA 2JP1A 1MJCA 1Z9FA 5I4DA 4POGA 1C4QA 1LABA 1EY7A 3U4ZA 3TMEA 2C35B 4DR4L 3HEJA 1NUCA 2A5HA 4JBJA 2CWPA 3TDQA 3H0GG 2K04A 5JJLA 1NR2A 3BVMA 3GTPH 3A74A 2LXKA 1K73C 1D2BA 3CD6A 2IY5B 3GTGB 3EROA 3A55A 3KYHC 2G5DA 2A73B 1MKHA 2ICIA 5IGEA 4LF7L 2B2YC 2KECA 1YZ6A 1B44D 2WAQB 1IHZA 4FXGC 2EOTA 1J5EQ 3M4PA 2L5TA 5E3FA 1VQDA 4JCVE 3QO2A 4AQYQ 1K83H 3FEWX 5DLQE 3CXCA 1MHWC 3S15H 3CW2C 3J80L 2Z8LA 3A5UA 1S5ED 1C9OA 3C1EA 1Y8NB 1SYBA 1CQFA 2NBFA 4G7OC 3S1RH 4CKCA 4B3SQ 1JJ2A 4CHTB 2M9VA 4OGQC 3BS1A 3BYYB 4HJ7A 4XTCS 5EPLA 1AP0A 1EYAA 4DV1L 3VR2A 2KCMA 3UI2A 5J1ZA 1YNND 5LHY1 2JK8A 2AQ1B 3RMHA 1FNWA 1I6HB 1A3UA 1ESRA 2BCOA 4X3SA 5EBDA 4N9PA 3J7ZC 4KHZA 4DAYB 3DLLA 1V1OA 4DV3L 1BCPD 3W1BA 1VQBA 4C3JH 3U9SA 4IURA 1QZGA 4XYQA 2VZAA 2UUAQ 1Q3LA 2A6HC 4GS3A 1EY6A 3K59A 1LT3D 4JYAL 1V1PA 2ZTDA 3J81L 1FGUA 3TP6A 4LFCQ 3PF4A 3S1NB 2K05A 3I55A 3PO3B 4GKJL 5C4JB 3KJOA 1YHAA 2Y0SE 3ERSX 5HGTA 2A6EC 5CV9A 4HCSA 4K2LA 4IPGA 4P74A 2KJXA 2CCZA 3GTGH 3G4SA 5JEAG 2JA5B 4DV4Q 1HUMA 2H4OA 1CZWA 1KDBA 2F3IA 4O0AA 1SYCA 1LT5D 4UAIA 5JJKA 1IBLL 1K8MA 1BDOA 1OXSC 4HR7B 1X56A 5M9OA 5IYDH 1LUZA 2KVMA 3WDNA 2OCEA 5M3MG 4DAPA 4JI8Q 3I73A 1KIXA 2L9HA 2A74C 3OIQA 3CCLA 3S24A 1Y1WG 4OEMB 2EJGC 1VQLA 1Z6HA 3GTLB 3H3VC 5I2XA 1JMCA 1YEZA 2QKIC 5M3FH 2HD3A 3K81C 2MNAA 1SNPA 1PH8A 5JPNC 1TWAH 1LACA 2HHHL 5IWAQ 4JI5L 2Y0SG 4A3BG 4U673 1NSNS 4FP5D 4DPGA 3KF6B 1PXUA 1V43A 1PHJA 5FLXL 4RMFA 2OQKA 5ELCA 2ZTCA 1W6KA 1CK1A 1PMRA 4MNOA 1WTXA 2PI2E 3K80C 2UXBL 2CW0D 2B2WC 5CV6A 4PZ8A 4A3JH 4JC0A 3MAQA 1KXLA 4YHHL 2PI2A 4IPDA 4BBRB 1N36L 1LTBD 2RCNA 2PQAB 5LMUL 4ZKBB 1UEAB 5GQOA 1TS2A 1F9SA 5C44H 3O13A 1B50A 4A3KG 3AMUA 3PQIA 1EQTA 2EE1A 4GN4B 4OWWB 1I94Q 4Y7NB 1SRUA 1DM0B 1UUPA 2IX3A 2HIVA 5C0XH 3HGBA 3GV3A 1N33L 5CC4A 1HZBA 2VB3X 1J6QA 5C4HA 4FVMA 1WCMB 1EYGA 2FHTA 4DAVA 3A56A 1GHJA 1WTRA 1HA5A 1MSHA 1DOKA 3CKIB 3E9IA 1XNQQ 1XXGA 1PLFA 3NEMA 1DZ1A 2A1AA 3HKZB 1I4QA 3BYTB 1TWGB 1Q86C 2HCIA 1A0IA 3I2ZA 1AW7A 3W3AA 2PNHA 2EYPA 1UE5A 4JI4Q 3FHWA 2IHFA 3NXWA 1ML0D 1IZ6A 1CKOA 1HH2P 1VQGA 1EUJA 4YWMA 4ZCKA 3QOLA 5A2QL 1VQKA 4FF3A 3H91A 4DAYA 4HJ9A 2WB1G 2O5JC 3S1QB 1VQMA 3DMUA 3M4QA 1RF2D 1YHQA 4IFDH 3CU7A 4XDXA 1I4HA 5I6YA 3RNUA 1ZXTA 4HAEA 3WOFA 1HQRD 3I4LA 1TT2A 2WP8J 3GTJB 4EQ5A 1A15A 3F8TA 1HZCA 4R4CA 2B29A 3R2IA 4DGZA 3M7NA 4KD4A 3KOJA 4LFBL 2OTLA 4I7ZC 1PTOC 1Q1BA 2RQXA 4X66L 1F2ZA 3RN2A 2E5LL 4DV5Q 2RVLA 4IN3A 2V1CC 3NE5B 1Q81C 4DR7Q 1WTQA 1G8ZD 2UUBQ 2LKVA 3CQZB 1IXRA 4CDEC 2PZWA 3EN2A 5FOBB 2GVBA 2JA5G 3KF6A 3I8ZA 4DV0L 3L7ZC 3ZYYX 3L3OC 1LTSD 4NXNL 1HHVA 4BY1B 1VQ7A 2I0QA 1EQVA 1ICWA 3L0OA 1H95A 4YIJA 2ZTEA 3FVQA 1X9NA 5ELEA 2K5NA 2WB1E 3FP9A 1TY2A 1GUNA 1VQAA 1TWGH 1O7ZA 2VY3A 4B3RQ 2L12A 1WD1A 5FO9B 4A3LG 2JXMB 3V2TA 1ET9A 1L1OB 1WTVA 2NYZD 3GTKB 1PTOF 2IX0A 1EYCA 3HOZH 4CJ2C 2KCNA 5EKKA 3NQTA 1EU3A 2JA9A 1JB3A 1CA5A 1OTCA 3GTOH 1RL2A 2SEBD 4TSSA 3U4VA 3PUZA 4QL5A 1VF7A 3MXPA 1Y14B 4F8MA 1CUKA 3HRZC 2NVQB 4LF4L 2K50A 1TKWB 4BY7B 3M3YH 5C4XG 1L1OC 4H02A 1IW7D 1DCZA 4O1NA 1EWHA 4L63B 3VR4A 3NTKA 3TS0A 1F2YA 3KUPA 4KKSA 4A3MH 3E0EA 4XQQA 5A2QE 1KAAA 2F0EA 3SGIA 5CMDA 2E2JH 1SFOH 2N49A 2B2VC 4AIMA 5KRUA 3S2DB 4X65L 4K5WA 4HCEA 2F0LA 1FL0A 3KLRA 2QEXA 2PW5A 3M85A 3D8GA 2WAQG 2Q8IB 3U58A 1D1IA 2IT1A 2MO0A 2XVSA 1F9PA 3M4OH 1RCVD 1S5BD 3UE1A 2R93B 4CGYB 3RD4A 4ZRZA 2F0NA 3S17H 2E76C 3HOUB 1GUOA 1XPRA 4C3IH 4DV2Q 1O80A 3IKJA 5K5PA 4UP7A 4DAMA 4CJ0B 2EY6A 2ZXRA 3S1QH 2D62A 1QNUA 4OWTB 4ZQ3A 2UXCL 5IYBG 2HIXA 4MIUA 1G91A 1PTOB 3QIAA 1E0BA 1VQIA 5IYCG 3I4MH 4QGUA 2F0KA 5LMNW 2JSOA 2A6ED 4IUQA 3G48A 1XJVA 1YJWA 2NVXB 2K5WA 3E0JA 4RWSC 1NJIC 4K5XA 4JI6Q 4A3KB 3T53B 1G2TA 3PGZA 4PQXA 1YNJD 3CQZH 4A3MB 2KEEA 4C3IG 3PUWA 3LWEA 3K7UC 1E1TA 1X54A 5TSSA 4M1UB 3SHLA 2F4VQ 1DGSA 1F77A 2H1EA 1PH3A 5JJZA 1GUSA 5CBAE 2EJMA 5C44G 4A3KH 1BBUA 2K1BA 3MZ5A 4K2KA 1TWHH 3ULLA 2OWOA 2F1MA 4G7ZC 1STHA 4G7HC 3AFQA 4A4IA 2R7ZH 5IGGA 4EQNA 2DY8A 4QUCA 4LWCA 4JI3Q 1QOHA 1VDZA 5C0XG 3M7GA 3RN5A 1Q46A 2NUCA 1XNRL 3J80i 2N8NA 1H9SA 4OIJA 1GUWA 2WFWA 1VQ6A 2I46A 4RA8A 2A19A 2FINB 1EQRA 4JOIC 3PSIA 1UAPA 1TWHB 2XWJB 1B9MA 3BVGA 4E6IA 4FF1A 3T51B 1U4RA 1IBLQ 2CFMA 4B9XA 3JAML 1DXMA 4KLKA 3OTOQ 1HR0Q 3RLFA 5E1FA 1TS4A 1VS0A 4OO1G 1LTAD 2XN9C 5EJWA 3K0XA 1SAPA 2JEBI 1F9QA 3BDOA 2NTSA 1ENFA 3K6OA 1HTLD 4MN3A 2R7ZG 1WTWA 3EQLC 1HZ9A 2KOLA 3HOWH 4IPCA 4A3BB 4H44C 1ZYRC 3I91A 3J80c 1YJNA 1WI5A 1WFQA 2IL8A 3S1RB 1KQSA 3A5ZB 1IKMA 3IFTA 2HDLA 1HA6A 3GV6A 3I4OA 1LT6D 2NZ1D 2JN4A 4IFDG 5IODA 3B6YA 1IBKQ 5FO8B 3CCJA 1RTNA 5KYIA 4GKKQ 1X3GA 1VQ8A 2Q8TA 3VYRA 4BBRG 2GVAA 1BF4A 1EFWA 2A68D 1JJGA 2JJQA 1Z7TA 2UXBQ 2EYOA 4KJNA 1T5XD 2YU9H 3NPPA 3KBGA 2IJ0A 3D4RA 3RLNA 1N36Q 4C56C 4B3TQ 4RHRA 1U4LA 1BR9A 4GNXA 3EJIA 1CHPD 1D7QA 4JBKA 1VQHA 2EIFA 4N9TA 1SE8A 3GQBA 4DR1L 1YHBA 4OHJA 4KI0A 2RSNA 1NNXA 4DR2Q 2NVTB 3ITPA 3BZCA 1YIJA 2VS1A 2AMCB 1K0RA 3MEHA 3VR6A 2TMPA 3D6CA 4ZAIA 1H9MA 5E4XA 4DK3C 2CWAA 4A3EG 5AJ3L 2NB0A 5E7NA 1EY0A 4R9WA 4DV3Q 1B53A 1HPCA 3WOEA 1U4MA 1E1OA 2Q2TA 2O4XA 3UDFA 2B2UA 3GTQH 5EGTA 1QZHA 4HIOA 1QB5D 2K5DA 3SE0A 1KTKA 3R8BA 1ICFB 3SVMA 2VQEQ 5GAEC 3HS0C 3AU7A 3FPUB 3S16B 4RGTA 2F4IA 1B3AA 2OT2A 4YY3Q 3K57A 4A76A 1FNUA 4G57A 2CKZB 2WACA 2Z9HA 4LJZC 4LF9L 2UUCQ 3KLWA 2BA0A 3MTSA 3MA2B 2KQ3A 4CKEA 5C6AA 3J81i 3I56A 4GNXC 1EWCA 1NE3A 2LY7A 4A3JB 3ULPA 2F0SA 4A3LH 2RA4A 4A3DG 4AQYL 4P72A 2JA8B 4DR7L 4H0LC 3NK9A 2VW9A 5FLMH 2EXDA 4LMQD 4DV0Q 2KA7A 5JOBA 4R4QA 1EQQA 4LUOA 4A3FH 4NXNQ 1PZJD 4JV5Q 2SNMA 1MI2A 1K3BC 2K75A 3J81c 4JI2L 4WJ3M 2L0CA 4QUFA 1LYLA 2R93G 5D3IB 4A75A 4GLVB 4YCWA 4IUNA 1PFNA 3NBHA 5HURA 5FO7B 3K5LA 3HOYG 4PG3A 1TXYA 2ZT9C 5G3LF 2CQAA 1I4XA 2KUMA 3PO3H 1BUVT 5CV7A 4XT1B 4FYDA 1XPUA 1VQCA 1NMFA 1NR4A 1JWUD 1I6VC 3Q23A 2E2HH 1SJED 5LMUQ 1BOSA 1QNKA 2SOBA 2OXPA 2F0GA 1Q82C 2ZM6Q 1OXUA 1RTOA 4GKJQ 1JWMD 1N32L 1PFMA 1KAWA 1S5CD 3D6WA 1SYFA 3BDCA 2MHVA 3S16H 4JG2A 1VQ4A 1UE6A 1PH7A 3H3VH 5JJIA 1NTGA 3E5SA 1ILQA 4GOPB 3F1ZA 3E9HA 4K8JA 3HOZB 4JBWA 3V05A 2F3WA 2F0WA 2FJ2A 3BDLA 3OSOA 3J81j 4MTKA 4LFBQ 1D5ZC 4A93G 1HZAA 4Z9CB 3EIVA 1HNWL 4ZUJA 5J22A 2M00A 4X3TA 5EKLA 1LTTD 4A3GB 1NY4A 4RAUC 1BNZA 2VXWA 3NTHA 1JJCB 4C3JB 4XQJA 2B2WA 2EQSA 3CPFA 2N88A 5DAUA 1EY9A 3SK8A 3STBC 5KGUA 1AE3A 3I3CA 1FGBD 3K7AB 2MUYA 2MP1A 3OHXC 1A62A 1VQEA 2YTVA 4UPAA 3J7A5 4KJOA 4BBSG 1VMCA 2K03A 3TP8A 3CCMA 1M1KC 2ES2A 5H1SE 2F03A 4K6LA 3R2TA 2R92H 5IWAL 2F0OA 1XTCD 2WAQE 5CBEE 3OYYA 4F87A 1CA6A 3QOJA 4M8AA 4ALPA 2VNUD 1Z47A 2B8FA 1GUGA 5C44B 1D5XC 2BDOA 1SNOA 4K14A 3VYTA 1UNSA 4DV7L 4GNXB 4KN7C 2JA8G 2LXJA 1PFBA 4H7BA 3NELA 2HQEA 1H9SB 3F2BA 4YHHQ 4OONA 1K3RA 1CSPA 4MTNA 4QB4A 4JK1C 3NTIA 4JBMA 1KRTA 2SNSA 2K6AA 1X65A 2YTXA 1HQMC 2ZJQA 4A3IB 1X3PA 3F2CA 3HOUH 2JA7B 2PW7A 3CC7A 1I5FA 1F9RA 1L0XB 2A68C 2EZVA 4X62L 1IW7C 1LV9A 3ZJYC 4LUVA 5M3FB 4DK0A 1KDAA 1PRTD 5JAVA 5JVG3 2F4VL 3HP3A 4LK1C 1GJXA 1ASYA 5M5WB 1T5EA 5LL6X 4DV6Q 1QE6A 1FR3A 5LMNL 1E7ZA 3NQIA 2QILA 5EPKA 5FLXc 1KC8C 4Y52H 3CC2A 2RHQB 3CCEA 5E4WC 4GZYC 2JA5H 1UE7A 1XNRQ 3QWNA 1KABA 1G6ZA 5T1GA 4A3CH 4KHPQ 3D3RA 2C9OA 2RBMA 2F0PA 5C0XJ 1CKNA 3A8JE 4V190 3S2HB 4FO2A 3R93A 1JT8A 3ND9A 4DV2L 4PZ7A 1BCPB 1PYBA 1B8AA 1SLJA 2F0VA 2Z4IA 2CQOA 4HJAA 1PRTB 5NUCA 3OWFA 3T1YQ 4UP8A 2HUGA 3PV0A 4RCOA 1X55A 3SDZA 4L5TA 1HR0W 3RZDH 3DM1A 3HZXA 4C3JG 3J7YW 2Z1CA 1VQJA 4OWXB 3Q8DA 5EKIA 3PIP3 4PMWA 2WIIB 3I4NB 4JOIA 4DU9A 4C3HG 2PZUA 3J81E 1OO9B 2MFIA 3Q6SA 4Q5VA 2ICEC 2DJGC 2JEAI 1Y69U 3U50C 1VQ5A 1X3EA 4R4TA 4ULLA 2F0MA 4RKLA 4IFDJ 2KBNA 1FYCA 4OELB 4ILWA 1R4PB 3GTJH 1I4GA 5CV5A 1NAPA 5IOCA 2XWBB 2FFKB 4ID6A 4A3EH 1X6OA 2B39A 4GOPC 1WYDA 1RDPD 3HOVG 4B3RL 1LTGD 4PNYA 3PF5A 4NP5A 3HOXG 1RD9D 1VQNA 3L2PA 2E8GA 4KHVA 2ZXOA 3H6MA 4OXPA 2D2CC 4DR3L 4C3HH 2EJFC 3A54A 1BKBA 1PH2A 4BY7H 4IQZA 4QIWB 5I9OA 2E2HB 1RKNA 3VR3A 4DR2L 3TN2A 2JA6H 1Y8OB 1SE2A 4QQBX 4XXEA 1SN8A 1Y1WH 1FD7D 3AYHB 4F88A 4JI0Q 3ERQA 2CHBD 2UXDQ 2R7ZB 3S9WA 2VUMH 1E2WA 5M3FG 2H5XA 1TWCB 1E2ZA 3CHBD 4OL7A 5AJ3Q 4NXMQ 2IX1A 1S72A 1TWAB 4TKOB 1RHPA 1SYEA 2E74C 5T1IA 3TP5A 2JA7H 1SMXA 2C5CA 1Q8KA 3HOXH 2PQEA 3GTMB 5CR3A 5IYBH 5IYCH 1HUNA 3SK6A 4CDFC 4DKAC 5C5MA 1N34L 1AEXA 1EIFA 2XSCA 4JI7Q 3HKSA 2IPKD 2WV6D 4JI3L 3Q22A 1DOLA 2AQ2B 4GKKL 1EL0A 4B08A 3HOWB 4UHVA 2NVQH 5GAGC 2ZJPA 2K7VA 3E3XA 1YNNC 2LFNA 4O42A 2N78A 3TQYA 1Y8PB 1VMPA 3GP7A 2PO4A 2PYKA 2UU9Q 3HG9A 5BN5A 4DUZQ 1GUTA 1XYIA 1PTOH 1TWFH 1CQVA 4J8QA 1CZGA 4IJLA 2HQLA 3T56B 4KY5A 5DNFA 4J6HA 4KV6A 2K52A 3OTOL 1PRTC 2GN5A 3K5MA 2EY2A 3PO3G 2F0IA 2B63H 4O2DA 1EIHA 2RDFA 2UXCQ 2K01A 2NZOA 4CBVA 4BY1G 2DY7A 4TVAB 2XRSD 3PMFA 3Q24A 4JI2Q 2R92G 4L5QA 1ESFA 2Z0SA 3TSSA 1CT1D 3DWAA 2IHEA 5IGDA 3M4YA 1JE5A 4I65A 1AE2A 4JI6L 1A63A 5JEAH 4K8IA 4AYBB 4HSVA 4R4IA 4WRDA 2EY1A 2RCFA 1QG7A 1IYUA 1A2TA 1SROA 4QIWE 2JA8H 3JAME 1PYWD 1TY0A 3GTLH 1KD1C 4DR5L 3I4NG 4QJFA 1O7IA 4KKUA 4R1JA 1GVPA 3GDEA 2RF4A 1MJEA 4NW2A 1RJTA 3C3LA 2ID0A 3UDIA 3LGJA 1SYDA 2Q2IA 5C0XI 1J9OA 4N8FA 2K33A 3DHQA 2I5HA 1STEA 1FJGQ 4NPSA 3KF8B 3MXNB 4XYOA 4P73A 1IBMQ 2KCTA 2QW7A 3SK5A 1XPOA 5CYUA 2Q2UA 4DR1Q 5HGQA 4YY3L 5A35A 3J7AV 3A8IE 1SNQA 2KEDA 3P1HA 4JI1L 3W2DA 3QR8A 4BBRH 3TZUA 2UUCL 1U9RA 3S2HH 4OX9L 3JC66 4YWKA 4GN5A 2TSSA 4DN4M 2ZXPA 4ME3A 5ELFA 2WKDA 2F52A 4HEDA 3I72A 5C4ZA 1HR0L 4JW0A 3H09A 1EFID 2VQFL 4B3ML 1WVLA 1S5FD 1IYJB 1V9PA 2QEJC 3M4OB 3MVVA 1A6XA 2QCPX 2FXQA 1IL2A 3KLSA 1GKHA 2X6LA 1U4PA 3V96A 1YNJC 4B9WA 5C3EH 3CRKC 2VQEL 1SMYD 4BWGB 4RG1A 5G3LD 2K5HA 1PYSB 2I5LX 3HOUG 1HTPA 2EDGA 4ZYSA 1IBKL 1PFSA 2CVRA 2DUDA 5IGBA 3A7AB
chains in the Genus database with same CATH topology
3A8KE 1M8AA 1BBXC 2HDMA 4NMZA 2EYHA 4QF4A 1DD2A 3D4DA 1GOZA 2RDGA 2MJ8A 2VB2X 2K5QA 3I90A 4FF2A 3QJYA 1HCZA 5EBCA 2R92B 4IZ8A 1JC7A 3AB9A 4EGVA 2G9DA 1AN8A 5KNBA 2E2IB 5C4XB 1WTOA 4KTAA 1XWEA 3VA5A 3G7LA 4RHSA 1Q90A 2WB1B 1PTOD 2EYJA 2B2YA 5M5YB 3E6ZX 4K6DA 1F2MA 1HRJA 4CJ1B 4L8JA 5IGCA 1MGSA 4EVOA 1VF5C 1LTID 2MPMA 1DONA 1SNMA 4H13C 1TS5A 1K8OA 3SXHA 2EYMA 2A69D 1SE3A 1B4OA 2R3ZA 1J8IA 3G6JB 3L9AX 4DFAA 4HTHA 2NVYB 2B2TA 3DWQA 1EOTA 4UDUC 1OXTA 5CV4A 2EPBA 4ME5A 3OMCA 2RKSA 4BS9A 3DXJC 2YYZA 2X6GA 4ABNA 4A3DB 1EY5A 4R8IA 3ONAB 3Q0AA 1STBA 4OIKA 5C3XA 5JVH3 5IT9L 4WJWA 1X3QA 4ODGA 1WD0A 2DN8A 3NBIA 2PCFB 1JICA 2Z4HA 3C1FA 3QG1A 5KYLA 3NSWA 3IAYA 4OO1I 3VYUA 2LS01 2WKCA 4OO1H 1STNA 4DXFA 3N6RA 2E75C 3OMGA 2NN6I 3A7LA 3NHHA 1LT4D 4IUPA 3GTOB 4IFDI 4KN4C 4FF4A 4A3EB 5DM73 1FNVA 1I50B 1V8QA 2QF7A 4HSPA 3GTQB 3VA7A 1EU4A 3EA6A 3N52A 5C5LA 1SFOB 2LMCB 1ZYRD 4PMBA 1D6EC 2WINB 3MFGA 5D3DA 2IW3A 4IUUA 3HOVB 1D1KA 2JYOA 4J1MA 2VUMB 4ZKCB 4RGMA 5KNDA 2GA4B 4X3UA 1F2LA 4G4KA 1LLRD 4S3SA 3P75A 3MHBA 4TQUS 1M4VA 3EFXD 1OXVA 3PUVA 2BE5D 2B2VA 1Q8IA 1SE4A 4C1NK 3LNNA 1JOKA 2KCCA 5CGKA 5BN4A 2BA1A 3OPOA 5D14A 5I2YA 1R9TB 1DYQA 1ILPA 2L55A 1C8CA 4C2MB 1H9RA 1Q12A 1IL8A 1H9JA 5AFWA 2AUJD 2B63B 3T4AC 3MC0B 4F7XA 1SNDA 3FRPB 3K5OA 1CHQD 1EEFD 2JE6I 2CW0C 1JOOA 4QMGA 1O7YA 4C3IB 1DJRD 2D9UA 2OEOA 2B2UC 2O2LD 4WORA 2R61A 3FPPA 1JCKB 1A2UA 2PMZB 1SJHD 3D31A 1SBBB 2AWNA 4KKTA 4BA1I 4IALA 3ND8A 1NCVA 5DEHA 3C46A 5I9PA 3J7AF 4KK7A 1JR0D 3GTPB 5D65A 1EY4A 3DEPA 3S14B 1KNAA 2EYLA 3TBIB 5DM63 3RZOB 1QWYA 1MSGA 2PZTA 2A69C 4KY7A 2EVBA 3K5NA 3FKIB 3H0GB 3MXGA 4C1NI 4K5VA 2B2TC 5ISRA 5C3WA 3HOYB 1A3TA 2MGSA 2NTTA 5ELDA 2N55A 3S15B 1EZ6A 3VR5A 3MWYW 4DNTB 1ZKOA 2DNEA 1SNCA 1CTMA 4FXKC 5F2DA 4BA2I 1I3QB 4DA2A 5C3EB 4RGNA 4PV1C 2V4DA 2F0UA 4R8NA 5FLXE 1BQQT 4LAAA 3BZDB 1SDFA 1B9NA 1SSOA 2A6HD 1B2TA 2XRQD 2KHSA 1TU2B 2XIWA 5CV8A 2FMMA 4RKBA 3NUCA 4TRDA 1BO0A 1PZID 3EVQA 3K58A 3C2PA 1QILA 4QCLA 1II3A 3P20A 1JOQA 1JORA 3KF8A 3MXNA 2F0FA 2NN6H 3QB3A 1STAA 2F3VA 1HFGA 5COYA 2RSOA 3S17B 3VYSA 3PUYA 1B1ZA 3SK4A 1CM9A 5J39A 3R3OA 3OIPA 4FNFA 1XX8A 1GXDC 1KLGD 4KY6A 1MD2D 2L1BA 1I4PA 1ONLA 4XIGS 2F0JA 2NWGA 2IWHA 3LX0A 5K36H 1D5MC 2EYFA 3M3YB 2AWOA 4Q0FA 1BXTA 4FXDA 2NN6G 1ZEQX 4X3KA 3PUXA 1R4QB 1Y1WB 1IKLA 1KNEA 1EZ8A 1CI3M 3FDTA 1TS3A 1ENCA 3OOCA 3RZDB 1SYGA 3NP8A 2XNAC 5FKAC 5ELBA 5JEAJ 1OXXK 2YU9B 5KNCA 1JQYD 5K36G 1AFPA 4EQPA 1ET6A 2Q8RE 4A3FB 1TQOA 1WTPA 2I07B 2G9HD 5M5XB 3CRLC 2J7ZA 4HN7A 2FMCA 2PPBC 3PIO3 3KLSX 3PO2B 2AUKA 3X3NA 4NKLA 5LL6S 3URYA 3I70A 1JE4A 4KD3A 1C48A 4CKBA 3I4MB 2QDBA 4NDXA 4MHEA 4C3HB 1MBYA 3TP7A 3F2UA 1V1PB 1G2SA 3X3MA 1Y1VB 4ZUIA 2O5IC 3GO5A 3SR1A 2B8GA 1EIGA 2L11A 2Y0SB 2F0TA 4BBSB 5IIFA 1TR5A 1O7LA 1HFNA 1CFMA 3KBXA 2EY5A 2RDHA 3BVZA 3NWSA 2ENBA 1QCBD 2AQ3B 2D5DA 1KLUD 1TIID 2L4NA 3TZDA 3T16A 1DOMA 3MXUA 4L6TB 2E2DC 4XT3B 3P7JA 2X69A 1QJOA 1ENAA 2HCCA 4V0BA 4XQNA 1AZQA 4HMJA 1LTRD 3T13A 4HMIA 4IUVA 2K32A 5JPMC 3MFYA 4IUTA 1S4ZA 3FMCA 3D4WA 4EQOA 5IGFA 5EPJA 1PZKD 1L0YB 3U9OA 2K28A 3SEBA 1Q1EA 4DNRB 2M2LA 5BN3A 4WFN3 3S1MB 1SMYC 3RUZA 3DEOA 3NWTA 4U68A 4KMUC 2PNRC 3IL8A 1EYDA 5M3MB 3DUZA 2OF1A 1STGA 3LWUA 1AZPA 1O78A 2BE5C 1A3VA 3OWEB 2DNCA 2E2JB 3GD7A 1IYVA 1VCIA 4P2CB 5KIXA 2J0TD 1EY8A 4PMCA 1TVXA 1W6JA 5KEEA 1E2VA 2F0HA 1GHKA 3BG3A 3HOXB 3J80E 3IFDA 1HXYD 4ZLTF 1LO5D 1SXTA 2J4XA 1PRTF 5CORA 1EEID 1K83B 3OW7A 5I6WA 2R6GA 4DK1A 1BCPF 2F0QA 1PDQA 4DXGA 1I4RA 4DF7A 1S5DD 1X32A 2BOSA 1G291 2JA6B 1KDCA 1JWSD 1RODA 4RFBA 1TWFB 3KK7A 5IT9E 4A93B 4RH6A 1H9KA 1SEBD 4RGOS 3H94A 2BDNA 2SDFA 1STYA 5FK9C 3K0YA 2EXZA 4ZK9B 4RCNA 2F0DA 1BCPC 5EQ0A 3DWPA 2JP1A 5I4DA 1C4QA 1LABA 1EY7A 3TMEA 3HEJA 1NUCA 2A5HA 3TDQA 2K04A 1NR2A 3BVMA 1D2BA 3GTGB 3EROA 3A55A 2A73B 2ICIA 5IGEA 2B2YC 2KECA 1B44D 2WAQB 1IHZA 4FXGC 2EOTA 2L5TA 5E3FA 3QO2A 3FEWX 3J80L 2Z8LA 1S5ED 3C1EA 1Y8NB 1SYBA 1CQFA 2NBFA 4G7OC 4CKCA 4CHTB 2M9VA 4OGQC 3BS1A 3BYYB 4XTCS 5EPLA 1AP0A 1EYAA 3VR2A 3UI2A 5J1ZA 1YNND 5LHY1 2AQ1B 3RMHA 1FNWA 1I6HB 1A3UA 1ESRA 2BCOA 4X3SA 5EBDA 4N9PA 4KHZA 1V1OA 1BCPD 3U9SA 4IURA 4XYQA 1Q3LA 2A6HC 1EY6A 3K59A 1LT3D 1V1PA 3J81L 3TP6A 3S1NB 2K05A 3PO3B 5C4JB 5HGTA 2A6EC 5CV9A 4HCSA 4K2LA 2KJXA 5JEAG 2JA5B 1HUMA 2H4OA 1CZWA 1KDBA 1SYCA 1LT5D 4UAIA 1K8MA 1BDOA 1OXSC 4HR7B 5M9OA 2KVMA 3WDNA 4DAPA 3I73A 2L9HA 2A74C 3OIQA 2EJGC 3H3VC 3GTLB 1Z6HA 5I2XA 2QKIC 1SNPA 5JPNC 1LACA 4U673 1NSNS 4FP5D 1PXUA 1V43A 5FLXL 5ELCA 1W6KA 1CK1A 1PMRA 1WTXA 2CW0D 2B2WC 5CV6A 3MAQA 4BBRB 1LTBD 4ZKBB 1UEAB 1TS2A 1F9SA 3O13A 1B50A 3AMUA 1EQTA 2EE1A 4Y7NB 1DM0B 1UUPA 2IX3A 5C0XH 3HGBA 3GV3A 5CC4A 2VB3X 5C4HA 4FVMA 1WCMB 2FHTA 4DAVA 3A56A 1GHJA 1WTRA 1HA5A 1MSHA 1DOKA 3CKIB 1XXGA 1PLFA 1DZ1A 3HKZB 1I4QA 3BYTB 1TWGB 2HCIA 1AW7A 3W3AA 2EYPA 3NXWA 1ML0D 3QOLA 5A2QL 4FF3A 3H91A 4DAYA 2O5JC 3S1QB 3DMUA 1RF2D 4IFDH 3CU7A 4XDXA 1I4HA 5I6YA 1ZXTA 4HAEA 3WOFA 1HQRD 3I4LA 1TT2A 2WP8J 3GTJB 1A15A 3R2IA 4DGZA 3M7NA 4KD4A 4I7ZC 1PTOC 1Q1BA 2RQXA 1F2ZA 2RVLA 4IN3A 3NE5B 1WTQA 1G8ZD 2LKVA 3CQZB 2PZWA 5FOBB 3I8ZA 3L7ZC 3ZYYX 3L3OC 1LTSD 1HHVA 4BY1B 1EQVA 1ICWA 4YIJA 3FVQA 5ELEA 1TY2A 1GUNA 1O7ZA 2L12A 1WD1A 5FO9B 2JXMB 3V2TA 1ET9A 1WTVA 2NYZD 3GTKB 1PTOF 2IX0A 1EYCA 4CJ2C 2KCNA 5EKKA 3NQTA 1EU3A 1JB3A 1CA5A 2SEBD 4TSSA 3PUZA 1VF7A 3MXPA 4F8MA 3HRZC 2NVQB 4BY7B 1TKWB 1IW7D 1DCZA 4O1NA 1EWHA 4L63B 3VR4A 3NTKA 1F2YA 3KUPA 4KKSA 4XQQA 5A2QE 1KAAA 2F0EA 5CMDA 2B2VC 5KRUA 3S2DB 4K5WA 4HCEA 2F0LA 3KLRA 2PW5A 3M85A 3D8GA 2Q8IB 1D1IA 2IT1A 2XVSA 1F9PA 1RCVD 1S5BD 2R93B 4CGYB 3RD4A 4ZRZA 2F0NA 2E76C 3HOUB 1GUOA 1O80A 3IKJA 5K5PA 4CJ0B 2EY6A 2ZXRA 2D62A 1QNUA 4ZQ3A 4MIUA 1G91A 1PTOB 3QIAA 1E0BA 2F0KA 2JSOA 2A6ED 4IUQA 2NVXB 2K5WA 3E0JA 4RWSC 4K5XA 4A3KB 3T53B 1G2TA 4PQXA 1YNJD 4A3MB 2KEEA 4C3IG 3PUWA 3LWEA 5TSSA 4M1UB 3SHLA 1F77A 2H1EA 5JJZA 1GUSA 5CBAE 2EJMA 2K1BA 3MZ5A 4K2KA 2F1MA 4G7ZC 1STHA 4G7HC 5IGGA 4EQNA 2DY8A 4QUCA 1QOHA 1VDZA 5C0XG 3M7GA 2NUCA 1H9SA 4OIJA 1GUWA 2I46A 4RA8A 2FINB 1UAPA 1TWHB 2XWJB 1B9MA 3BVGA 4E6IA 4FF1A 3T51B 1U4RA 4B9XA 3JAML 1DXMA 3RLFA 5E1FA 1TS4A 4OO1G 1LTAD 2XN9C 5EJWA 1SAPA 2JEBI 1F9QA 3BDOA 2NTSA 1ENFA 3K6OA 1HTLD 4MN3A 1WTWA 3EQLC 2KOLA 4A3BB 4H44C 1ZYRC 3I91A 2IL8A 3S1RB 1IKMA 3IFTA 2HDLA 1HA6A 3GV6A 1LT6D 2NZ1D 4IFDG 5IODA 5FO8B 1RTNA 5KYIA 2Q8TA 3VYRA 1BF4A 2A68D 1Z7TA 2EYOA 4KJNA 1T5XD 3NPPA 3KBGA 2IJ0A 3D4RA 4C56C 4RHRA 1U4LA 1BR9A 3EJIA 1CHPD 4N9TA 3GQBA 4OHJA 4KI0A 2RSNA 2NVTB 3ITPA 3MEHA 3VR6A 2TMPA 3D6CA 4ZAIA 1H9MA 5E4XA 2NB0A 1EY0A 4R9WA 1B53A 1HPCA 3WOEA 1U4MA 2O4XA 2B2UA 5EGTA 1QB5D 2K5DA 3SE0A 1KTKA 3R8BA 3SVMA 3HS0C 3AU7A 3FPUB 3S16B 4RGTA 2F4IA 1B3AA 2OT2A 3K57A 1FNUA 4G57A 2WACA 4LJZC 2BA0A 3MTSA 3MA2B 2KQ3A 4CKEA 5C6AA 1EWCA 2LY7A 4A3JB 2F0SA 2RA4A 2JA8B 4H0LC 3NK9A 4LMQD 2KA7A 5JOBA 1PZJD 2SNMA 1MI2A 2L0CA 4QUFA 5D3IB 4IUNA 1PFNA 3NBHA 5HURA 5FO7B 3K5LA 2ZT9C 5G3LF 2CQAA 1I4XA 2KUMA 1BUVT 5CV7A 4XT1B 4FYDA 1NR4A 1JWUD 1I6VC 3Q23A 1SJED 1BOSA 1QNKA 2SOBA 2OXPA 2F0GA 1OXUA 1RTOA 1JWMD 1PFMA 1S5CD 3D6WA 1SYFA 3BDCA 2MHVA 3E5SA 1ILQA 4K8JA 3HOZB 4JBWA 3V05A 2F3WA 2F0WA 2FJ2A 3BDLA 3OSOA 1D5ZC 4Z9CB 4ZUJA 5J22A 2M00A 4X3TA 5EKLA 1LTTD 4A3GB 4RAUC 1BNZA 2VXWA 3NTHA 4C3JB 4XQJA 2B2WA 2N88A 5DAUA 1EY9A 3SK8A 5KGUA 3I3CA 1FGBD 3K7AB 2MUYA 2MP1A 3OHXC 4KJOA 1VMCA 2K03A 3TP8A 2F03A 4K6LA 3R2TA 2F0OA 1XTCD 5CBEE 4F87A 1CA6A 3QOJA 4M8AA 2VNUD 1Z47A 2B8FA 1GUGA 5C44B 1D5XC 2BDOA 1SNOA 4K14A 3VYTA 1UNSA 4KN7C 1PFBA 4H7BA 2HQEA 1H9SB 4QB4A 4JK1C 3NTIA 2SNSA 2K6AA 1HQMC 4A3IB 1X3PA 2JA7B 2PW7A 1F9RA 1L0XB 2A68C 2EZVA 1IW7C 1LV9A 5M3FB 4DK0A 1KDAA 5JVG3 1PRTD 5JAVA 3HP3A 4LK1C 1GJXA 5M5WB 1T5EA 5LL6X 1QE6A 1FR3A 3NQIA 2QILA 5EPKA 5E4WC 4GZYC 3QWNA 1KABA 1G6ZA 5T1GA 3D3RA 2C9OA 2RBMA 2F0PA 5C0XJ 3A8JE 4V190 3S2HB 4FO2A 3R93A 3ND9A 1BCPB 2F0VA 2Z4IA 1PRTB 5NUCA 3OWFA 2HUGA 3PV0A 4RCOA 3SDZA 3DM1A 3HZXA 4C3JG 3J7YW 2Z1CA 5EKIA 3PIP3 4PMWA 2WIIB 3I4NB 4DU9A 4C3HG 2PZUA 3J81E 1OO9B 3Q6SA 4Q5VA 2ICEC 2JEAI 1Y69U 4ULLA 4IFDJ 2F0MA 4RKLA 1FYCA 4ILWA 1R4PB 1I4GA 5CV5A 1NAPA 5IOCA 2XWBB 2FFKB 4ID6A 2B39A 1RDPD 1LTGD 4PNYA 4NP5A 1RD9D 4KHVA 2ZXOA 3H6MA 2D2CC 2EJFC 3A54A 4IQZA 4QIWB 5I9OA 2E2HB 1RKNA 3VR3A 3TN2A 1Y8OB 1SE2A 4XXEA 1FD7D 4F88A 2R7ZB 3ERQA 2CHBD 3S9WA 1E2WA 1TWCB 1E2ZA 3CHBD 4OL7A 2IX1A 1TWAB 4TKOB 1RHPA 1SYEA 2E74C 5T1IA 3TP5A 2C5CA 2PQEA 3GTMB 5CR3A 1HUNA 3SK6A 5C5MA 1AEXA 2XSCA 2IPKD 2WV6D 3Q22A 1DOLA 2AQ2B 1EL0A 4B08A 3HOWB 2K7VA 1YNNC 2LFNA 4O42A 1Y8PB 1VMPA 3GP7A 2PO4A 2PYKA 3HG9A 5BN5A 1GUTA 1XYIA 1PTOH 1CQVA 4J8QA 1CZGA 3T56B 4KY5A 5DNFA 4J6HA 4KV6A 1PRTC 3K5MA 2EY2A 2F0IA 1EIHA 2RDFA 2K01A 4CBVA 2DY7A 2XRSD 3PMFA 3Q24A 1ESFA 3TSSA 1CT1D 3DWAA 5IGDA 3M4YA 4I65A 5JEAH 4K8IA 4AYBB 4HSVA 4WRDA 2EY1A 1QG7A 1IYUA 1A2TA 3JAME 1PYWD 1TY0A 4KKUA 3C3LA 4NW2A 1RJTA 2ID0A 1SYDA 5C0XI 1J9OA 2K33A 3DHQA 1STEA 4XYOA 3SK5A 5CYUA 5A35A 3J7AV 3A8IE 1SNQA 2KEDA 3P1HA 3W2DA 3TZUA 1U9RA 2TSSA 4DN4M 2ZXPA 5ELFA 2WKDA 4HEDA 3I72A 5C4ZA 3H09A 1EFID 1WVLA 1S5FD 2QEJC 3M4OB 3MVVA 1A6XA 2QCPX 3KLSA 2X6LA 1U4PA 3V96A 1YNJC 4B9WA 3CRKC 1SMYD 4BWGB 5G3LD 1HTPA 2EDGA 4ZYSA 2CVRA 5IGBA 3A7AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I8Z A;  4LMQ D;  4R8I A;  1M8A A;  1EIG A;  1BBX C;  1BF4 A;  2HDM A;  3IFD A;  2L11 A;  1XX8 A;  2K01 A;  1WTX A;  3ONA B;  1HHV A;  4ZLT F;  2B2W C;  1PFB A;  1G91 A;  1E0B A;  1ICW A;  4OIK A;  2DY7 A;  1HFN A;  1MI2 A;  1NAP A;  5COR A;  2L1B A;  2B2T C;  4QUF A;  2FFK B;  1X3Q A;  4IUQ A;  5D14 A;  2NWG A;  2MJ8 A;  5EPL A;  3KBX A;  4ZKB B;  1WD0 A;  1AP0 A;  1F9S A;  1O7Z A;  1U4L A;  2MGS A;  1PDQ A;  2N55 A;  3I90 A;  4RWS C;  3UI2 A;  1ILP A;  1B50 A;  1C8C A;  1X3P A;  2L12 A;  1WD1 A;  1PFN A;  1G2T A;  1ESR A;  1JIC A;  4X3S A;  1WTV A;  1EQT A;  2EE1 A;  4HSV A;  3MWY W;  2NYZ D;  1X32 A;  1QG7 A;  1F9R A;  1IL8 A;  2KEE A;  4CJ2 C;  5AFW A;  2L4N A;  2KUM A;  3LWE A;  3TZD A;  4X3K A;  2RSN A;  1DOM A;  3GV3 A;  4XT1 B;  1LV9 A;  4IUR A;  4XT3 B;  3P7J A;  1ROD A;  3TN2 A;  1NR4 A;  2X69 A;  2H1E A;  1Q3L A;  3HP3 A;  4NW2 A;  1RJT A;  1CA5 A;  1IKL A;  1KNE A;  5JJZ A;  5CBA E;  2FHT A;  2HCC A;  3FDT A;  4IUP A;  1WTR A;  1QNK A;  2BDN A;  1AZQ A;  1MSH A;  1DOK A;  2K1B A;  1J9O A;  1QE6 A;  2SDF A;  4ZAI A;  1WTO A;  5E4X A;  1PLF A;  4IUV A;  1DZ1 A;  4ZK9 B;  2K05 A;  1RTO A;  3G7L A;  2HCI A;  5EPK A;  1O7Y A;  4IUT A;  1PFM A;  1SDF A;  1S4Z A;  2DY8 A;  4QUC A;  4R9W A;  1RHP A;  2D9U A;  1SSO A;  2B2Y A;  1B53 A;  3D6W A;  5T1I A;  2B2U C;  1B2T A;  5EQ0 A;  2JP1 A;  4HCS A;  5EPJ A;  5E4W C;  1HRJ A;  2KED A;  4CJ1 B;  1MGS A;  1U4M A;  2K28 A;  4OIJ A;  3KUP A;  1G6Z A;  1ML0 D;  5T1G A;  3N52 A;  1ILQ A;  1GUW A;  2B2U A;  2XIW A;  4RA8 A;  1HUM A;  2M2L A;  2FIN B;  2Q8R E;  2FJ2 A;  2MPM A;  1DON A;  1WTP A;  1HUN A;  4DN4 M;  4UAI A;  5CMD A;  2FMM A;  3R93 A;  2J7Z A;  3SVM A;  4IUU A;  3H91 A;  1U4R A;  2B2V C;  2K04 A;  2JYO A;  4HED A;  1NCV A;  3FPU B;  1NR2 A;  4X3T A;  3DEO A;  4RAU C;  4U68 A;  2KVM A;  1BO0 A;  1BNZ A;  3IL8 A;  2VXW A;  1B3A A;  4XDX A;  4ZKC B;  1DOL A;  1EL0 A;  2B2W A;  1ZXT A;  4HAE A;  5EJW A;  1JE4 A;  1WVL A;  1B4O A;  2R3Z A;  1J8I A;  1SAP A;  2L9H A;  4X3U A;  1F9Q A;  1F2L A;  1A15 A;  1AZP A;  5D65 A;  2N88 A;  2B2T A;  2HUG A;  4MN3 A;  1F9P A;  4O42 A;  3I3C A;  2B2Y C;  1WTW A;  2KOL A;  2MP1 A;  1VMP A;  2KEC A;  1EOT A;  2X6L A;  3DM1 A;  3MTS A;  4MHE A;  1U4P A;  3DEP A;  3I91 A;  2EPB A;  1VMC A;  2K03 A;  1KNA A;  2EOT A;  2IL8 A;  3F2U A;  5EKI A;  1XYI A;  1IKM A;  1HA6 A;  2HDL A;  2RA4 A;  3GV6 A;  2RVL A;  2NZ1 D;  1G2S A;  3QO2 A;  5CBE E;  5DNF A;  1HFG A;  5COY A;  1TVX A;  1O80 A;  2RSO A;  1WTQ A;  1CA6 A;  2CVR A;  3Q6S A;  1MSG A;  1RTN A;  2X6G A;  4CJ0 B;  2B2V A;  1CM9 A;  1EIH A;  2Q8T A; 
#chains in the Genus database with same CATH topology
 3A8K E;  1M8A A;  3PCO B;  1BBX C;  2HDM A;  2VL6 A;  4NMZ A;  2EYH A;  4QF4 A;  1DD2 A;  4J15 A;  3D4D A;  1XMO Q;  5GRO A;  1GOZ A;  4HJ8 A;  2RDG A;  2MJ8 A;  2VB2 X;  1NMG A;  2K5Q A;  3I90 A;  2XGT A;  1PH6 A;  4FF2 A;  3QJY A;  1HCZ A;  3BJU A;  5EBC A;  4IPH A;  2R92 B;  4IZ8 A;  1JC7 A;  4CDD C;  3AB9 A;  4EGV A;  3S2D H;  1YIT A;  2P5Z X;  2G9D A;  1WCM H;  1N9W A;  1Q7Y C;  1AN8 A;  5KNB A;  5GAD C;  3HOV H;  2E2I B;  3HOZ G;  5C4X B;  1WTO A;  4KTA A;  1LTL A;  1XWE A;  3VA5 A;  4DR6 L;  3G7L A;  2QGQ A;  4RHS A;  1HNX L;  5J3B A;  1Q90 A;  2WB1 B;  1PTO D;  2R7D A;  2EYJ A;  4A3I H;  2B2Y A;  5M5Y B;  3E6Z X;  4K6D A;  1F2M A;  1HRJ A;  4CJ1 B;  4L8J A;  5IGC A;  1MGS A;  3HFZ B;  3CC4 A;  1HNZ L;  5IYD G;  4EVO A;  1K9M C;  4KHP L;  1VF5 C;  1LTI D;  4AYB G;  4EX5 A;  2MPM A;  1DON A;  2VUM G;  4NB3 A;  1SNM A;  1PA6 A;  4H13 C;  1TS5 A;  1I50 H;  5BR8 Q;  1K8O A;  3WWV A;  2ZM6 L;  3SXH A;  2EYM A;  4LFA Q;  4DNI A;  1N32 Q;  1YI2 A;  2MQH A;  2A69 D;  2JA7 G;  4LF5 L;  1SE3 A;  3K7A H;  1B4O A;  2R3Z A;  1J8I A;  3G6J B;  1G51 A;  3L9A X;  4DFA A;  4HTH A;  3A0J A;  1WJJ A;  2NVY B;  4LF9 Q;  2B2T A;  5ELN A;  3DWQ A;  1EOT A;  4UDU C;  1OXT A;  2QDL A;  5CV4 A;  2EPB A;  4ME5 A;  3OMC A;  2RKS A;  1C0A A;  1HNW Q;  4GLX A;  1RIP A;  4BS9 A;  3DXJ C;  3PIO A;  2YYZ A;  1VQF A;  4A3J G;  2X6G A;  4ABN A;  4A3D B;  3FKI G;  1EY5 A;  4R8I A;  1GD7 A;  5L37 A;  3ONA B;  3Q0A A;  4IJH A;  4JV5 L;  1STB A;  4OIK A;  3H3V I;  5C3X A;  5C4X H;  3D0F A;  1KL9 A;  5JVH 3;  5IT9 L;  4WJW A;  1X3Q A;  4ODG A;  1WD0 A;  2DN8 A;  5FJ8 G;  3NBI A;  2PCF B;  5IT9 c;  4A3M G;  1JB7 A;  2KHJ A;  1X3F A;  3I4M G;  2E2I H;  2B63 G;  1JIC A;  2D0P A;  2NZH A;  2Z4H A;  3C1F A;  3QG1 A;  5KYL A;  3G71 A;  3H15 A;  3NSW A;  3IAY A;  4OO1 I;  4DV7 Q;  2NVT H;  3VYU A;  2LS0 1;  2WKC A;  4OO1 H;  4UY8 C;  1STN A;  4DXF A;  3N6R A;  5IY0 A;  2E75 C;  3OMG A;  3T1H Q;  2NN6 I;  1I3Q H;  3HOW G;  3A7L A;  3NHH A;  4POF A;  1LT4 D;  4IUP A;  4JI0 L;  3K8A A;  2UXD L;  3GTO B;  4IFD I;  4KN4 C;  4FF4 A;  4A3E B;  5DM7 3;  1FNV A;  4NXM L;  1I50 B;  1V8Q A;  2DJF C;  5FJ8 H;  4BXX G;  4LF8 L;  2QF7 A;  4HSP A;  1CKM A;  3GTQ B;  3S14 H;  3VA7 A;  1EU4 A;  1MIU A;  3BZK A;  3EA6 A;  3N52 A;  5C5L A;  1SFO B;  2LMC B;  4LF6 Q;  1ZYR D;  4PMB A;  4DR4 Q;  1D6E C;  2WIN B;  1B70 B;  4DV6 L;  3MFG A;  5D3D A;  3UDX A;  1CKN B;  2IW3 A;  4IUU A;  3HOV B;  1D1K A;  2JYO A;  4J1M A;  2QA4 A;  4QY7 A;  1PH9 A;  1L0W A;  2VUM B;  4ZKC B;  4RGM A;  5KND A;  4AH6 A;  1HJP A;  2GA4 B;  4X3U A;  1F2L A;  1YBY A;  4G4K A;  1LLR D;  2AKW B;  4S3S A;  1EOV A;  3P75 A;  2B3G A;  3MHB A;  2DGY A;  4TQU S;  1M4V A;  2UU9 L;  5IP7 H;  3EFX D;  5ELO A;  1OXV A;  2LSS A;  3CP0 A;  1KRS A;  2ALY B;  3PUV A;  2BE5 D;  2B2V A;  1Q8I A;  4X64 L;  1SE4 A;  3DM3 A;  4C1N K;  1AH9 A;  3LNN A;  3T1Y L;  1JOK A;  2KCC A;  5CGK A;  5BN4 A;  2BA1 A;  4B3S L;  3OPO A;  5D14 A;  3HKZ G;  5I2Y A;  1W2B A;  1R9T B;  3S1N H;  1DYQ A;  1ILP A;  2L55 A;  1C8C A;  2K14 A;  4C2M B;  1H9R A;  1Q12 A;  1K0S A;  1TWC H;  4YCU A;  3RZO H;  4X62 Q;  1IL8 A;  1H9J A;  5AFW A;  2AUJ D;  2B63 B;  4DR5 Q;  2XTI A;  3RR5 A;  3T4A C;  1V1Q A;  3MC0 B;  1YJ9 A;  4F7X A;  1BVS A;  1E3P A;  4DUY Q;  3GTM H;  1SND A;  1I6H H;  3FRP B;  1QUQ B;  3K5O A;  4IOA A;  1CHQ D;  1EEF D;  5LMN Q;  3AQQ A;  2JE6 I;  2CW0 C;  4UP9 A;  4JI7 L;  1JOO A;  4QMG A;  1B3Q A;  1O7Y A;  4C3I B;  1WOC A;  4GLA C;  1DJR D;  2D9U A;  3JAM i;  2OEO A;  4DR3 Q;  2B2U C;  2O2L D;  4WOR A;  3BU2 A;  1VQP A;  2R61 A;  3KJP A;  3FPP A;  1JCK B;  1A2U A;  4HIK A;  2PMZ B;  3STB D;  4A3F G;  4K0K Q;  1SJH D;  3NEN A;  4JPB W;  3D31 A;  1J5E L;  4I7A A;  1SBB B;  2AWN A;  4KKT A;  4BA1 I;  4IAL A;  5C4J H;  3ND8 A;  3NBH B;  1NCV A;  5DEH A;  3C46 A;  5I9P A;  3J7A F;  4KK7 A;  4L5S A;  1JR0 D;  1E22 A;  3GTP B;  5D65 A;  1EY4 A;  3PIP A;  3KFU A;  3DEP A;  3S14 B;  1KNA A;  1FVI A;  1N34 Q;  2I5M X;  2Z6K C;  2EYL A;  3TBI B;  4DV1 Q;  5DM6 3;  2R7F A;  3RZO B;  1QWY A;  1MSG A;  2PZT A;  2A69 C;  4KY7 A;  3CCS A;  2PMZ E;  1XMQ Q;  2EVB A;  3K5N A;  3FKI B;  2RHS B;  4LF7 Q;  3H0G B;  3MXG A;  2UUA L;  4C1N I;  4K5V A;  2JQO A;  2B2T C;  5ISR A;  5C3W A;  3HKZ E;  4BXX H;  3HOY B;  1A3T A;  2MGS A;  1CSQ A;  2NTT A;  5ELD A;  2OTJ A;  2N55 A;  3S15 B;  4A3I G;  1FJG L;  3FKI H;  1EZ6 A;  3VR5 A;  1IBM L;  3MWY W;  4DNT B;  1ZKO A;  2DNE A;  1SNC A;  1UWV A;  1CTM A;  3CPW A;  1QUQ A;  4FXK C;  5F2D A;  4X6A H;  4BA2 I;  3PO2 G;  4R4O A;  1I3Q B;  4DA2 A;  5C3E B;  4RGN A;  3HOY H;  4PV1 C;  2V4D A;  4A3B H;  1PVO A;  2F0U A;  4R8N A;  3ER0 A;  5FLX E;  3TEH B;  1XNQ L;  1BQQ T;  3CCU A;  1R9T H;  4LAA A;  4APV A;  3BZD B;  1HNX Q;  3IRB A;  1SDF A;  1B9N A;  2BH8 A;  2K4K A;  1SSO A;  2A6H D;  1B2T A;  1PH1 A;  3OW2 A;  2XRQ D;  1PH4 A;  1Y1V G;  3KDF B;  2KHS A;  1TU2 B;  2XIW A;  5CV8 A;  4JYA Q;  4BY1 H;  2FMM A;  5EAY A;  3CCV A;  1L2F A;  4RKB A;  3NUC A;  4TRD A;  4LFC L;  1YNX A;  1BO0 A;  1PZI D;  3EVQ A;  3K58 A;  3C2P A;  1VQ9 A;  2HT1 A;  1QIL A;  4QCL A;  1II3 A;  3P20 A;  4JI1 Q;  4AYB E;  3GTK H;  1JOQ A;  1GO3 E;  1JOR A;  4N8X 1;  1N8R C;  1K28 A;  4DUZ L;  2K5V A;  3KF8 A;  3MXN A;  2F0F A;  3ULJ A;  2NN6 H;  3QB3 A;  1STA A;  3W5O A;  3CME A;  2F3V A;  4DV5 L;  1HFG A;  5COY A;  5M5W H;  1B7Y B;  2RSO A;  1UEB A;  3S17 B;  3VYS A;  2AHO B;  1E24 A;  3M9B A;  3PUY A;  1B1Z A;  3SK4 A;  1CM9 A;  5J39 A;  4B3M Q;  2ZJR A;  4IOC A;  3R3O A;  3EBE A;  5IP9 G;  3OIP A;  4FNF A;  1XX8 A;  1GXD C;  1KLG D;  4KY6 A;  2PQA A;  1MD2 D;  2L1B A;  1I4P A;  1ONL A;  3W1G A;  4XIG S;  5IP7 G;  1VQO A;  2F0J A;  2NWG A;  2ATW A;  3TS2 A;  2IWH A;  3UDG A;  4A3G H;  3LX0 A;  4JI5 Q;  5K36 H;  2NVX H;  1D5M C;  1G6P A;  2EYF A;  3M3Y B;  2AWO A;  4Q0F A;  1BXT A;  2BH2 A;  4FXD A;  2NN6 G;  1ZEQ X;  3UE0 A;  4X3K A;  3PUX A;  1R4Q B;  3CCR A;  1Y1W B;  4Y7N H;  4HIM A;  3T1H L;  1IKL A;  1KNE A;  1EZ8 A;  1CI3 M;  3FDT A;  1TS3 A;  1UE1 A;  1ENC A;  3OOC A;  3RZD B;  1SYG A;  3NP8 A;  2KHI A;  5C3E G;  2XNA C;  5FKA C;  1XTD A;  4FDB A;  5ELB A;  5JEA J;  4P75 A;  4A3G G;  1OXX K;  4LF5 Q;  2YU9 B;  2YTY A;  5KNC A;  1JQY D;  4LF8 Q;  5K36 G;  3TRZ A;  1AFP A;  1N33 Q;  2R93 H;  4EQP A;  2YV5 A;  1ET6 A;  4DV4 L;  4OX9 Q;  1PV4 A;  2Q8R E;  4A3F B;  4LF6 L;  1TQO A;  1WTP A;  2I07 B;  2G9H D;  5M5X B;  3CRL C;  2J7Z A;  4HN7 A;  1M90 C;  2FMC A;  4X66 Q;  4DR6 Q;  2PPB C;  3PIO 3;  3KLS X;  3PO2 B;  2AUK A;  3X3N A;  4NKL A;  2VQF Q;  4LUZ A;  5LL6 S;  2OQ0 A;  3URY A;  3I70 A;  4JI8 L;  4PZ6 A;  1JE4 A;  4KD3 A;  1C48 A;  4CKB A;  3I4M B;  4A3D H;  2QDB A;  1QVF A;  4NDX A;  4MHE A;  4C3H B;  5FLM G;  1MBY A;  1WCM G;  3TP7 A;  2JA6 G;  3F2U A;  1LM0 A;  1V1P B;  5BR8 L;  2HHH Q;  1EIY B;  1G2S A;  1GM5 A;  1C7Y A;  4LFA L;  1EWI A;  4HJ5 A;  3X3M A;  1Y1V B;  4LNQ A;  4ZUI A;  2O5I C;  3GO5 A;  3SR1 A;  2B8G A;  1BBW A;  1EIG A;  2L11 A;  3H0G H;  2Y0S B;  5M3M H;  2F0T A;  4BBS B;  5IIF A;  4A93 H;  1TR5 A;  1XMO L;  1O7L A;  2ASB A;  1HFN A;  1P8L A;  1S40 A;  1CFM A;  5IE8 A;  3KBX A;  5GAH C;  4YWL A;  2E5L Q;  1WTH A;  1SR3 A;  2EY5 A;  2KEN A;  2RDH A;  1L1O A;  3BVZ A;  3CAM A;  3NWS A;  2UUB L;  2ENB A;  3JAM c;  2CH4 W;  1I94 L;  2D0O A;  1QCB D;  2AQ3 B;  2D5D A;  1KLU D;  1TII D;  2L4N A;  3TZD A;  3T16 A;  1K8G A;  1DOM A;  3MXU A;  4L6T B;  2E2D C;  5M5X H;  4XT3 B;  1QVC A;  3P7J A;  2X69 A;  1QJO A;  1ENA A;  4CDC C;  2HCC A;  4HID A;  4V0B A;  4XQN A;  1AZQ A;  4HMJ A;  1QVG A;  1LTR D;  3T13 A;  4HMI A;  4IUV A;  2K32 A;  5JPM C;  4GOP A;  4X65 Q;  3MFY A;  3S1M H;  4IUT A;  1S4Z A;  3FMC A;  3D4W A;  4EQO A;  5IGF A;  5EPJ A;  4JI4 L;  1PZK D;  4MZ9 A;  1L0Y B;  3VDY A;  3U9O A;  1U0L A;  2K28 A;  1HNZ Q;  4IO9 A;  1S3O A;  3AFP A;  2MO1 A;  3SEB A;  1K8A C;  1A8V A;  1Q1E A;  4DNR B;  2M2L A;  5BN3 A;  1KHI A;  2NVY H;  1ASZ A;  4WFN 3;  2Z6B A;  4GN3 B;  1NBW A;  3S1M B;  1W3S A;  1SMY C;  3RUZ A;  3DEO A;  3NWT A;  4U68 A;  4KMU C;  2PNR C;  3IL8 A;  1EYD A;  3TRE A;  5M3M B;  4BBS H;  3DUZ A;  2OF1 A;  2L15 A;  1STG A;  1YVC A;  4X64 Q;  3LWU A;  2CH4 A;  3I7F A;  1AZP A;  1O78 A;  5M5Y H;  2BE5 C;  1A3V A;  3OWE B;  3I4N H;  2DNC A;  2E2J B;  3GD7 A;  1IYV A;  4BY7 G;  1VCI A;  3RLO A;  4P2C B;  5KIX A;  2J0T D;  2N3S A;  1EY8 A;  4PMC A;  1TVX A;  1W6J A;  5KEE A;  1E2V A;  2F0H A;  3PO2 H;  1U5K A;  4A3C G;  1GHK A;  1XMQ L;  3BG3 A;  3HOX B;  3J80 E;  2Q2H A;  3IFD A;  1HXY D;  4ZLT F;  1LO5 D;  1SXT A;  2J4X A;  1D8L A;  3KDF A;  1PRT F;  4LW1 A;  4YCV A;  5HY6 A;  3CF5 A;  5COR A;  1EEI D;  1K83 B;  4C2M H;  4DUY L;  3OW7 A;  5I6W A;  2R6G A;  3MEF A;  4DK1 A;  4L5R C;  1BCP F;  2F0Q A;  4B3T L;  4P71 A;  1PDQ A;  3F2D A;  4DXG A;  1I4R A;  3AEV A;  3CMA A;  2Z6K A;  4DF7 A;  1S5D D;  4JVZ A;  5IP9 H;  1X32 A;  2BOS A;  1Y1V H;  1G29 1;  2JA6 B;  1T9H A;  1PH5 A;  1KDC A;  4DK6 C;  1JWS D;  3G6E A;  1ROD A;  4RFB A;  1TWF B;  3KK7 A;  5IT9 E;  4A93 B;  4RH6 A;  1H9K A;  1SEB D;  4K0K L;  1P16 A;  4RGO S;  3H94 A;  2A8V A;  2BDN A;  3ICE A;  2SDF A;  1STY A;  5FK9 C;  3K0Y A;  2EXZ A;  4ZK9 B;  4WJ4 A;  3CCQ A;  4LF4 Q;  4RCN A;  2F0D A;  1BCP C;  5EQ0 A;  3DWP A;  2JP1 A;  1MJC A;  1Z9F A;  5I4D A;  4POG A;  1C4Q A;  1LAB A;  1EY7 A;  3U4Z A;  3TME A;  2C35 B;  4DR4 L;  3HEJ A;  1NUC A;  2A5H A;  4JBJ A;  2CWP A;  3TDQ A;  3H0G G;  2K04 A;  5JJL A;  1NR2 A;  3BVM A;  3GTP H;  3A74 A;  2LXK A;  1K73 C;  1D2B A;  3CD6 A;  2IY5 B;  3GTG B;  3ERO A;  3A55 A;  3KYH C;  2G5D A;  2A73 B;  1MKH A;  2ICI A;  5IGE A;  4LF7 L;  2B2Y C;  2KEC A;  1YZ6 A;  1B44 D;  2WAQ B;  1IHZ A;  4FXG C;  2EOT A;  1J5E Q;  3M4P A;  2L5T A;  5E3F A;  1VQD A;  4JCV E;  3QO2 A;  4AQY Q;  1K83 H;  3FEW X;  5DLQ E;  3CXC A;  1MHW C;  3S15 H;  3CW2 C;  3J80 L;  2Z8L A;  3A5U A;  1S5E D;  1C9O A;  3C1E A;  1Y8N B;  1SYB A;  1CQF A;  2NBF A;  4G7O C;  3S1R H;  4CKC A;  4B3S Q;  1JJ2 A;  4CHT B;  2M9V A;  4OGQ C;  3BS1 A;  3BYY B;  4HJ7 A;  4XTC S;  5EPL A;  1AP0 A;  1EYA A;  4DV1 L;  3VR2 A;  2KCM A;  3UI2 A;  5J1Z A;  1YNN D;  5LHY 1;  2JK8 A;  2AQ1 B;  3RMH A;  1FNW A;  1I6H B;  1A3U A;  1ESR A;  2BCO A;  4X3S A;  5EBD A;  4N9P A;  3J7Z C;  4KHZ A;  4DAY B;  3DLL A;  1V1O A;  4DV3 L;  1BCP D;  3W1B A;  1VQB A;  4C3J H;  3U9S A;  4IUR A;  1QZG A;  4XYQ A;  2VZA A;  2UUA Q;  1Q3L A;  2A6H C;  4GS3 A;  1EY6 A;  3K59 A;  1LT3 D;  4JYA L;  1V1P A;  2ZTD A;  3J81 L;  1FGU A;  3TP6 A;  4LFC Q;  3PF4 A;  3S1N B;  2K05 A;  3I55 A;  3PO3 B;  4GKJ L;  5C4J B;  3KJO A;  1YHA A;  2Y0S E;  3ERS X;  5HGT A;  2A6E C;  5CV9 A;  4HCS A;  4K2L A;  4IPG A;  4P74 A;  2KJX A;  2CCZ A;  3GTG H;  3G4S A;  5JEA G;  2JA5 B;  4DV4 Q;  1HUM A;  2H4O A;  1CZW A;  1KDB A;  2F3I A;  4O0A A;  1SYC A;  1LT5 D;  4UAI A;  5JJK A;  1IBL L;  1K8M A;  1BDO A;  1OXS C;  4HR7 B;  1X56 A;  5M9O A;  5IYD H;  1LUZ A;  2KVM A;  3WDN A;  2OCE A;  5M3M G;  4DAP A;  4JI8 Q;  3I73 A;  1KIX A;  2L9H A;  2A74 C;  3OIQ A;  3CCL A;  3S24 A;  1Y1W G;  4OEM B;  2EJG C;  1VQL A;  1Z6H A;  3GTL B;  3H3V C;  5I2X A;  1JMC A;  1YEZ A;  2QKI C;  5M3F H;  2HD3 A;  3K81 C;  2MNA A;  1SNP A;  1PH8 A;  5JPN C;  1TWA H;  1LAC A;  2HHH L;  5IWA Q;  4JI5 L;  2Y0S G;  4A3B G;  4U67 3;  1NSN S;  4FP5 D;  4DPG A;  3KF6 B;  1PXU A;  1V43 A;  1PHJ A;  5FLX L;  4RMF A;  2OQK A;  5ELC A;  2ZTC A;  1W6K A;  1CK1 A;  1PMR A;  4MNO A;  1WTX A;  2PI2 E;  3K80 C;  2UXB L;  2CW0 D;  2B2W C;  5CV6 A;  4PZ8 A;  4A3J H;  4JC0 A;  3MAQ A;  1KXL A;  4YHH L;  2PI2 A;  4IPD A;  4BBR B;  1N36 L;  1LTB D;  2RCN A;  2PQA B;  5LMU L;  4ZKB B;  1UEA B;  5GQO A;  1TS2 A;  1F9S A;  5C44 H;  3O13 A;  1B50 A;  4A3K G;  3AMU A;  3PQI A;  1EQT A;  2EE1 A;  4GN4 B;  4OWW B;  1I94 Q;  4Y7N B;  1SRU A;  1DM0 B;  1UUP A;  2IX3 A;  2HIV A;  5C0X H;  3HGB A;  3GV3 A;  1N33 L;  5CC4 A;  1HZB A;  2VB3 X;  1J6Q A;  5C4H A;  4FVM A;  1WCM B;  1EYG A;  2FHT A;  4DAV A;  3A56 A;  1GHJ A;  1WTR A;  1HA5 A;  1MSH A;  1DOK A;  3CKI B;  3E9I A;  1XNQ Q;  1XXG A;  1PLF A;  3NEM A;  1DZ1 A;  2A1A A;  3HKZ B;  1I4Q A;  3BYT B;  1TWG B;  1Q86 C;  2HCI A;  1A0I A;  3I2Z A;  1AW7 A;  3W3A A;  2PNH A;  2EYP A;  1UE5 A;  4JI4 Q;  3FHW A;  2IHF A;  3NXW A;  1ML0 D;  1IZ6 A;  1CKO A;  1HH2 P;  1VQG A;  1EUJ A;  4YWM A;  4ZCK A;  3QOL A;  5A2Q L;  1VQK A;  4FF3 A;  3H91 A;  4DAY A;  4HJ9 A;  2WB1 G;  2O5J C;  3S1Q B;  1VQM A;  3DMU A;  3M4Q A;  1RF2 D;  1YHQ A;  4IFD H;  3CU7 A;  4XDX A;  1I4H A;  5I6Y A;  3RNU A;  1ZXT A;  4HAE A;  3WOF A;  1HQR D;  3I4L A;  1TT2 A;  2WP8 J;  3GTJ B;  4EQ5 A;  1A15 A;  3F8T A;  1HZC A;  4R4C A;  2B29 A;  3R2I A;  4DGZ A;  3M7N A;  4KD4 A;  3KOJ A;  4LFB L;  2OTL A;  4I7Z C;  1PTO C;  1Q1B A;  2RQX A;  4X66 L;  1F2Z A;  3RN2 A;  2E5L L;  4DV5 Q;  2RVL A;  4IN3 A;  2V1C C;  3NE5 B;  1Q81 C;  4DR7 Q;  1WTQ A;  1G8Z D;  2UUB Q;  2LKV A;  3CQZ B;  1IXR A;  4CDE C;  2PZW A;  3EN2 A;  5FOB B;  2GVB A;  2JA5 G;  3KF6 A;  3I8Z A;  4DV0 L;  3L7Z C;  3ZYY X;  3L3O C;  1LTS D;  4NXN L;  1HHV A;  4BY1 B;  1VQ7 A;  2I0Q A;  1EQV A;  1ICW A;  3L0O A;  1H95 A;  4YIJ A;  2ZTE A;  3FVQ A;  1X9N A;  5ELE A;  2K5N A;  2WB1 E;  3FP9 A;  1TY2 A;  1GUN A;  1VQA A;  1TWG H;  1O7Z A;  2VY3 A;  4B3R Q;  2L12 A;  1WD1 A;  5FO9 B;  4A3L G;  2JXM B;  3V2T A;  1ET9 A;  1L1O B;  1WTV A;  2NYZ D;  3GTK B;  1PTO F;  2IX0 A;  1EYC A;  3HOZ H;  4CJ2 C;  2KCN A;  5EKK A;  3NQT A;  1EU3 A;  2JA9 A;  1JB3 A;  1CA5 A;  1OTC A;  3GTO H;  1RL2 A;  2SEB D;  4TSS A;  3U4V A;  3PUZ A;  4QL5 A;  1VF7 A;  3MXP A;  1Y14 B;  4F8M A;  1CUK A;  3HRZ C;  2NVQ B;  4LF4 L;  2K50 A;  1TKW B;  4BY7 B;  3M3Y H;  5C4X G;  1L1O C;  4H02 A;  1IW7 D;  1DCZ A;  4O1N A;  1EWH A;  4L63 B;  3VR4 A;  3NTK A;  3TS0 A;  1F2Y A;  3KUP A;  4KKS A;  4A3M H;  3E0E A;  4XQQ A;  5A2Q E;  1KAA A;  2F0E A;  3SGI A;  5CMD A;  2E2J H;  1SFO H;  2N49 A;  2B2V C;  4AIM A;  5KRU A;  3S2D B;  4X65 L;  4K5W A;  4HCE A;  2F0L A;  1FL0 A;  3KLR A;  2QEX A;  2PW5 A;  3M85 A;  3D8G A;  2WAQ G;  2Q8I B;  3U58 A;  1D1I A;  2IT1 A;  2MO0 A;  2XVS A;  1F9P A;  3M4O H;  1RCV D;  1S5B D;  3UE1 A;  2R93 B;  4CGY B;  3RD4 A;  4ZRZ A;  2F0N A;  3S17 H;  2E76 C;  3HOU B;  1GUO A;  1XPR A;  4C3I H;  4DV2 Q;  1O80 A;  3IKJ A;  5K5P A;  4UP7 A;  4DAM A;  4CJ0 B;  2EY6 A;  2ZXR A;  3S1Q H;  2D62 A;  1QNU A;  4OWT B;  4ZQ3 A;  2UXC L;  5IYB G;  2HIX A;  4MIU A;  1G91 A;  1PTO B;  3QIA A;  1E0B A;  1VQI A;  5IYC G;  3I4M H;  4QGU A;  2F0K A;  5LMN W;  2JSO A;  2A6E D;  4IUQ A;  3G48 A;  1XJV A;  1YJW A;  2NVX B;  2K5W A;  3E0J A;  4RWS C;  1NJI C;  4K5X A;  4JI6 Q;  4A3K B;  3T53 B;  1G2T A;  3PGZ A;  4PQX A;  1YNJ D;  3CQZ H;  4A3M B;  2KEE A;  4C3I G;  3PUW A;  3LWE A;  3K7U C;  1E1T A;  1X54 A;  5TSS A;  4M1U B;  3SHL A;  2F4V Q;  1DGS A;  1F77 A;  2H1E A;  1PH3 A;  5JJZ A;  1GUS A;  5CBA E;  2EJM A;  5C44 G;  4A3K H;  1BBU A;  2K1B A;  3MZ5 A;  4K2K A;  1TWH H;  3ULL A;  2OWO A;  2F1M A;  4G7Z C;  1STH A;  4G7H C;  3AFQ A;  4A4I A;  2R7Z H;  5IGG A;  4EQN A;  2DY8 A;  4QUC A;  4LWC A;  4JI3 Q;  1QOH A;  1VDZ A;  5C0X G;  3M7G A;  3RN5 A;  1Q46 A;  2NUC A;  1XNR L;  3J80 i;  2N8N A;  1H9S A;  4OIJ A;  1GUW A;  2WFW A;  1VQ6 A;  2I46 A;  4RA8 A;  2A19 A;  2FIN B;  1EQR A;  4JOI C;  3PSI A;  1UAP A;  1TWH B;  2XWJ B;  1B9M A;  3BVG A;  4E6I A;  4FF1 A;  3T51 B;  1U4R A;  1IBL Q;  2CFM A;  4B9X A;  3JAM L;  1DXM A;  4KLK A;  3OTO Q;  1HR0 Q;  3RLF A;  5E1F A;  1TS4 A;  1VS0 A;  4OO1 G;  1LTA D;  2XN9 C;  5EJW A;  3K0X A;  1SAP A;  2JEB I;  1F9Q A;  3BDO A;  2NTS A;  1ENF A;  3K6O A;  1HTL D;  4MN3 A;  2R7Z G;  1WTW A;  3EQL C;  1HZ9 A;  2KOL A;  3HOW H;  4IPC A;  4A3B B;  4H44 C;  1ZYR C;  3I91 A;  3J80 c;  1YJN A;  1WI5 A;  1WFQ A;  2IL8 A;  3S1R B;  1KQS A;  3A5Z B;  1IKM A;  3IFT A;  2HDL A;  1HA6 A;  3GV6 A;  3I4O A;  1LT6 D;  2NZ1 D;  2JN4 A;  4IFD G;  5IOD A;  3B6Y A;  1IBK Q;  5FO8 B;  3CCJ A;  1RTN A;  5KYI A;  4GKK Q;  1X3G A;  1VQ8 A;  2Q8T A;  3VYR A;  4BBR G;  2GVA A;  1BF4 A;  1EFW A;  2A68 D;  1JJG A;  2JJQ A;  1Z7T A;  2UXB Q;  2EYO A;  4KJN A;  1T5X D;  2YU9 H;  3NPP A;  3KBG A;  2IJ0 A;  3D4R A;  3RLN A;  1N36 Q;  4C56 C;  4B3T Q;  4RHR A;  1U4L A;  1BR9 A;  4GNX A;  3EJI A;  1CHP D;  1D7Q A;  4JBK A;  1VQH A;  2EIF A;  4N9T A;  1SE8 A;  3GQB A;  4DR1 L;  1YHB A;  4OHJ A;  4KI0 A;  2RSN A;  1NNX A;  4DR2 Q;  2NVT B;  3ITP A;  3BZC A;  1YIJ A;  2VS1 A;  2AMC B;  1K0R A;  3MEH A;  3VR6 A;  2TMP A;  3D6C A;  4ZAI A;  1H9M A;  5E4X A;  4DK3 C;  2CWA A;  4A3E G;  5AJ3 L;  2NB0 A;  5E7N A;  1EY0 A;  4R9W A;  4DV3 Q;  1B53 A;  1HPC A;  3WOE A;  1U4M A;  1E1O A;  2Q2T A;  2O4X A;  3UDF A;  2B2U A;  3GTQ H;  5EGT A;  1QZH A;  4HIO A;  1QB5 D;  2K5D A;  3SE0 A;  1KTK A;  3R8B A;  1ICF B;  3SVM A;  2VQE Q;  5GAE C;  3HS0 C;  3AU7 A;  3FPU B;  3S16 B;  4RGT A;  2F4I A;  1B3A A;  2OT2 A;  4YY3 Q;  3K57 A;  4A76 A;  1FNU A;  4G57 A;  2CKZ B;  2WAC A;  2Z9H A;  4LJZ C;  4LF9 L;  2UUC Q;  3KLW A;  2BA0 A;  3MTS A;  3MA2 B;  2KQ3 A;  4CKE A;  5C6A A;  3J81 i;  3I56 A;  4GNX C;  1EWC A;  1NE3 A;  2LY7 A;  4A3J B;  3ULP A;  2F0S A;  4A3L H;  2RA4 A;  4A3D G;  4AQY L;  4P72 A;  2JA8 B;  4DR7 L;  4H0L C;  3NK9 A;  2VW9 A;  5FLM H;  2EXD A;  4LMQ D;  4DV0 Q;  2KA7 A;  5JOB A;  4R4Q A;  1EQQ A;  4LUO A;  4A3F H;  4NXN Q;  1PZJ D;  4JV5 Q;  2SNM A;  1MI2 A;  1K3B C;  2K75 A;  3J81 c;  4JI2 L;  4WJ3 M;  2L0C A;  4QUF A;  1LYL A;  2R93 G;  5D3I B;  4A75 A;  4GLV B;  4YCW A;  4IUN A;  1PFN A;  3NBH A;  5HUR A;  5FO7 B;  3K5L A;  3HOY G;  4PG3 A;  1TXY A;  2ZT9 C;  5G3L F;  2CQA A;  1I4X A;  2KUM A;  3PO3 H;  1BUV T;  5CV7 A;  4XT1 B;  4FYD A;  1XPU A;  1VQC A;  1NMF A;  1NR4 A;  1JWU D;  1I6V C;  3Q23 A;  2E2H H;  1SJE D;  5LMU Q;  1BOS A;  1QNK A;  2SOB A;  2OXP A;  2F0G A;  1Q82 C;  2ZM6 Q;  1OXU A;  1RTO A;  4GKJ Q;  1JWM D;  1N32 L;  1PFM A;  1KAW A;  1S5C D;  3D6W A;  1SYF A;  3BDC A;  2MHV A;  3S16 H;  4JG2 A;  1VQ4 A;  1UE6 A;  1PH7 A;  3H3V H;  5JJI A;  1NTG A;  3E5S A;  1ILQ A;  4GOP B;  3F1Z A;  3E9H A;  4K8J A;  3HOZ B;  4JBW A;  3V05 A;  2F3W A;  2F0W A;  2FJ2 A;  3BDL A;  3OSO A;  3J81 j;  4MTK A;  4LFB Q;  1D5Z C;  4A93 G;  1HZA A;  4Z9C B;  3EIV A;  1HNW L;  4ZUJ A;  5J22 A;  2M00 A;  4X3T A;  5EKL A;  1LTT D;  4A3G B;  1NY4 A;  4RAU C;  1BNZ A;  2VXW A;  3NTH A;  1JJC B;  4C3J B;  4XQJ A;  2B2W A;  2EQS A;  3CPF A;  2N88 A;  5DAU A;  1EY9 A;  3SK8 A;  3STB C;  5KGU A;  1AE3 A;  3I3C A;  1FGB D;  3K7A B;  2MUY A;  2MP1 A;  3OHX C;  1A62 A;  1VQE A;  2YTV A;  4UPA A;  3J7A 5;  4KJO A;  4BBS G;  1VMC A;  2K03 A;  3TP8 A;  3CCM A;  1M1K C;  2ES2 A;  5H1S E;  2F03 A;  4K6L A;  3R2T A;  2R92 H;  5IWA L;  2F0O A;  1XTC D;  2WAQ E;  5CBE E;  3OYY A;  4F87 A;  1CA6 A;  3QOJ A;  4M8A A;  4ALP A;  2VNU D;  1Z47 A;  2B8F A;  1GUG A;  5C44 B;  1D5X C;  2BDO A;  1SNO A;  4K14 A;  3VYT A;  1UNS A;  4DV7 L;  4GNX B;  4KN7 C;  2JA8 G;  2LXJ A;  1PFB A;  4H7B A;  3NEL A;  2HQE A;  1H9S B;  3F2B A;  4YHH Q;  4OON A;  1K3R A;  1CSP A;  4MTN A;  4QB4 A;  4JK1 C;  3NTI A;  4JBM A;  1KRT A;  2SNS A;  2K6A A;  1X65 A;  2YTX A;  1HQM C;  2ZJQ A;  4A3I B;  1X3P A;  3F2C A;  3HOU H;  2JA7 B;  2PW7 A;  3CC7 A;  1I5F A;  1F9R A;  1L0X B;  2A68 C;  2EZV A;  4X62 L;  1IW7 C;  1LV9 A;  3ZJY C;  4LUV A;  5M3F B;  4DK0 A;  1KDA A;  1PRT D;  5JAV A;  5JVG 3;  2F4V L;  3HP3 A;  4LK1 C;  1GJX A;  1ASY A;  5M5W B;  1T5E A;  5LL6 X;  4DV6 Q;  1QE6 A;  1FR3 A;  5LMN L;  1E7Z A;  3NQI A;  2QIL A;  5EPK A;  5FLX c;  1KC8 C;  4Y52 H;  3CC2 A;  2RHQ B;  3CCE A;  5E4W C;  4GZY C;  2JA5 H;  1UE7 A;  1XNR Q;  3QWN A;  1KAB A;  1G6Z A;  5T1G A;  4A3C H;  4KHP Q;  3D3R A;  2C9O A;  2RBM A;  2F0P A;  5C0X J;  1CKN A;  3A8J E;  4V19 0;  3S2H B;  4FO2 A;  3R93 A;  1JT8 A;  3ND9 A;  4DV2 L;  4PZ7 A;  1BCP B;  1PYB A;  1B8A A;  1SLJ A;  2F0V A;  2Z4I A;  2CQO A;  4HJA A;  1PRT B;  5NUC A;  3OWF A;  3T1Y Q;  4UP8 A;  2HUG A;  3PV0 A;  4RCO A;  1X55 A;  3SDZ A;  4L5T A;  1HR0 W;  3RZD H;  3DM1 A;  3HZX A;  4C3J G;  3J7Y W;  2Z1C A;  1VQJ A;  4OWX B;  3Q8D A;  5EKI A;  3PIP 3;  4PMW A;  2WII B;  3I4N B;  4JOI A;  4DU9 A;  4C3H G;  2PZU A;  3J81 E;  1OO9 B;  2MFI A;  3Q6S A;  4Q5V A;  2ICE C;  2DJG C;  2JEA I;  1Y69 U;  3U50 C;  1VQ5 A;  1X3E A;  4R4T A;  4ULL A;  2F0M A;  4RKL A;  4IFD J;  2KBN A;  1FYC A;  4OEL B;  4ILW A;  1R4P B;  3GTJ H;  1I4G A;  5CV5 A;  1NAP A;  5IOC A;  2XWB B;  2FFK B;  4ID6 A;  4A3E H;  1X6O A;  2B39 A;  4GOP C;  1WYD A;  1RDP D;  3HOV G;  4B3R L;  1LTG D;  4PNY A;  3PF5 A;  4NP5 A;  3HOX G;  1RD9 D;  1VQN A;  3L2P A;  2E8G A;  4KHV A;  2ZXO A;  3H6M A;  4OXP A;  2D2C C;  4DR3 L;  4C3H H;  2EJF C;  3A54 A;  1BKB A;  1PH2 A;  4BY7 H;  4IQZ A;  4QIW B;  5I9O A;  2E2H B;  1RKN A;  3VR3 A;  4DR2 L;  3TN2 A;  2JA6 H;  1Y8O B;  1SE2 A;  4QQB X;  4XXE A;  1SN8 A;  1Y1W H;  1FD7 D;  3AYH B;  4F88 A;  4JI0 Q;  3ERQ A;  2CHB D;  2UXD Q;  2R7Z B;  3S9W A;  2VUM H;  1E2W A;  5M3F G;  2H5X A;  1TWC B;  1E2Z A;  3CHB D;  4OL7 A;  5AJ3 Q;  4NXM Q;  2IX1 A;  1S72 A;  1TWA B;  4TKO B;  1RHP A;  1SYE A;  2E74 C;  5T1I A;  3TP5 A;  2JA7 H;  1SMX A;  2C5C A;  1Q8K A;  3HOX H;  2PQE A;  3GTM B;  5CR3 A;  5IYB H;  5IYC H;  1HUN A;  3SK6 A;  4CDF C;  4DKA C;  5C5M A;  1N34 L;  1AEX A;  1EIF A;  2XSC A;  4JI7 Q;  3HKS A;  2IPK D;  2WV6 D;  4JI3 L;  3Q22 A;  1DOL A;  2AQ2 B;  4GKK L;  1EL0 A;  4B08 A;  3HOW B;  4UHV A;  2NVQ H;  5GAG C;  2ZJP A;  2K7V A;  3E3X A;  1YNN C;  2LFN A;  4O42 A;  2N78 A;  3TQY A;  1Y8P B;  1VMP A;  3GP7 A;  2PO4 A;  2PYK A;  2UU9 Q;  3HG9 A;  5BN5 A;  4DUZ Q;  1GUT A;  1XYI A;  1PTO H;  1TWF H;  1CQV A;  4J8Q A;  1CZG A;  4IJL A;  2HQL A;  3T56 B;  4KY5 A;  5DNF A;  4J6H A;  4KV6 A;  2K52 A;  3OTO L;  1PRT C;  2GN5 A;  3K5M A;  2EY2 A;  3PO3 G;  2F0I A;  2B63 H;  4O2D A;  1EIH A;  2RDF A;  2UXC Q;  2K01 A;  2NZO A;  4CBV A;  4BY1 G;  2DY7 A;  4TVA B;  2XRS D;  3PMF A;  3Q24 A;  4JI2 Q;  2R92 G;  4L5Q A;  1ESF A;  2Z0S A;  3TSS A;  1CT1 D;  3DWA A;  2IHE A;  5IGD A;  3M4Y A;  1JE5 A;  4I65 A;  1AE2 A;  4JI6 L;  1A63 A;  5JEA H;  4K8I A;  4AYB B;  4HSV A;  4R4I A;  4WRD A;  2EY1 A;  2RCF A;  1QG7 A;  1IYU A;  1A2T A;  1SRO A;  4QIW E;  2JA8 H;  3JAM E;  1PYW D;  1TY0 A;  3GTL H;  1KD1 C;  4DR5 L;  3I4N G;  4QJF A;  1O7I A;  4KKU A;  4R1J A;  1GVP A;  3GDE A;  2RF4 A;  1MJE A;  4NW2 A;  1RJT A;  3C3L A;  2ID0 A;  3UDI A;  3LGJ A;  1SYD A;  2Q2I A;  5C0X I;  1J9O A;  4N8F A;  2K33 A;  3DHQ A;  2I5H A;  1STE A;  1FJG Q;  4NPS A;  3KF8 B;  3MXN B;  4XYO A;  4P73 A;  1IBM Q;  2KCT A;  2QW7 A;  3SK5 A;  1XPO A;  5CYU A;  2Q2U A;  4DR1 Q;  5HGQ A;  4YY3 L;  5A35 A;  3J7A V;  3A8I E;  1SNQ A;  2KED A;  3P1H A;  4JI1 L;  3W2D A;  3QR8 A;  4BBR H;  3TZU A;  2UUC L;  1U9R A;  3S2H H;  4OX9 L;  3JC6 6;  4YWK A;  4GN5 A;  2TSS A;  4DN4 M;  2ZXP A;  4ME3 A;  5ELF A;  2WKD A;  2F52 A;  4HED A;  3I72 A;  5C4Z A;  1HR0 L;  4JW0 A;  3H09 A;  1EFI D;  2VQF L;  4B3M L;  1WVL A;  1S5F D;  1IYJ B;  1V9P A;  2QEJ C;  3M4O B;  3MVV A;  1A6X A;  2QCP X;  2FXQ A;  1IL2 A;  3KLS A;  1GKH A;  2X6L A;  1U4P A;  3V96 A;  1YNJ C;  4B9W A;  5C3E H;  3CRK C;  2VQE L;  1SMY D;  4BWG B;  4RG1 A;  5G3L D;  2K5H A;  1PYS B;  2I5L X;  3HOU G;  1HTP A;  2EDG A;  4ZYS A;  1IBK L;  1PFS A;  2CVR A;  2DUD A;  5IGB A;  3A7A B; 
#chains in the Genus database with same CATH homology
 3A8K E;  1M8A A;  1BBX C;  2HDM A;  4NMZ A;  2EYH A;  4QF4 A;  1DD2 A;  3D4D A;  1GOZ A;  2RDG A;  2MJ8 A;  2VB2 X;  2K5Q A;  3I90 A;  4FF2 A;  3QJY A;  1HCZ A;  5EBC A;  2R92 B;  4IZ8 A;  1JC7 A;  3AB9 A;  4EGV A;  2G9D A;  1AN8 A;  5KNB A;  2E2I B;  5C4X B;  1WTO A;  4KTA A;  1XWE A;  3VA5 A;  3G7L A;  4RHS A;  1Q90 A;  2WB1 B;  1PTO D;  2EYJ A;  2B2Y A;  5M5Y B;  3E6Z X;  4K6D A;  1F2M A;  1HRJ A;  4CJ1 B;  4L8J A;  5IGC A;  1MGS A;  4EVO A;  1VF5 C;  1LTI D;  2MPM A;  1DON A;  1SNM A;  4H13 C;  1TS5 A;  1K8O A;  3SXH A;  2EYM A;  2A69 D;  1SE3 A;  1B4O A;  2R3Z A;  1J8I A;  3G6J B;  3L9A X;  4DFA A;  4HTH A;  2NVY B;  2B2T A;  3DWQ A;  1EOT A;  4UDU C;  1OXT A;  5CV4 A;  2EPB A;  4ME5 A;  3OMC A;  2RKS A;  4BS9 A;  3DXJ C;  2YYZ A;  2X6G A;  4ABN A;  4A3D B;  1EY5 A;  4R8I A;  3ONA B;  3Q0A A;  1STB A;  4OIK A;  5C3X A;  5JVH 3;  5IT9 L;  4WJW A;  1X3Q A;  4ODG A;  1WD0 A;  2DN8 A;  3NBI A;  2PCF B;  1JIC A;  2Z4H A;  3C1F A;  3QG1 A;  5KYL A;  3NSW A;  3IAY A;  4OO1 I;  3VYU A;  2LS0 1;  2WKC A;  4OO1 H;  1STN A;  4DXF A;  3N6R A;  2E75 C;  3OMG A;  2NN6 I;  3A7L A;  3NHH A;  1LT4 D;  4IUP A;  3GTO B;  4IFD I;  4KN4 C;  4FF4 A;  4A3E B;  5DM7 3;  1FNV A;  1I50 B;  1V8Q A;  2QF7 A;  4HSP A;  3GTQ B;  3VA7 A;  1EU4 A;  3EA6 A;  3N52 A;  5C5L A;  1SFO B;  2LMC B;  1ZYR D;  4PMB A;  1D6E C;  2WIN B;  3MFG A;  5D3D A;  2IW3 A;  4IUU A;  3HOV B;  1D1K A;  2JYO A;  4J1M A;  2VUM B;  4ZKC B;  4RGM A;  5KND A;  2GA4 B;  4X3U A;  1F2L A;  4G4K A;  1LLR D;  4S3S A;  3P75 A;  3MHB A;  4TQU S;  1M4V A;  3EFX D;  1OXV A;  3PUV A;  2BE5 D;  2B2V A;  1Q8I A;  1SE4 A;  4C1N K;  3LNN A;  1JOK A;  2KCC A;  5CGK A;  5BN4 A;  2BA1 A;  3OPO A;  5D14 A;  5I2Y A;  1R9T B;  1DYQ A;  1ILP A;  2L55 A;  1C8C A;  4C2M B;  1H9R A;  1Q12 A;  1IL8 A;  1H9J A;  5AFW A;  2AUJ D;  2B63 B;  3T4A C;  3MC0 B;  4F7X A;  1SND A;  3FRP B;  3K5O A;  1CHQ D;  1EEF D;  2JE6 I;  2CW0 C;  1JOO A;  4QMG A;  1O7Y A;  4C3I B;  1DJR D;  2D9U A;  2OEO A;  2B2U C;  2O2L D;  4WOR A;  2R61 A;  3FPP A;  1JCK B;  1A2U A;  2PMZ B;  1SJH D;  3D31 A;  1SBB B;  2AWN A;  4KKT A;  4BA1 I;  4IAL A;  3ND8 A;  1NCV A;  5DEH A;  3C46 A;  5I9P A;  3J7A F;  4KK7 A;  1JR0 D;  3GTP B;  5D65 A;  1EY4 A;  3DEP A;  3S14 B;  1KNA A;  2EYL A;  3TBI B;  5DM6 3;  3RZO B;  1QWY A;  1MSG A;  2PZT A;  2A69 C;  4KY7 A;  2EVB A;  3K5N A;  3FKI B;  3H0G B;  3MXG A;  4C1N I;  4K5V A;  2B2T C;  5ISR A;  5C3W A;  3HOY B;  1A3T A;  2MGS A;  2NTT A;  5ELD A;  2N55 A;  3S15 B;  1EZ6 A;  3VR5 A;  3MWY W;  4DNT B;  1ZKO A;  2DNE A;  1SNC A;  1CTM A;  4FXK C;  5F2D A;  4BA2 I;  1I3Q B;  4DA2 A;  5C3E B;  4RGN A;  4PV1 C;  2V4D A;  2F0U A;  4R8N A;  5FLX E;  1BQQ T;  4LAA A;  3BZD B;  1SDF A;  1B9N A;  1SSO A;  2A6H D;  1B2T A;  2XRQ D;  2KHS A;  1TU2 B;  2XIW A;  5CV8 A;  2FMM A;  4RKB A;  3NUC A;  4TRD A;  1BO0 A;  1PZI D;  3EVQ A;  3K58 A;  3C2P A;  1QIL A;  4QCL A;  1II3 A;  3P20 A;  1JOQ A;  1JOR A;  3KF8 A;  3MXN A;  2F0F A;  2NN6 H;  3QB3 A;  1STA A;  2F3V A;  1HFG A;  5COY A;  2RSO A;  3S17 B;  3VYS A;  3PUY A;  1B1Z A;  3SK4 A;  1CM9 A;  5J39 A;  3R3O A;  3OIP A;  4FNF A;  1XX8 A;  1GXD C;  1KLG D;  4KY6 A;  1MD2 D;  2L1B A;  1I4P A;  1ONL A;  4XIG S;  2F0J A;  2NWG A;  2IWH A;  3LX0 A;  5K36 H;  1D5M C;  2EYF A;  3M3Y B;  2AWO A;  4Q0F A;  1BXT A;  4FXD A;  2NN6 G;  1ZEQ X;  4X3K A;  3PUX A;  1R4Q B;  1Y1W B;  1IKL A;  1KNE A;  1EZ8 A;  1CI3 M;  3FDT A;  1TS3 A;  1ENC A;  3OOC A;  3RZD B;  1SYG A;  3NP8 A;  2XNA C;  5FKA C;  5ELB A;  5JEA J;  1OXX K;  2YU9 B;  5KNC A;  1JQY D;  5K36 G;  1AFP A;  4EQP A;  1ET6 A;  2Q8R E;  4A3F B;  1TQO A;  1WTP A;  2I07 B;  2G9H D;  5M5X B;  3CRL C;  2J7Z A;  4HN7 A;  2FMC A;  2PPB C;  3PIO 3;  3KLS X;  3PO2 B;  2AUK A;  3X3N A;  4NKL A;  5LL6 S;  3URY A;  3I70 A;  1JE4 A;  4KD3 A;  1C48 A;  4CKB A;  3I4M B;  2QDB A;  4NDX A;  4MHE A;  4C3H B;  1MBY A;  3TP7 A;  3F2U A;  1V1P B;  1G2S A;  3X3M A;  1Y1V B;  4ZUI A;  2O5I C;  3GO5 A;  3SR1 A;  2B8G A;  1EIG A;  2L11 A;  2Y0S B;  2F0T A;  4BBS B;  5IIF A;  1TR5 A;  1O7L A;  1HFN A;  1CFM A;  3KBX A;  2EY5 A;  2RDH A;  3BVZ A;  3NWS A;  2ENB A;  1QCB D;  2AQ3 B;  2D5D A;  1KLU D;  1TII D;  2L4N A;  3TZD A;  3T16 A;  1DOM A;  3MXU A;  4L6T B;  2E2D C;  4XT3 B;  3P7J A;  2X69 A;  1QJO A;  1ENA A;  2HCC A;  4V0B A;  4XQN A;  1AZQ A;  4HMJ A;  1LTR D;  3T13 A;  4HMI A;  4IUV A;  2K32 A;  5JPM C;  3MFY A;  4IUT A;  1S4Z A;  3FMC A;  3D4W A;  4EQO A;  5IGF A;  5EPJ A;  1PZK D;  1L0Y B;  3U9O A;  2K28 A;  3SEB A;  1Q1E A;  4DNR B;  2M2L A;  5BN3 A;  4WFN 3;  3S1M B;  1SMY C;  3RUZ A;  3DEO A;  3NWT A;  4U68 A;  4KMU C;  2PNR C;  3IL8 A;  1EYD A;  5M3M B;  3DUZ A;  2OF1 A;  1STG A;  3LWU A;  1AZP A;  1O78 A;  2BE5 C;  1A3V A;  3OWE B;  2DNC A;  2E2J B;  3GD7 A;  1IYV A;  1VCI A;  4P2C B;  5KIX A;  2J0T D;  1EY8 A;  4PMC A;  1TVX A;  1W6J A;  5KEE A;  1E2V A;  2F0H A;  1GHK A;  3BG3 A;  3HOX B;  3J80 E;  3IFD A;  1HXY D;  4ZLT F;  1LO5 D;  1SXT A;  2J4X A;  1PRT F;  5COR A;  1EEI D;  1K83 B;  3OW7 A;  5I6W A;  2R6G A;  4DK1 A;  1BCP F;  2F0Q A;  1PDQ A;  4DXG A;  1I4R A;  4DF7 A;  1S5D D;  1X32 A;  2BOS A;  1G29 1;  2JA6 B;  1KDC A;  1JWS D;  1ROD A;  4RFB A;  1TWF B;  3KK7 A;  5IT9 E;  4A93 B;  4RH6 A;  1H9K A;  1SEB D;  4RGO S;  3H94 A;  2BDN A;  2SDF A;  1STY A;  5FK9 C;  3K0Y A;  2EXZ A;  4ZK9 B;  4RCN A;  2F0D A;  1BCP C;  5EQ0 A;  3DWP A;  2JP1 A;  5I4D A;  1C4Q A;  1LAB A;  1EY7 A;  3TME A;  3HEJ A;  1NUC A;  2A5H A;  3TDQ A;  2K04 A;  1NR2 A;  3BVM A;  1D2B A;  3GTG B;  3ERO A;  3A55 A;  2A73 B;  2ICI A;  5IGE A;  2B2Y C;  2KEC A;  1B44 D;  2WAQ B;  1IHZ A;  4FXG C;  2EOT A;  2L5T A;  5E3F A;  3QO2 A;  3FEW X;  3J80 L;  2Z8L A;  1S5E D;  3C1E A;  1Y8N B;  1SYB A;  1CQF A;  2NBF A;  4G7O C;  4CKC A;  4CHT B;  2M9V A;  4OGQ C;  3BS1 A;  3BYY B;  4XTC S;  5EPL A;  1AP0 A;  1EYA A;  3VR2 A;  3UI2 A;  5J1Z A;  1YNN D;  5LHY 1;  2AQ1 B;  3RMH A;  1FNW A;  1I6H B;  1A3U A;  1ESR A;  2BCO A;  4X3S A;  5EBD A;  4N9P A;  4KHZ A;  1V1O A;  1BCP D;  3U9S A;  4IUR A;  4XYQ A;  1Q3L A;  2A6H C;  1EY6 A;  3K59 A;  1LT3 D;  1V1P A;  3J81 L;  3TP6 A;  3S1N B;  2K05 A;  3PO3 B;  5C4J B;  5HGT A;  2A6E C;  5CV9 A;  4HCS A;  4K2L A;  2KJX A;  5JEA G;  2JA5 B;  1HUM A;  2H4O A;  1CZW A;  1KDB A;  1SYC A;  1LT5 D;  4UAI A;  1K8M A;  1BDO A;  1OXS C;  4HR7 B;  5M9O A;  2KVM A;  3WDN A;  4DAP A;  3I73 A;  2L9H A;  2A74 C;  3OIQ A;  2EJG C;  3H3V C;  3GTL B;  1Z6H A;  5I2X A;  2QKI C;  1SNP A;  5JPN C;  1LAC A;  4U67 3;  1NSN S;  4FP5 D;  1PXU A;  1V43 A;  5FLX L;  5ELC A;  1W6K A;  1CK1 A;  1PMR A;  1WTX A;  2CW0 D;  2B2W C;  5CV6 A;  3MAQ A;  4BBR B;  1LTB D;  4ZKB B;  1UEA B;  1TS2 A;  1F9S A;  3O13 A;  1B50 A;  3AMU A;  1EQT A;  2EE1 A;  4Y7N B;  1DM0 B;  1UUP A;  2IX3 A;  5C0X H;  3HGB A;  3GV3 A;  5CC4 A;  2VB3 X;  5C4H A;  4FVM A;  1WCM B;  2FHT A;  4DAV A;  3A56 A;  1GHJ A;  1WTR A;  1HA5 A;  1MSH A;  1DOK A;  3CKI B;  1XXG A;  1PLF A;  1DZ1 A;  3HKZ B;  1I4Q A;  3BYT B;  1TWG B;  2HCI A;  1AW7 A;  3W3A A;  2EYP A;  3NXW A;  1ML0 D;  3QOL A;  5A2Q L;  4FF3 A;  3H91 A;  4DAY A;  2O5J C;  3S1Q B;  3DMU A;  1RF2 D;  4IFD H;  3CU7 A;  4XDX A;  1I4H A;  5I6Y A;  1ZXT A;  4HAE A;  3WOF A;  1HQR D;  3I4L A;  1TT2 A;  2WP8 J;  3GTJ B;  1A15 A;  3R2I A;  4DGZ A;  3M7N A;  4KD4 A;  4I7Z C;  1PTO C;  1Q1B A;  2RQX A;  1F2Z A;  2RVL A;  4IN3 A;  3NE5 B;  1WTQ A;  1G8Z D;  2LKV A;  3CQZ B;  2PZW A;  5FOB B;  3I8Z A;  3L7Z C;  3ZYY X;  3L3O C;  1LTS D;  1HHV A;  4BY1 B;  1EQV A;  1ICW A;  4YIJ A;  3FVQ A;  5ELE A;  1TY2 A;  1GUN A;  1O7Z A;  2L12 A;  1WD1 A;  5FO9 B;  2JXM B;  3V2T A;  1ET9 A;  1WTV A;  2NYZ D;  3GTK B;  1PTO F;  2IX0 A;  1EYC A;  4CJ2 C;  2KCN A;  5EKK A;  3NQT A;  1EU3 A;  1JB3 A;  1CA5 A;  2SEB D;  4TSS A;  3PUZ A;  1VF7 A;  3MXP A;  4F8M A;  3HRZ C;  2NVQ B;  4BY7 B;  1TKW B;  1IW7 D;  1DCZ A;  4O1N A;  1EWH A;  4L63 B;  3VR4 A;  3NTK A;  1F2Y A;  3KUP A;  4KKS A;  4XQQ A;  5A2Q E;  1KAA A;  2F0E A;  5CMD A;  2B2V C;  5KRU A;  3S2D B;  4K5W A;  4HCE A;  2F0L A;  3KLR A;  2PW5 A;  3M85 A;  3D8G A;  2Q8I B;  1D1I A;  2IT1 A;  2XVS A;  1F9P A;  1RCV D;  1S5B D;  2R93 B;  4CGY B;  3RD4 A;  4ZRZ A;  2F0N A;  2E76 C;  3HOU B;  1GUO A;  1O80 A;  3IKJ A;  5K5P A;  4CJ0 B;  2EY6 A;  2ZXR A;  2D62 A;  1QNU A;  4ZQ3 A;  4MIU A;  1G91 A;  1PTO B;  3QIA A;  1E0B A;  2F0K A;  2JSO A;  2A6E D;  4IUQ A;  2NVX B;  2K5W A;  3E0J A;  4RWS C;  4K5X A;  4A3K B;  3T53 B;  1G2T A;  4PQX A;  1YNJ D;  4A3M B;  2KEE A;  4C3I G;  3PUW A;  3LWE A;  5TSS A;  4M1U B;  3SHL A;  1F77 A;  2H1E A;  5JJZ A;  1GUS A;  5CBA E;  2EJM A;  2K1B A;  3MZ5 A;  4K2K A;  2F1M A;  4G7Z C;  1STH A;  4G7H C;  5IGG A;  4EQN A;  2DY8 A;  4QUC A;  1QOH A;  1VDZ A;  5C0X G;  3M7G A;  2NUC A;  1H9S A;  4OIJ A;  1GUW A;  2I46 A;  4RA8 A;  2FIN B;  1UAP A;  1TWH B;  2XWJ B;  1B9M A;  3BVG A;  4E6I A;  4FF1 A;  3T51 B;  1U4R A;  4B9X A;  3JAM L;  1DXM A;  3RLF A;  5E1F A;  1TS4 A;  4OO1 G;  1LTA D;  2XN9 C;  5EJW A;  1SAP A;  2JEB I;  1F9Q A;  3BDO A;  2NTS A;  1ENF A;  3K6O A;  1HTL D;  4MN3 A;  1WTW A;  3EQL C;  2KOL A;  4A3B B;  4H44 C;  1ZYR C;  3I91 A;  2IL8 A;  3S1R B;  1IKM A;  3IFT A;  2HDL A;  1HA6 A;  3GV6 A;  1LT6 D;  2NZ1 D;  4IFD G;  5IOD A;  5FO8 B;  1RTN A;  5KYI A;  2Q8T A;  3VYR A;  1BF4 A;  2A68 D;  1Z7T A;  2EYO A;  4KJN A;  1T5X D;  3NPP A;  3KBG A;  2IJ0 A;  3D4R A;  4C56 C;  4RHR A;  1U4L A;  1BR9 A;  3EJI A;  1CHP D;  4N9T A;  3GQB A;  4OHJ A;  4KI0 A;  2RSN A;  2NVT B;  3ITP A;  3MEH A;  3VR6 A;  2TMP A;  3D6C A;  4ZAI A;  1H9M A;  5E4X A;  2NB0 A;  1EY0 A;  4R9W A;  1B53 A;  1HPC A;  3WOE A;  1U4M A;  2O4X A;  2B2U A;  5EGT A;  1QB5 D;  2K5D A;  3SE0 A;  1KTK A;  3R8B A;  3SVM A;  3HS0 C;  3AU7 A;  3FPU B;  3S16 B;  4RGT A;  2F4I A;  1B3A A;  2OT2 A;  3K57 A;  1FNU A;  4G57 A;  2WAC A;  4LJZ C;  2BA0 A;  3MTS A;  3MA2 B;  2KQ3 A;  4CKE A;  5C6A A;  1EWC A;  2LY7 A;  4A3J B;  2F0S A;  2RA4 A;  2JA8 B;  4H0L C;  3NK9 A;  4LMQ D;  2KA7 A;  5JOB A;  1PZJ D;  2SNM A;  1MI2 A;  2L0C A;  4QUF A;  5D3I B;  4IUN A;  1PFN A;  3NBH A;  5HUR A;  5FO7 B;  3K5L A;  2ZT9 C;  5G3L F;  2CQA A;  1I4X A;  2KUM A;  1BUV T;  5CV7 A;  4XT1 B;  4FYD A;  1NR4 A;  1JWU D;  1I6V C;  3Q23 A;  1SJE D;  1BOS A;  1QNK A;  2SOB A;  2OXP A;  2F0G A;  1OXU A;  1RTO A;  1JWM D;  1PFM A;  1S5C D;  3D6W A;  1SYF A;  3BDC A;  2MHV A;  3E5S A;  1ILQ A;  4K8J A;  3HOZ B;  4JBW A;  3V05 A;  2F3W A;  2F0W A;  2FJ2 A;  3BDL A;  3OSO A;  1D5Z C;  4Z9C B;  4ZUJ A;  5J22 A;  2M00 A;  4X3T A;  5EKL A;  1LTT D;  4A3G B;  4RAU C;  1BNZ A;  2VXW A;  3NTH A;  4C3J B;  4XQJ A;  2B2W A;  2N88 A;  5DAU A;  1EY9 A;  3SK8 A;  5KGU A;  3I3C A;  1FGB D;  3K7A B;  2MUY A;  2MP1 A;  3OHX C;  4KJO A;  1VMC A;  2K03 A;  3TP8 A;  2F03 A;  4K6L A;  3R2T A;  2F0O A;  1XTC D;  5CBE E;  4F87 A;  1CA6 A;  3QOJ A;  4M8A A;  2VNU D;  1Z47 A;  2B8F A;  1GUG A;  5C44 B;  1D5X C;  2BDO A;  1SNO A;  4K14 A;  3VYT A;  1UNS A;  4KN7 C;  1PFB A;  4H7B A;  2HQE A;  1H9S B;  4QB4 A;  4JK1 C;  3NTI A;  2SNS A;  2K6A A;  1HQM C;  4A3I B;  1X3P A;  2JA7 B;  2PW7 A;  1F9R A;  1L0X B;  2A68 C;  2EZV A;  1IW7 C;  1LV9 A;  5M3F B;  4DK0 A;  1KDA A;  5JVG 3;  1PRT D;  5JAV A;  3HP3 A;  4LK1 C;  1GJX A;  5M5W B;  1T5E A;  5LL6 X;  1QE6 A;  1FR3 A;  3NQI A;  2QIL A;  5EPK A;  5E4W C;  4GZY C;  3QWN A;  1KAB A;  1G6Z A;  5T1G A;  3D3R A;  2C9O A;  2RBM A;  2F0P A;  5C0X J;  3A8J E;  4V19 0;  3S2H B;  4FO2 A;  3R93 A;  3ND9 A;  1BCP B;  2F0V A;  2Z4I A;  1PRT B;  5NUC A;  3OWF A;  2HUG A;  3PV0 A;  4RCO A;  3SDZ A;  3DM1 A;  3HZX A;  4C3J G;  3J7Y W;  2Z1C A;  5EKI A;  3PIP 3;  4PMW A;  2WII B;  3I4N B;  4DU9 A;  4C3H G;  2PZU A;  3J81 E;  1OO9 B;  3Q6S A;  4Q5V A;  2ICE C;  2JEA I;  1Y69 U;  4ULL A;  4IFD J;  2F0M A;  4RKL A;  1FYC A;  4ILW A;  1R4P B;  1I4G A;  5CV5 A;  1NAP A;  5IOC A;  2XWB B;  2FFK B;  4ID6 A;  2B39 A;  1RDP D;  1LTG D;  4PNY A;  4NP5 A;  1RD9 D;  4KHV A;  2ZXO A;  3H6M A;  2D2C C;  2EJF C;  3A54 A;  4IQZ A;  4QIW B;  5I9O A;  2E2H B;  1RKN A;  3VR3 A;  3TN2 A;  1Y8O B;  1SE2 A;  4XXE A;  1FD7 D;  4F88 A;  2R7Z B;  3ERQ A;  2CHB D;  3S9W A;  1E2W A;  1TWC B;  1E2Z A;  3CHB D;  4OL7 A;  2IX1 A;  1TWA B;  4TKO B;  1RHP A;  1SYE A;  2E74 C;  5T1I A;  3TP5 A;  2C5C A;  2PQE A;  3GTM B;  5CR3 A;  1HUN A;  3SK6 A;  5C5M A;  1AEX A;  2XSC A;  2IPK D;  2WV6 D;  3Q22 A;  1DOL A;  2AQ2 B;  1EL0 A;  4B08 A;  3HOW B;  2K7V A;  1YNN C;  2LFN A;  4O42 A;  1Y8P B;  1VMP A;  3GP7 A;  2PO4 A;  2PYK A;  3HG9 A;  5BN5 A;  1GUT A;  1XYI A;  1PTO H;  1CQV A;  4J8Q A;  1CZG A;  3T56 B;  4KY5 A;  5DNF A;  4J6H A;  4KV6 A;  1PRT C;  3K5M A;  2EY2 A;  2F0I A;  1EIH A;  2RDF A;  2K01 A;  4CBV A;  2DY7 A;  2XRS D;  3PMF A;  3Q24 A;  1ESF A;  3TSS A;  1CT1 D;  3DWA A;  5IGD A;  3M4Y A;  4I65 A;  5JEA H;  4K8I A;  4AYB B;  4HSV A;  4WRD A;  2EY1 A;  1QG7 A;  1IYU A;  1A2T A;  3JAM E;  1PYW D;  1TY0 A;  4KKU A;  3C3L A;  4NW2 A;  1RJT A;  2ID0 A;  1SYD A;  5C0X I;  1J9O A;  2K33 A;  3DHQ A;  1STE A;  4XYO A;  3SK5 A;  5CYU A;  5A35 A;  3J7A V;  3A8I E;  1SNQ A;  2KED A;  3P1H A;  3W2D A;  3TZU A;  1U9R A;  2TSS A;  4DN4 M;  2ZXP A;  5ELF A;  2WKD A;  4HED A;  3I72 A;  5C4Z A;  3H09 A;  1EFI D;  1WVL A;  1S5F D;  2QEJ C;  3M4O B;  3MVV A;  1A6X A;  2QCP X;  3KLS A;  2X6L A;  1U4P A;  3V96 A;  1YNJ C;  4B9W A;  3CRK C;  1SMY D;  4BWG B;  5G3L D;  1HTP A;  2EDG A;  4ZYS A;  2CVR A;  5IGB A;  3A7A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...