1NRIA

Crystal structure of putative phosphosugar isomerase hi0754 from haemophilus influenzae
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
248
Chain Sequence
b'LSTLITEQRNPNSVDIDRQSTLEIVRLMNEEDKLVPLAIESCLPQISLAVEQIVQAFQQGGRLIYIGAGTSGRLGVLDASECPPTFGVSTEMVKGIIAGGECAIRHPVEGAEDNTKAVLNDLQSIHFSKNDVLVGIAASGRTPYVIAGLQYAKSLGALTISIASNPKSEMAEIADIAIETIVGPEILTGSSRLKSGTAQKMVLNMLTTASMILLGKCYENLMVDVQASNEKLKARAVRIVMQATDCNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein HI0754
publication title Crystal Structure of Hypothetical protein HI0754 from Haemophilus influenzae
rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 80
structure length 248
sequence length 248
ec nomenclature ec 4.2.1.126: N-acetylmuramic acid 6-phosphate etherase.
pdb deposition date 2003-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1nriA00
5A2QA 2DECA 1XNQB 4DV3B 4LZJA 2VF4X 2AMLA 3G68A 5BY2A 1XMQB 1N36B 4EM6A 4DR1B 3I0ZA 2V4MA 2X3YA 2XHZA 4LF4B 4JI0B 1G98A 2DF8A 4B3TB 5LL6P 4B3MB 1IRIA 1X9HA 1MOSA 2PGIA 4JI6B 4DUYB 1NRIA 2UUCB 1HNWB 5FLXA 2Q8NA 1GZDA 4LF7B 3HJBA 2E5FA 1HNXB 1JEOA 1U0GA 2WU8A 3Q88A 3IFSA 3KNZA 1XMOB 4TOIA 4LF8B 4DV2B 2CXPA 4NXMB 4JI3B 4DR7B 1VIMA 3JAMA 2HHHB 4IVNA 4DR3B 3NBUA 4DV1B 4X64B 1B0ZA 4JI1B 3JX9A 1FJGB 1C7QA 1IBMB 4JI2B 1N34B 1HM5A 3FXAA 3TRJA 3OOJA 4GKKB 3FJ1A 1XNRB 2PUWA 3UJHA 3J80A 4B3RB 1C7RA 2J6HA 1VIVA 4JI7B 1X9IA 1TZCA 2CB0A 1VI6A 3Q7IA 4YHHB 2E5LB 4LFBB 2UXCB 5LMUB 2UXBB 2PUVA 4DR6B 3J81A 4DR5B 4JI5B 1DQRA 1U0EA 3EUAA 4DV5B 4LF5B 1JXAA 4U6NA 3T1YB 4K0KB 1HR0B 3J7AC 1Q50A 4DV7B 1J5XA 3ETNA 2VQEB 2F4VB 5BR8B 1TK9A 3BCHA 4S12A 4M0DA 4DUZB 3SHOA 2O2DA 2CXNA 2UU9B 4AQYB 1U0FA 4YY3B 1J5EB 1TZBA 4JV5B 2ZJ3A 2CVPA 5IT9A 1T10A 4OX9B 2A3NA 4LF9B 4X65B 1N8TA 3PR3A 2CXSA 1JIQA 2O2CA 2CXUA 2ZM6B 3FF1A 1VI5A 2I2WA 4KHPB 3QKIA 4JYAB 1X92A 2CXQA 1IBKB 2PUTA 4X62B 4B3SB 3LJKA 5I01A 4S1WA 1GZVA 2UUAB 1NUHA 3OTOB 1X94A 1M3SA 1ZZGA 2VF5X 4JI8B 3TBFA 1MOQA 4NXNB 2CXRA 2UUBB 4DV4B 4GKJB 2UXDB 3FKJA 1IATA 2I22A 2YVAA 4AMVA 4DV0B 1HOXA 1I94B 4LFAB 1N33B 2XBLA 5IWAB 2CXTA 4DR4B 2ZJ4A 3HBAA 3T1HB 1IBLB 3M5PA 1N32B 4JI4B 2POCA 3C3JA 4DR2B 4LFCB 2VQFB 1XTBA 3CVJA 2CXOA 1HNZB 1KOJA 1WIWA 3BJZA 4X66B 3ODPA 1JLHA 4LF6B 4DV6B 5LMNB 1MORA
chains in the Genus database with same CATH superfamily
1ZLXA 3X1MA 4R2LA 1WV1A 1NXVA 3IJPA 1R50A 5E4JA 1WZ2A 1GLGA 2HTFA 1ADYA 4FOOA 4BX0A 4OGWA 5JH7B 3VBCA 4XX0B 3VH4A 4XGIA 2X76A 4GQBA 1W5FA 4QO7A 5C1DA 1E4EA 3I2KA 4AQ7A 1JQLB 2QHXA 4XSVA 4YJ2B 4CKCB 4UREA 1SCAA 1JLLA 3L02A 4L02A 2YNMD 5AD1A 1YA6A 2PUCA 3M1LA 2JBHA 1X1CA 3KNZA 4V0NA 4PS0A 2HZBA 2VHQA 4V0OA 4XQCA 2VDWA 4FB4A 1TE2A 3RVRA 5D6OA 3IEIA 1Q1GA 1QTNA 2VRCA 5DLPA 2M32A 3N8NA 3IR6A 1XCGB 1IB0A 3JAKB 4L4ZA 4KXXA 1RACA 3B7PA 4DLZA 1KK3A 1CZKA 4MYRA 3NVDA 2H4ZA 4QWWA 2KHZA 3K8OE 3TSCA 5BT9A 4GGMX 3V4OA 3ZWBA 4M36A 3OU2A 1AXEA 4PPQA 3FWZA 1NU8A 2HHJA 1VLZA 1GRCA 2RHRA 2ZAYA 4IOJA 2V0GA 5CLFA 1I9CA 2BGTA 4NBLA 4BATA 2COEA 4LQCA 4CCSA 1LPMA 3KQYA 1LBIA 4Y6GB 3T15A 1KSHA 1SQFA 2HWYA 3CUUA 3GZNB 4WKPA 2UXBB 3C5EA 2WJYA 1G38A 3QKRA 2G07A 2ZRGA 3PFKA 4RK5A 2ZBGA 2G4CA 3SHVA 4AZ3B 4MHTA 1CY4A 3FX2A 2J32A 1G291 3PQ7A 4RMHA 3AVPA 3DF7A 3PDCA 4FGLA 5FQOA 5LIRA 3R5FA 5EWMA 1U1IA 1L4GA 2FUKA 1AQIA 2XMCA 4MUMA 5A0TA 3D1JA 2VCHA 1AXRA 2FHPA 2XD4A 3EGXB 2GK7A 4CKBA 2K7FA 5DYTA 5EFZA 1MC5A 4Z4GA 4JJEA 2IGTA 1AS2A 4FD3A 3S2SA 1F2VA 3R40A 5A7FA 5JCJA 4QDOA 1JBEA 1ENPA 2NX2A 2ZCJA 3W7VA 1PJ8A 3E9MA 4BFXA 4CG0A 621PA 2Q3DA 4ZYTA 3IIEA 1AKYA 3FGOA 3KUKA 4JJFA 1NF2A 2EWMA 3AONB 4KIWA 5FKJA 2E6UX 3Q3GE 5H81A 1OLOA 2B20A 4P54A 1W0JA 2DYKA 4DZRA 1SVKA 2JGNA 2UKDA 1ZCAA 4CMHA 2WJVA 1MDBA 4Q4HA 2VSXA 3EWSA 3VH3A 5F9HA 1N1MA 3FTEA 4K9KA 3OQ6A 5JALA 3WG9A 2YX1A 3LWZA 2C4HA 3GLGE 2IHZA 1G9TA 3KAPA 3KV3O 4KG7A 3FPAA 2HCBA 5F7JA 4J0IA 4N8EA 5K8LA 2V54A 4XYGA 2O59A 1XE3A 1W581 3MC1A 2Z8YA 1SBQA 2DFTA 1X7DA 1JIXA 3SNKA 2G04A 4GS5A 3ZZMA 4PLGA 4F1WA 5AW8A 3D6FA 2I87A 1GAEO 1YA8A 3HB5X 4X95A 3ROPA 1GSOA 3OLVA 2R1TB 1RJEA 1Z5UA 3HGMA 3UJ6A 1EM8B 1QWSA 1SXJD 3E8XA 3L7IA 3N8DA 3NMUF 2BT4A 2RHJA 3GX1A 3TIGA 8MHTA 5LQSA 4I55F 1JSZA 1G7RA 4P86A 3DWEX 1W0KA 1UXKA 4M9XA 4ZWNA 5JVDA 1V25A 2B4TO 3AHCA 2CHEA 3CLHA 1M6VA 2M9MA 2FKAA 4JDUA 3SS8A 3VZDA 1NIPA 3EFBA 4IR7A 4XPIA 4DNOA 5LZ7A 4AWAA 1F8GA 3GNQA 5C34B 4P2GA 1VJ1A 1N25A 3OZDA 4MWCA 2AK3A 5AOAA 3RYHB 3BB3A 3GLTA 1DAHA 4MR7B 4RX1A 4KWEA 2WD7A 3FVTA 3MRSA 4RZQA 3F8TA 1TGVA 3HCDA 2QSZA 4GT1A 4HFRA 3WRXC 3HXOA 3AI3A 3PCTA 3PRYA 3VAAA 3AR8A 1R00A 3DB1A 4JK3A 4R9RA 4EHNA 2PA0A 1YQ9A 3H9CA 1WMBA 2WINI 2YJNA 1J22A 4L0MA 4BV9A 4RQAA 3SK0A 4IILA 3HXKA 4QELA 4RHUA 5KNBD 4KRFA 4GC5A 2FWAA 1XWWA 2EZTA 3RSLA 3SF0A 4TZ6A 5T4FA 2DCMA 2XZTA 1H2AS 3FUVA 1QP7A 5U4XA 4QYMA 3ZY6A 5HZKA 1PDWA 5L3ZA 4UQPA 1CE8A 3OE5A 2RE8A 4FJ0A 1B8UA 1M75A 2A5LA 5JCJD 1JEQA 1PD0A 1JRLA 2NZWA 4NKRA 4DCNA 4Z5XA 3U4QA 5JI2E 2AG8A 2GDJA 5KYUA 1A69A 3UAZA 3Q87B 3D8UA 4Q24A 2EIXA 2XF2A 3MSXA 5LQJA 2VWHA 3GJ7A 3LCUA 1Q5PA 1NJSA 2P77A 2R6AA 3QEBZ 3A14A 2RCYA 2FVYA 3RS0A 1ID8A 1W0JD 1YB4A 3FVQA 3NNDA 4YP0A 3BREA 4FYMA 4TL6A 3WLIA 2DBRA 4YT2A 5JZVA 3OOHA 3GFPA 5IYZF 3E18A 3PFIA 2HT6A 1PJ2A 3R7FA 2BKEA 2G40A 3LPNA 2VTVA 2JHFA 3MXOA 3OETA 5DEIA 2PS3A 2WK1A 521PA 1MC4A 3VR6H 3E7PA 1A9OA 3LP5A 4XM0A 3VO2A 1G20E 2HRDA 1JIQA 3N2NA 3T95A 4RUKA 4JJ6A 2XKAA 2OCKA 1JXQA 3K70B 5B64A 2F3QA 3DHYA 5K0SA 1LUAA 1DBWA 3ORHA 1Q1BA 1BFUA 1UINA 3C97A 4JJ4A 5B3JA 1W1UA 2WJGA 2ENWA 1B0AA 2H1CA 3BAFA 1CJSA 3LY7A 4J1QA 3WXBA 1R9GA 3MJFA 2BCEA 3RRMA 1GTRA 3PXAA 4YGXB 1PJSA 1M2EA 4TT3A 4KSCA 1P7PA 1BMDA 2VDUE 1KYVA 5TT0A 1QOPB 5KWIA 1W0KD 1YVDA 1E1DA 4LZLA 3M4ZA 4TVSA 4HWOA 2O50A 1Q7TA 1OX4A 3H16A 5JAQA 2I1QA 2WMDA 3P9NA 3V8NA 3TZCA 3F97A 2OVBA 2W4QA 4P31A 1KR2A 3LRPA 4XCXA 1FFSA 4NCAA 2MWMA 4BUJA 2VQSA 1EX7A 3O4GA 4FDLA 3TMAA 2EKPA 5IAJA 4UPEA 3LGAA 1FS5A 2H54A 2IYAA 1N2ZA 3W7AA 3DC2A 1RAAA 1IN6A 1JA9A 1PUJA 3F4LA 4UCQA 4WNCA 5THXA 2NPFA 1VM6A 2Y1XA 3V42A 1ZCZA 4QGFA 3TW6A 4A7PA 4ALJA 4LKOA 3HJFA 2XVAA 5BN1A 1TA9A 3LQ1A 1YZYA 4G5XA 3RFCA 3ZW9A 2YZNA 1ZJJA 1GARA 3MB5A 4U3JA 3TINA 2R2AA 2GEUA 2NU9A 3C6XA 3JY6A 1TTHA 1LTHR 4G67A 3VU9B 4Y6OA 4Q9AA 4AJ4A 1EWKA 4YCJA 1UQRA 4ENTA 2UYYA 3JQAB 4JX8A 2Y1EA 4HPXB 4AY2A 4EBFA 1S3GA 3OMWA 3KL4A 3P2KA 4MVJA 2WLSA 4XFKA 3RDPA 4BLTA 3ZV7A 4GMXA 5JDIC 2YWRA 5ERGB 4D26A 1JFFB 4MWBA 2NU6A 1QO0A 1VIMA 3AJRA 4GWKA 5LU8A 2Z2KA 2Z6QA 3LG2A 1X7GA 4BO3A 3LFHA 1NMSA 3GRVA 4GUDA 2RGRA 3W9SA 3A6GA 3MGAA 2EW1A 2RBEA 4EY4A 3KD3A 3UCXA 5GVSA 1L5ZA 2CBXA 5CA0B 3K94A 3GGOA 3KB8A 3ZGZA 1I1HA 2O2JA 3H9JA 4FN5A 4Z3KA 3AC0A 1SPBS 1BQ4A 3L8YA 4PHHA 2I66A 1YCDA 3N70A 5ALLA 1Z7WA 1L6IA 4XOUA 5FI1B 5IW8A 1EDBA 1L9KA 4XWYA 4TL7A 3KT8A 3DOCA 4YFVA 4G8JA 3AF3A 1YJBA 3OQMA 1SK9A 4WCFC 3OZGA 3TUJC 4WCVA 4EPWA 1U0EA 2EZ4A 3JYPA 5LQRA 3SPXA 1R8SA 4FOTA 3FYSA 4ZOQI 2VL7A 4QULA 3LM8A 2D0IA 4Q0MA 2OFFA 1CQXA 3FR7A 3ZDZB 4AMYA 1QM5A 1JAYA 4AAYA 1OXUA 4BFCA 5KYWA 4K9QA 1E7SA 1O77A 3AVQA 2CNNA 2CJPA 2SKCA 3ND8A 1QR6A 3A6PC 1A3CA 3GG9A 2IDKA 2DH6A 3PNKA 1GZ3A 2DWUA 3CF0A 3LZDA 3GC6A 4NABA 2Q4BA 4TT3D 5L4LA 5IT9A 4HADA 1KVRA 3AX6A 3WB2A 3THWB 1I2ZA 3BMXA 3CZ4A 4JL6A 4KI0A 5IDVA 4KPGA 4D82A 4DHWA 3EWNA 3HL0A 2VC2B 3CZPA 4V24A 4KR3A 2GXSA 4V39A 2I2WA 5K0NA 3A9WA 3T5DA 3HN7A 1WXEA 1EUDA 1JR2A 2F90A 4PLCA 4G1MB 4B3JA 4ZMRA 1USGA 1H5NA 4N3NA 2I9PA 1LS6A 1NAIA 3VOTA 2NNLD 4ID9A 4HCJA 4X1IB 3NKFA 4MULA 4C20A 2AW5A 2GLTA 1MH1A 3EDMA 1P2SA 3OQHA 5AJZA 3SJBA 3O8RA 1EWQA 3ASUA 3QF4A 4NULA 4K28A 1QDLB 2PJZA 5B36A 4G41A 5A62A 3OCJA 2H65A 2ODTX 4FBMA 4H6PA 1L7QA 3S2GA 4BWVA 2GCNA 3DLTA 1NYTA 3MF4A 5EGSA 4NX2A 5FI3A 5F98A 1QVZA 3RSHA 1Z74A 2A7QA 3ESYA 4N5NA 4QU8A 2PZBA 1GU1A 1IZZA 1OGIA 5BOVA 1CT9A 4IMJB 4LEIA 2ATXA 1MX5A 2ZSJA 3HDVA 1N32B 3LXUX 4WLOA 2CXHA 3DR3A 3UJAA 3RJZA 2HBZA 3FHOA 4IDPA 1G6KA 4Z9FA 3THRA 3GF4A 5EIXA 3AG5A 4JYBA 1Z9BA 3B70A 3HCRA 5BN3A 5ESWA 1NN3A 3FZYA 3M8KA 5J2TB 1OFGA 1QO0D 4EGCB 1XA4A 4XFDA 3SQLA 2G1PA 1RCTE 4I36A 3DQZA 3QMVA 3OJOA 1FQKA 4JUIA 4KYIB 2QNRA 3INNA 1PGNA 4GG1A 3DCYA 4U4AA 2CDRA 5JECA 3S1AA 5GADl 1E2GA 1MNQA 2AQIA 3R0VA 1UXIA 3F96A 4BP8A 2G1KA 5KTRA 4Q4AB 5E9AA 3B5IA 3K32A 1QHHB 4YWJA 5E3IA 3UA3A 5FWYA 4ZDKA 3HKBB 3ZTTA 3AOEA 1D9ZA 1RQGA 3FMFA 2HADA 1E94E 3WHLA 5GONB 1GGEA 5L4NA 9MHTA 3DW1X 4KUHA 2O8VA 3SC4A 1SBHA 3P20A 2F48A 4HRYA 3LYUA 4Y8VA 4MGKR 1U9YA 1A2OA 1V43A 1PJRA 4YK7A 4A2PA 4UPVA 5DX0A 3Q12A 4M88A 4GOLD 1BYIA 4HS4A 4PYIA 4FDTA 3GLHB 4YONB 4KFTA 1NT2A 2Z95A 1E58A 1YDEA 2SBTA 3WGUA 2P8SA 3VYSB 5BR1A 1ZGBA 1KFCB 2JG3A 2FDXA 2FN9A 4RC9A 2WV9A 4OK5A 1Z22A 2F00A 3DAGA 3OZUA 4D81A 3K2QA 3LUJA 1XJQA 3IPRA 3SEQA 2FUEA 2OKCA 3LFTA 1PR4A 2OQVA 5DK6A 4ALIA 4ZN6A 1CCWA 1GTSA 3MVEA 2H29A 2VDOB 1WPRA 1WY5A 3OM1A 1M8JA 3L8ZA 4G1UC 5EAIA 2B78A 4ARBA 2P2CA 2Z30A 1JQJC 2D7CA 4PIPA 5ALRA 3WL5A 2VDLB 4I50B 1DC3A 3QIVA 4RA9A 5EUCA 5ESDA 1T3LA 4WXPA 1RYEA 1I4WA 2GEBA 3H86A 2VPXA 1PJ4A 4G4GA 1U8XX 4PNHA 4NH0A 5KOYA 4MUHA 4LCBA 3D1LA 4MO9A 1DAEA 3I1FA 3LXXA 3OFJA 5EIHA 5DNVA 3VR3A 4RHFA 1WLYA 3MWLA 5CB4F 1Y8RB 3U80A 4JLMA 3TQRA 1BJRE 3O2SB 3PWSA 1CDEA 1OA1A 2OPBA 2E3JA 2WNSA 2Q6VA 4FMDB 4Q12A 3T99A 1T2DA 4HUJA 3LSTA 3CW2A 1OW3B 3QA3E 1XTIA 3KLMX 3CG0A 3ER6A 2FPPB 3I01A 4MKHA 4URZR 3OTHA 4AZ0B 1TM4E 3KOOA 3CB2A 2VYQA 3N75A 2UVQA 2I4IA 4JJAA 4OK6A 3EVEA 1A7AA 1AY0A 1JEAA 1CY2A 1UZUA 2B82A 1I3LA 2CNWA 2X58A 3EYAA 5ALTA 1A4IA 4A36A 1XOIA 3LUGA 1I5RA 4FMCF 4I1PA 3LQ4A 5AT1A 2BMJA 2OBXA 1ZI8A 4J2HA 4QFBA 5SZJA 1LGYA 3IUPA 3PSAA 4MB2A 4BMVA 3CWCA 3CE9A 1PLJA 3NW9A 5LWHA 3UUWA 4I9GA 4L78A 4TYWA 1JDSA 2J08A 4BNJA 1JN0A 4OUDA 2Q1XA 3D2LA 1CLEA 4X94A 1ZGAA 4MEBA 1Q19A 3BHJA 2WMYA 4MV0A 3D3WA 1PQUA 2J45A 2WJ4A 4OLFA 4C6SA 3ND5A 3SY8A 3PI6A 1T8SA 2REQA 2IPXA 3WTBA 4PQFA 4OI1A 2ZJ7A 4UEQA 3V1KA 3T6KA 4O1MA 1Q11A 1TU0A 1Y9JA 2HDOA 4O2BF 2YWGA 4B44A 2QP3A 3VU0A 1JLHA 2O06A 1Q7CA 2O8EB 3B85A 4NBWA 1P9LA 1I3OA 4X1KA 1QDUA 3E9NA 3PUIA 4CTJA 3AERA 4JENA 1AA9A 4EM6A 5BQFA 3VR4A 4CIDA 2FMHA 4DA8A 1Z06A 5C1OA 5B53A 2V98A 4B4VA 3VR2A 1ZW6A 2PS9A 3ER9A 2G0TA 1QIFA 3FYUC 3JATA 4W63A 4MITA 1V9LA 1BU8A 1N8KA 1V47A 3INTA 5B37A 2DETA 4KR2A 4N1AA 1M5TA 1PI3A 1SC9A 3IAFA 3KEOA 4P6VF 1J25A 4PEVA 4Q1BA 3BL8A 1QVWA 5FOUA 5HP4A 2FN3A 2OGWA 4KGZA 2O19A 3AUKA 1AB5A 5L3QB 3KVNA 3JQDA 3BCRA 1R6XA 2ZYAA 1AS0A 2Z4RA 1A7JA 3DCIA 1N9GB 3VC1A 721PA 1TAQA 2R25B 5DHFA 5CK5A 5FOQA 4TYYA 4MUEA 3RREA 3QLEA 1FU8A 3CR7A 3QFRA 1JIIA 4MRMB 3TZBA 3AY7A 3MS2A 4V0MA 1UKEA 5FTNA 3VR3D 4KQXA 4BP9A 4JU9A 4OV6B 2ZIWB 2NW6A 2ZSAA 5K3BA 4RF2A 4FE3A 3P9SA 2ZRPA 4D9JA 2A9JA 4UD2A 4KITB 4J75A 4WVFA 3S2YA 3TRKA 2W2NA 4F6LA 3CH5A 1GZSA 3IP7A 2YMMA 3G1WA 1XF9A 4RTOA 1ZI6A 4QRIA 2XUDA 3HB9A 2PIDA 2WHYA 4D9BA 2KB0A 5JOQA 3AP3A 3SG0A 1DQRA 4YUWA 3GGJA 2DBQA 5I7EA 1DKLA 4MUGA 1PNOA 5KSPA 4B33A 2FE1A 1NI4A 3KAQA 1T8UA 1R4AA 1GDHA 3SC6A 1SAYA 4EYOA 4BECA 2CNWD 1FS6A 3TMKA 1KI6A 4ENPA 4GW3A 1J8DA 2SCUB 1I30A 2RG1A 5LKRA 1FX0A 1TCBA 5ESRA 1Y1LA 1N2IA 3O73A 2FWJA 4IWXA 3SJCA 4CN9A 3CSUA 4MR8A 3DDWA 2C3OA 4G65A 5E4YA 5ILOA 3S81A 2A5JA 2Z4TA 3CRMA 3W5CA 4MQ6A 3GQVA 2CMHA 4F3YA 1F60A 2C9MA 4F6RB 4JITA 2PJUA 5C4GB 1W87A 4G56A 2R6JA 3LWNA 4BQIA 2P0EA 3G2LA 5FBVB 1Y5NA 1KAQA 2WWIA 2NV2B 2WF6A 3EFOA 4Z8YA 5FWXB 4JSRA 1HYHA 4Q02A 1UAAA 1TEHA 1Z33A 3TNFA 2E1PA 3RC2A 4E7OA 1FNSA 1GZVA 1Y7HA 2ZAIA 4DMFA 5HGXA 1MQ8B 1XD8A 3O1JC 3WI7A 4Q4CA 2WD9A 3DDSA 2X5JO 4QOHA 3ZU3A 3LLCA 5BNWA 4J4HA 1C0LA 1T24A 4GZ3A 4ZCPA 1OH5A 1Z18A 1NL3A 8LDHA 5JSUA 1QMGA 1E69A 2EYUA 3VR4D 2FMUA 2XGSA 4PO8A 5K6AA 1FUIA 4AJKA 3IVGA 3AU9A 1ZNYA 3COYA 1OHHA 1FUYB 1S3IA 2XVMA 4FOLA 3VR2D 1BGVA 2HI0A 1GA4A 4H0CA 2PSFA 4L5BA 4XGNA 4HDOB 1FFCA 1Y7PA 4ZCRA 3OIWA 1P5ZB 3AEQA 4BFSA 5HKKA 3AXTA 1HE8B 4KIUA 4UCXA 1MOPA 4F3CA 2GILA 2WOJA 1G5TA 2D4HA 1A7KA 3FMVA 3K0KA 4J43A 4LRSB 3ZHBA 3JALA 4LZJA 4O2LA 4BO2A 3R0XA 2PKXA 2Z2JA 3NHYA 1NHGA 3FDZA 4CT4B 3K0CC 1T26A 5HCNA 4Z0TA 4KCGA 1YO6A 4WLFA 4N5HX 1Z68A 1ZUHA 2QOEA 2VHYA 1Z4MA 3UENA 1Z25A 2NU7A 2BSAA 2CT8A 1C4KA 1I7QB 5CG2A 3V80A 4HDRA 2A1UA 4HEJA 4LF7B 5H0IA 2POQX 1WCXA 3SQDA 1C1XA 5E6SA 1TPYA 3L8GA 1PF7E 3HU5A 1FA9A 2EP5A 2O9JA 3PF8A 1H4VB 4IFTA 5DV9A 2ZS9A 3ZBPA 3A28A 1RWPA 2X2OA 5E3JA 1M10A 5F4BA 3RAJA 1HLDA 1XTTA 3THXB 1W36C 1R10A 2WW8A 4HGZA 5IARA 4AS3A 4RGQA 4CM4B 2HBYA 3BJEA 1UFQA 1SXQA 4NDAA 3KUCA 3V1MA 4ANFA 1CB7A 4TLCA 2GSWA 2FQYA 2PKQO 1EX1A 2IZ6A 1KOLA 5BSKA 1NUUA 2J9GA 4ZYVA 3L06A 2GXQA 1AKEA 5A5GA 1L5YA 1Z6AA 3CF2A 2A9OA 3R09A 3W1EA 1M1UA 2JAUA 4RVDA 5IHPA 4DJTA 1W94A 2DPLA 2NSJA 3HDYA 3LOPA 5TS3A 2QAGC 2X8BA 4JN6B 5K05A 3SVTA 1JA0A 1E63A 1RW4A 1ARZA 3I37X 4O4IA 1YHYA 2XQFA 2CSUA 5J5VA 1QIKA 2V96A 3TAHA 3VO9A 3IKJA 5TX7A 3SVLA 1ILEA 5HKAA 2XDWA 3QVOA 4YMIA 3CVYA 3ZVKA 2GCGA 3LT1A 2VAXA 2VJLA 3UAOA 3L0BA 1ZPDA 1DCTA 2CFRA 3GIDA 2BL4A 3AY3A 3DWIA 2I91A 1UKYA 2LKDA 4TUYF 4GECA 1YULA 3N0VA 3EULA 4M83A 3LYLA 5ALYA 5KYNA 2HT1A 1F9AA 2IS1A 1NPDA 2HF9A 2ZZMA 1SR8A 3ONDA 4M76B 1S9DA 3AW9A 4QU0A 1OHHD 2PX3A 1YE8A 3HJAA 2TMDA 4ZQCB 1QGZA 1LNSA 2PWPA 4GC9A 4B3SB 5TMPA 4PIVA 2YV3A 3RAFC 2GZ2A 1J70A 4TWZA 4CL0A 2EFYA 5HKKD 2VDKB 3FWPA 1U4OA 3WK7A 2WFAA 1FDUA 121PA 5ED0A 1YMUA 1Z07A 5ILQA 3T5CA 5INTA 2IYUA 1XAGA 4BFYA 1G4HA 3QVGB 4E15A 4MLCA 3K7EA 3RT7A 2P68A 2H18A 5KYXA 1PK7A 4XVHA 3RVKA 5TMBA 1CK4A 1X2EA 4D57A 1JIVA 1U6JA 1BWSA 1LY1A 5EE3A 1TJYA 3DMTC 1NVUQ 2QRNA 2ZI9A 1T4MA 5B7GA 3KK0A 1FX1A 3AKEA 3QYPA 3IIIA 2YXDA 4UM7A 4ZKDA 1OFUA 3IAEA 4E21A 3IUSA 4D9CA 2OV1A 2YV2A 3L41A 3ZD9A 1W88B 1XTBA 1ZD2P 3GY0A 1A8UA 1JSXA 3L1JA 7ADHA 4PXSA 2HMSA 1LQ2A 1VGQA 4ZV4A 4IV0A 1XLVA 1Z08A 4MV5A 2EX4A 1THMA 1X3SA 3ZQUA 1F06A 4J1TA 5EFOA 4BNLA 2J3HA 1CY0A 1ULHA 2ET6A 3MCWA 3Q7EA 1JLKA 2WJ6A 4GOXA 3ZR4B 5KWJA 3F5MA 3DBLA 3K2BA 1MH9A 2YHUA 5EJEA 2CFTA 2ZI6A 3EZGA 1JR4A 1SC4A 4M4SA 3PC4A 1S3SA 3O90A 4MEAA 2JFYA 3GUHA 2ERXA 1ZESA 1G8KA 1J33A 3DEAA 3PHHA 1PKEA 2A5FA 2PANA 4GEKA 1XYVA 4QJ4A 4ARUA 5C8DA 1J6UA 1NJ6A 2WP8J 1YDMA 5DN9A 1T36B 3KKEA 4I9HA 2IHYA 1UXOA 4NBNA 3MJCA 4CBVA 5JR3A 4AM8A 5JROA 3HFJA 3T4EA 5C9ZA 4WXHA 4BJHB 4HVCA 2D5CA 1YZTA 5JI3E 3Q5GA 1QMPA 2J5QA 1PL7A 4PFJA 3RS4A 4JUFA 4NAUA 3WISA 5DI9A 3N1UA 2P30A 3NOVA 2M6KA 1P0CA 3GLQA 1NDHA 1UJ5A 3IQEA 2OXEA 4CE6A 3RO7A 3LDHA 4GZMA 4Q4LA 2W9XA 5LBUA 4P0PB 1Z2DA 2E4WA 2UV8A 1SRRA 2AMYA 3FJ1A 3HR8A 4X84A 4F96A 2VF2A 3ISTA 2WWFA 3EEYA 1N3BA 1JEDA 5E8RA 5EIFA 2VZLA 2HO5A 4N7MA 3SX0A 3W8NA 3DTVA 3Q7IA 1MFPA 4BGUA 4BWYA 2B2NA 4YQFA 4JJZA 1D4AA 2WEKA 3RUCA 1JNXX 5FPYA 3PT5A 3P32A 3AEUB 1XDZA 1U2SA 3RLIA 3NASA 1VYTA 1Y5IA 1LK0A 1B6RA 3HDGA 4WOJA 5LLSA 3GQBA 3F1KA 3EIEA 3ZGXA 3D64A 4RANA 4W5TA 5EHZA 4NENB 3U3ZA 5EMLA 3WR5A 1FTSA 4CNBA 4EHLA 1RQ2A 1PYGA 4I55B 4IX9A 3ESCA 5ALZA 4YMVA 5AVXA 1RU3A 3MQFA 1XD2A 3SHOA 4BKPA 1M2FA 2F3SA 3SR0A 4NG5A 2F3UA 2ZWOA 1J2RA 3DMHA 4YAIA 3CPHA 1BD3A 4MS3B 5AW9A 5CVVA 3REFA 4OLAA 2GTIA 4KQ9A 1EE9A 2IWRA 3C5CA 1L7OA 2C5BA 3IVRA 3OPYA 2F1IA 5ALGA 2QGNA 1Y7LA 3M4XA 1GJRA 4UEWA 3TPZA 2GERA 4OXRA 1QB7A 4I2VA 5KC8A 1GPNA 2HC9A 2CC2A 1TT7A 3WKDA 4C01A 2R86A 4EB0A 1C8VB 3DWGA 5FUWA 1ZRMA 5JW6A 1FFAA 4Q3AA 1EA5A 1QTIA 3KBBA 1U3FA 2HXSA 2J3MA 4WEOA 4X63A 3A1VA 2FW0A 3BPSA 3HDHA 4I1IA 5M7EA 3V4RA 4YQYA 4HVLA 2YIMA 1NA5A 5LP6A 2CXRA 4CQLB 1FFXB 1MD9A 2B25A 2PZ8A 2ETVA 4IQ4A 4GRAA 2Y1FA 4LGMA 4YP6A 1AOXA 2C4KA 4YAOA 4ATNA 4CEIA 3L9XA 2P6UA 1KQNA 1UXJA 5D5QA 5AK5A 4PLZA 3NCTA 1R3DA 2IPOA 2J0EA 2XA1A 2QMEA 4HDSA 1VZ3A 1JKXA 2NXNA 2XDQA 2PMKA 2BM1A 1AG9A 2DULA 2JHAA 2XRMA 3AFMA 1MN6A 4JASB 4KQKA 1WMDA 1J7JA 1UK9A 4WA7A 4D3DA 5B7QA 3L9WA 4BVJA 3GLIA 1B1AA 2ZUFA 2IH5A 1EG2A 2BY4A 3RHSA 3DPUA 3N28A 2H1IA 4KMSA 2OPHA 1I0LA 5KEIA 1HE3A 3LHSA 4DIFA 1TO2E 3BIWA 2QRHA 5CM9C 4JDPA 4PAGA 3U3OA 4DPMA 1T9ZA 2J3QA 1DT3A 1VLHA 2A7XA 2YIVX 3EW9A 2X15A 2DECA 2XUOA 3BX1A 4JVMA 3WLEA 5A5FA 5BY2A 1H4QA 3C14C 2HY7A 4Z54A 1A88A 1S1MA 1PX2A 2O8CA 2VS1A 3LWBA 4Q3NA 4ESHA 1X1EA 1HKUA 2HQOA 4AK9A 1E9AA 4EQ6A 1EK5A 3QG1A 2C03A 1KO4A 4B7XA 5HE8A 4FKMA 4ISBA 1JYEA 1SZPA 5HX7A 1IWOA 1E92A 1AM4D 3MWYW 4REQA 5G0WA 1G0OA 1FRQA 5GM2A 3BZUA 3BM5A 3DTVD 3NI2A 2FZ5A 3MRTA 4GFDA 4XR4A 4ND7A 3DBHB 1IXKA 1E1RD 3EXHA 3L82B 3I6ZA 1PYDA 4UZFA 1K75A 4YRLA 2G25A 5ALMA 3AEYA 4XYLA 1XN1A 5F51A 3N2ZB 4H4DA 1O94A 5CVJA 3ZGOA 1OH7A 1ZMTA 3ESQA 4FFWA 4XIJA 2FWNA 3A37A 3DE7X 3DKKA 3OT5A 2GN1A 1AKUA 2BBOA 3AUSA 3AWDA 2C57A 2UZIR 3HEAA 1G2IA 1PZEA 1VG8A 4PFQA 2ZYDA 3D7SA 5F21A 1HQCA 1KETA 1RAIA 3WMWA 4V0QA 3KD2A 2XQGA 3UAGA 4HC4A 1U2RA 5HJEA 1GUDA 3IV6A 4O4HF 2WPDD 2XTNA 2IJGX 2K2WA 4E5YA 1DNPA 4ZCTA 4Q1CA 4LJRA 5B2ZA 1OF1A 2VWGA 1O6FA 3BIFA 2BFOA 4XB1A 4MQ4A 3OM9A 2EHJA 4UUNA 3TBKA 2J48A 3K1TA 1NU6A 2QG4A 4FDAA 3CT4A 3ZK8A 3I9JA 3P94A 1SVNA 4YT8A 5CXSA 1MRNA 4G36A 3SJZA 2ZJ3A 3A10A 1E2PA 3SR3A 1C3VA 1PT6A 1SK8A 4E13A 4AU1A 4FE4A 1G3RA 2M2IA 1U9IC 3RSGA 4UMFA 5EPUA 1G64A 3OG9A 1RRCA 2OHOA 5MN6A 3V48A 2IUUA 1BDMA 4B4DA 5IRCD 3HWWA 1E98A 3H19A 1P9RA 1Y4ZA 1CUEA 3IJ5A 3TDMA 1VJGA 3DPIA 3ENKA 3VGJA 3WYCA 1N2XA 3OQVA 2XMBA 3LJKA 3WIUA 1BEUB 2Q5CA 4HGYA 4BO5A 1D4ZA 3FRHA 5JVDF 4EWLA 3DVQX 4AUEA 2JVIA 1X94A 4XWKA 5CJJA 1UR5A 2CDAA 3TZ6A 3ZNOA 2PYIA 2ZTUA 3K6SB 4IL5A 2ZE8A 4EDHA 2X0RA 3B20A 3DSRA 2Z98A 4XUGB 4RE5A 3RVDA 1ESCA 3OESA 4NJOA 5DX1A 4DB4A 1YRWA 3Q8XB 3QEKA 2OXRA 1B8NA 4L0DA 4YMWA 3WHIA 5DM70 2FPUA 3PHBE 3NRBA 2EJWA 2XBLA 3FCEA 1D2NA 5SYMA 4H0NA 2C2MA 4U7WA 1CG6A 3BMNA 3OO0A 5DYYA 4GYKA 3SZRA 3K0HA 5CD1A 3PPWA 4Q37A 1BS2A 3D43A 4ITVA 2XWJI 4J7AA 4BVLA 2AWOA 4GLOA 3DTTA 3C5VA 4MI1A 5DO9A 5DHSA 5TMDA 3ZV6A 1B0UA 4L5CA 5FOVA 4DDKA 1SHUX 5C4MA 4QT0A 1NVVR 1CZOA 2P2DA 3MIZA 3C1TA 1U7OA 4UMVA 4TQUS 5LMZA 1SCKA 4DC9A 5TY0A 3OT1B 1KSJA 4BN5A 3A11A 2PXAA 4HLUC 3QWFA 1WPXA 1W0CA 4JBNA 2EFHB 4D3FA 1E61A 4TQ9A 2WYWA 2I6XA 4IXNA 4CF4A 4C0AC 4C2UA 2EQBA 1BQ3A 1LLDA 1XJ5A 1I0ZA 3PA8A 3BD8A 3IERA 2YVQA 4RZHA 3URMA 4DCUA 3KOYA 1QZXA 2OTCA 5LWQA 4OPMA 3H05A 4YT5A 4WXRA 4LXGA 1K3TA 4LJLA 4F4DA 4FZRA 4Y67A 2DTDA 3DDZX 3IO5A 1RPNA 3TQSA 4DSAA 3KYDB 1KPIA 2G17A 3KT3A 1MX9A 3FVVA 3WDSA 4IVNA 4EJFA 3SXUB 1UPCA 4EY8A 5BWCA 5K8TA 2QR2A 3B3AA 3Q9SA 4X61A 4ZI2A 2ZVPX 1EZZA 2Z2YA 1YI8A 4PINA 3RS2A 1NKSA 4C4RA 1IM8A 4FCVA 2C42A 4PSAA 5K3FA 2IXFA 4B6OA 3CUEF 5EHGA 3MAGA 2RHDA 4JR1A 5K99A 3C7CB 4B3RB 5IMBA 3LUDA 3QFSA 3ZWNA 4RAQA 1RMTA 1R6TA 2C2OA 3IMKA 3KM0A 5EJ9A 1OWLA 4KV7A 1M9NA 2QTVB 5ERXA 5FBQB 5C1IA 3TX2A 3NDJA 2FOLA 2XMRA 2VN8A 3GH3A 4LJKA 2ODWA 2B8JA 3LHFA 3IPAA 2BDUA 1Z4JA 4EYQA 2EX0A 2H2IA 2WUGA 2A1TS 3N2GA 4Q47A 3HO1A 1YC2A 2LE0A 6YASA 3PYMA 4D6PA 3MSCA 3OZBA 3WQQA 3RFTA 1VJRA 4M8LA 5CDGA 2P6RA 3EFEA 2GAOA 4G0YA 1JVBA 3KOZA 5ENZA 5EUQB 3PTAA 3B7WA 4YUVA 1F6DA 2Q9UA 4DN6A 3Q6MA 4EUKA 1R4NA 3C5HA 4ER3A 2EVWX 5AKJA 4X65B 4J8PA 4O33A 2WVJA 3M70A 5P8WA 4MR9B 4HS9A 1KNQA 2FCAA 2Q6TA 2D8MA 3EIHA 4G0MA 4NCNA 1DMSA 2PSDA 4EVQA 1CEYA 3W8RA 2GEFA 3GBPA 3O2QB 4J0JA 4OLHA 1X8XA 1AKNA 3TD6A 2E85A 3WWEA 4YMLA 1ODTC 5KSOA 1XMJA 2XE7A 4N0PA 2GM4A 4D43A 3N8HA 2HJVA 2VJMA 2VF5X 3KX2A 1KIMA 3OTWA 5DGDA 4J0HA 4RY2A 3HBJA 4UNSA 5JYDA 1INLA 1SOVA 4UATA 3R3VA 5HRCA 1PFVA 4V0KA 1YQGA 1V8PA 1E6MA 3S3TA 2C7VA 3PKZA 4PQEA 2VDNB 1M33A 3FNEA 1NZJA 2E49A 3K15A 4MVJF 4DWJA 3IQHX 2NP6A 5FB3A 3UMGA 2IS2A 1RP1A 3TLKA 4BB0A 3B1YA 5IWAB 2PO7A 2RARA 4E2XA 3UB4A 2V7TA 3AIIA 3EH1A 1Q7EA 1D6MA 1I6WA 4MGYR 4BZZA 1ULSA 1FMFA 1IY8A 2H4HA 4I5GA 4EF5A 4FYVA 3ZKWB 2CW5A 3GBSA 3UHFA 4WI1A 2R00A 2VXBA 2WTXA 3FPGA 4FXPA 5T5QA 5KTPA 1KY3A 3HZOA 2ZR9A 3BFVA 5IBCA 1F2TA 1C2YA 3VRHA 2DHEA 1U7XA 1UPXA 2JIMA 4YH1A 4J7CA 5J59A 5CB4B 3EVTA 3MWEA 4BC1A 2GPYA 3KWLA 3OEEA 4W8HA 4F4JA 2BRUC 2HMWA 2VPTA 3FPKA 4D8VA 1TC1A 2Q0QA 1UAYA 2BUAA 2XXJA 2PKCA 1LPBB 1ND5A 3MLEA 4ND8A 2V6JA 5C8YA 3C8UA 1Q3KA 3F3YA 4DYVA 2OESA 2DP4E 3DE6X 4MYCA 1LTKA 1EWVA 4RIEA 4YDHB 4K7JA 2GCOB 3ZLUA 5TF4A 1MIOA 3M6LA 4TOIA 3WGNA 4HYEA 2D8AA 3PKIA 3PE3A 3ROZA 3W5SA 1LEHA 4A8JA 5CXUA 2OLEA 4IYRA 1W34A 5DOVA 4MUIA 4US2R 3D0KA 2GVNA 2BUBA 4WLNA 3ND7A 3RLFA 4FMCB 1E2NA 4BGVA 3BEDA 3EIUA 1ZIDA 4F86A 1V7ZA 2ERCA 2FA9A 3GZ4A 2BJWA 2IEBA 3PNPA 2WQZA 4OA8A 4ZZ0A 2XNCA 3X44A 1OY1A 1KIFA 1Z2OX 2FAXA 4NU0A 5IXYA 3CEMA 2RHMA 2XB8A 5UKDA 3VU1A 3LPLA 2R751 2XCTB 1XXHE 2I78A 2QYOA 3ICWA 2BGLA 2R7AA 4V2IA 5EJ2A 5BMVA 2ZE7A 2M1ZA 4NE7A 4DT1B 1TJ4A 2UYOA 5JMWA 4MVJP 4CLOA 1KO5A 2HA6A 1NJ2A 4JVLA 4B34A 4L72A 5IJZA 1NMZA 4OK3A 2ZR0A 5HJ5A 4OHBA 1N6HA 2GH1A 4NMLA 4O2BB 3TLGB 1A5AB 4YLYA 5CLLA 4CM8A 3K9CA 1RTTA 1WXGA 2HWXA 4HZGA 3V9AA 2LVBA 2X7HA 5DYIA 1YK0A 4QBKA 3A8TA 4OHWA 3KYJB 3PUXA 2EZ8A 2QKYA 4ZU1X 4EGFA 4QDJA 3VQTA 4ER5A 1XVTA 3ACBA 4RQTA 2G4LA 3LZ6A 1N2CA 2YN0A 3UBTA 2KX7A 2BEWA 2BWJA 4HPJB 3B48A 2HWWA 5B7PA 1WU7A 3P2OA 4IIBA 2ZTVA 1JJBA 1M5UA 4DADA 3V2GA 5KYGA 2Q9CA 1E2DA 1WDWB 2AVNA 3E23A 1JKJB 1XPJA 1FXUA 3NIWA 4DRZA 4ZJUA 1IXYA 4FS8A 1OV4A 3UC5A 4BLPA 3KUDA 4MUAA 1V3VA 4LVUA 1JAHA 2YUTA 4ZREA 2LCQA 5B3AA 1G6HA 1P3DA 4H4EA 1KYTA 5NLLA 5TC4A 5IUJC 4QQFA 4ABYA 3TLBA 4Z1MA 3WLRA 4EIWA 4K6FA 1E79A 2WTNA 4L76A 3KTAA 3W9UA 3O8DA 1KVUA 1NUQA 1QONA 1WD7A 2A3RA 2XE6A 3GBVA 3HKEA 3QU9A 4JJGA 4MKXA 1DAKA 3OEED 1XWFA 2JFUA 1Z4NA 1K63A 4FYIA 4AX8A 3E84A 3KTDA 5LKAA 3PJDA 1OAOA 2FMXA 5FO0A 3WP0A 2W8BB 4CLXA 2FZ4A 3JPWA 2HCJB 1IBLB 1UMDA 1SUWA 2WP0A 2DPGA 4HQKA 3GWGA 3T1QA 1H0KA 4LI3X 5DNEA 3G2NA 3Q7QA 5HJ7A 3L3BA 1GGHA 3CVJA 1L5QA 1HNZB 1JT2A 1PQPA 1VRCA 4PX3A 3QVMA 4GMFA 4QUHA 3TZQA 1CQPA 1Y4SA 3HABA 4FJ2A 3KC2A 5H3LA 2P9HA 2HIAA 2ZUDA 4R2IA 5FUVA 2GAAA 5EE1A 1XU4A 2X0DA 4F5DA 5A3VA 2G0NA 1E9DA 1NZDA 4Z99A 3RSCA 2GBGA 3DLCA 4KJZA 5EZSA 1EFHA 1TZJA 3T9FA 4D7AA 2CDCA 5K45A 2HV8A 4IO1A 2I5PO 4NCIA 2J41A 2O8FA 1VKJA 1ZY2A 2I7CA 4MVJG 3IMGA 2XYVA 2BZ0A 4YACA 2II6A 2MCFA 3KZXA 1AD2A 2QF7A 4M0KA 4M54A 4RABA 5J47A 2BHNA 2C3MA 3EGDB 3GJ5A 4HDMA 4RJTA 3RUEA 2QZZA 1OIWA 4COKA 3GJ0A 4FNGA 4N5MA 5DW3A 2IBTA 3D4IA 1U8EA 1ZH8A 5HK8A 1KERA 1EI9A 1FDWA 3CUWA 3QUSA 3RIHA 3GEDA 1KRHA 2X5NA 3WLSA 1PP4A 2OYCA 2AFRA 1AKVA 3W6PA 2ZTLA 3P7MA 1S8AA 7AT1A 4BMXA 2FPGB 4K9RA 4CKZA 1G5IA 1KL7A 1AZLA 3BAZA 4KBFA 4G0WA 3T3NA 1SOMA 2HNAA 2QQ0A 3EZNA 1VL6A 2BGIA 2MTBA 3H5VA 1MZVA 2OYSA 3HC7A 4G97A 2VDPB 4OBWA 4PZUA 1KZ9A 2GO7A 2WJIA 1BG6A 5LMUB 4HMPA 1I4EB 3INYA 1IEQA 2X1VA 4RK7A 4B2PA 1X1BA 2JBAA 3VV2A 4CGZA 4F04A 1PLKA 2BONA 1K8RA 4XYBA 4PV7A 1ZVKA 3I58A 4H6WA 3H8WA 3P71T 3U7JA 2WG2A 4GM4A 2QGZA 4XD2A 1LW6E 1ZM7A 3GEIA 1VYVA 1PT8A 2I55A 4M0DA 4PAQA 2I2AA 3ABQB 4EOGA 4PY2A 2YHIA 4KLCA 3SOZA 1X19A 1ZMBA 4NSNA 4LG1A 3URKA 3WGOA 4ECEA 4ZXFA 1A8SA 3H2SA 3VGPA 5C32A 4P3PA 2OK8A 4Z1MD 3JQFC 1MRSA 4ZK6A 2VZ0A 1SKAA 5L95A 1QDEA 2BBTA 2IZ7A 4RMGA 3WAJA 4MRPA 3GNLA 1N78A 2ZS7A 2VEOA 1O03A 2GRJA 2HYDA 4FW9A 3NS7A 3BSSA 1X92A 1DV1A 2VATA 1AK1A 1PTJA 4ALKA 4QPZA 2WKSA 4LE2A 1U5BB 3D8RA 3EXG2 4RACA 4CMIA 2FMFA 3JS5A 4WAUA 4EGJA 5B57C 1PQYA 1R4ZA 4IGAA 4CI9A 3AL0C 2J3IA 2XKBA 2Y6VA 3A1TA 4URXR 4C6RA 3CM0A 3FFBA 2Y0DA 1DTSA 4X8HA 3T34A 4EUSA 1PBTA 1VA5A 4BYGA 4ZDJA 1E2LA 3CBQA 1N5MA 5A6SB 3H4TA 3R7LA 1N6PA 3VZRA 5CCEA 3E82A 1W4CA 1XSEA 1Y4DE 3ANXA 1YBFA 3IURA 1BCSA 3CZCA 3F90A 4PXAA 4F8YA 2KSQA 2RKBA 2QZSA 3H5TA 1C50A 3UHAA 5DN6D 1NJ5A 3HY6A 4GZLA 5KYYB 2H9YA 2IHVA 3SIWA 2QRVA 4HZUA 4MRSA 1HXHA 4GLJA 2HRRA 2E55A 2ZIGA 3DO5A 3FUWA 5EE9A 3KPVA 4XA8A 4UBIA 2HW8A 4WXYB 1J09A 4BDSA 3VO8A 4IMRA 1KQ3A 1YB2A 1YMVA 5JAOA 1XTZA 1Q77A 2PLAA 3F3MA 4P2BA 2O8NA 1M6EX 3ZW8A 1T0PA 5AWFC 1PFGA 4UZSA 1WCV1 2P9TA 5BVGA 4JU8A 1O97C 1NIJA 1L4HA 5FWDA 4ZVLA 1SCJA 2WUFA 4F7WA 1U8YA 4KE9A 2C98A 2V1XA 4R98A 1C14A 3HCEA 4EMBA 5IN5A 1QHFA 3QHQA 1E66A 1ZEMA 3EVZA 1TOAA 3I2HA 5GV8A 1GNRA 3DULA 1XDWA 4QKQA 4TUYB 1YT5A 4IHQA 2BGNA 1E0DA 1XQXA 1ZISA 2G88A 3HB4X 3JAWA 3Q72A 3WJ7A 1VYUA 2BEUB 1YQWA 1OPRA 3G2KA 3QTTA 4IXWA 5AJTA 5GAJA 3BQNB 3L1UA 1DX9A 3WWOA 3LC0A 2QU7A 3C3CA 1MBZA 1RBZA 1EU1A 3QMPA 4BASA 2O5RA 1R0YA 2HGZA 2G9QA 3G13A 4FOPA 1E1KA 3JASA 3LD9A 3RABA 4ARVA 4CUJA 2GASA 1JPUA 1V4VA 1GV1A 1YB5A 2NG1A 1GCUA 2Y9PB 2YJ4A 3HCPA 4KR0A 4YQEA 3VPCA 1KHHA 4QLBA 3TBHA 1KP9A 1O4VA 2Y2UA 3I9LA 1XZPA 3OBIA 3KQHA 1I2CA 2FSPA 1E6KA 2JA2A 3BXXA 1E1NA 1XQ1A 3NX4A 2RFLA 4DCTA 5EXPA 4C4YA 1PEKE 2MMGA 5KHLB 4GE0A 3D3KA 3OWHA 1URPA 4UKDA 5I9TA 1C4WA 2BKLA 2GAJA 1CKEA 1CS0A 3OLQA 4U6NA 1OFIA 3IDOA 3K1ZA 3UOWA 1MTOA 1PJQA 1I10A 2B4RO 1LDYA 1DG1G 4DDUA 1VGRA 2A33A 1G63A 1EKXA 4AQYB 1FJHA 4INZA 2N42A 1CUCA 3NT2A 4OJMX 1MB3A 4Q3LA 4RF3A 3ZWCA 1ZXXA 2WICA 3E2IA 3V2HA 2VYVA 1G5QA 3SAJA 1X80A 4LZAA 3TR5A 3EGEA 3BWDD 4B3CA 3I6QA 4B73A 1ZUNB 1YJ8A 2OMKA 1TAUA 3IIKA 1VI5A 3P9XA 1PSDA 3NQ41 4P3KA 4IUBS 5C3MA 1NSYA 1SC3A 1DQSA 4L51A 2ZYIA 4YN3A 1ZGHA 2CHUA 2CL7X 2LDBA 4PN7A 4YRCA 4PLYA 3Q9NA 1WZIA 1W85A 2C4NA 4KLNA 2GCEA 1YKSA 4MRNA 1SQ0A 2XIJA 3FZQA 3P0FA 5AK6A 4HVAA 4EAAA 5A04A 5FT9A 3PUJA 4OYHA 1JG2A 4BLOA 1V5GA 3EDRA 4ZJZA 5HS4A 4R9UC 1EFCA 4HH1A 1IATA 1GFSA 2QTGA 2HA4A 4LRQA 4QL3A 5A1JA 1W4AA 1ZI9A 2QG6A 4BKOA 1RHUA 2P79A 3KQQA 3QLTA 3AB7A 4C0HA 2WV7A 4F2WA 4F91B 5JQWA 5TIIA 4TTSA 2B5WA 3AL3A 5EKSA 3VA7A 3BMOB 4MMXB 5AW5A 4HMQA 3IUNA 2GZ3A 3HBAA 3MJSA 2XOKA 3NRCA 4N12A 3SP1A 1PV4A 4KE8A 1PEAA 4MX8A 1WNTA 4I9UA 4KPFC 1RXEA 4L3WA 2Q62A 4HSEA 5AW3A 3N8GA 1OIXA 3B7GA 3F47A 1T1SA 3U26A 3VISA 1QC5A 1JH9A 3A6ZA 1VP3A 3MJVA 3OJXA 4EGAA 1UEIA 5CMLA 3VOBA 5A2QA 4IFBA 3ZUPA 4C4PA 5T3UA 3JQBC 5CFMA 1QE3A 2HJ9A 2NO5A 1V95A 3EPPA 4DUGA 3HXPA 2H5JA 2ONZA 2XRYA 1RM3A 4BLRA 2JBWA 1FVHA 1E5XA 1WXQA 1AV7A 3VHXA 4C43A 3TTSA 5JD4A 1XVIA 4I4IA 2QAIA 4K88A 4HTAA 2GA8A 4ZYYA 3UB3A 1Q12A 5T8KA 1QGYA 1OLXA 5LSAA 2OM6A 1J5PA 4O4IF 2Q0HA 1T15A 1XRJA 3CCFA 5H7XA 1P91A 2JLYA 1JB9A 3DOEA 4KNYA 2WY2D 5C1BA 1L7BA 5JZOA 3PFNA 1BIFA 4AY3A 4Q7KA 3T9DA 4ARSA 2G5TA 1IXRC 1CD5A 2TECE 3DO6A 4O6VA 1K66A 3W06A 1QPGA 2IW1A 1T1EA 2PZAA 4EHFA 5EJ5A 3OLCX 4JOQA 3NDPA 4YDSA 1H2ZA 1DKMA 3GLGA 3F9IA 3WK8A 3FPLA 2R6R1 1XCBA 1ABBA 5BSGA 1G41A 4Y6SA 3NEAA 1UWLA 2JJ1A 1DRWA 3D9QX 1M74A 3I23A 2G8NA 5D7BA 2I29A 5HG0A 1V9CA 1JLLB 2VYVD 2ZBVA 4DCMA 5EP1A 3ESAA 2HJGA 4QNNA 3CRRA 4EA6A 2DCUA 4CV1A 2Q9BA 3SHWA 2OCDA 1ECFA 3S29A 4CZ2A 2VDWB 2I6UA 1ZIXA 4JP5A 2ZXFA 1DVRA 4WFJA 2WDZA 3B51X 2W4IA 4MUNA 5EHNA 1M76A 2FUNB 2AI2A 3R0IA 1Z17A 3X0DA 1AUVA 2E18A 2ATVA 2MYPA 4KPEC 2R8BA 4JXKA 3BXZA 1QOQB 2IYYA 3HUFA 4FU0A 1IHUA 1Z4OA 3O8NA 2YOHA 1L7MA 1J21A 4MYSA 4OCZA 1W75A 1M6HA 2RGYA 3TNJA 4LGCA 4KN8A 2MSEB 4BNFA 4TTJA 4MW6A 3DV2A 1X7YA 3QKRB 4G5GA 3CNLA 3N0XA 4LVOA 1FBNA 3OT4A 5CH5A 5T41A 4C22A 4C0JA 5LXTB 3PT9A 3TJZA 3QNUA 5TDHA 3F6RA 2TMGA 5A3RA 2ADOA 3TCNA 1JU9A 2HREA 5EWMB 1N4AA 4CIBA 2XOKD 3ZZNA 5KQGA 2PIAA 4CKBB 4WOPA 2PFSA 2DAPA 3WMGA 1G16A 3TTUA 2ACVA 4JQZA 3LY5A 3TZEA 3FF4A 2RGBA 3R3UA 5IVIA 1AZWA 1V7PC 1C1YA 3RSQA 2JF0A 1IOZA 4HDKA 4UM5A 13PKA 4DLAA 4E5DA 4ZZ1A 3OCXA 3D31A 5JS1A 2HO4A 1SQGA 2YVAA 4DUGD 1E3DA 4WWHA 1N3IA 2P9FA 1OXTA 3BVPA 4QOGA 1L5HA 3G0IA 3HE3A 4OXXA 2W58A 4AZWA 3SZMA 4HTFA 2YHAA 1KKUA 2OO5A 3LCJA 4O4HB 4RXUA 3HWRA 2ES4A 1SBIA 3COPA 4RZUA 3LE8A 5EIBD 1G8PA 4MOWA 4YAGA 2W00A 3RKUA 3M6IA 4G0ZA 4Q4HB 3E8SA 3SXJA 2REOA 4R7TA 5CG1A 1R7RA 2IPLA 2J33A 1WB9A 4GHWA 4H17A 3BC1A 3QRWA 4YJFA 1DKRA 1VKHA 3DEFA 4RVUA 4U9IS 1AHPA 3N7AA 1EUCA 4B31A 3EZ2A 2IYVA 4LRXA 1WMSA 2NUPA 4PTZA 4EK9A 1MO4A 4PLTA 1Q20A 4IBOA 1ODSA 1YZLA 1I4DD 2OHIA 3Q8KA 4B2LA 1G20A 4J2TA 1PR9A 1EM6A 1CB0A 1A98A 1CQWA 2A9VA 2JJ1D 2I2XB 4JLPA 1UBCA 3WRYA 3ZCUA 3DMPA 1F3OA 4OQXA 3TXAA 4OFBA 5ES3A 2IF0A 2RGNA 2CLIB 4LUCA 4EVSA 2PGXA 2WYOA 4JOBA 4G5SA 2HH9A 2YXBA 1WDLA 1YI1A 2BN4A 5JJKA 5EESA 5JVDB 1ONOA 5KTOA 5M04A 4JLJA 3X1XA 3NBUA 1FW6A 1M6VB 4AIIA 1K8XB 4OQ4A 3EW7A 4QHYA 4XPIB 4EYKA 2HXGA 3X1YA 1IHYA 3WFJA 4LCJA 4LC9A 4Z2AA 4R1UA 1GRRA 3L05A 4AG3A 3E9CA 4IMPA 5BSTA 4HNSA 4Q15A 4I99A 1AGRA 3BBPA 3O3NB 3U7HB 3DW3X 4JEIA 5FUMA 1NW8A 1GTG1 1O0BA 1JFRA 1PS0A 3L0PA 4JODA 5BSWA 1LH0A 2ZWIA 5HWSA 4HK4A 4WNYA 1QKJA 3NEYA 2UVDA 3HUDA 2HWKA 4YP9A 1ZYUA 4R84A 3HXTA 4BMYA 2AI3A 1Y9ZA 5LP6F 4ZEMA 4DXDA 4P34A 3OKCA 1XEAA 1WQ4A 4G0NA 4W99A 5BP7A 1DXYA 4LZPA 4CQMA 1RCUA 4EAQA 1J0DA 1Z2PX 2EL7A 1X8KA 3RJ5A 5FAKA 1Z0DA 3JRWA 4K6HA 4HV4A 1CVLA 1JEQB 4JA0A 5GJBA 4I1UA 1I1NA 1SB8A 1H0RA 3U4QB 2QZ9A 1FYXA 1ADJA 1XZDA 1Z28A 1Z3CA 4G5FA 3R7WA 4DJ5X 5KYUB 3CH7A 2QLFA 1FPMA 3UEOA 3ZXSA 3F7NA 3RVBA 1D3AA 4M0LA 1PEDA 3HP7A 5E9JA 1C8BA 1XZBA 1YOBA 1HWYA 3DDOA 4X62B 3EBLA 4X8MA 1IPEA 3CUTA 3T41A 1CJMA 2XAUA 3WMEA 5J4YA 4ZEVA 5J4VA 1L8LA 3OTOB 4URVR 1J1UA 3NPMA 4QX6A 3GPDG 1MEEA 4J49A 1YDFA 4WESA 1M6WA 5A02A 3EEBA 1XX6A 2EX1A 2NUBA 1FQOA 3R3WA 4G8CA 4RF4A 2PGAA 3M49A 5A1TA 3ZWWA 4YROA 1R5BA 4YPOA 2F8TA 1XB2A 3GDGA 1XXLA 4QT4A 1SN7A 2ZSKA 1CC1S 1RP7A 3DMYA 4B8YA 4N5IX 2D74A 3AGPA 4H31A 1BZYA 1ZD3A 3A9CA 2HHCA 5FFMA 1JXMA 3K31A 1O4WA 4FB5A 1LDEA 1QGUB 3GJRA 2YYSA 4PAMA 4WFQA 1WIWA 2L2QA 2QN7A 2JS7A 5I51A 3RARA 1IXZA 1Z6XA 2QD4A 2OM2A 1RIFA 3HM2A 5LLTA 5I4CA 3ZTYA 2XHZA 3QG5A 2QL5A 3LDAA 1GY8A 4L4RA 4H2DA 4R6WA 4PYJA 2F9FA 3FROA 4UVHA 2ZT8A 5CTAA 2Q3CA 2OHGA 3V4LA 1Z8DA 3G8AA 5H80A 2FPWA 1CQIA 3QUQA 3JYQA 4GPBA 2X0EA 1N5JA 2CZCA 3HJBA 1WMFA 2P5SA 3OUZA 3P27A 4LE0A 4OB8A 1AKTA 1ZUIA 4J0FA 3DH0A 1GZ6A 2O57A 5AVYA 2GPNA 4JLDA 3CVXA 4DSTA 3IBYA 3OSUA 2GD1O 3AL2A 1A8IA 2PN1A 1WETA 4AJPA 2ORED 1NBWB 2FUCA 2ONKA 3EJWA 3OP4A 3SZ3A 2WB4A 4F38A 1YR9A 3D8TA 1V7CA 4QREA 4U3JB 4X7RA 1U02A 4YGYA 3TQIA 2NU9B 4LHVA 1PR6A 1HFJA 3F9CA 4ZGBA 1U1EA 3Q15C 4ZEOA 1UP6A 2IY9A 1VSTA 4KO1S 3OCCA 5CP8A 4DQXA 3PNYA 4PG5A 4NR0A 4UU1A 4EHDA 4LZOA 3EIQA 4AP5A 3D54D 1R0WA 2CE7A 2NU6B 5AHOA 2P6NA 1E2JA 1J24A 1C7IA 3L43A 3HI4A 4NEQA 5I9LA 5MGNA 4HKTA 4N6NA 4R31A 3Q9LA 5JSFA 1RYYA 1DDIA 3MILA 2GBCA 2D1RA 4G9BA 2CLHB 4IG9A 3ROQA 3A1WA 3RFFA 2PBLA 3KKMA 3EE6A 3CUYA 3OZEA 4ACBA 5A3QA 2Q5EA 2WM8A 4QE3A 5DBHX 1ZAYA 3H5OA 2W2LA 4BPBA 1TA0A 4DRYA 2DU8A 4LPKA 2FZLA 3PDIA 2EAUA 3AK4A 3GUVA 4EHJA 3IP6A 3QWIA 2WWXA 1HG0A 2PL9A 4IFEA 2E2WA 2ODPA 3C3EA 9LDTA 5T67A 3U81A 2K4MA 5JARA 1BW9B 1ZRSA 3HH8A 1L8OA 3LL4A 4IVQA 4BRUA 3MTEA 3T3MB 2AMVA 3QSGA 5ITVA 2D13A 3R6LA 3R23A 4EI9A 2AN9A 3DNMA 3CNHA 4G0QA 3DC7A 3N7TA 4P22A 3EXG1 3PC6A 4OH7A 5EQJB 5FRDA 3WC4A 4C0WA 3MFQA 4UFPA 4JUAA 4JYPA 5LJIA 3PENA 3L5KA 1FBTA 2XNDA 5D3ZA 1DEHA 3CGGA 1W5EA 3NKLA 1E3EA 3LXMA 1QQ7A 3NVAA 2R3SA 4AS2A 1WPGA 3WRWA 1QBKC 1T4BA 1U2PA 2YCLA 3OZAA 4OHXA 3MHPA 5L51A 3T0IA 2AYZA 3FUUA 4UBNA 4Y2XA 1T34A 3KAKA 4FYHA 3SM3A 4BKQA 4B5KA 5KTMA 1EUDB 2BD0A 1Z88A 1XCMA 4PW0A 3SKXA 4E4YA 3H3XA 2JKZA 2ZBEA 2XPCA 4KDRA 3G9TA 3REQB 3TH5A 1KWKA 5KKAA 2POCA 3MJTA 3WOHA 1VPWA 4IEFB 4BMDA 2CFOA 2I6SA 1ZNWA 3QF4B 3L8FA 4AZ3A 4PX2A 1U6IA 3QKSA 3ZH2A 2PH1A 1TVKA 2H17A 1K8ZB 3IAAA 4FNMA 4Q9KA 3ED1A 3RT9A 4I66A 1FUUA 2YYZA 1XTRA 3FTQA 2OBBA 3ZE1B 3ZHRA 3KZVA 1Z7BA 2RONA 5T4EA 5IDWA 5KUTA 3DOJA 1P39A 1ULAA 3PHLA 3I6YA 4RTQA 4F4IA 4N41A 3D7MA 2IU4A 1TEXA 4EABA 1AKRA 3LC7O 4MA4A 1RI5A 3K96A 5KNDH 4CL3A 3TQOA 4JQCA 1J23A 1WW2A 5AHKA 5BSEA 5EMNA 4TLMB 4W4TA 3SOPA 4JOCA 2Q50A 4MPRA 5LCXA 5AI4A 4G1VA 1N0WA 3BGSA 1PG2A 4B74A 4KQWA 2WTAA 5IAEA 4DMGA 4C7BA 2YXEA 5BN3B 3IUYA 1KRWA 2TRSB 5JFOA 4NXMB 1P7ZA 3CIFA 3W2EA 2XITA 4QSMA 4B8WA 1G6OA 4E14A 1O89A 5L9AA 2ZOSA 2JH9A 1ETUA 2NYAA 1R0BA 2RC5A 3BKWA 3L6RA 2WRZA 3S1AB 3ASYA 5EA2A 3PE4A 2QRQA 1U0HC 3KEGA 4X1OA 1UBHS 3TRJA 2GSDA 5JANA 1OI3A 1QF7A 2O14A 2WFZA 4AB1A 2JEOA 2XAAA 3PFGA 5FWYB 2X0KA 2P7HA 1E64A 3UQYS 4YR7A 4Q3BA 3BIOA 3D4OA 2IPAB 2V03A 2W2LD 4GKAA 3UN1A 3NETA 4RL6A 3TEFA 1XYYA 1K9VF 3CMCO 4L7QA 4AZVA 2E5LB 2CN1A 2UXCB 1MDFA 2O6HA 2PZJA 2NP7A 1RQXA 1JDBB 3C6KA 4B6PA 3EPKA 1P4AA 2XHEA 1Z4IA 1WULS 1Y6RA 4EENA 1TLTA 2R1TA 1QUEA 1T35A 2Q5OA 5DWVA 1EM8A 4QYIA 2P2ZA 1NZFA 2ZB2A 4GOJA 4FFSA 5TEVA 4IIXA 5GY7A 4ENSA 4J0DA 2FQ1A 2CNDA 4RJLA 4MV1A 1N5RA 1HLFA 4MS1A 2MSWA 2QT9A 4PX9A 3K4PA 5BNZA 5LVAA 2XNDD 4AL4A 5HVNA 3K0FA 5DI3A 1J06A 2GX6A 4X93A 3FDJA 3L40A 1F51E 5HDQA 4ADSG 3GLFE 2QBYA 1LCIA 1DIOB 1P7VA 4LXIA 4CI0B 4IDHA 3O0TA 3K3PA 3K1JA 1BN7A 2RHOA 4UUBA 3H4MA 3ZCPA 2FEWB 3KCNA 3EX7C 2W6CX 3QXSA 1D2HA 4QXRA 1X7ZA 3UW3A 3E70C 1DOZA 1XTUA 4RA9B 4MR7A 3A9UA 3F7OA 4JOSA 1Y8ZA 1GCOA 5JLJA 4O08A 4A8PA 4DCSA 3IKLA 1TC2A 1VGVA 3NHBA 3OU6A 4W5NA 5DSXA 1WVGA 3EPJA 3T5PA 3HA2A 3NHRA 4MWZA 2RCNA 3Q3JB 4U5XA 3ICPA 5J5AA 4G0OA 1SKYB 5KDDA 4NEHB 3I3SR 3QOFA 3UJPA 5C8YF 5JBIA 2ECQA 4QAQA 2C4TA 2XOEA 3EZFA 2B8EA 3UK1A 1JT9A 1KVSA 2EZUA 2FWMX 2HSJA 4ITUA 1M72A 2OYRA 1GUBA 4D99A 5COQA 1MJFA 5EUBA 4Q66C 3P5SA 3Q6NA 4UJ5A 4LOIA 2HX1A 1GL3A 4TTVA 1L4YA 1CUSA 3FY4A 4BO0A 2C07A 2V9PA 3ILVA 4GBMA 5C80A 4PC6A 5ECWA 5DHPA 2JD2A 1YC5A 3LX5A 4MINA 1J0EA 1DWQA 3ZLVA 1UBEA 3UOGA 1SHKA 5JWRA 2I2CA 4L73A 2FX5A 2Y8EA 1FXWA 1PX0A 4O63O 5BYJA 1IAVA 3A2KA 4ZVTA 4PZCA 3DA8A 1UJ4A 3WLNA 4CMEC 1N5OX 3KZCA 4OUDB 4A0QA 2ZSDA 1G7SA 4JS0A 2DQSA 1R15A 1Y1QA 2PX0A 4XYEA 3ECSA 3VVBA 5BMVF 8ADHA 4BY9E 1TMKA 1QXSA 4ZAXA 1WMEA 3W6UA 1E2IA 4ZQEA 1PWZA 1V16A 2AZTA 3WNQA 3AW8A 1N2EA 2V7XA 3SX2A 3P0EA 4KR6A 3GJTA 1KQPA 1NI5A 4YIKA 2OWEA 2Y1DA 3V3KA 4PHTA 5F7OA 2YHBA 3JSXA 1US8B 4X1KB 4ZD6A 4EX6A 4D9NA 3USES 3AERB 3FSJX 1NY6A 2DBVO 5ELMA 4C1BA 3LNTA 2Y0CA 2YQ5A 2ORIA 1YGYA 1IQ0A 3OM0A 4W5JA 1GAWA 4XUDA 1NQ5A 3RYCB 2GZSA 5JXGA 3H1TA 3EN0A 3H2BA 1U6KA 1LF5A 1SC6A 2O3RA 3JATB 4PM4A 4A0FA 4WFIA 2XXAA 3H1FA 2NT3A 3EGCA 2O05A 4F0JA 1OJLA 4N0EA 2X0FA 3FNIA 2HLNA 3O38A 5CURA 1LDGA 4FCWA 3PHIA 1YQDA 3W1VA 1JAZA 2X42A 1Y81A 3MT9A 4NFSA 5BW6B 3ZHVA 4CUZA 3VJLA 4Z4CA 4W9MC 1RC8A 5DCLA 2OHXA 2QR5A 4FUTA 2QENA 2Y1LA 3CLSD 1PW7A 3DLIA 1IE3A 1EIZA 1P9OA 2R4UA 1EK6A 2EBUA 3CONA 3P19A 4FEGA 3RUHA 3L8HA 2GN2A 4WY2A 2JH3A 4EVRA 5BSVA 2YCBA 1G1MA 4X92A 4QJ5A 3MD0A 4M7RA 4TMVA 3H5NA 4U0KA 3FSGA 4ROTA 3ZNNA 4FX2A 2P2SA 3VZQA 5DGXA 1E5DA 3C3YA 5AH0A 2D06A 4IIVA 4CW7A 4R8KA 2NMVA 2WAYA 4R8RA 5C7IO 5JDCA 4CWAA 5KJCA 1KKLA 2AH5A 4NJMA 2AF3C 2FUG6 5H4GA 3UV6A 2FFBA 3A25A 3GV0A 3NBXX 3Q4GA 2VUHB 5K0JA 4JYAB 1K7YA 5CB8A 1QQAA 3JR3A 1CR4A 3VNAA 1NI4B 2OP1A 4FLEA 4PC7A 1DRKA 1TLLA 4G37A 1FMJA 2WJJA 5MFPA 1HA3A 1JFFA 3W5BA 1SOUA 4PZEA 1W96A 2IEAA 3E9YA 2EGHA 3VBEA 4YRNA 4H7EA 3H11B 4UU8A 1JQKA 4CU5A 1FX0B 1C1HA 4KK4A 3OX2A 3OLYA 5TQ0A 1M2OA 5CVTA 4IHJA 3FZNA 4X6YA 3C8DA 4MR8B 4E07A 2PDAA 3K09A 5E38A 3OIVA 2ZSIA 4FYWA 4P3NA 4P4GA 4DJEC 3K5HA 4M53A 3ABSB 4J07A 3K9LA 5E7MA 2QI9C 3CH4B 3GLKA 3EFOB 2Y9MB 2AHRA 2YYYA 4A82A 3TL2A 3PX7A 5JC8A 5L3SA 2H1WA 5GZ1A 4RPGA 5LUAA 1T8YA 3T4UA 3K70D 2BFBA 3CVOA 3GT3A 3AEZA 5HRAA 2QYTA 3IALA 4X66B 3EXIA 2R96A 3DMRA 3GCWA 1MORA 5ITWA 4TKMA 1E9VA 3EARA 4UNQA 4PSDA 1C7ZA 1H23A 1N36B 1S2IA 2VQ3A 2XYPA 2RC6A 4PYKA 1Y8AA 5DJ5A 3D7NA 3VI4B 4X54A 2UZAA 5LL6P 3P0HA 1GAQA 1U7ZA 2ZSHA 3THWA 5T64A 1NI3A 4XSHA 1P7WA 2IEZA 4MEJA 4C21A 2Q8NA 4DEVA 1KQOA 2QN1A 2OORA 1Q1EA 3QX8A 4Q01A 4RS4A 4M38A 3AUFA 5B58T 1GM5A 3DFUA 1G2QA 2GN6A 2A67A 2KLBA 4EJ0A 1L4FA 2HU2A 3ROMA 4E4TA 2FZEA 4LECA 4O5AA 2OILA 2DSNA 4X1IA 1ISPA 1DS6A 1GT6A 3K92A 1ZSVA 5MN4A 3K9FC 4XRGA 2VT2A 3U60B 1ZZEA 3GJZA 3FDZB 4KZPA 5FTLA 2QTTA 4XEUA 3DO8A 2O0JA 1CUHA 2KI5A 1S1CA 1T5BA 1XU9A 2Q4OA 3PDWA 4I1YA 4N7BA 1R37A 3DKVA 4DUZB 1VL2A 3OLZA 2ZJZA 2NU7B 3PS9A 1TGYA 1MC1A 3FSGD 5FPSA 1OB5A 3BWCA 3JVDA 1K5PA 2P7IA 4JI7B 3GLRA 4HDRB 5FR1A 1GNQA 2WQ6A 1KAHA 3ZVRA 2D7JA 4AF8A 1FLAA 2QQ5A 1ZK4A 3GJ4A 6LDHA 5E6SB 3UT0A 3IT0A 4N3AA 1E7YA 1GGVA 3VPSA 4J03A 3UUFA 3E6AA 1U8FO 2IV7A 4DSUA 1GP2A 1QQBA 2LDXA 3H5LA 4YRGA 4V3CA 4EO7A 4Q16A 2B7BA 1BNCA 3I8XA 3K9WA 4DTIA 3QE4A 3IHTA 1HPLA 1Q44A 3NWPA 4RXTA 2QD2A 1J5XA 4ES6A 4UTRA 1JGTA 1W4BA 4DNXA 1IEXA 5EEGA 1ZUD1 5J2TA 1JIUA 421PA 3LUHA 3BZBA 2XGMA 2OO3A 5A9SA 4JV5B 3C98A 3OF2A 1TQ6A 4ZEXA 5G02A 5LA6A 3UNXA 1VHLA 4FIDA 3BJMA 4F84A 1QHXA 5GGXA 1X7WB 5KB3A 4OHZA 2HIMA 2NQ8A 2ZULA 1K4YA 3LVRE 5FD8A 3NHKA 3ZVLA 2Q4DA 2BP7A 3SEZA 3NFRA 2Q49A 1LRLA 4EATA 1RSZA 5GONA 1HI9A 1IHDA 4UUMA 4EI8A 1YU6A 1AQ6A 3D3QA 3IUBA 3VX3A 5TJHA 3ZE6A 4LHYA 4O4IB 1YTUA 1WDMA 4ROSA 2VAMA 3HR7A 3P9RA 1VJDA 2LBPA 1LW7A 3EAFA 2CSXA 3UMRA 3AI1A 1GL9B 3NAQA 3DNPA 2AOUB 1W5BA 1T5IA 4V0SA 2NPOA 2J6CA 3NBAA 2G06A 2QW8A 4U2GA 2PMFA 3FN4A 4PQGA 4XSGA 4Z7OB 1O0CA 1AK9A 2WIKA 4INAA 4B82A 5KAMA 1O08A 1XZIA 2WHRA 1DBVO 3V3TA 5TVGA 2M98A 4HJXA 4DV0B 5LQNA 1P4SA 1JAIA 3EUEA 2ZW9A 3HVIA 2CHVA 4GI5A 1TM3E 2QL6A 2ZB7A 3IB6A 4MLPA 4Q82A 5AJHA 5IKOA 1QGOA 1V9SA 2A35A 3GFBA 2CCKA 3K9NA 5ALHA 2XMPA 5G4KA 1R0RE 2R1VA 2B98A 2LPMA 2Z9CA 3K9QO 3G2OA 1IONA 2IE8A 4C0KA 4CTKA 2GEKA 2CGEA 2I6TA 1LK5A 5AVQA 4QTXA 5JC1A 5A4MS 2RHGB 1NBEA 2AC4A 4I50A 1EEHA 1ISMA 3E3NA 4JYMA 2FPLA 4AG5A 1P6XA 4CDNA 5BW5A 5C46F 1SKUA 2IOFK 1GGNA 4NMXB 1KAGA 2VBGA 3WIDA 1IC6A 1T0JB 3HCBA 5HS6A 3RS3A 5KYXB 3CEHA 2R1UA 5FFFA 2FN7A 2XLBA 2ZI7A 4R1TA 3OLXA 2HEIA 2XCQA 1TVEA 2YBEA 1A04A 1WQ3A 2GTHA 1HDCA 1K6EA 2OE2A 2DHQA 2H5EA 2P65A 2XTZA 1JV2B 3K9BA 2CL6X 3WYFA 4BMPB 4M1SA 1VE3A 3GN1A 5KNCH 3NATA 2OQIA 4ZEWA 3WL4A 1B3RA 2A0WA 1ZA1A 2GARA 5EI5A 4KFCA 2HSGA 3G2HA 1TF7A 1YR3A 5F23A 1J4AA 1EGHA 2FPPA 2QRZA 4KJXA 4LXTA 5AYVA 4QLAA 3UAYA 3PKJA 1ZHOA 2VWPA 4V0RA 1JEYB 2BLLA 4CU2A 2B8WA 3K30A 2B8NA 3UHJA 1EP3B 3BOSA 3KHUA 3DBLB 4CEJA 2D5LA 4IP0A 4O2RA 4CLHA 4LJ9A 2EQAA 2VA9A 1UANA 3DVSX 2OO7A 5L7YA 1VCOA 3L4JA 4NHOA 2I6QA 1FJ2A 1VCIA 4M55A 1N9KA 2NOAA 4RV9A 2FTKE 3EPLA 3D5QA 4PPYA 3VJKA 3FCYA 4B0PA 3IQDB 2IXBA 1L5NA 1O5TA 2J67A 1E7QA 1KHTA 3DD5A 3DOFA 4XB6B 2ALJA 2Z58A 2FEKA 4ZOAA 4LRWA 1YE5A 2AD5A 2IFTA 5I8ZA 3LF1A 2VT6A 4DV5B 3ZWMA 4RMJA 1HR0B 1RWMA 3BQMB 5I3CA 2EJTA 2FCRA 3GIWA 1ADBA 4YMGA 5HBGA 1EE2A 2Q2NA 4M9QA 1GOTA 2I6GA 2XJ4A 3BF7A 1OTXA 1G17A 1O95C 3LBNA 4GH5A 1RHJA 2C59A 2G3YA 1YR6A 2VDRB 4LYEA 3T5TA 4QM7A 2O8EA 2VIIA 1YHZA 3STVA 3D6VA 5KOIA 2DPXA 1V39A 2JK1A 1XNJA 4U6SA 2CLOB 1RZUA 4D1YA 1C5KA 4JLBA 4POAA 4Q9IA 3R0JA 5HCUA 1U94A 4DWWA 3ZU4A 1HFKA 4FZVA 4IHKA 4BFZA 2JL1A 1P0IA 3G7NA 3MW8A 4F12A 4G5HA 3IS3A 4PF1A 3ZWXA 5K3DA 3W5VA 4B7UA 1VG1A 3C7DB 5BSMA 1P1JA 1OILA 1WUJS 2YZGA 4K3UA 4NBSA 4XQGA 1HEIA 4C78A 5L8VA 2E89A 2ZAGA 3DLPX 3CU5A 5HQ3A 1SGWA 2EEPA 2X9VA 4FZJA 4PYRA 3TNLA 3IMCA 1XVAA 4OU5A 4LPSA 2C3UA 3JQ8A 1XD2B 1U7DA 2BMWA 1O6BA 4ZP1A 5FIUA 5HDBB 1X86B 5JATA 5IVHA 4M8IA 4I5DA 2ZXEA 3ISJA 3TN7A 1XZEA 4ZZ2A 4BBPA 4F4CA 1LPNA 5DISB 1A96A 4B40A 1AGPA 1OC2A 3LLVA 1NLUA 3HACA 3JZDA 3I2FA 1F0KA 3TTYA 4CHTA 5E95A 4BTEA 3BTSA 2DERA 5FHRA 1DSSG 4FFPA 3QMWA 3B3QA 2AGVA 4IZ6A 2JCGA 2XWQA 3LX6A 6ADHA 4LCEA 3ZGLA 4N0QA 3EVAA 1EHYA 1FY2A 1YRYE 5K0ZA 2JFVA 5T7BA 1R2QA 3DBOB 3GZJA 4OLBA 5JIBA 2Q4RA 3RC1A 3RNLA 3RHFA 2BKAA 4GXNA 5IVKA 4DA7A 2HSZA 2QSYA 4JBHA 3CE6A 4FYYA 3S5UA 5LP6B 3L8EA 3MTAA 3SX4A 1DPFA 2H8GA 2HIHA 4YBRA 1UBKS 1VLLA 4L0QA 4AY5A 3UGTA 2GDZA 1Q7RA 2PAAA 3RU9A 4HDSB 3MAAC 4A6PA 2P4HX 3HLKA 1ZQ9A 2IYOA 4NMHA 1PFQA 1TQ2A 3S2ZA 3OKFA 3O26A 5JCOC 4DA4A 2PSHA 1MJNA 3H2GA 4CN8A 1YQEA 3IOEA 2GHTA 1ACLA 1YL5A 3CZ9A 4WKOA 1TYBE 2WE7A 5HPYB 5FPQA 1OBHA 1XMOB 1MX3A 1MG0A 3A4MA 5LBTA 3U7GA 1PT7A 3CIOA 4U7JA 3ANSA 4V38A 3EZLA 4ZA2A 3W5JA 4DCCA 4MDEA 1A97A 4GI2A 2DWQA 5GV7A 4AROA 5JCXA 3DZBA 2O8CB 3WRVA 1ZNZA 4EQ6B 2GXAA 4XAQA 3OUTA 2QWXA 3I4FA 3FCSB 5HMLA 3DKRA 1K9SA 4M21A 3TPFA 2JPDA 3VR6A 4REQB 5F76A 3MAJA 3EIWA 2C88A 3GLUA 3Q2KA 1CF2O 2DTXA 1E5TA 2C78A 1N9ZA 2FLKA 1N2SA 3PWTA 2FP3A 4U7FA 5JSYA 5B5SA 5JYCA 4HYYA 2VUTA 4C89A 3Q9UA 3B36A 1ES9A 1U3TA 1UK8A 3EXHB 3M4JA 3G3EA 3QHAA 4K9NA 1AMNA 2R8XA 2ARKA 2UYGA 1SIWA 3H8SA 4UEOA 5K2MA 4BVHA 4EEXA 1LS1A 1GG2A 1JR3D 3PGKA 4ECAA 3TAXA 3BCHA 3WK6A 1W4RA 1F20A 2AV6A 1UDBA 3UHPA 4N5LA 9LDBA 2UU9B 5EPOA 1BX3A 3PNQA 4N9QA 2F8LA 4AURA 1GPJA 1PG5A 1YB1A 5HJ2A 5HYVA 4K46A 3KKLA 2J07A 4EEKA 4RTLA 1XJCA 4QQ8A 5C5DA 4DANA 3I52A 3EPRA 4W9NA 3EA5A 3FUXA 2QSJA 2B5VA 3FLMA 5EWLA 2B2CA 2NO4A 1UKCA 5KTTA 2AOVA 3BGVA 3B1VA 5JNVA 3FUTA 1DFGA 1B8PA 4L9WA 5I01A 4WCFA 1M2VA 1Z62A 2WF8A 5CX1A 3W6ZA 2P9QA 4F8JA 4HX9A 4KPYA 1U1CA 2XUHA 1LK7A 2VP3A 1VCMA 4GQIA 5BRNA 3OEYA 5FYDA 1NLFA 2R8YA 3H9UA 4K9LA 4FI3C 5J1TB 1MJGM 1A2BA 2FOXA 2AF4C 1ML4A 2QEQA 1TU4A 3DM9B 4J90A 1DKNA 3ADPA 3JARA 4NCHA 2QMOA 3NOQA 4WOBA 2RAUA 4I4TA 1UZAA 2RH4A 4RFLA 3T7TA 2ZYWX 2GBLC 1AUPA 2H9IA 1U0LA 1M2HA 3QI7A 1GAJA 2C77A 1CJCA 1U0RA 1QQ5A 1DX4A 1X1QA 1VPVA 2BMAA 2HPAA 4LYDA 4XVRA 4MDHA 3WGGA 5C5EA 3WYNA 4BX3A 5DHAA 3RADC 3A6KA 2G09A 2PPLA 1NW4A 3FOEC 4FMBB 2ZWPA 2DC1A 3W2GA 4GR4A 4DDWA 1GTZA 5KNBH 2ZSBA 3PNLA 3AF6A 2QR3A 5JQGA 4NPCA 4QXMA 3CRQA 3UMFA 1YWGO 3KFLA 1EK2A 1ZOSA 1NLZA 1H6BA 4JI0B 5DNAA 4DIOA 1MQSA 3Q1LA 3E8MA 5E1BA 3BMNB 1LDNA 1P0PA 4C7KA 1W9HA 1SXJC 3VR6D 3OJ0A 2WFMA 2O7VA 1QYIA 2ZBDA 3QBDA 5HW0A 4RKFA 2B6HA 1N77A 4Y1EA 1L5VA 4Y98A 5FH9A 4BRWA 5BW8A 4W1PA 1RC1A 2VDMB 3DEIA 1XL0A 3HP1A 4GVXA 2OL4A 4WXEA 5AR1A 4N18A 3E3OA 4KXNA 2JEZA 1JILA 3C3DA 4GO1A 4O4JA 1X0XA 5CTJA 2HBQA 2Q3HA 2O1SA 4ACAA 4RZ2A 1OCEA 4KAFA 4X64B 4DYHA 4Q00A 1JDUA 3GARA 4LJSA 4M1TA 3EMDA 3PHCA 3FGPA 2HRCA 3QKWA 3X1JA 5E3HA 2JGKA 3HVHA 3NONA 3BORA 1A1SA 5JPIA 1P8JA 2N46A 3QVGA 4ETIA 4EX7A 1JEEA 2PFKA 4PAWA 3G1UA 4UAVA 1NSFA 3I05A 2E0IA 3O6VA 1P7YA 1JECA 1VPDA 2P4QA 3H5WA 2VXCA 3PFBA 1DXQA 5E1OA 5A4KA 2WTUA 1AN9A 1CUIA 2WNIA 4NOMA 1VC2A 3KLNA 1MP0A 1EG7A 1M6YA 2AN3A 2INGX 2XYGA 2ZJYA 3RYFA 2Q28A 1MHPA 1VTKA 1DXOA 1XLTC 2ODAA 1QE0A 3S99A 4XM1A 3WA7A 3OPQA 1FYDA 1T1GA 2Q6LA 2NVWA 3VDQA 2EGUA 2AFIE 3M2PA 5FV7A 1DO2A 5K3FB 3OTQA 1C1DA 3KQSA 4GPD1 3UV3A 2XNHA 3FCUB 2CJYA