1NRIA

Crystal structure of putative phosphosugar isomerase hi0754 from haemophilus influenzae
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
248
Chain Sequence
LSTLITEQRNPNSVDIDRQSTLEIVRLMNEEDKLVPLAIESCLPQISLAVEQIVQAFQQGGRLIYIGAGTSGRLGVLDASECPPTFGVSTEMVKGIIAGGECAIRHPVEGAEDNTKAVLNDLQSIHFSKNDVLVGIAASGRTPYVIAGLQYAKSLGALTISIASNPKSEMAEIADIAIETIVGPEILTGSSRLKSGTAQKMVLNMLTTASMILLGKCYENLMVDVQASNEKLKARAVRIVMQATDCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein HI0754
publication title Crystal Structure of Hypothetical protein HI0754 from Haemophilus influenzae
rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 80
structure length 248
sequence length 248
ec nomenclature ec 4.2.1.126: N-acetylmuramic acid 6-phosphate etherase.
pdb deposition date 2003-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1nriA00
1GZVA 5FLXA 5LMUB 4JI4B 2VQFB 2O2CA 1HOXA 4M0DA 1N34B 3M5PA 2DF8A 4LFAB 3JX9A 3T1HB 2CXOA 1HNWB 4DV5B 4X62B 2CXRA 4LF9B 2UXCB 1VIMA 4AMVA 4DV7B 1TK9A 1J5EB 4LF5B 4U6NA 1U0GA 4JV5B 3QKIA 1FJGB 3TRJA 3IFSA 4GKJB 1J5XA 4AQYB 4LFBB 1TZCA 2CXTA 3HJBA 2ZJ4A 5I01A 2I2WA 4JI0B 2HHHB 3J81A 2VQEB 1IATA 3FF1A 1T10A 1XNQB 1C7RA 3OTOB 3T1YB 4LF6B 3G68A 4DUYB 4DV6B 1MOQA 2VF5X 4X64B 1IBLB 3PR3A 1VIVA 2WU8A 5IT9A 4DR6B 1U0EA 1C7QA 2E5FA 1NUHA 4NXMB 3FJ1A 3J7AC 2O2DA 4JI2B 4TOIA 2ZJ3A 2J6HA 2CXSA 5BY2A 2UUAB 4JYAB 2CXNA 4JI8B 4GKKB 1JIQA 4B3RB 4DV1B 3I0ZA 1B0ZA 4DV2B 4DUZB 1HM5A 1XMQB 4KHPB 1DQRA 4OX9B 2UXBB 1GZDA 3CVJA 1HNZB 2CXPA 4X65B 4LFCB 3HBAA 3ETNA 4DR7B 1IRIA 3FKJA 1ZZGA 3UJHA 1HNXB 2DECA 1MOSA 2UXDB 1KOJA 2V4MA 4JI7B 4LF7B 1G98A 2UUBB 1X94A 2A3NA 1IBMB 4LF4B 1TZBA 1XNRB 1X92A 3JAMA 1NRIA 2UU9B 4DR5B 2PGIA 4NXNB 3NBUA 1VI6A 2YVAA 4X66B 1M3SA 1VI5A 3EUAA 3FXAA 4JI6B 1XMOB 4LF8B 1MORA 1N32B 3BJZA 4K0KB 5LL6P 2X3YA 2PUVA 1N36B 2I22A 4EM6A 3J80A 3Q7IA 4B3TB 4DR1B 2F4VB 3OOJA 5BR8B 3TBFA 1U0FA 2PUTA 4B3MB 2CXQA 1X9IA 2PUWA 1WIWA 4YHHB 2CXUA 4B3SB 2XHZA 3Q88A 1XTBA 3SHOA 1JLHA 4DR2B 2CB0A 1N8TA 2XBLA 4LZJA 5LMNB 4YY3B 3ODPA 3BCHA 2POCA 2CVPA 1Q50A 1JEOA 4S1WA 4DV4B 1N33B 2AMLA 4DR4B 1JXAA 5A2QA 2ZM6B 1X9HA 2VF4X 4DV0B 2Q8NA 5IWAB 1IBKB 4DV3B 4JI1B 4JI3B 3C3JA 3LJKA 4JI5B 4DR3B 3KNZA 4S12A 1I94B 2UUCB 2E5LB 1HR0B 4IVNA
chains in the Genus database with same CATH superfamily
3L43A 4JJAA 3ENQA 3VJKA 3AMVA 3E7WA 2D74A 2JKZA 5ELXA 3L6OO 4CM5A 1DTWA 4MHTA 3PIDA 2GN8A 5AHKA 3WWCA 4EA6A 5HIAA 2QUZA 4MV5A 4L0MA 1Z2DA 4HQRA 3WP0A 3AEKB 4BNFA 2WWVD 2ONKA 3HKBB 3WDMA 4MVJA 5BYAA 5KJEA 3K0HA 1VA5A 2R60A 3MRXA 5ALEA 1DDGA 4DLTA 4I1SA 4UE6A 5C7OO 3C8DA 4QOFA 4PRYA 5CTAA 5KVVA 3T7AA 5DM1A 1OUMA 1QIIA 4ZQBA 2J41A 4N76A 1FPMA 4I08A 1UPCA 3HUDA 4CMKA 4OJMX 2VC2B 3KB6A 1KU0A 1C4KA 4ZK2A 3ND8A 1JH8A 2BD0A 2GJ8A 1EK0A 2JBHA 3OIDA 3TTUA 1G1MA 3FPCA 3VR5H 5FWNA 5JSYA 4F7WA 3AUYA 2V4UA 1MA0A 3EVDA 3OTOB 1N5KA 1UMDA 2O6LA 2ZUSA 1ZYUA 4QDXA 3RUCA 4DIDA 3IXQA 3QV1A 3SJAA 2GS9A 2R1TA 3HYNA 1N6LA 3L82B 4W9NC 4X44A 1ORTA 3KSUA 4ZAXA 5GVSA 1UXIA 2OXEA 1LJ8A 1J8FA 3AOEA 4CMAA 4HH0A 2BKUA 3W7VA 5LXTF 3IP9A 3PGVA 5EUQB 4F84A 5JRZA 1M5UA 5FTKA 3HB0A 3BVPA 5DSXA 1Q95A 2V0NA 5D6NA 1QHGA 4DABA 1J39A 1KQPA 3QUTA 4P5EA 5DHRA 3K0CA 3U4AA 4E11A 1PJRA 3B3QA 2AXNA 4W1RA 1EK5A 5AHRA 2WWYA 1F3LA 3IUQA 2IH4A 4OX9B 2IYOA 3E82A 1KL7A 1T34A 3VKGA 3CH7A 5HJ2A 2FFJA 3KQPA 1PL8A 2GCNA 2GSWA 4JB8A 2FMTA 2KYRA 5D3MA 4CL3A 3A4MA 4ZZIA 3OOYA 3H2KA 1BSVA 4EFMA 2FN9A 1ODSA 3L1JA 5JPCA 4DE5A 3P0HA 3CW9A 3UATA 4B32A 1N6NA 1P9WA 3VU9B 4PAGA 1GVHA 2V3WA 1XNRB 1KDRA 4P36A 1JGTA 3DMFA 3RAEC 2ODWA 3RFUA 3A7EA 2EX1A 2GN4A 3ID6C 5CH8A 4DDVA 2V3CC 1FB5A 4P0QB 3BK1A 3LXUX 1DX9A 3NHBA 4PPNA 2R1UA 4Y2QA 3EUAA 4J4TA 4R8KA 2VF7A 4R0NA 1JFTA 3EH1A 2W70A 3B9QA 1U9ZA 4ZOLF 4A2WA 3TINA 4WNAB 5AQ1A 1FJHA 3DMRA 1A3CA 4PXYA 4TKVB 3ZTYA 4C7BA 2ZI5A 1EVIA 2IYLD 1L5SA 1NRWA 1ULUA 2Z83A 2EG5A 3PDIA 4JJFA 2CUTA 4IICA 4C07A 5ICGA 3BTOA 2VTBB 4B3SB 8ATCA 1T36B 4PC6A 4QL3A 4LPKA 4RK4A 5CUQA 5K0TA 5HWSA 1XLTA 5HIMA 5JC1A 5C52B 1N0WA 3FSEA 2P78A 3GZNB 3OWHA 5LBUA 3P2OA 3FHCB 4EY5A 2X8LA 1WPGA 3PSAA 1M73E 3OI7A 2R66A 3ROKA 1KZYC 3G1WA 5KI6A 4B8WA 4M1QA 1PQWA 1U7DA 1BDBA 4U2FA 4Q9IA 2GBPA 4Y0AA 1RI2A 3C74A 5AIBA 2WAMA 1V7CA 3RB8A 5DHTA 3NC0C 4WY5A 2WM9B 5CYOA 4P33A 3ZX4A 1TEHA 4G1FA 3HN7A 5AVYA 3NQ41 2Q0HA 2IHYA 4HYQA 4YJ2F 3WMEA 4AECA 4KPEC 4YUVA 1KFCB 3UAVA 3GJ4A 4CT4B 2EL9A 2QMZA 4OO3A 2BHLA 3IAAA 3G7SA 1XMXA 1VA4A 1VL1A 4QYIA 1GM5A 3EXG1 1IC6A 1WP4A 2PT7A 7ADHA 5H0IA 1J99A 4LHEA 1BQ3A 1G6KA 2IUFA 1XPJA 4R1MA 4DV7B 2H63A 4TKLA 2Y1OA 5CVCA 3B5JA 5I7EA 1SCQA 1T5OA 3EXHC 3UC9A 1PS0A 4C0HA 1H8EA 5H1YA 1KOFA 2QN9A 5H82A 1ND5A 1JHRA 1QCDA 3VU3A 1EVLA 1G9TA 2P5YA 3NNSA 5I9BA 2DM6A 2ZB4A 2NAPA 1GEEA 3CH6A 3FJYA 1U0JA 4HAXA 3RHFA 1ZIOA 4NCAA 5AMXA 1BH6A 4QOHA 4M8IA 5HFJA 3OOSA 2PZGA 4XUDA 3TB4A 3TS1A 5DFAA 1KC3A 1PHRA 5LU9A 4HEA6 2FW1A 3KUDA 3PUYA 4G36A 4QAQA 2DUUA 3LI2A 1GPLA 3QPUA 3KOUA 1YI0A 3IIEA 1DWUA 1N2IA 1JHDA 4LTMA 1KPGA 1TAHA 2A1TS 3C3MA 3A25A 3CNOA 4KUEA 3BMCB 1OXVA 4P58A 3V34A 3ZJUA 2B2NA 1F1BA 3N0RA 4LZZA 2PO5A 1JAYA 4GOOD 4RTSA 1QG4A 3OWXA 3PDWA 1IL0A 4LYJA 4O2AB 1I7DA 4O3MA 2GTHA 4FCTA 3F6SA 2HI0A 3W2IA 4OXNA 1QLHA 1V8OA 3OBIA 3R9WA 1XP8A 3E3LA 1Y8QA 4QHSA 2JRLA 5KPJA 4C0AC 2XUOA 1SOWA 1LVHA 3GMSA 3JWEA 2QTNA 3IVCA 1DOZA 1H65A 2F48A 3FLAA 4KE8A 5HF9A 1TVKA 3DF9A 1RC8A 1E6LA 4JGBA 1JDVA 1YD7A 5HGXA 3U7QA 4LF4B 1IFXA 3Q11A 2PQMA 4Z2YA 3AG5A 4J2HA 1ZIYA 4OVKA 4DXHA 2FUKA 4V0SA 1XXHB 2Z8YA 4J7XA 2PZAA 2IY7A 1Y42X 3AQ4A 1FMLA 5MN6A 4TUYB 4OHKA 1E2FA 1OFIA 3OE1A 2EF0A 2XVYA 4LJAA 3SVTA 3AW8A 1FVXA 2OO7A 2JK1A 4F8JA 4EM6A 1G21B 2IIQA 3EVZA 3HI6A 2WP8J 2FDCA 2G9VA 5FBVB 3IAM1 4AMYA 4YFVA 2ZSFA 2HZ7A 2GPWA 3KJGA 1EHYA 3AFMA 3EDOA 3WLOA 5CIWA 1I6WA 1GTJ1 2W5UA 1Q2UA 2O3QA 4OA5A 5JSKA 4QUEA 5CYPA 2HF7A 4H6XA 2Y4OA 3V5NA 2FMHA 4AJJA 4BKUA 1P4HA 5AOCA 4B6PA 1JJFA 2BFMA 3FTFA 4FEYA 2KM1A 2QQ0A 1OWMA 1YZGA 4KKXB 4PSDA 3O82A 2LCFA 4YJDA 3ZWDA 2ZBRA 5ARCA 4RTPA 1M1NB 2HO4A 2VLIA 3QFHA 2C31A 4MP8A 1EFPB 2PWYA 2OM6A 3GRKA 3HFJA 2OV3A 4JB3A 5GMOA 3ZXUB 1I6LA 1HTWA 2DTEA 1VTKA 2YFHA 4REQA 3NTVA 4C1NA 1MNAA 4JGIA 1MVLA 1NSFA 3IV6A 4NK5A 4NOJA 3VFDA 4ZYUA 5AW2A 2E5LB 3OQ1A 4O1HA 4O4JA 4W4TA 4K3UA 3I34X 4RULA 1NJ2A 2AFHE 3RBZA 5I47A 3K8ZA 4O4IB 3RG8A 1HEYA 4AS2A 1CZUA 2DPXA 2FW0A 4IJUA 4R6WA 4M9QA 1DUVG 4RTOA 1MFZA 3W3AH 2GJSA 1NY5A 3AK4A 1UXHA 2F62A 3K3PA 4WAUA 5CFMA 3DMDA 2Z0MA 4PIVA 5BW8A 5G0SA 1SUWA 3RT1A 4YI5A 2OYRA 5J59A 1I7PA 1ZU5A 3OJLA 4K87A 4MW5A 1SHZA 3W5IA 4DF3A 1GTVA 2QB5A 3MTGA 5CA0B 2I8AA 1HK7A 1XLWA 4BGIA 4R31A 5DTRA 2HNAA 2Q4TA 4B2PA 4F5WA 1DRUA 2AQKA 3F3MA 2EDAA 3SJ7A 5C8DA 3C6BA 3F3YA 3NC4A 4H08A 2XJ9A 3ILHA 2XY4A 4XQEA 1VJTA 1XZDA 1QH8A 3O90A 4O4LB 4KIWA 2RK4A 1QJ4A 4I55F 2PD3A 2BEUB 4JLAA 3WLMA 4HGOA 1XZMA 1R50A 2EYUA 2IUEA 2DUMA 3PHIA 3PPWA 1RT9A 4J43A 4YRDA 3E22B 3TFWA 3WMXA 4JUFA 1N8KA 1YUNA 1ZN8A 4M1KA 2FLVA 2G5CA 2HRRA 3KU1A 4L5IA 5ALMA 2GJ4A 4HN4B 2GHIA 2QD2A 1C9DB 1LPNA 2MSCB 5J4KA 4FSHA 4KHZA 3W6NA 2XNSA 3KUKA 5JYCA 3GJQA 3DMTC 4EJ2A 1KVUA 3CUVA 1JVBA 1P77A 4M2LA 5GV7A 3S40A 1WMEA 1JVSA 4P7FA 4B35A 2SNIE 5L3SB 3GRPA 1Z68A 2ZI9A 3LUFA 4ZYWA 2GXUA 6PFKA 5LMCA 1VCHA 1I33A 1IU9A 3QLTA 1HDIA 2EP5A 2Z04A 4C6HA 4AZVA 3ZV4A 4HYYA 4DTIA 5AVRA 4WTOA 1I2AA 4MW2A 3EFOA 4GPAA 4RVFA 3TSOA 1L5VA 2NNLD 1PJ4A 3AU9A 1B3RA 1G20A 2H7XA 5DX1A 1JW9B 4MVJD 1XA0A 2W4IA 2WJPA 5AM1A 3H42B 5A62A 1EJ2A 3E48A 2EFGA 2QE6A 2YZMA 1QGDA 3D3WB 3DV0B 4UEOA 5LZ7A 2CFTA 4DEYA 2HPZA 4LXYA 4F45A 3DKIA 1BA3A 2HJWA 3O94A 3PNYA 4NFLA 2G0AA 1VIAA 2NM0A 5DE3A 4URZR 1FQJA 1I14A 1MXFA 1WNFA 4YP1A 1MHTA 1PJ2A 4S35A 1CUUA 5CG2A 4KRFA 1U2GC 4R71A 1A8SA 4EGSA 4A0HA 4JBNA 1HH4A 1SB8A 1R5NA 4JL5A 3CSSA 4B3TB 3HE3A 1O94D 3TBFA 4A73A 4YUXA 4ZO8A 1QVWA 3EEFA 4MV4A 1JSXA 7MHTA 5J1SB 2M2IA 1UBCA 2WUEA 4LC0A 5BV2P 3L0ZA 4LMRA 5EXSA 3HFRA 1DIGA 2BF4A 3PL5A 4BNLA 4H18A 3WBKA 1SCUA 1P1CA 4H1WA 1TEZA 4OQMA 4UVIA 1JF8A 2EBWA 1J0CA 1X3SA 2VA8A 1FQOA 1VL6A 1KEWA 4KQHA 1CPYA 2GXSA 2QAGA 2OCKA 1NYQA 2TMGA 3N2EA 3PYLA 4QLOA 1U3TA 4FNGA 3EX7C 5CIYA 2BP7A 1CUIA 1QLWA 4GKBA 5KDLA 1YUMA 3WB9A 2B8EA 2PR2A 3ZGNA 4CMBA 3RSFA 3PQCA 4QX6A 3RIEA 5JQWA 1SQSA 5F4BA 4C6TB 1SK8A 2HJRA 4ES6A 1K6IA 3JQ7B 5HEKA 2G4VA 2NVOA 1W36B 3BSWA 2QXYA 4QDKA 1A71A 5L6LB 3JXEA 3M7IA 3KR9A 5GY7A 1MFPA 2A14A 2YFYA 4DLPA 1YQXA 2E1PA 3WGYA 1BRTA 2BE7A 3GFQA 1ZOPA 4F12A 3QPVA 1Z74A 3FDZA 1GRRA 3FPAA 3LK7A 4L85A 1MAWA 1SUCA 3AILA 5FNVA 2QG9A 1I9GA 4I1OA 5IM4F 2G7ZA 3OICA 1E7MA 4B2LA 1IXSB 3GXBA 2IKQA 1Z37A 2Y92A 1OY1A 3Q8XB 5JDCC 3T1QA 1ABFA 3ECCA 4I6EA 2FMXA 4R2KA 4N1AA 3CLTD 5TARA 3LQRA 3RH0A 2X3FA 3H84A 4IIJA 3UCFA 3E9EA 4QT0A 2OVFA 4FGJA 4J4BA 1UM9A 4JJ6A 1SAYA 2G08A 3EQ8A 3TLZA 4P93A 1JI0A 3WTCA 4BP8A 3QFRA 2XYQA 5K4AA 1DOHA 4D4HA 1LLCA 2R4TA 4CNQA 1K8YB 2D0IA 2I99A 2PBRA 3JWHA 4JYAB 4OM7A 4B75A 2FPGA 2BGTA 3G8DA 4B43A 4CN9A 1GV1A 1U9YA 1ZU4A 2C4VA 2WJZB 3I0ZA 4P7KA 2EBFX 4P3KA 1SKAA 1F8XA 3T3IA 2JASA 2BFFB 5C32A 3RRMA 3C41J 1M5RA 1OGYA 2IQIA 3WIOA 4X1KA 1YS6A 3BWCA 1ZJJA 1IM5A 4ARSA 3PFWO 1Z12A 2X0RA 3CKMA 3PENA 1U28C 3RK4A 3ZY3A 3H6HA 4TV8A 4H4EA 3IR6A 2CHGA 2FWNA 3SX0A 5FBRB 1OLOA 1RAEA 1M6VA 3K09C 4W5HA 3WZ2A 4D9CA 2Q46A 4YAIA 1WD5A 2ZKIA 4LF7B 1G98A 2D5AA 3JVEA 4X71A 2J30A 5KNBA 1A9ZA 4KGXA 1E1MA 3EVCA 2OD9A 4LG1A 3R6WA 2FG6C 3AFIA 1H8ED 1HURA 1M66A 2JHGA 2CDNA 1WXQA 2PL1A 4WCFB 3UGQA 3P0RA 3C6ZA 3SF8B 1VL8A 3ANSA 3GOHA 1H5QA 1TECE 2V7XA 1QF9A 3QZUA 5FYDA 2O8CA 3HCRA 1XJ0A 4LJ6A 2VUHB 3T5GA 1LC0A 2K2WA 3IPLA 5HMMA 3VTAA 1SXIA 1XVAA 1YC5A 4FFRA 4X7RA 4D5EA 2XITA 3F47A 3MJRA 1M34E 1MX9A 4ZEXA 3TD2A 4DZRA 4NZNA 4X1OA 1S5PA 1A4XA 1OW3B 2LUOA 4FHFA 4KTTE 3WZMA 5C8YB 3WGNA 4MVYA 5FPYA 1EE2A 4RS4A 4EA7A 5SICE 1AQYA 1DELA 1YR7A 4MUEA 4X6XA 3OQHA 5LSAA 4KI0A 3B2NA 1N75A 3AJDA 2I6UA 1LI5A 1AKTA 2HO5A 2ZJ0A 3FPJA 3HDHA 4H6PA 4IHJF 3JQ6A 4ZALA 1TFRA 1YOVB 1O6BA 4PNPA 5JCXA 4WX2B 2CLOB 1A9PA 2HQBA 3ZIDA 1GG5A 4D3YA 1NW4A 3IXMA 1J49A 2PS1A 2XODA 2APJA 3KKPA 3PNVA 4HPXB 5HHTA 2R65A 1KYVA 1XHLA 3PR1A 2IOFA 4K81B 2QL5A 2A0YA 2EQAA 3DS8A 2HWKA 3NHSA 1S8NA 3PNMA 4LBZA 4PHFA 3WXBA 2H00A 3VSEA 4D44A 4CM1A 3UYLA 5F52A 2OHVA 3WK9A 3H1BA 5F3WB 2EGGA 2PL9A 3ZDBA 2BT4A 1EXMA 4KDFA 4XJSA 3C3XA 3B8EA 4FDMA 4H7FA 4OHVA 4P8RA 4PC2A 3IT3A 3KUCA 5T8KC 3VYWA 3OE5A 3T9BA 5EIBC 1BDHA 2FWMX 4XM1A 1JIUA 2W00A 1JEAA 4J9UE 5B58T 3A6EA 1UEJA 2XMPA 2EERA 1YL5A 1N2XA 4UASA 4WESA 3U39A 3AU8A 3MCUA 1N2OA 1A5SB 2F8MA 3CX6A 2FQQA 2YZ2A 3IUPA 4CI9A 3DYBA 3L0OA 3W9SA 2FMIA 1YE8A 2YXLA 5JJBA 3QFFA 2O2EA 1M74A 1FXSA 4WFJA 2IIVA 4Q4CA 1D03A 3IQIX 3TOVA 1D5WA 2VEDA 1SHTX 2GUGA 2PKEA 4LEIA 3TVYA 5IN4A 4O1MA 1ORDA 1W25A 2ALJA 3ESQA 5BNZA 1ICEA 1MJNA 1Y6RA 2G70A 3FOBA 4OBBA 4R98A 4GI2A 3BWMA 3ADKA 3FKSA 2JLRA 4G4SO 4IIGA 3IVMA 3HU5A 3LPCA 1PI3A 1P1JA 5C34B 1GL9B 3GARA 4OJTA 4OJYA 3ZU6A 1G5PA 1EWVA 1GL3A 1PZNA 3MRSA 1NJ6A 2XA9A 4IXMA 1MN6A 5FJIA 1UZLA 3B6ZA 3ZGLA 4EG0A 3O9MA 1SEPA 3Q6MA 5CX1A 3V1YA 4WT7A 4AZTA 1BOFA 3K15A 2Q5FA 3M4JA 4MYDA 4PAOA 4MICA 2BVNA 2QJRA 3I0MA 4HLUA 1T8PA 4RD3A 3UV7A 3ZDXB 1IXKA 3F67A 1DINA 3BULA 1PK9A 1WUYA 3M0EA 3ECSA 4PZEA 5IYZF 3I05A 1E1RA 4FLEA 4BE7B 2V1UA 4MRSA 1FDVA 3Q5EA 1FYVA 1USKA 4L16A 3EF0A 4PYKA 1EQ2A 1DKNA 3L1UA 4RCVA 1L7MA 1FNBA 1U04A 3N28A 1Y81A 1CW2B 4AZ3B 5GQSA 4DG8A 5SZHB 4DR5B 4AKIA 2AG1A 2A5DA 4PO8A 4TTQA 4BQOA 4PV7A 1H2FA 1JJAA 1KI6A 4YPVA 4X66B 1N9GA 5IPFA 2HC9A 3LQKA 4H1HA 4LV8B 4RJTA 4OYYA 2AD1A 3SE7A 2ON6A 2GCOA 2ZB7A 1JQJC 2NAFA 3MRTA 4M1YA 5ECYA 1BE6A 5HJ7A 1DLIA 5I9LA 1E9DA 1NLUA 4ZVVA 1XRMA 4EPXA 3KLNA 2EWMA 5JATA 2RFLA 1LRLA 2I2AA 2CJYA 4NMLA 1BYUA 1PTJA 2W11A 3EUWA 1J5PA 1W52X 1WW3A 1U7ZA 1X2BA 2PU7A 3LF2A 3OPMA 5AW8A 2HM7A 2QIOA 1NAIA 2OGSA 3E0QA 3NX4A 3U9LA 1TUIA 3HWSA 5IMBA 3DVLA 3DB2A 5JALA 1LVUA 3M6XA 1Y6GA 4UM5A 4KJZA 1Y3FE 5KX5A 1G5QA 4I9GA 4LISA 1D3AA 1U3DA 1XRQA 2ZBFA 2N0SA 5EUCA 1DT3A 5A4IS 3NDBB 2GM4A 3MT9A 3R44A 1B0UA 1MRNA 4HJRA 3ZNNA 4EABA 3NT2A 1QTNA 3JQGB 3DHWC 1XZAA 4Q9NA 3WQQA 5JHGB 2QRPA 3LH5A 2W71A 4MARA 3ZHYA 5K01A 4MCIA 4M0DA 4RMIA 4Z4QA 4GGOA 1Y1TA 4JEUA 4PQRA 5H3LA 3REFA 3DKVA 3DEHA 3K5WA 1UJ2A 1JZQA 4LOHA 4O2BB 1GUFA 4Q0MA 3N58A 3U4QA 3PIIA 4LJYA 4GMXA 1LSUA 2MCFA 4DKJA 3STTA 5CXQA 1OYYA 1RJ9B 3RTCA 3NHPA 4QBHA 4H9GA 1ZQ1A 4PYQA 3ET5A 2HTEA 1AUOA 2RDMA 2GPAA 2W6CX 4JNKA 1RXIA 4AY5A 1TLFA 2RD2A 4A36A 1FLAA 2PLFA 4NCHA 3FYHA 3UENA 2JLQA 5JLAA 1LQUA 1NVTA 1U9CA 3QF7A 2IIBA 4EUKA 3JYQA 1KKUA 4OUDA 4GBGA 1ORRA 1QAQA 4QNMA 4BO8A 1VRCA 2QRNA 1MENA 5EZ5A 4RS3A 1JTEA 2HQSA 3ROGA 3W78A 4B83A 4ILEA 4WZAB 4CKEB 2V03A 1F0KA 3JSAA 3VSBA 4MV8A 1QCYA 3C4QA 3ZU3A 1F8GA 1YQQA 1MEJA 1R4MB 2DHQA 3ICWA 4NKRA 2Z08A 4BO0A 1YRBA 1CEEA 3UZUA 4QFDA 3O03A 3AR5A 1C4WA 3FNFA 3IDQA 2QLTA 2P2YA 3DE2X 1RWOA 3ES9A 3MHPA 4P80A 1SELA 3KBOA 4FN5A 5BSEA 3VNQA 1VYTA 5HE8A 5CM9C 3OTGA 2F1KA 2GYWA 2ZXFA 1L2TA 1KQOA 4N54A 4OJNA 2I54A 3OZUA 5DHAA 1J2JA 3HFSA 5ECWA 3QEMA 3SBDA 2Q0QA 4XD7A 1FVOA 3DT8A 1RMTA 1F2DA 3ER8A 1ARZA 1U2DA 3DBHB 4IH1A 1U4OA 4TLMB 3QVTA 4IAOA 3TX6A 2J3EA 3SS8A 3AERA 1DFHA 3DAFA 1XCLA 5M5BA 1RBYA 4C3VA 4JSYA 3HGQA 4XUEA 2SECE 4PM4A 1PR2A 1T4CA 4CKWB 3EYAA 3MJCA 5IDYA 3WK6A 1QQ7A 3TQSA 1HDXA 3PUZA 2YJZA 1Z88A 3R0XA 4MW7A 1L1RA 3IULA 1JU9A 3EF3A 5EWMA 5A03A 6ABPA 3IQDB 2Q5LA 2CVHA 4IJWA 2P27A 3LCUA 1MIOA 2JPDA 4ND8A 2HA6A 2I7TA 3PQ4A 4CMCA 3IOCA 3I32A 4FYXA 2WW8A 4LHWA 3H8WA 4PC3A 5IJ9A 4GPIB 1O5TA 3U16A 5BYJA 1T1SA 3LT4A 1MAUA 2Z4TA 2RGNA 4DLZA 2DERA 1A95A 3WBJA 3FPBA 1QNFA 1A2QA 1FSGA 4ZV4A 1VIDA 4I36A 4LRSB 4BBJA 1H2EA 3B89A 1SQ5A 2O1EA 3NH9A 3IUYA 4QHTA 4DSOA 4DVGA 2AC4A 1PUIA 9ATCA 2BMJA 1MJGM 3L1HA 1GWNA 2J3DA 3Q4GA 3NU1A 2YNMA 2A1UB 3HN2A 2ZSAA 3TL3A 5JJLA 1WUIS 3QMMA 1LBEA 5SY4A 1H1LA 2FE4A 3D6AA 3BTUA 1L6IA 3DZJA 4XGQA 1B74A 3HCNA 4PFSA 3KLPX 2GBIA 3IBGA 1E0JA 4X20A 3OPYB 3U4DA 5BN5B 1UPXA 2DLCX 1P17A 2ZJFA 3OIUA 4QBTA 4KBFA 2RHGB 4RKFA 1AZSC 3M4XA 1Q1QA 5AI6A 2QRJA 1L7RA 4ZEVA 4BQSA 3D1LA 4EPVA 4INPA 4PYLA 4A27A 2HWUA 4CM7A 4PZDA 5JANA 3BGSA 4WKCA 4ND6A 2CFCA 2H57A 2ZXEA 4BNHA 1I1OA 1SHJA 5C4IA 2Q2OA 4IY1A 2BJHA 5ALWA 3QKIA 1Q77A 1W59A 4TXMA 3N74A 2D7DA 1G5IA 1O8CA 1VCOA 3F3KA 3L8YA 4YMUA 3I2YX 1JDZA 1E6EA 1NUAA 4MHOA 3ABRB 1SC4A 1V43A 3I6QA 4YACA 1O94C 2O5VA 3EISA 1W4ZA 2QZJA 3L0YA 3W79A 3W8DA 1GGEA 2DTXA 3WJ1A 1FSSA 2P30A 4KXNA 3PQ8A 5FR1A 3E23A 3SVZA 4NLLA 1KO1A 2C3PA 3LO8A 1LLUA 4AX4A 1CK4A 4PLVA 3GJ0A 1KSHA 3AOEC 1HMYA 4MV0A 2RBGA 3E4DA 4NMMA 5AM4A 1U90A 4P35A 1TGVA 4C7MA 1GSOA 3L7AA 2F8SA 4F4FA 3R7SA 5IT9A 5HIIA 3L01A 2X5NA 4XM0A 2PFSA 3UK1A 4HFMA 1ZIDA 4MRMA 1W6RA 4DUPA 3TLKA 3I23A 3KOXA 4Z7JA 1K7CA 1QF6A 2VDUE 1E61A 1O9HA 4WECA 4I4NA 1QHEA 3AVPA 5J58A 2CV2A 1D04A 2EEZA 3UJNA 1L7QA 4FKMA 4OHBA 2C7GA 1JN0A 1GXSA 4DMKA 1FDOA 1KO7A 2IC5A 2YYZA 2E3JA 5T5QA 4AJ4A 1Y1KE 1CUSA 1EGAA 1CU1A 2L69A 2BONA 2OD2A 5AXAA 2F7SA 1J2TA 4EYKA 4WLOA 5ES3A 2AN9A 1SD2A 2AQHA 3KPJA 2A94A 4JQCA 2PQ0A 2W2MA 3FVQA 3IPAA 5CLHA 5G2OA 4ALIA 2E5WA 2QEQA 2WD7A 1C30B 2H1VA 3DGEC 4KGDA 1S02A 1U0BB 2JGLA 1JQEA 1YH3A 1ZZGA 3MJVA 3B7GA 1EEHA 3L1KA 4QGBA 1ADFA 4O1IA 4RPLA 3RC1A 4EBFA 4Q4JA 1Q7EA 1VYUA 3I5UA 3N2KB 5IJ9B 2PUFA 2V6FA 2PT6A 3CRNA 5C5IA 4BMOB 3GLFB 2AGVA 1B8UA 3NDRA 1XDDA 1AU9A 1RI5A 3PDJA 1TUBA 2UKDA 2YN4A 3F3SA 2NV0A 4IILA 3Q7PA 1GYRA 4MWCA 5SZKB 5IFLA 5KYUB 1YDHA 3QTBA 3RVOA 2ECQA 2EF1A 3DDOA 5FBQB 3TW8B 3MERA 4HVLA 2D59A 3PJDA 1UC8A 1E9CA 2XEXA 3CO5A 1IZZA 1N6IA 2OBMA 3NDPA 2BMEA 3DXZA 1ICIA 2B4TO 3P2YA 3A58B 4V0RA 4ZI7A 3COVA 5DCLA 4ID3A 4PHHA 1NC1A 1LUAA 4HWTA 5F3DA 3S81A 1E9SA 3IUEA 3OOJA 1WVGA 2BJVA 2CCJA 3ADOA 3IILA 4TWIA 2P4UA 2G5TA 4MR9A 3IBCA 3E5MA 2ZVQX 3V6LA 1P9OA 1F0PA 3KVNA 1C0EA 1Z22A 2BDTA 3UT0A 3HDJA 3VHXB 5C8XA 1YE3A 3KSDO 4MWTA 3FKSD 2JJMA 3OP1A 3PNSA 1K7EB 4IDQA 3PPVA 4UVGA 5CT4A 3ZXYA 1E6WA 4OKNA 4BGDA 1IBKB 1O6ZA 3UMMA 1JG1A 2OBYA 2ZRGA 2VJDA 2ZQYA 1CZOA 1VQ1A 1SXJE 3HXOA 2PSEA 4HTFA 4RQUA 3TEFA 4KQ2A 3QXJA 2EX4A 1AT1A 1IE3A 2QKYA 1DKPA 4I5DA 1DBIA 4F3NA 3PHCA 4JXJA 3MUFA 3N2IA 4G9EA 1E1RD 4ZV7A 3AZOA 2Q0SA 2HHCA 1Z39A 1YU9A 3BGWA 2HLPA 1N6RA 2NU7A 3RFTA 2P6UA 3G5AA 5C31A 4EKYA 3QOYA 5KYNA 1OGJA 3KJZA 2PJZA 1SG9A 4YNBA 2QVZX 3D0OA 3R0ZA 2WV9A 3AR8A 3A2LA 2OHOA 2XZDA 3WHLA 4AIIA 3T54A 1KDOA 3GJSA 1UPFA 3E6AA 4TYPA 5LZ2A 1Q91A 1DMRA 4ZQIA 2I2XB 2AKYA 3VR4A 3T3MB 1WXDA 4TXJA 3O2JA 3V4RA 1L8AA 4IF4A 3PR3A 1E66A 4KR3A 4X8OA 2Z57A 3WLQA 4UXHA 4MV9A 4C0JA 5EJ5A 2O3RA 3O8QA 3D9QX 4KYTA 5LQNA 1NDUA 2FMKA 3ACCA 4ODIA 3RYHA 4YYEA 2FY8A 1H66A 1X7YA 2OCBA 2OXCA 2XIQA 4RXTA 3I8OA 4BNDB 4D4KA 1X1QA 4E5PA 3ANYB 3FCOA 4V0ME 3RIMA 4WDRA 4X8LA 3FTEA 3DXFA 2K2QB 1UBFA 1V8DA 4B3RB 1NQVA 3K1JA 1QHFA 1N3LA 2J46A 4FOTA 1VOTA 1MZVA 5JIBA 2QUKA 3EFBA 4RSGA 4KYVA 3W2HA 1QK4A 1A4UA 3M4YA 4U7HA 3VZDA 1PD1A 1L5YA 1SXJC 4CTKA 4UVEA 3TFOA 1BWRA 1WOYA 3QU5A 3CSDA 4L4YA 4B34A 4QYTA 1Y3IA 3AIKA 3VKHA 2EFYA 1V1MB 1NU8A 3BB1A 1YKGA 1I2MA 2XMRA 4TLLB 2QRHA 2CN1A 1LBTA 3IEXA 1HKHA 1WB4A 3Q2KA 4MS3A 4RC9A 2HK8A 5F1PA 4ZDKA 3HK2A 1CEQA 4XGRA 1U5CA 3S2GA 4MUFA 3WLEA 5JXGA 4JZKA 3CLVA 2ACEA 1J20A 1N6OA 3GK3A 1QIGA 4B8ZA 3HKCA 1X92A 4G26A 1RHRA 1Y9JA 3UB2A 3X1MA 3SKXA 5DYIA 2P62A 1QFZA 4HP8A 3F8WA 2B1GA 3ZWWA 1V1JA 4MAMA 2ZANA 1DPGA 2Z8ZA 4UM8B 3ZDEA 4DNFA 3E3AA 5JNTA 3CNLA 1AQLA 2I4TA 3IUMA 4PYOA 4JLBA 2GFIA 2CJWA 1CQWA 4NFSA 1KGDA 4F4HA 3FR8A 4EAQA 2PUAA 2PUVA 2W8BA 4MLDA 1TRKA 1U8UA 4ENPA 3NJ4A 2QD3A 4CODB 1WU7A 2GM5A 4MWGA 4MDFA 4JC8A 1VJRA 2P6NA 1QVVA 2GCPA 4LDQA 4RGBA 5TQJA 4BQIA 3JQAB 5AKHA 2I7XA 1UMCB 4ZVOA 4Y1RB 4YY3B 5EIAA 4DV4B 3PX3A 5FL3A 1E2GA 5JU6A 1E4OA 5FXMA 3A1FA 4X7BA 1NT4A 2VSYA 4JQOA 1H5NA 1JG6A 1KJNA 2NO5A 4JASB 5AT1A 5TB5A 4ARAA 4BO2A 4CEIB 4YROA 1M1YB 2VNIA 5AJHA 5BWNA 2BGRA 4V39A 3PFBA 4ZVSA 3GRVA 2JGRA 4NENA 4DPLA 1I13A 1CQIB 4NE7A 1E0AA 3FR7A 3UQYS 4ER3A 4IRMA 1DSSG 3C16C 3AESB 5IJWA 1D4ZA 1E2HA 3KDPA 4XUCA 2GZRA 4LKOA 5COQA 4RIIA 1SHKA 4HDRB 4E5MA 2BCJQ 3T7KA 3AJEA 2IS1A 1RRKA 3IJRA 4J1QA 2M9MA 1GTZA 2Z9DA 4L07A 2SKEA 3AUFA 2HRCA 5G53C 2Y0BA 3UUWA 4IQGA 2ZVJA 4KU4A 1J97A 1E9AA 1H94A 5GIPE 4MUNA 3DTYA 4Q3DA 3PITA 1CQJA 4FGUA 4N39A 4UBMA 1QMGA 4XDZA 3UMBA 1BVUA 3N8DA 1N5OX 3A6KA 4G37A 4MPDA 4AM8A 1WCXA 3EAQA 1Z2PX 3L8HA 5JH7B 2FX3A 3HCFA 4A8JB 2NT4A 3QYAA 4IIDA 4FR5A 4IDCA 1E3SA 4OD0A 1NF8A 4IG4A 1JSCA 3O1LA 1EFKA 3T1TA 3L18A 3NUQA 4LF6B 3WLHA 3WK8A 5HKKA 2DSTA 3H97A 1XN4A 2ZQ5A 1M8KA 2XOKA 4B3CA 1YCDA 3QVKA 1GG9A 3RT9A 3QBJA 4HS9A 3EXIB 2R9VA 3H8SA 1VMKA 3CPSA 1PNVA 3D3QA 2ZUFA 3HFGA 1Z2NX 3L4BA 4KQCA 1RPZA 3I3OA 3BDAA 4RA6B 1L4LA 4FFBB 4NYJQ 3CG4A 4C14A 2YNMD 3M34A 3BMOB 1TUGA 1W44A 3F7NA 2RGWA 2RJNA 4ZQHA 4BP9A 3TEJA 1G9XA 5LOVF 1YJXA 4R2IA 1NWHA 1GPKA 4UDNA 3ZEIA 4F0JA 4IDEA 2AUMA 3E3OA 4ENSA 1QR6A 4F86A 5HRCA 1ZH6A 2JFVA 4XB1A 4XQ0A 3AWIA 1KNQA 4UPEA 1XVTA 3A3OA 2DFNA 1RPJA 1RDFA 2SBTA 4E1VA 1AY0A 4H4CA 4MGIR 2IHUA 5LCXA 1QTQA 2AOUB 3K5PA 3SAJA 4GBMA 2E7ZA 2PV7A 3OZCA 4YMSA 4JMPA 5J3JA 4DLWA 4ZVMA 3FPSA 1NRIA 2GERA 2NMVA 2C5BA 4JYCA 1VB3A 1DTSA 4Z51A 3EXFB 2O5CA 3B53X 4WXYB 3W9YA 2LE0A 3BFPA 1KEEB 1QQAA 4KQKA 4RZXA 2AK2A 1KYTA 4IINA 1F2UB 2EOAA 2FNAA 5T3YA 3C8HA 4PBTA 3LP5A 4N49A 3L4KA 1LU9A 4UD6A 3VR5A 2QL6A 1PKEA 2B0CA 2PUWA 4UREA 1GRQA 1C8LA 4W9RA 3E0XA 2Z2JA 4BVAA 4D02A 4N7MA 2HIGA 2GPJA 5ELLA 3L9XA 5K0JA 5J23A 1OVMA 3FBWA 3WAKA 2EZTA 3LT5A 3U1BA 3H86A 1RAIA 2ZAGA 3SDZA 1YTUA 3H4TA 3PFKA 1JFLA 3TTTA 5CLFA 1G7TA 3MYRA 4FOSA 1C1DB 5A2QA 2QAGC 4OQDA 1IN8A 2Q8NA 1YVPA 1A9RA 1NY6A 4J0EA 4OFZA 2IU3A 2LIPA 1CZRA 3LY9A 4JI1B 2WAAA 4AI6A 5EP1A 2NUTA 4BNZA 3H5WA 2W6OA 3IPYA 2X1LA 4YRBA 1N6HA 1A5AB 3AHEA 3F6YA 5G4KB 4QD3A 1LTKA 1RVDA 3J7TA 1AX9A 1PNRA 1KJIA 3STHA 3UANA 5EJ9A 1JPNA 2FSPA 2WP0A 1XCGB 1CUDA 3T3PB 4FSXA 2ZJ6A 3T95A 5CFLA 3NFYA 4GR9A 3FPFA 1C3LA 4QDOA 5DBHX 4YB8A 2RGYA 2Y0CA 3G23A 4DMRA 2B82A 1GTSA 2BMFA 2PT5A 3LWNA 2R2GA 3M6AA 4FMDB 5CM2Z 3HWRA 2GCGA 4E15A 3OQMA 4MR7A 3ZUGA 4B3IA 5IAGA 4O63O 1NVUQ 1YHYA 5CGZA 2Q99A 3S1AB 3VMMA 2GDJA 2ODPA 3GHYA 4B7CA 2IELA 3BXZA 2YC2C 3ISJA 4P7GA 4C78A 2FEAA 5A6VA 1JTVA 3U31A 2GB4A 3BWEA 3IKTA 2JFPA 5C80A 4ZCPA 3SSOA 2JAPA 4YEDA 5IDXA 1Z6QA 1XAIA 3IQWA 2AYYA 2IZ7A 2DHDA 4KH0A 5E3JA 5KZMB 1SXHA 4EA8A 3ML1A 2E5FA 3GPBA 2AFIA 4M6WA 3P94A 3HJRA 1KXZA 5I8WA 2IKSA 3DP9A 4F71A 4YASA 2FPKA 2FTKE 3JTMA 3QX7A 3LBHA 4ZOAA 1PZHA 2VXOA 1MH9A 1TQ4A 2W90A 3OO0A 4ZYXA 3DQPA 3WRYC 4J0IA 1JDBC 3GLQA 3SS7X 3RAFC 1JIQA 1RS0A 4GLLA 4AWBA 2XR1A 2YWJA 3B2EA 4CMIA 1L4HA 3FYUA 1PIWA 2Q7OE 4BPBA 1E63A 1ZM4A 3C1TA 1CS0B 4PANA 3LTEA 3VDNB 4CU2A 1APBA 2I8LA 4N9WA 1ZD8A 3K96A 2OFPA 2TMDA 3OUTA 1ILWA 4MVJI 2YHIA 1SMKA 1DDOA 2ID8A 1FTQA 2JFZA 3DE6X 3GGGA 3OD5A 2OA0A 2L0XA 4QDUA 1KZ7B 1QIFA 3TN7A 1Q3TA 2YRXA 2YCBA 5BQFA 3GGCA 3ETEA 2ZJ5A 3SIWA 4Y9DA 1UR5A 3HP1A 2JRCA 3FLEA 4C4SA 1JDPA 1UWCA 2C58A 4QPJC 1I5RA 3HWWA 4FFLA 2OPBA 2IYQA 3NBUA 4JYMA 1UXOA 3AY6A 3FCYA 3GFVA 3P4XA 4MV7A 3ZPXA 1DKRA 1JJ7A 1F8FA 2EFDB 5A0TA 5LR6A 2JLAA 3I9LA 4IL5A 3DQZA 2PKXA 4OQ4A 5K1ZA 4IX9A 4LGCA 1NXPA 1WF6A 1RQXA 1XSEA 2O9JA 3G2QA 5A5VA 1QFYA 3VR4D 5J5VA 1U2PA 4F1JA 5DTJA 5JAOA 4RTNA 3LM8A 3ZI7A 3CURA 1UBOS 3KVYA 2WICA 3PUWA 4XXHA 3KDSE 1RYZA 2VJAA 4D9MA 3O8RA 1NUPA 3IBTA 1MDFA 2RGRA 3PHGA 1H4VB 2HRDA 3L7BA 2HDWA 1WVIA 4I1VA 1YASA 4FCVA 3Q7TA 1E5XA 4FE4A 1DKMA 4F5DA 5GIOE 1M6EX 5KYVA 5LYJA 4IBOA 5DYTA 1W96A 2WQ6A 2RBKA 4TSKA 3TLYA 4HFNA 5E7IA 1L7DA 1V11A 3E03A 3QLJA 4Y2GA 3ZCVA 4B82A 1DEXA 3TMYA 2J9GA 4YQEA 3AUSA 2J87A 2D1FA 3RR2A 4JI5B 1XJCA 4S12A 4NHOA 1PFVA 1XNHA 1OIXA 4FKZA 4QRDA 5EWJA 3ZWNA 2Q6TA 5JBNA 3EDYA 3ONVA 1XVVA 3KO8A 1SOAA 4ZCMA 1XK7A 3PUKA 2BE9A 1GCAA 3D59A 5E9QA 3M3DA 4C7OB 2GPTA 1NOKA 4AFNA 2XYVA 3GLKA 4LWOA 2BV3A 1A9SA 2A59A 1NW8A 2VK1A 3PFHA 1GKYA 2REXB 4Q3AA 3LU1A 5DKFA 3VYRB 4XSHA 2Q62A 4IOLA 2YBEA 1W35A 1FU7A 1ZUNA 4IJKA 4QAJA 1YVEI 4M1EA 2OV8A 4JROA 1G3RA 3EBPA 3G7NA 4MP3A 1LY1A 3BH6A 3DLPX 2YWEA 4FIDA 2R8ZA 2DPYA 2RAVA 3TJMA 1XE3A 2ZTHA 1O58A 2UVPB 2OK7A 1OLXB 3UAWA 3ZTWA 1QGOA 2ONYA 2XE7A 1QQBA 3D7MA 1SZJG 1E5TA 3N75A 5A9SA 4BGVA 1T2NA 2G1UA 4EHHA 1WSWA 2WM3A 3JATB 3PGLA 1GTG1 4UQLA 3S4YA 1Y5NA 2NXEA 3TLMA 3V1MA 1VIVA 2FJ0A 4CLRA 4HUQA 3E5NA 2GBCA 1TA0A 3CINA 3FJ1A 1M1ZA 3Q3GE 5TDHA 5CBKA 3DYIA 2WIDA 1F06A 1BXGA 4AL4A 2IOYA 4BS9A 3RRNA 1T1RA 2QHXA 1GG2A 1VSQA 2QTGA 2XD4A 2FW6A 3GNTA 4LHVA 4PR3A 2W6QA 4Q7LA 1O95A 5FPTA 3SYKA 1C9JA 1DIOB 1W4BA 1LDNA 3FVTA 3ZDDA 2VBFA 2H08A 3W6ZA 3MLBA 3EEIA 1ISHA 4HEJA 4FLFA 3PUHA 3H4IA 5DF1A 3SU8A 5IUNC 4R0VA 5JNVA 2QN7A 1OWNA 2ZYHA 4HLUC 2NYAA 2FW9A 2WZQA 5DSZA 5MFPA 2YMPA 3H3FA 4H7IA 4LX8A 5FULA 3X2FA 2IEBA 5K8UA 4UM9B 3GMDA 1X19A 5P21A 2FAXA 3JQ8B 3ZHCA 1CY4A 3QEOA 3D64A 1LWNA 1W5TA 3I4CA 1NA5A 4LSZA 4PYRA 3X2EA 2VXCA 3LLSA 3LWBA 1BN6A 3MTIA 3QJYA 3FFXA 1XWFA 2NTYC 2WFLB 4HWSA 1J9EA 2C4NA 4JMLA 3IEMA 2FDRA 2OYSA 3EPRA 4P4UA 1K6XA 2HIMA 4XX1A 5C1OA 3KUXA 4Q9AA 3T3GA 3BSYA 4E6PA 1Z73A 1BD4A 2V9ZA 5CLJA 1JFFB 2JGJA 1WCYA 1XDBA 4W6QA 3V42A 4JZYA 1RAHA 3AW9A 1VI5A 5F7JA 1P80A 4F38A 4ZOBA 1D2RA 1KGSA 1RQPA 1RYHA 1ZIPA 2OCDA 2QT9A 3D8SA 1ZSNA 3LBYA 3FFWA 2G1JA 2PUEA 1IY8A 2R00A 3A6ZA 1C3XA 1FIUA 2O7RA 2XTMA 2XB9A 4CKYA 1ZQ9A 1XUOA 2AEMA 2AT1A 2PSFA 5KMGB 5HKKD 4MEAA 1UUFA 2IWRA 2B8JA 2HJGA 2XOKD 2WM8A 4DCSA 2H7VA 3A2KA 1Q6ZA 1W93A 4RFSA 1T4MA 3T7DA 4R1SA 4W5RA 3ROTA 5KDOA 3FI9A 4MK4A 2BR3A 1C7IA 4Q1BA 4D3DA 3DL2A 3INNA 3IOEA 3NWPA 5A2GA 2AF3C 5LQDA 1XZHA 1YZHA 1YRAA 4KQEA 4XR4A 4ENVA 4AU1A 3ESRA 1T5LA 1DU4A 3OP4A 2QZZA 5BWCA 4Z6KA 1CF4A 4UTPA 1QO0A 4CCYA 4ZHQF 1UFQA 4BRZA 3WQBA 4B3XA 2ONCA 3A1DA 5DMHA 4PYNA 2VAXA 5E7MA 4UQPA 4B9EA 3TCNA 1RWWA 3TQTA 4U9HS 4B80A 1OI7A 1RWMA 1UBJS 4LBWA 3MMNA 4XIJA 5E1MA 1CUYA 2GN2A 1NZJA 2FEWB 3AYZB 3KPYA 1AS2A 2W2LA 3GVXA 4HKTA 1G291 3QPWA 3WISA 5B53A 2C0CA 1ITZA 4MKIA 2CYCA 4LN1A 4X5OA 3H2GA 2VDLB 1KHTA 3DBLB 1TADA 4IFIA 4QUKA 5ALIA 3VGPA 2IS6A 4Q3OA 3ELUA 1RBQA 4H1VA 4K8RB 3P9XA 3SP1A 4E5UA 2CFIA 1Z75A 2CL7X 1UBRS 5DTQA 3C3EA 2QK4A 3VR5D 1GAXA 3SM9A 1U7UA 4Q4HB 3OC0A 4H16A 2ST1A 3MSXA 1TQHA 5E4TA 4ACBA 3ZJYA 3K6SB 2Q3BA 2Q9AA 1N1DA 1QPBA 1CUHA 4A5OA 1OA1A 1K7FB 5B2FA 3BT7A 3P2KA 2ZEJA 5KAMA 4XOUA 4DMCA 3ENKA 4JC4A 2FFBA 3O95A 4LOKA 2XUIA 4ZGGA 2C98A 1EP9A 1WKCA 1ZH2A 1ZJ5A 3IRUA 4W7HA 3IAUA 1XTPA 1YS7A 3I6YA 2OZEA 1T2EA 3EC1A 5HNKA 4X85A 4HMOA 4H1UA 4RX1A 2NU6B 3DD1A 3SBEA 1Z5WA 3CMCO 4XGNA 1RLIA 2HK7A 2AK3A 3SC6A 3WNCA 5EMKA 3GUUA 1NXXA 4DT1A 2W2NA 1FYFA 1XPUA 1PZMA 3MUEA 4WSOA 2ZG6A 2FV8A 5EPEA 1PW5A 3EQ2A 4PZUA 4RPGA 4YRAA 5LD2B 5A5FA 3BREA 2I1VB 3AV3A 1E2PA 4BHTA 3L93A 4KQ6A 4EUSA 1XMSA 5D5HA 3CVXA 5A5EA 1O0CA 1WMBA 3KLMX 3QXGA 1KH2A 2DE0X 3INYA 2D62A 2FQWA 2WRZA 3DF7A 4YP7A 4JWTA 4UU0A 3UXYA 2V45A 5L7WA 3G9TA 3M6WA 1W36C 3TIIA 3VSCA 3WLNA 5CB0A 3ND6A 1JQLB 1DJQA 5FLEX 3EA4A 5L7TA 3IAFA 1W2WB 2ONZA 4JODA 3D3JA 2VUTA 1DARA 2Z2KA 3FSJX 4OFWA 2G6BA 3R6LA 4UEJA 2ZB3A 5AVUA 4UBJA 5AJUA 3H19A 1NP7A 3TVDA 2WT8A 1R0BA 4ND5A 1ND6A 1ZFNA 2OGTA 3NORA 1YA4A 1Z4OA 1JG7A 3ZHRA 5K99A 4GIBA 1ECLA 2GPYA 2VKTA 2G88A 2Z56A 4NBVA 1YIAA 4Q1AA 4G1MB 1K8ZB 4PBRA 2AN4A 5AUQA 2I3BA 7REQB 3T5PA 1SHUX 2ACVA 1ZVKA 2AHOA 3DAPA 4RELA 3S5UA 4DCMA 3O8BA 3ZDCA 3DLBA 1KK2A 1GA4A 4I6GA 5AKYA 1N2JA 1ZM2A 2QNBA 2OQIA 4U6QA 1V9CA 2PX5A 1Z5UA 4NECA 2IVFA 3QHAA 1RXVA 2VA9A 3U7GA 1QU2A 1L4NA 3ICCA 1HNZB 1TAQA 1AA6A 1XTRA 4I14A 3MWEB 3PWKA 4NH0A 4ZEOA 4A15A 1JR4A 1OXMA 4AY4A 4M53A 3A06A 1BO6A 1S96A 3NBQA 1MT3A 4R7GA 3EGXB 1ZK4A 4K26A 3PICA 4FCWA 4NDZA 3WWDA 4PFKA 3I76A 1XKXA 1AQIA 3EIEA 1ORHA 5BMOA 4E03A 2KLHA 3DCNA 3FPGA 1CJKC 2JVKA 2NZVG 4YRRA 2OVBA 1N78A 3HVRA 2UYOA 1W85B 4L7VA 3FHTA 3B6MA 1CNFA 1X1AA 4X94A 4DBZA 5B12A 2HX1A 2QP3A 3WWYA 1Z56C 1FRVA 2VQSA 4UD2A 2O2DA 4QA9A 5LA6B 6Q21A 2QX9A 3P8ZA 2ZPTX 2W0MA 5F64A 1A72A 3PVCA 4AB1A 5KYYA 3V2UA 3KE9A 1BIFA 1NE2A 2G67A 3H4VA 1DC7A 2AL7A 2RHLA 3D1JA 3KLBA 3WMGA 1E9EA 4FFOA 3PG5A 2H16A 4U0KA 3RYTC 1RCTE 2K7FA 2B1IA 1XYVA 4DUZB 1KZ6A 2C2WA 1AUVA 3KQYA 1DTEA 1WAMA 1VE7A 2PGDA 3HCOA 3KYBA 4JR2A 2Z3VA 3PD1A 5FOVA 1UANA 5ENZA 2PLRA 2TECE 4US2R 2QR3A 5MGNA 5FEUA 3ON5A 2GZAA 3UGTA 5LN1A 5FI0B 2XECA 3MVEA 1B7GO 1I36A 1YSCA 4EMSA 2H06A 2DPMA 5GWXA 2QW8A 2BFDB 2GDZA 4M8SA 1V5EA 5BN3A 1A9YA 3LCMA 3E70C 5AVJA 4D8VA 4IOMA 1JHXA 3HCDA 4M8KA 4TV9B 2IY9A 1L4BA 3I2KA 3LQQA 2BFBA 4P53A 4PLFA 2X0DA 2IEAA 1YC2A 3C7KA 2CE2X 2IZ1A 4R01A 2A4MA 2GZDA 4ZWNA 3SXUA 5JS6A 4C3ZA 1XD2B 3JAKA 3G1UA 1TJ5A 4PQFA 5TF0A 2MINB 4I4TB 8ABPA 3LCCA 4IO0A 2VAMA 3ZE2B 5BV1A 5MGBA 3B82A 1E1YA 4KK4A 4YPOA 5JBQA 1T3TA 1GL6A 2X5XA 3AJ9A 3G59A 4QYMA 3OE4A 4H1TA 4WW0A 3H05A 2V54A 4FBGA 5DLDA 4CF6A 5G0UA 1XMVA 3KQVA 1IZ9A 4KBGA 2GLTA 2AH5A 4C4OA 4DXDA 1LSSA 4F85A 3PA6A 4P4SB 1ZZEA 1SBHA 3DO8A 3JS5A 3NRJA 4BP3A 4D46A 1L8OA 1P7YA 1U1DA 3AR3A 2QD1A 1G3MA 1LQ2A 2AEJA 4PZCA 5KOJA 3Q41A 3KQOA 1VJCA 3TXYA 4G5YA 1O95D 2HIHA 4BO1A 4JLDA 4S05A 2JBWA 4LBVA 4ED9A 1Z2AA 1JFVA 4XR9A 1RQ2A 3D0RA 3IAXA 2WHQA 3KWMA 2Q45A 2B5OA 4JJEA 2H5IA 4RA9B 1N5DA 4UVDA 5EJ6A 3K71B 3UFXB 1P0PA 2PS3A 4GXQA 1P4RA 1Q0TA 3F6BX 3I92A 3K1YA 4L6IA 1GZ6A 2OENG 4MJXA 2YS7A 4O25A 4RZ3A 5CD1A 1JA9A 4CEJB 3F90A 1NVBA 4KC0A 5CCDA 3TLEA 1ISJA 3WJAA 2XA1A 1TNDA 2A0UA 2VNAA 5G41A 2I5PO 1QU3A 1CIPA 4Q7MB 1DVRA 1E7RA 3M1LA 4UW9A 1IXYA 1M0TA 1Q0QA 5CJ2A 5CW1A 4BU0A 1W48A 3TRIA 4G23A 5KSOA 3DUFB 4EYQA 1GSIA 1KI8A 4IIVA 1G3IA 5EJAA 5CAEB 1AMOA 1GPMA 4E7OA 2R751 1RLJA 2X40A 1JSZA 1GA6A 4CUJA 2QGZA 3HI4A 2PIDA 2NU8B 4PSCA 1HSZA 1YR2A 3JYNA 3TQCA 4BTLA 4D74A 3V4OA 2OCAA 1CUXA 2VYNA 2C57A 2FEOA 3BXXA 3C5WP 2A9JA 2QRVA 3CZ4A 5G40A 3PC8A 5GP1A 1W7AA 4GX5A 4UAGA 1XCPA 4OSPA 2GILA 5LNK1 4BCBA 1N57A 1RJFA 4NYMQ 5LJLA 1C3EA 3DT6A 4YMGA 1H6CA 1S4MA 1T26A 4ZQFA 4JI8B 1C7ZA 2QX8A 5AXCA 4R84A 5CVDA 8AT1A 5DGTA 1BMTA 1IY2A 1Q0LA 1GCOA 5B4TA 2OHXA 4B81A 3GJTA 4YQYA 1EZZA 3GGSA 1LB1B 4EPWA 2DQKA 4C2BA 2F55A 1XNGA 1QO0D 3I2FA 3VH3A 1OWOA 5DJ5A 2QSUA 2X6QA 2QX7A 1E79A 3GT4A 3HA2A 3KKOA 4M88A 4L6CA 3U4HA 5C4GB 1TKBA 3P0EA 1N1GA 2H18A 1D07A 4X3OA 1ZM9A 5AJXA 4IGFA 1DIRA 5C46F 5FWXA 4X60A 2J7KA 3MJFA 5GJCA 4JU8A 1MKYA 4LHZA 2ENWA 4TKMA 1LBIA 3FAKA 4GOKA 1E3MA 1I10A 4IGKA 1RYMA 1SBTA 2W2LD 3MJDA 3NATA 4GI7A 3GRYA 3UGKA 1G7RA 9GPBA 3CU5A 3VZPA 5K6TA 3FCXA 1RM5A 1VYHA 1L3CA 1KIFA 3HB5X 1CBUA 3MGCA 4B0PA 2C82A 4FHGA 1Z7YA 4QJIA 2OHHA 4ON9A 5AI4A 5AKGA 1RHKA 1NVGA 1A2KC 2G72A 4CIYA 5EKDA 4C3UA 1K1EA 2EIXA 2XUAA 3E7FA 2XXBA 4I3GA 4UMVA 1W0KA 2IYAA 2NSYA 2QDKA 2ZYGA 1R0SA 2DULA 5JJIA 4Z0TA 1H6AA 3A31A 1LPMA 5HQJA 1X7HA 4DSNA 1I4LD 3ZXSA 4N5IX 3IEIA 1QIEA 2FEPA 4OLAA 3MWLA 1ZGBA 2C9CA 4PTZA 2GM9A 1N7JA 3E53A 2E4AA 2ZROA 3NBKA 2MYNA 2HQRA 3L02A 3RNLA 6REQA 3CONA 1MC1A 5K8CA 1D9ZA 1PAUA 2MMCA 2V55B 3DT9A 3PXAA 4M87A 5ESDA 4GL4A 3LKZA 5B4VA 4ZYTA 3OZEA 1M8JA 3T3EA 3RC8A 4D80A 3STXA 4HDQB 5E4FA 3IMCA 1SWVA 4WNAA 5DGIA 4TKVA 2Z8XA 2DQYA 4XX0A 5KPDA 1G59A 3CKLA 4G5QA 3V7UA 2VTBA 4AULA 2Z5VA 2HWYA 3RTGA 2OO5C 3DFMA 2H17A 2YKGA 2O3SA 3QG5A 1DKUA 1TFUA 1EWYA 2F1JA 2I76A 4HEHA 1R27A 1FCJA 1UBUS 4X45A 2BY4A 2PUHA 3GJ6A 1PDVA 3OY2A 4II2A 2VF2A 2GSDA 4ZU6X 2GNAA 2VXBA 3C6QA 2C9DA 3L8GA 1FF9A 5AOVA 2DFTA 3SQOA 3K70D 3VUEA 5G0VA 1EA5A 3M9WA 4R7TA 4DCTA 3DR5A 4PF1A 4WZBA 4Z7QB 1R74A 4N3GA 5EHQA 1C7RA 2GJAA 5DASA 4O5AA 3G2PA 2BOVA 3E61A 2AEEA 2RE8A 2PS9A 5JZSA 1I80A 3MIZA 3GP5A 1FYXA 3EC7A 2ZRDA 1CR0A 3Q9NA 4EY7A 1CY2A 2H1LA 2QM0A 1F20A 3B6JA 4Z1MA 1KAGA 4GFDA 3HQ4O 4D4JA 5BY2A 4IJVA 1D7OA 3BX1A 4ITRC 4BN5A 1IHYA 3L4SO 5F1KA 3WBFA 5LP6F 3I39X 3QLVA 3RIYA 1L7BA 5B55A 4FB4A 3EZ7A 1A5ZA 2ZBEA 1WY5A 5EEGA 3K2EA 3NS7A 3JR7A 4ETMA 1X15A 1JMVA 1R0KA 1OLSB 4EI2A 2AIRA 2WPDA 4EECA 1DG1G 5L45A 1SJ9A 3ZZTA 3ZWAA 3HXTA 4GE3A 1NJGA 2X19A 3V3TA 5K4GA 2R25B 3HCCA 2ZBVA 3SQNA 1U0RA 1YI8A 4K6GA 3OAAA 1B4DA 2Q5JA 2D2FA 3VNSA 3Q0EA 1R0ZA 3H17A 4BEJA 4I1YA 3JPWA 4TLEA 2CNDA 1IMJA 1MV5A 4JUAA 3ZVMA 1PLKA 2X1MA 2XT9A 4P22A 4AO6A 2O5RA 1MJFA 1VJDA 4CF4A 1PO7A 2QUAA 3SR4A 4DIKA 3OT5A 1T0IA 4K6HA 2ECKA 1VI2A 3VC2A 5T4FA 3BCUA 2YVAA 2M6LA 2HAEA 3U3RA 4O2AA 4Q1CA 3WKEA 1N32B 4K0KB 3KOZA 2CT8A 4TZ0A 3ANXA 3HCWA 4L74A 4BUJA 3ICEA 4UU8A 1R6AA 5JWOA 3S8EA 3P27A 1EQUA 4Z4HA 2AFIE 5KEIA 3EIQA 1L7XA 4UPDA 5TT1A 2P9YA 1PS8A 4RD0A 4HBGA 3HRHA 1I32A 1JKFA 4XPIA 3V00A 1BU8A 2FA9A 1MQAA 1HG0A 1UKBA 1OTXA 3L84A 1ZS9A 4R3UC 3RBAA 3RDPA 3T5CA 3PKZA 4F6CA 2ZB8A 1E2MA 3E18A 1VG1A 1NWCA 2ZJAA 3R09A 4NWIA 4FT4A 1DG3A 4H77A 2P2SA 2HXSA 4GXTA 3PUVA 4ROTA 2H5JA 3V55A 1NXQA 1XXHA 3JZFA 2XUZA 3BK7A 3VGJA 3ED5A 1LD3A 3L7YA 3PNOA 1J7JA 4NABA 4R05A 4TUYA 4Y2PA 3RVDA 3KT8A 3CPHA 3RPEA 1BGVA 3VOSA 4BNMA 3UV3A 2RGAA 4WIAA 3UWSA 5B36A 1G21A 4GI5A 3K9HA 4RLSA 4EJFA 2FSVC 4MMXB 4EHNA 5B30A 2NVWA 2KWIA 4L4UA 1M2NA 2H8KA 3GX1A 5CVVA 3IBYA 1LS6A 3OCCA 3F0TA 3F1KA 1PG0A 1NX6A 5LDGA 3ZWKA 1UKZA 2EZUA 3T1HB 1K88A 2AW5A 1I4OA 3O2QB 3DLCA 3HUFA 4OHXA 2WSMA 4BFYA 4NZOA 4FGWA 3VR6A 2Y6UA 3ORRA 4YAFA 4EA9A 3HG7A 4F9EA 5KKAA 3CXRA 1WCV1 4PQGA 4UATA 5KU1A 1W49A 2Y68A 1EFPA 5LZ9A 2QMOA 2B37A 3BCRA 5BOSA 2F1RA 1KAMA 1ULZA 3MM4A 3PHHA 2VP0A 4IS3A 4X97A 4JXKA 4Y6LA 4I19A 2EG9A 2FRDA 3JVDA 4UXIA 2C54A 2CNBA 4XWGA 3AUKA 5EIHA 3SIXA 4O4IA 5A6SB 1WXFA 3GWZA 4L08A 3ZLUA 2CF5A 3MQ4A 3T06B 3RTAA 3EIWA 5BVGA 3M5DA 2TS1A 4MYTA 1YA8A 3DPIA 3RI3A 3IMEA 5BT9A 4MDHA 1NTOA 4JDPA 3X1WA 3T5MA 1KQGA 4ALNA 5HPYB 2WU3A 1QG2A 3GLSA 4FONA 2HNKA 3RKUA 2ZITA 3I9V6 3W7BA 1AQJA 4ZP1A 3FUWA 4FFWA 5CA0A 2UZ1B 3Q3JB 1U2SA 1U3VA 2PX6A 4YP0A 1D9XA 3T52A 4PCLA 3ZDYB 3L8CA 1KP2A 1OR8A 4GE0A 4UCQA 2F8LA 3LVFO 2G9RA 2ERYA 2Q9CA 3EIOA 1NR5A 1HQCA 3P0JA 4L28A 5C7LO 4LDPA 3U0BA 4XARA 2B3TA 3UW3A 5J2TA 1FDSA 1SCIA 1T3HA 3BN3A 4ZRDA 4D9KA 1NG1A 1OBOA 1Y5MA 4O4LA 4K2AA 3I5MA 3B3GA 1Z0SA 2EKQA 2BEUA 3FUCA 3Q8WA 2JAXA 4PLTA 4WA8A 3IE1A 3GVCA 3EQZA 4LUCA 3W3AD 5LVAA 3EPKA 1PJZA 3E22A 5TPZA 1TO2E 4S24A 1ULTA 3DMYA 3RJ9A 4EDFA 5IX8A 1J22A 4NVRA 2PGOA 2TRSB 2ISSD 4IIXA 2Y6VA 1V26A 3V1TC 2WA1A 2VYFA 1CUEA 1G18A 2C7BA 2IWHA 5L3SA 4EG7A 1ENOA 2BDUA 3E9ZA 5JI3E 4DEVA 3EZLA 4KE6A 3WIEA 3ZI4A 3AB7A 2R3SA 3RUFA 3H04A 4E33A 4L02A 4MVJH 3F5DA 2R96A 1CE8B 1T6NA 3G6KA 1SPBS 3FTNA 1ODKA 3CS3A 3WNVA 1R6TA 3VNVA 2ZRHA 2DRIA 3GQBB 2I4RA 4M0LA 3U9TA 2ZJ1A 3D3WA 1QK3A 3PBKA 1E8MA 3DV0A 3HCBA 4KOAA 4Z4EA 4DSTA 4Y8VA 1R1DA 2P7HA 4RL4A 5ALLA 2FSHA 3LPDA 1EXWA 3QPAA 1DXYA 1EGMB 1Q0UA 4C9BA 2G8NA 3C5VA 3LK6A 3DLAA 3RE1A 1FQWA 1EH5A 1R12A 4K9OA 2ZUEA 4OY3A 3V4LA 2VTKA 4GT1A 1XC7A 2OHFA 3D81A 2ETVA 3WX0A 1E79D 4LJ7A 2HPHA 5C7YA 1NQOA 3D2CA 3FMVA 3C97A 1K8XB 4A4DA 1I01A 4KDEA 3BWYA 3OURA 1CQXA 4KB5A 1Z82A 1PLJA 4MV6A 3KFVA 4KQMA 2IBSA 2BC9A 4FZ5A 3MMPA 4MA5A 4QODA 3WZLA 2QUIA 3WRWA 4H3VA 1JS1X 2EZ4A 2ZAIA 5FHQA 1KBOA 1DXQA 1SIUA 1WSAA 1FW8A 4KVZA 3WLRA 3DAGA 4B84A 3RSOA 1B8PA 1TYAE 1WXEA 4M3NA 5B5SA 1LLQA 2XEDA 4N3CA 5T7BA 1CX9B 1WTCA 5K7SA 2D2IA 3DNFA 1YS2X 5EQTA 2NYUA 4KACA 1QVAA 1TCBA 3FMPB 3QBDA 4WV3A 1FFEA 1W0KD 2F3QA 4MP6A 3M89A 4U9IS 3UBMA 3CN9A 1EDBA 2PCJA 4HGQA 5AK4A 3VZSA 4B40A 3QLUC 2V97A 4IZIA 5IT4A 1O95C 3G6WA 3JQ7A 2C7RA 3CT6A 2IYWA 3KB1A 2FPUA 1IHUA 4KDRA 5JZMA 4TYNA 4YJGA 2I1WA 4EELA 3IDSA 3GFSA 3O1IC 1KBQA 1UZAA 1HM5A 1RPNA 2X0NA 3GT0A 4GQIA 5HK8A 3VPBA 3VO2A 1KEKA 2QY9A 4JUBA 2Z4SA 4O4HB 4HMPA 4B4DA 2UXBB 3LDAA 1E6CA 4IVQA 2DFKB 1T2AA 2Q4EA 1H3NA 5ER6A 3JZMA 5C5DA 2W7TA 2PEYA 2XUKA 1YK0A 4AUMA 4IDNA 3VX4A 3ZN2A 3A14A 4O0LA 4URFA 2QTVB 4WBNB 4WJKB 1ADGA 1EUDB 3PPIA 2CHQA 3BIWA 4JLWA 5I7RA 2YZKA 3OCXA 1EE1A 2Q6KA 3D8UA 3ADBA 2JEYA 5CHEA 3DOEA 2UUBB 1DKLA 3WKAA 5EMJA 1ZCBA 2AEFA 3BRWA 5I8PA 3ELWA 4IGEA 4HRVA 2FMFA 2Q4BA 4B46A 5I6DA 1CRQA 2X58A 2BGIA 1YZLA 4CZ2A 2IIPA 2SKCA 4QXOA 1GILA 3OIVA 2QTLA 1NQUA 2O8DB 1PFQA 3HXLA 4NK4A 2NPIA 3CZRA 1R18A 3RJZA 4ZPJA 3TOZA 5LQJA 3AVVA 3LX4A 1QC5B 2Q49A 4QT4A 4R8LA 1OPXA 3LZCA 1GNSA 1DIHA 5REQB 3ZHQA 3PJEA 1G2OA 1WV0A 2PDAA 4X63A 1ML3A 1IMOA 1CVRA 1U3GA 1EDOA 3BYZA 4BEBA 1RYDA 5BMVA 1C2YA 2R48A 4Q19A 1NXWA 3GPLA 3KT3A 1FEZA 1JEYB 4IEEA 1TEVA 2CKDA 2GD2A 2VT7A 2YINC 2ZRLA 1YBMA 2QRUA 1FFHA 1C0PA 2GAIA 3GH1A 1H42A 3QQ5A 2Y0DA 4G1UC 5FA8A 5EI5A 4Z1MD 4M9XA 1SG6A 1RKXA 4PPYA 4E5KA 1CY1A 1X0VA 2GAOA 3N8HA 4G09A 4YCNA 4HGNA 4C4YA 4M76B 5GJWC 4WCFA 3RADC 1XWWA 1XZFA 3JALB 1FP7A 1Q83A 3SF8A 2JGIA 1SGWA 4A1OA 2VNJA 4PX3A 3LOPA 1HT0A 5DOVA 1I1QB 5EKTA 1YQUA 2WPDD 1E58A 1XLVA 3MS7A 4G5FA 3BDVA 1LNSA 4ARBA 1M2VA 1OLUB 2IPNA 2B2XA 2VFAA 2WHXA 5AW3A 1RAGA 1E62A 4K88A 3OAAD 4R9UC 5C8YA 4YBZA 3O0TA 4NBRA 1JMYA 2HA5A 1KSFX 4G8BA 4E6EA 1XWIA 5EYPA 1YB4A 4K1XA 3AI7A 4LMAA 4TM8A 2XKKA 4IUDS 4IW3B 4B6QA 1YOVA 3I64A 1TDJA 3UJDA 3ZU4A 3MS2A 1E3JA 1MO4A 3N07A 5KWJA 3K9WA 1Y4AE 2WUFA 4N12A 3K0EA 5DBEX 3LUBA 3I53A 1N2CB 2DSNA 1R8QA 1RI1A 2RGXA 3IALA 4LZLA 4MLPA 2VNSA 3VISA 1EAMA 1DKQA 2QQGA 5E6SB 4BXOA 3LFHA 3D5TA 1CTQA 1YAJA 3MWJA 3B1KA 2OCYC 3BICA 3KVVA 2NUBA 5D8DA 1YWGO 1NNLA 1U02A 3UICA 3WDLA 2PUCA 3A70A 2ZRQA 2WVHA 3C3AA 3KTDA 4PFQA 4X8HA 1MO2A 2PKYX 2IUYA 5I9SA 2DPLA 1CZLA 2VUIB 4HN2A 4RHUA 2FRXA 5KNBH 3FVRA 4XDGA 2JIOA 3E1KA 3I9JA 1L5FA 2PFKA 3U17A 3ADCA 2ORWA 3L06A 4K0RA 3P9KA 3PEEA 2IITA 5K03A 4TKUA 3BGVA 3HLKA 4E4TA 2ZAMA 3ZWXA 1SCBA 4E94A 4QE3A 3PQ2A 1AURA 5JCJA 5CFNA 5KOHB 2D6FA 2H5LA 2YOGA 5D2CA 3ZV3A 4HLDA 1OX6A 4RDCA 1PX0A 1E1LA 4A9AA 1PSWA 2J0UB 4PZYA 1EUQA 1QKKA 2GTPA 2ZBGA 3EZNA 3R5XA 2WIFA 3DWEX 4W5WA 3IT2A 3PCRB 3RC9A 3MJ4A 4ANFA 2J5KA 4KWHA 3E9DA 3SFTA 1WMSA 3DWIA 4RF3A 2NU9A 2GBFA 1MG0A 4EFDA 1ZW1A 1AXEA 2IZOA 3JSXA 4FXOA 4BLVA 5KYWB 1NPYA 1KPHA 1TB4A 3H2HA 3HV2A 4FD3A 4GF5A 1I3MA 3VKFA 3PC2A 4F46A 2LCQA 2ZXUA 3N9IA 1OZHA 5EAIA 3VR6D 4JELA 3USZA 4KOEC 3PA8A 3KRTA 1QGYA 3FFTA 4IKEA 4BLWA 4ZJYA 1FUKA 4HDNB 2QU7A 1IB6A 3TIXB 4P5DA 5J5CA 1ZR4A 1UPTA 5ERYA 4M55A 3B51X 2FFRA 4K7JA 4Z4GA 5DBIA 1MT0A 4UE2A 1XGKA 5BURA 2I1QA 3OT1A 4KG7A 3FIJA 3GLHA 3R5TA 5C3UA 4ENRA 2VJOA 4ESVA 1TAUA 4CWAA 3VOAA 5CNIA 1P4AA 1BC5A 3R2JA 3Q88A 3RFFA 4XVHA 4BMPB 4FUQA 2QYSA 4UAJA 1Z33A 4MGKR 4NZYA 4B48A 4BO9A 2WU4A 1EK1A 3S55A 3T3DA 2Q2NA 3ICOA 1EFDN 4AZ3A 3RVRA 4G3XA 4DIFA 1JQKA 1IZ0A 5H9VA 1OYWA 2WILA 2V59A 2QTAA 4PLHA 2VKQA 4IFBA 4BV2A 1K0UA 2ECFA 1HDGO 1X8JA 3L0SA 3C3JA 5LWHA 1WXGA 3Q7SA 4LWPA 1QDUA 4TTPA 1PQPA 4KQGA 4OFXA 1ZH0A 4XEHA 2A7XA 2PSHA 4A6EA 4FNMA 2FH5B 4M7PA 1MX1A 2WJWA 5C4MA 5LMZA 2VZLA 4MLZA 4B6EA 4OXQA 4CCWA 3P2IA 3H2JA 4N5LA 1U81A 1ZW6A 5HF6A 5DGCA 2HUPA 5A1JA 2DF8A 5A3JA 3JX9A 1UMBB 2GVDC 4XASA 3SNHA 2ZRNA 4AG5A 1CZHA 1XZNA 1N92A 2XCTB 3C8MA 1P29A 1OT5A 1U8EA 2V5AA 3CUUA 2Z5LA 4OK5A 1U65A 5D5PA 5TPZD 3RU2A 5B6IA 4IFTA 3EYWA 3LHDA 5BN4B 5IRCD 2K87A 1ZA1A 2VDRB 1R8SA 4XGKA 3KOWA 1WJGA 1H4SA 3L7JA 3IAM6 2ZTUA 1L5KA 1XQVA 1ZGGA 4ITUA 1KSGA 2D13A 4UDYX 1EHIA 2H29A 5ALYA 2PJRA 2GF2A 4ZDWA 1CUVA 3VZQA 3MCAA 3BMQB 4RK5A 3CE6A 5G1PA 2RH4A 4QKQA 1A2BA 1FOEB 4G24A 4KQWA 5CFOA 5JBIA 1HFKA 3T9DA 4TMXA 3SYRA 5IKMA 3KEQA 1OMOA 4E4RA 2GUWA 4WKBA 4HZGA 2L19A 1XO1A 4I50F 1XAJA 4NEGA 3KETA 1EINA 3QEJA 4I6JA 3G8CA 5CFRA 1IONA 2YQ5A 4H0FA 4DY6A 4UUQA 1MW8X 4JD5A 1QRDA 1N9KA 1YIDA 3C8ZA 5GPBA 4QNNA 2FVYA 4GYWA 4LDNA 1QG6A 2Q3CA 4I9NA 4M0FA 4TRMA 2O07A 5F2OA 2JKYA 3T0GA 5A1TA 5BW4A 2M98A 3D54D 4EL0A 4GEKA 1PR3A 2Y1CA 3OOEA 4R8SA 4Q9LA 4EO9A 2I80A 3A1SA 1U94A 5C0OE 1J1IA 5EE0A 1M0WA 1TMYA 1ADBA 4MO2A 1L7EA 5F5NA 4DAEA 3DAHA 2JFHA 1R2QA 2P67A 4OGGA 3R6DA 4TT8A 1LDBA 2EKLA 3DDCA 2AE1A 4RVUA 4IYJA 3T9EA 3BJIC 4P6VF 3VYVA 3ZJ4A 4B6JA 4C7KA 4CM9A 2GBLC 4Z0HO 1V3VA 3DKKA 2R6ZA 4FIZA 4WZAA 4CKEA 4NNPA 3T9FA 1DJPA 1QHIA 4XUGB 4NJEB 3PP8A 5AW1A 4CF7A 2BEWB 3NBZC 4NH4A 3OIWA 3I6BA 2O14A 4YDHB 1ZLXA 3ZDRA 2OZPA 4NIMA 1GQ2A 2ZBPA 3S8YA 3NBFA 5CM8B 4I50A 1MA3A 5THQA 2JAWA 3NGMA 1L8LA 1OZGA 1THTA 4XWTA 3GBSA 4AURA 2ODTX 3D6NB 4K6KA 4HO1X 4NBKA 1TD1A 4DM4A 4FMBB 4KYIB 1HLGA 2PZMA 4BWFB 2Y9PB 3I8XA 3DBHA 3HRKA 4Q3LA 2KE5A 1Y82A 5JXIA 1S9DA 1EVZA 2FOXA 2J3QA 1T6YA 1SKBA 1VJ5A 2FSGA 3DDZX 3LP6A 4ZODA 3L0CA 4WXMA 3U1TA 1IEWA 2V6BA 1WTAA 1ZCZA 1V4NA 3ZNOA 5LKAA 3KV3O 2XXAB 4HD8A 2JIPA 4OXXA 4NARA 4R5MA 5A9RA 2BTQB 2H0AA 4YCBA 1WHSB 1YZTA 1SOMA 4H7EA 1T9ZA 2NV6A 1R4NB 3ESDA 4JHLA 3V8BA 3LJKA 4WBNF 1PD0A 3HKDA 4MUXA 5AKJA 3SOPA 3PXUA 3C7TA 4MIEA 2R86A 4QO8A 4TTAA 3U3XA 2QRMA 2JZCA 2JI4A 4OK3A 1V71A 4KP7A 3UKOA 1K7YA 1E6MA 3KZNA 2PEZA 3EPHA 3W4IA 4TLBA 4G0VA 9LDBA 5DX8A 3GLIE 3HJFA 4GRDA 1D1QA 2DFVA 1SUEA 4BRUA 3ZNQA 1QFXA 2ZBDA 3BIXA 3DV2A 5ITSA 3RSHA 4DIOA 1GPDG 3AUUA 3JD0A 1TK9A 4Q3BA 1JLSA 4ZCLA 2QYHA 5U4QA 1H4QA 2RONA 1BX3A 3BRWD 1BS2A 4MUYA 2C5SA 3QM1A 4BAGA 1KDZA 3EWSA 2ERCA 1FXUA 3ZE9A 4Z7OB 4M7WA 1W4LA 2VRCA 4UMEA 3C15C 4LOLA 2J0QA 4JYBA 4F60A 3TUZC 4W1SA 2OYCA 4FUTA 1EXDA 1H69A 3AHGA 3B5EA 5C9ZA 1DNPA 1Z6TA 3S1SA 4DL9A 4YRLA 5E38A 1W4AA 2C4UA 3JVIA 3WKBA 4LZOA 3ZE7A 4CQLB 3THWB 1PJCA 3W7AA 4BX0A 2GN6A 2AC2A 1R9MA 1D8TA 3LUJA 3W8EA 5JAMA 1OWPA 1UWVA 3NHRA 4J75A 5LKRA 1HZJA 4DIBA 2VDVE 3EWAA 3P9PA 2WIKA 1DC8A 2DBRA 3H0EA 2NVUB 4GO1A 2OV1A 2CVOA 1UC5B 4YGYA 3AG6A 1QE3A 2E55A 2ZI3A 1XHFA 2PH5A 3MJEA 1K0FA 1NXSA 4RXMA 2H2HA 1NYTA 1BHJA 5JDIC 3S2FA 3ZDFA 2JATA 3GUYA 1AHPA 4W5OA 5EMNA 5B7GA 1B00A 2VYQA 3H4MA 1FFDA 2WWHA 1U5BB 2X4LA 4FLMA 2P3OA 3WL8A 4AUKA 1ONPA 2WY2D 3FNIA 5HCUA 1L4FA 1T29A 4DLBA 2XUPA 1N2HA 1NLMA 3ED1A 4G9BA 3SZMA 2PU5A 2FPSA 2F6RA 3EARA 4AICA 1Z7WA 4LMPA 4ALMA 1PCXA 2RHWA 3QIVA 4IV8A 2QZ9A 3G0BA 3UJ9A 2OAGA 1CXZA 1ECFA 3GT7A 1Z8DA 2M6SA 2FWAA 1A9QA 3B8HA 1EVJA 1YJ8A 3DDWA 2FG5A 3IMFA 3NEYA 4TMFA 3WGZA 4WZBE 2W2XA 4CI0B 1Y5LA 4X93A 4FBMA 4TXLA 3M33A 1DAIA 3LX8A 4EUEA 2C9OA 1PR4A 4I9UA 3A2NA 5GONF 2YVKA 1GPWB 3D0QA 1NBMA 5CX4A 2X41A 5A4FS 5AH0A 1Z63A 3UOGA 4BGEA 4DRXA 1XZBA 5TQ2B 4LSWA 4D97A 4G97A 5CVEA 1Y8ZA 2Q28A 2W2OA 4CLHA 5EE5B 3TW4A 1CUGA 1TO6A 4F4JA 2UXDB 1YBAA 3QU4A 2XZPA 3CN7A 4NS4A 5EMHA 3C5EA 4HPWA 3CM0A 5BYKA 1OBVA 3K9LA 4CMJA 1KY3A 1TTPB 1ZC3A 1P6XA 2R6DA 4RADA 2JEOA 4BV8A 3GLFA 1QP0A 1PFWA 3BSFA 4GC9A 4XVCA 5EHGA 4R4JA 4XWWA 1FU4A 3EJ6A 4OIMA 3ROXA 4EJMA 5K4HA 2QQ5A 2PZLA 2ZT5A 3QHPA 4RPJA 5KYUA 4X1YA 4REOA 4EPRA 2W58A 3WGIA 5I9MA 4OQNA 4RF2A 3LDHA 4LY9A 3T3OA 3OECA 4TKZA 3ITKA 5KTSA 3WMRA 1HTBA 5JAIA 3RLFA 3DDNA 2FX2A 4D26A 3UM9A 4H31A 4EIWA 2N75A 4U7PB 4BNUA 3IVGA 1K8RA 3TR0A 3FOZA 1O9BA 3OM8A 1J9GA 5K6AA 1YUBA 4XDHA 4G0WA 1NFRA 2P1DA 3KFLA 1VZ2A 2C1XA 5GONA 4BNNA 4DQXA 1YRYE 2NZXA 5JCOC 4QVIA 1WZ2A 2I62A 2FHSA 3K5HA 1UADA 5D7BA 5CDUA 4JT8A 1VHDA 4MYHA 4V2UA 5KU7A 4R9RA 3JD2A 1VIMA 4HDSB 4JEMA 5FAXA 3L2OB 3RROA 2WTXA 4KVGA 3UHAA 1FFYA 4EB6A 4RJKA 1T0PA 4BKQA 3IFSA 1Z2EA 4H7HA 3NT4A 2W0SA 4UHEA 1TZCA 2O2JA 1BE1A 1RQRA 2P2CA 2R5FA 4GYJA 4G07A 4MVJP 4KIFA 4N65A 4TVOA 2EZ9A 3SSMA 1AKYA 3SXPA 3KZ1E 3ZDZB 1J2YA 1PP4A 1JIXA 1SIOA 4ENUA 2V7VA 5IULC 1DAPA 3L0DA 2WJJA 4NU0A 3KR0A 4PYMA 4J6FA 4QO7A 2W4QA 1DWOA 1FDUA 4TTSA 4BPRA 2YQ4A 2J3IA 3Q98A 3PVSA 1KXJA 3OJWA 2HK6A 3RSGA 1MXHA 4D79A 3KP1A 3ZWMA 4M38A 2X0JA 3D7RA 4HWRA 3EG9B 4HI0E 1QXSA 4H15A 3CX8A 4RJLA 1O2DA 4RPKA 4J6EA 1D2CA 1IH8A 1RC0A 2VP2A 3M5CA 2AYXA 2EP7A 3CF4G 3R3VA 2EC5A 2IK8A 4K9KA 5ICFA 5C5CA 4F93B 1ISSA 1DT5A 3WQSB 3OWOA 5H9WA 1OWLA 2CUKA 4OHFA 5EMMA 4PX9A 1DOAA 3KDAA 5KYXB 1CRPA 2BBOA 3G2MA 1SUPA 1C0LA 1P91A 3CEHA 1SKMA 4QXAA 3UJAA 1JT2A 1ODFA 1JIVA 2JAHA 2E4ZA 1Z0IA 2AFHB 1TYCA 4QXQA 1B0PA 1WUJS 1NF9A 1VKRA 1G8FA 2WYWA 4XCVA 1OV4A 2BM9A 4AJ9A 3FDFA 1VE1A 3WSTA 1E1NA 3NC1C 1AUXA