1NRIA

Crystal structure of putative phosphosugar isomerase hi0754 from haemophilus influenzae
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
248
structure length
248
Chain Sequence
b'LSTLITEQRNPNSVDIDRQSTLEIVRLMNEEDKLVPLAIESCLPQISLAVEQIVQAFQQGGRLIYIGAGTSGRLGVLDASECPPTFGVSTEMVKGIIAGGECAIRHPVEGAEDNTKAVLNDLQSIHFSKNDVLVGIAASGRTPYVIAGLQYAKSLGALTISIASNPKSEMAEIADIAIETIVGPEILTGSSRLKSGTAQKMVLNMLTTASMILLGKCYENLMVDVQASNEKLKARAVRIVMQATDCNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein HI0754
publication title Crystal Structure of Hypothetical protein HI0754 from Haemophilus influenzae
rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 80
structure length 248
sequence length 248
ec nomenclature ec 4.2.1.126: N-acetylmuramic acid 6-phosphate etherase.
pdb deposition date 2003-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01380 SIS SIS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10490 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glucose-6-phosphate isomerase like protein; domain 1 1nriA00
1JIQA 1N33B 2UXBB 1X9HA 1C7RA 2ZM6B 1U0EA 3EUAA 3G68A 3Q88A 1XMQB 4JI6B 1HOXA 1HR0B 4B3TB 4JI0B 2UUCB 4KHPB 3LJKA 4DR7B 1DQRA 1NRIA 2DF8A 1HM5A 2O2DA 2VF5X 2X3YA 4JI7B 2I2WA 3PR3A 5A2QA 4DV0B 2UU9B 4GKJB 1U0GA 4DR6B 1X9IA 4NXNB 4X65B 3JX9A 2CXSA 4S12A 4YHHB 3IFSA 4NXMB 1IRIA 1XTBA 1HNXB 2CXUA 3M5PA 4LF9B 1KOJA 1NUHA 4DV3B 4K0KB 3OOJA 2O2CA 1MORA 3C3JA 2VQEB 2J6HA 4LF7B 4OX9B 1XNQB 1N36B 1B0ZA 1XMOB 1IBLB 2UUBB 2E5FA 2XBLA 1Q50A 3OTOB 1X92A 2UXDB 2CB0A 4M0DA 4LF4B 3T1HB 4GKKB 1JEOA 2I22A 4X66B 5BR8B 1C7QA 4DV2B 2CXRA 1G98A 3HBAA 1TK9A 2CVPA 1TZCA 4U6NA 5LL6P 3J80A 5FLXA 4X62B 1U0FA 4JI4B 1GZVA 2ZJ4A 3NBUA 4X64B 3BCHA 4DV5B 1I94B 5IWAB 3I0ZA 4JI2B 2E5LB 4JI3B 3TBFA 3Q7IA 4DR3B 4AQYB 2PUWA 3J81A 2XHZA 3T1YB 4EM6A 3UJHA 1VI6A 1MOQA 2HHHB 4LFCB 4DV6B 4LF6B 1FJGB 4TOIA 1HNWB 3ODPA 4YY3B 2PUTA 1GZDA 2CXNA 4IVNA 1TZBA 4S1WA 4JI5B 4JI8B 3QKIA 1VIMA 4LZJA 2UUAB 4AMVA 4DV4B 2VF4X 2V4MA 1J5EB 2PGIA 2AMLA 1N32B 3SHOA 5LMUB 3ETNA 1MOSA 3FF1A 1T10A 4B3MB 5I01A 2Q8NA 3CVJA 4LF8B 2CXOA 4LF5B 2DECA 2F4VB 4DR2B 4DUZB 3HJBA 5LMNB 3BJZA 1VI5A 3FXAA 1IATA 4DR4B 1JXAA 4DR1B 5BY2A 3TRJA 3JAMA 1N34B 5IT9A 4DV1B 4B3SB 1IBKB 3KNZA 2WU8A 3J7AC 4JV5B 2CXTA 2VQFB 1JLHA 4JYAB 4B3RB 2CXQA 4DV7B 4DR5B 4LFAB 1VIVA 2PUVA 1HNZB 4DUYB 2POCA 1IBMB 4JI1B 3FKJA 1M3SA 1X94A 2ZJ3A 1ZZGA 1N8TA 1WIWA 2CXPA 1XNRB 3FJ1A 2YVAA 2A3NA 4LFBB 2UXCB 1J5XA
chains in the Genus database with same CATH superfamily
2QR3A 2G6BA 3C24A 5HM8A 4HLCA 4YI5A 4I50A 3PPXA 4LIPD 4WK2B 3PEWA 5IC4A 4RBNA 1E9CA 1MXFA 2HZBA 3FYHA 3NTRA 1T0BA 2V7VA 4IX1A 3KYCA 1ZM3A 2NV6A 1DOHA 2X3YA 8GPBA 2ISQA 4KE7A 3TW8B 1CUDA 1ORWA 3NVKI 1GNRA 1IB0A 4NCHA 1RT9A 1XCPA 4H4EA 1UAYA 4S35A 1E8NA 3T12A 2OL4A 4OQYA 3TNLA 1X1SA 4AKIA 1FP6A 1Y0BA 1C9EA 3FVRA 5GMOA 5IJAA 5JRZA 4LF9B 1E7WA 2J3LA 1I6WA 4ZOBA 3BKXA 3HI6A 4RIHA 4IIJF 4K6OA 1XDGA 1CY6A 1EXMA 2WD9A 4UTRA 3N59A 1FYFA 5J63A 3KK0A 3NJ8A 2NGRA 3DMDA 1AF4A 2QTNA 3L7AA 1KE1A 3SHQA 4CVNA 4JX9A 1SRQA 3U60B 5AQEA 1T1GA 3PRJA 5AOBA 1LRLA 2G04A 5K6RA 1E1LA 1NN5A 2R62A 2XMDA 2WJPA 3JV7A 4LQCA 4X1YB 1IUNA 2RI6A 2JLQA 3KU1A 3TB4A 4K9PA 1IXRC 2P8JA 3PI7A 2DBVO 4N9QA 4ZAFA 1E3WB 2PZKA 3PGVA 5GM2A 4NMMA 4J3JA 4K9QA 3I04M 2RC6A 4HH0A 4N39A 1IZZA 3EPKA 1W36B 5A4JA 4X66B 5IEJA 1S96A 1U2SA 1RZRA 1ZD2P 3EJ6A 4WKCA 1FVOA 4P5PA 1EFVB 3FCCA 3IILA 3IL2A 4MUAA 4PLWA 5TQVA 1RZRD 2UZ0A 1TM7E 4G5SA 4WKPA 5DHFA 4FVTA 1KOLA 3AETB 1YZTA 4QU0A 2R1TB 2PH1A 4HX5A 4AS3A 2RGGA 4TLBA 3EDMA 4TL8A 3UF0A 4NBWA 2G77B 5G0SA 1JHVA 3RT7A 3W05A 3KAJA 3NHBA 3GUZA 4L3VA 4LXGA 5BWOA 4KFCA 1DIOB 1AGYA 1L5RA 2I0FA 3R7DA 1VB3A 3B51X 1S1CA 3SICE 3Q3JB 2B1GA 1G3UA 1GGHA 2YHUA 3B9RA 3NATA 3NONA 5JHHB 2VP6A 1WLYA 3OZBA 3R6TA 2NUPB 3C8ZA 4GYWA 1Y1QA 1K1EA 5ALNA 5JROA 1BXGA 5EN4A 9LDTA 2R0QC 2WRZA 3KTOA 4TT8A 3D6MA 1ODLA 3I2JA 3O95A 2RAFA 2ODTX 3F3KA 4JLAA 4V0ME 2C4WA 4RF5A 4MROA 1JQ5A 1O89A 4KFRA 3LWDA 2G7MC 1GZSA 4TTIA 4AJNA 4IILA 4QELA 4Q3CA 1ZVKA 2P9JA 1ENZA 5AQ1A 1T1IA 3KC2A 3T9AA 2Y1EA 1AE1A 3A05A 4ON9A 1L1QA 4PG5A 1Z4MA 3C41J 1P31A 1ZD4A 3PEUA 3DMYA 5T57A 4MUIA 4GP6A 4XGNA 3AFNA 5DP1A 3RS3A 3JD4A 1N2SA 3SQMA 4N3CA 2NSJA 4QHTA 4O4HA 1OBOA 4NFLA 5FPSA 3T5AA 5HM6A 1N2IA 1OC4A 2ZVQX 1SQ0A 1QHHA 2GZ2A 4PSAA 4H7HA 2CNOA 4D4IA 1TL7C 1OAOC 5FNVB 2VNAA 4BV9A 3NC4A 1ITZA 2G36A 1YUNA 2JK1A 4J3FA 4MRVA 4R31A 1JTEA 2O8CA 1R6UA 2QM7A 2Z8YM 4RCYA 3T35A 2B0JA 3O38A 1XMQB 1D1SA 2YV2A 1NXQA 2HO4A 1Q6ZA 3AYXB 4BWYA 5A9SA 2G25A 2QY6A 5JTTA 1APBA 3D8HA 3GFSA 3RYIB 4ENRA 3CNQS 4PZPA 3QFSA 5JNSA 3I3OA 2VT2A 1L5MA 3STXA 1Z0IA 3RVKA 2R25B 2FFAA 2I2WA 1DG3A 3VSBA 3ZJVA 1R4NA 3NMUF 4P54A 4RETA 1U8YA 1MLDA 1NAIA 1RWQA 2V4UA 3PCXA 1FDRA 1N7JA 2A9VA 4ZYYA 1ECCA 3EB9A 1DC4A 3I1IA 4YJGB 4YUAA 2J6BA 1RCUA 1FNMA 1LY1A 2X1HA 1GFSA 2FV8A 4LX0A 1L7PA 1L5WA 4O4LA 4BNFA 4DKXA 3LO8A 2FWMX 5CFLA 3R9XB 4TT3A 3OPQA 5JAPA 3GFVA 2AKAB 1Y42X 3P97A 5FUMA 3HKEB 2CBZA 3BJMA 4GR9A 1TMOA 4WASA 4ES6A 5JJIA 2G07A 2WM8A 2FH5B 4V3BA 3MTJA 2WFAA 4JS0A 1QRSA 2QORA 3RRNA 4G6ZA 3UHAA 1E9RA 1ISJA 3AV0B 1J8QA 2XOXA 3HYCA 1OV4A 4RSHA 4UU8A 2V9PA 3OCVA 4I99A 3CGWA 2XYPA 5T8KC 2XTZA 3H1GA 3IAS6 3OOHA 1UBFA 4IIYA 4CDNA 1OXBB 2C03A 2I6QA 3C6YA 4BE7B 1TIBA 2Q7XA 2TMYA 3EK2A 2XTJA 2FWPA 4RC9A 4EW6A 4FWTA 1YKFA 3U4QA 4KMOA 4TN1A 4YQFA 1UOQA 1T35A 3ZZMA 4TZ0A 1L3BA 3NDBB 1B8UA 5DTQA 2HU7A 5FXMA 4C7XA 4ZQEA 5DRTA 1EDBA 5CH8A 3L8DA 1JBQA 4G8DA 2IHBA 5CNIA 1DE0A 1BX1A 4W63A 4B31A 4CN9A 1B2RA 2P9CA 2Q99A 4DHEA 3BD7A 5JOQA 2XLBA 1I3OA 3I76A 3THXA 2J9GA 3ODPA 1O7JA 5HJ2A 3R23A 2IYOA 4QARA 2BFDB 4V24A 4JI5B 2H52A 5DNUA 5TGDA 1UBOS 2WTUA 2PXAA 2ZPAA 1GHTA 3LYLA 3WWYA 3INYA 3OE7A 5CVEA 3TLJA 4DC0A 1GJRA 3MSCA 4UBJA 1XPUA 1AB6A 2QW1A 3A10A 4I36A 4P5EA 4GRDA 3BMOA 1SUCA 2QAGC 2IXAA 3SU8A 4C03A 5HUHA 3GLFB 3GPLA 4JFRA 4OAQA 1ETUA 2C8KA 1A5SB 1GRRA 2R84A 3AM5A 4Y6QA 3UJ7A 4AP5A 1GV0A 3CRQA 3KLOA 4O0LA 3VGPA 1P1FA 4KN8A 2K2WA 3FR7A 3MGGA 4FHZA 4MQEA 3C5EA 5ALSA 3G1WA 4FFWA 4OAOA 4XCVA 5C8DA 2CNLA 2I3AA 1FRQA 5BYAA 2FZ4A 3GCZA 3A4YA 3LG2A 4BVGA 4DCSA 3GLUA 5BVHB 5KJ1A 5HZHA 1S9DA 3JAKA 2GZDA 4MMXB 1KJZA 5DI9A 5KNBH 3FM9A 1D07A 2WG0A 3G5LA 3I6YA 2PGJA 4PSVA 1UC5B 4Q19A 3U1VA 2A78A 2BEKA 3NHFA 4U8GA 2R5NA 4GLLA 2PNJA 1XHEA 4Q0MA 4EB6B 2X7XA 5EHNA 1XEAA 2QDKA 4UEQA 2NUAA 4ND4A 2WUDA 4KO2S 1G7TA 2BZSA 3BGSA 1N33B 1LQ2A 5HKKA 4LC9A 2AB0A 1UWKA 3DE0X 1IEXA 1NLZA 1V6SA 4QLOA 2GH1A 4BC0A 5HKKD 5I9IA 5AW9A 4BVJA 4US2R 3LIIA 1ZVJA 5K3BA 3PNOA 4DCCA 2VZ8A 1A4XA 4EA7A 2BFAA 3Q9UA 2B61A 4OH7A 4DPKA 5JXWA 1ST3A 4ZQGA 2OD7A 2OZPA 2H4YA 4ZQFA 1IY0A 1QTIA 3HHEA 2RAUA 4JUFA 1MAWA 5HMMA 5D2CA 3HBMA 3TLKA 3ZU2A 4ZJZA 3P0HA 1X1AA 2QVZX 3QYAA 2DGDA 4KWTA 3WTBA 4ZEMA 3WGHA 2PPVA 4M9XA 3VZRA 3MWFA 4HLQB 1VYUA 3QVKA 1TB4A 2PU5A 1O03A 4PLTA 5ITSA 2DB3A 1BWSA 1ZWKA 4I50F 1W5BA 1DG9A 3CQ9A 5JALA 1PI3A 2I7VA 2HCFA 4RM2A 1U3CA 2RC5A 1M34A 2H5JA 4ALJA 2F59A 3OPVA 2ECFA 2GBCA 4E3ZA 3EXIB 2I67A 3H8SA 5B12A 5FL3A 1G20E 1LS1A 1M5UA 2HJHA 3PJGA 5M3BA 3UWKA 4S04A 2B7CA 4EARA 2WFLA 3AU8A 1TEVA 2X19A 1EEHA 1EVEA 3JYNA 1XZPA 3H97A 2JAHA 3PWTA 2E82A 1D0VA 2C54A 2YMQA 3A2LA 4FN4A 4IGIA 3KVYA 4LJYA 3Q7SA 3EYWA 3EGXB 4LQLA 1BDIA 1NL3A 1QV6A 3SD7A 1Y6ZA 3ZGYA 3RROA 4YMVA 3Q2KA 1NW4A 3VO1A 2FQYA 2HL6A 2FR0A 4CMJA 1TGYA 2O3UA 3WNQA 5C8YF 3CZCA 2OHXA 1CK4A 5HCNA 5FA8A 4DDHA 5B7NA 3LPCA 4M9CA 3A6KA 3FDFA 3CR8A 2IZZA 3NHWA 1G0NA 4ZVQA 1PLJA 2XTMA 2RBGA 2RHBA 4QPZA 4POOA 1XZJA 5REQB 3L6CA 3C8MA 3MWDB 3R77A 4ERNA 3T0GA 5KNBA 3T3DA 4RPLA 4EFKA 1H6CA 5KNBD 1DSSG 1AG9A 3UUEA 2HX1A 1SEVA 2CLFB 3LKVA 4JJEA 5KDDA 4L4XA 3EPJA 4L0QA 1NFRA 1XQ6A 2BTQB 2GSDA 2QM8A 3RI3A 1TEZA 3SEFA 4ZCMA 3MK31 1FS4A 4CIYA 1V7QA 3BIXA 3BE4A 3DVLA 3AB8A 3ZY2A 3WGIA 3I6BA 1NVMB 1RVV1 4Z2AA 3AUYA 3LXRA 5ALTA 5DXJA 5LMNB 3ET4A 1Q3KA 4KK3A 2IIVA 1KVTA 4OM7A 3ZXYA 2FX2A 1I5OA 3U4GA 3DE7X 4CF7A 3OZUA 5B3JA 1KZ6A 3JWGA 4TS1A 4NV0A 1FYEA 2I5PO 3NH9A 3GFFA 1SJ9A 1II8A 4TXJA 2F8MA 4FFBA 2O2GA 3RVJA 3HPQA 4EELA 3E53A 1J8MF 4NFYA 1H9AA 1W47A 2AI2A 2QPLA 1K97A 1ZA1A 2H18A 3D4OA 3HCBA 4N65A 3U4HA 2Y8EA 1ZPDA 5KQRA 1VIVA 4I6JA 4IH1A 2FSSA 4V03A 7MHTA 4ZAYA 5IVHA 2RCYA 3D9QX 1E7SA 2WIFA 1G8KA 4R05A 3T9FA 4HB3A 4KWCA 1W5EA 4U0KA 1Z2NX 3MCUA 1AGXA 2AJDA 2O50A 3A11A 4J94A 3ZZUA 1NLMA 4BO6A 4NJMB 1ZCZA 1Z37A 2RGBA 3KCQA 4PX3A 4XWGA 1AQYA 2B1QA 1F06A 2HHLA 1BROA 1N1EA 3PZRA 4IIFA 1V9SA 1II0A 4YH1A 1X86B 3ETGA 5I8ZA 3VBEA 1G38A 5DT2A 3D7NA 4UFPA 1U1FA 3ZJYA 3GK3A 2FMFA 3A2KA 3RSQA 2PX4A 4HB4A 1ZD1A 2NQ8A 5FOVA 3PK0A 3UK2A 1PTJA 2IH4A 4E5SA 2RHGB 5KYKA 1OYVA 4AQ7A 4LZOA 3SYMA 3FVTA 3A6PC 3NB0A 1UDWA 1D2MA 2VRWA 3QI2A 1J56A 2QA5A 1Z4IA 4PRLA 4RXTA 4JFAA 3T54A 4R8KA 1JT2A 3LP6A 5D51S 3KDSE 4F1JA 3FKSD 1KBQA 2J48A 1LDGA 1N0HA 3PC6A 4P82A 1JDTA 1G5IA 1LBSA 4GPD1 3K16A 2NTNA 1NVXQ 4WPGA 4HEQA 3PXUA 1E1NA 4MWEA 2OQVA 2DEUA 1VSBA 1G18A 4OSPA 4RSMA 4EMSA 4CF4A 1GD1O 2E21A 1FDOA 2LW7A 3W5SA 4WXYB 3GCGA 4FEAA 4OGFA 3K92A 2J1LA 1U0NA 3EULA 1P1BA 1Y34E 3RC8A 4EYKA 1NBOA 3HM2A 5DF1A 2HRZA 4LKRA 3ICWA 1M6WA 1K6JA 1NMQA 3A7DA 5IBQA 3U16A 1XTZA 2FE1A 1PX2A 4YRBA 4M89A 1IZ0A 1QIEA 1S2OA 4EW2A 1G60A 1V37A 2FWRA 2G88A 4NENB 5KDLA 1EJBA 3B8EA 4O59O 4Z5XA 3O1JC 3GA5A 4I3GA 3FMVA 4KXUA 3TWOA 4WKGA 3AW8A 2VHEA 1OBFO 5CB4A 4IRMA 1QRUA 3RF6A 3GRAA 5CT9A 4UHJA 3WIOA 1QGDA 1PV4A 3N0VA 1CCWA 4BN4A 3KTDA 4F4JA 3AF3A 4Q4LA 2KWIA 3I73A 3S99A 4YP0A 1E0AA 1GV1A 4Y2UA 1A71A 4AZ0A 3RVPA 4NFHA 2HWYA 2C5GA 1ICEA 2VSQA 5AOCA 2C9DA 1GGKA 2QRJA 4QQFA 4NBUA 2EZUA 4XQ0A 1B26A 2W70A 1YJQA 2VVTA 4B0OA 1H2ZA 6REQA 3HNRA 1L5QA 3BD8A 1ZL0A 1KP3A 3O84A 1NXVA 3ZCTA 1V8OA 2QGNA 4AMVA 3VR5H 4GWGA 3W2TA 3IEMA 4A15A 5U9CA 1QB7A 1Z9BA 2ODQA 3CRMA 3PYMA 4HK4A 3IE0A 4A8JC 3VHRA 4PEVA 3QE3A 3C5VA 5JJBA 4IUYA 4HN4B 1N2BA 4M0LA 3BRQA 1FNNA 2ILVA 4GNKA 4MKFA 3TD6A 3EEOA 4WH0A 4FOSA 2D5LA 5K5EA 2DFTA 2OA0A 1YDHA 5E1BA 3M6UA 3OJLA 1C3OA 2ZYVX 2LCIA 4AMZA 5L3VA 3IV7A 1FDIA 1A8HA 1IATA 1NQWA 3PE4A 5KX5B 3PEEA 3FWYA 4CKBA 1ZNYA 5JAZA 5I4IA 3BXFA 1FQWA 1GTMA 3D7MA 3F4BA 3AY3A 5CPFA 5FOSA 5IAJA 4GE3A 5DNYB 3GBSA 4I19A 2QLTA 3R3VA 1KP9A 2X9QA 4Y0AA 2GAFA 4HDNA 1ULUA 1ONBA 3OOEA 4L3WA 1H2HA 3NXSA 1ZH0A 4L72A 1DIHA 5CDYA 2WMNB 2FQ1A 2VLBA 3IEPA 1X94A 1KZGB 3NDRA 2NZUG 1C1XB 1JHZA 2QVYX 5TXGA 1TU0A 1P73A 1O96A 3OU6A 4QUKA 4AKSA 2HQRA 3C3EA 4NICA 5DW3A 3C0KA 1QGYA 3GZTB 4ZVPA 1V9LA 3N8DA 1C29B 1DKPA 3BRCA 2H6EA 2JBAA 3NUZA 3CPJB 4ZRNA 2Z08A 2H4XA 3G89A 1QVAA 5BWNA 2NYVA 5BR4A 3AVUA 3I62A 2XITA 1CRWG 3BS4A 4JI7B 1ABEA 4Y0NA 2W2XA 1RRVA 4LJKA 3CX4A 4WESB 2FLVA 2GPAA 4YA6A 3ZHSA 1UANA 1SA0A 1I14A 2OENG 3N75A 4QFBA 4RELA 3EBLA 3TXXA 5DE3A 5A2GA 1EFAA 2EF0A 3ZGZA 3ROEA 3ICCA 4GPZA 1G2PA 1XD9A 1XKLA 1PSWA 1XQYA 3WQSB 4ESHA 2AT1A 2OHVA 3BD9A 5EXXA 1MXHA 4PSCA 4KE9A 3WGJA 5ALOA 1QYCA 4BKOA 3C3JA 4CKCA 3CNHA 4PCAA 5CBPA 3PGMA 4TWIA 1QCYA 3DUWA 4MP3A 2XD4A 1KI7A 4LQ4A 5F7JA 3CEJA 1Z73A 2P2ZA 3N2KA 2VJYA 1T13A 2YJ5A 3KE9A 3VR5A 4LCJA 1HE5A 2ACKA 1RIIA 4MHTA 3VR5D 4D98A 2XEDA 3LGXA 4RLQA 2VJDA 2FPMA 4QPJC 2DUUA 3FFXA 3O8RA 3W78A 2O5EA 5DM70 4BLUA 3T7EA 4DBVO 3OJEA 3F2IA 4KX5A 4BP1A 3HCCA 2IYAA 4XJVA 1ZSNA 3MBKA 3HWX1 1ULZA 5DRYA 4YCLA 1JILA 3AEKB 4II2A 4Z54A 1MOPA 1T5BA 1YKSA 3AB3A 3CLTC 5JI3E 5JSZB 1DFIA 1QAOA 2I8LA 3GPDG 3N5CA 4H6VA 4NYMQ 3H0CA 2ZBFA 1XMPA 1SCUA 2P11A 4RY9A 5FBWB 4I5EA 3BPSA 1KEEA 3RAJA 1J5PA 1T8SA 1XZLA 1H93A 4G1UC 4O5AA 3NOOA 2ZROA 1W35A 2SHKA 1AN0A 1NXWA 1E62A 2X0JA 3MAJA 5ETJA 5BQPA 4AF8A 1P5HA 1FMLA 3ORHA 1GXSB 4RD3A 5DW0A 3TO5A 1COWD 4H16A 1W1IA 4H59A 4Y1GA 3Q40A 4ND6A 1K92A 2VYNA 3LF2A 3VNQA 1EWYA 4R2WA 3VTKA 3PNKA 3GR6A 3IA7A 3S2UA 1HNNA 2PLAA 3CGGA 4D25A 1MOSA 2X22A 2VYND 4R41A 3EGEA 2IVZA 5TJHA 4EVQA 3ITDA 1GPUA 2BHTA 4XVUA 3K73O 1UT5A 4DMFA 4CEHB 2XGSA 3ACDA 1WXGA 1B41A 2EFEB 4KDCA 3ABRB 4JKYA 4LRXA 1K8ZB 3WMFA 1FDTA 3DBLB 1NDQA 3KDAA 4IMPA 4HZUA 1SCBA 3GV0A 3ZR4B 2PYZA 4B6FA 4ZZ1A 3EVCA 4FWBA 3KXDA 4Y30A 2OCYC 1L4MA 4Q4JA 5D8DA 1TYCA 1VKRA 2YJ6A 4GH5A 5K6AC 1VE9A 5F1YA 1EK5A 1UKVY 1P4HA 1V7CA 1Y6QA 2GEJA 3LQYA 2PO5A 2ZJZA 4HQNA 4I1YA 5K8VA 1WE2A 2VPZA 2Y2VA 3O4RA 4LHXA 3V32A 2WD7A 3EVNA 4ZDWA 3L6RA 5CDFA 1QCZA 2OGTA 3CUSA 4LKOA 3HNOA 2RK3A 1J97A 3OP4A 1IL0A 4MV9A 4V0LA 5FHRA 3SDZA 4G5FA 4BV3A 4F5EA 1D2GA 3ICEA 4BVKA 1FYVA 1W4AA 3PCRB 1E2BA 3BWMA 1FC0A 5BNIA 2POQX 4KSBA 3WV5A 2B98A 4WOKA 1QBKC 1SC3A 3DLTA 3P2JA 1ZK3A 3EISA 4C3OB 4ZGBA 3OZCA 3WGQA 1XK6A 1XRLA 1UJ5A 3I9V1 1XZEA 1KMCA 4PANA 3SWWA 3S2FA 1ZAYA 3ICPA 4GUAA 2FEKA 1IZYA 2HA5A 5KBYA 3VO9A 3H42B 5FBHA 1JHOA 4DCJA 3Q0IA 4KBYA 3CX8A 2CL0X 3LZCA 4L02A 3GEMA 1U9CA 4BO9A 3DLPX 2VP5A 1LF5A 1I36A 4J03A 4EY6A 2NV0A 2Z1MA 2VYQA 3P0JA 3T3PB 1BHSA 1Z18A 2W2KA 4H1HA 1X9GA 2A1TS 1GCOA 3CBQA 5LOVB 1W96A 4YWJA 1YHZA 2FF7A 2P4HX 1C2TA 3LX4A 6ABPA 4CMBA 1W5SA 3O8OA 5JW6A 1WO8A 4J75A 4C2UA 1Q1ZA 2E5FA 5ALLA 1O95C 3NLLA 1ML3A 4FGJA 3A06A 4ZHQB 2P7HA 1QFXA 1YDGA 2BGMA 3TSYA 1QSGA 2XMPA 4MKIA 4GKJB 1TM1E 3DYVA 1M8FA 1XIVA 1ZGCA 4B3BA 3LDFA 4U6NA 4BB5A 4TV8F 3K0BA 1UAAA 3U56A 1F8FA 2HJVA 4TL7A 2NUBA 3QWBA 2ZQYA 5FWXA 4QPDA 1XEWX 3BEOA 3IAUA 1SIBE 5IWAB 3HXOA 4XWWA 4BFSA 4QJIA 3F5QA 1D2EA 1LBIA 4W99A 5FOTA 5HDQA 1LSUA 4E03A 1VJCA 1SKBA 2PNFA 2Z57A 4PBRA 2GM4A 5KWSA 3PBKA 4PX9A 5ALEA 1H0HA 5K3FA 1E2UA 1I0ZA 2YV1A 3G82C 3N39C 3FGPA 1JLLA 4JQYA 4AP6A 1RRKA 1ZRMA 4TTQA 1UFOA 2PRIA 5IHXA 1KH1A 3JARB 1N5MA 5BRJA 1LDBA 2ANCA 1Y5IA 2OZVA 4HGPA 4HDAA 1PAUA 2Z09A 3ONWA 1TOAA 4P58A 4BNTA 3CA8A 1P0CA 2F1HA 4OMFG 4KN5A 3B38A 4B3MB 3JQFA 5DNEA 3SBDA 4FNAA 4E0BA 2F4VB 5G1NA 2ZJ8A 5CURA 3WA6A 1PG5A 5CVVA 2H51A 1K6EA 4P9NA 4ITUA 1RAEA 3HKDB 2G5PA 1BCSA 1A97A 3GJ5A 5C4GB 3PX7A 3VA7A 1ZOIA 3DSRA 4GKAA 2DCUA 4HFJA 4EA9A 3ZD7A 5A0FA 4AN4A 4EY7A 2DWPA 2PMCA 3TR0A 4CJXA 4BFWA 1I4DD 3N7AA 4B3FX 1IQRA 1VE7A 2HSWA 2HU5A 3C1OA 2ECOA 3OCCA 3SQWA 3DEHA 5EJMA 1QYVA 1RJWA 4YB8A 4ND5A 4CL2A 4BS9A 5J4VA 2XXJA 3L7NA 1Y3CE 3K9WA 1C8VB 2OB2A 2I4LA 5HS4A 1F6DA 1N7GA 1ZJZA 4UNIA 2WYUA 1JFSA 3IAM1 1A9QA 4XLLA 1FVHA 3M6VA 2R1ZA 1JDVA 2F1IA 5HW0A 4W5JA 2WUFA 4AZ3B 3FCEA 4RZ3A 5KVCA 5EZQA 1KK0A 3LQFA 4GBMA 1QHFA 2XTAA 3TBHA 3GC6A 4JITA 4WLFA 1CY7A 1LK0A 5BYKA 5IDXA 3IYLW 2HR1A 1ES9A 2XKAA 1NIPA 3BOSA 3LC1O 5CX1B 5DHTA 4L75A 3E58A 3VGJA 2Q3JA 3ELBA 3SC4A 3VOSA 2OBNA 3AFIA 3RHFA 3PQ4A 2AX3A 5JBQA 3KUDA 1N2EA 3ZV4A 3L0OA 3PQ7A 2H2HA 4DIUA 4LDZA 4ZO7A 5A1TA 3WBJA 2PT9A 3GUVA 1FFBA 2HOQA 1EFDN 1YMVA 2YWFA 3CEPB 5TSDA 2ZRJA 1JDBC 1PEKE 4MZDA 3R9IA 2W37A 5C3MA 3AESB 1KQNA 1JIUA 1G8MA 1F5NA 3FNFA 1OQAA 3H5AA 1WS6A 1E6MA 5FORA 3CJRA 4RORA 5FOUA 4B2YA 4MQ4A 1JZSA 2J45A 2ID8A 2NXCA 2XECA 3IXQA 4DIKA 2G5GX 4HOYA 3B2EA 4WK4B 3T4UA 4C0WA 2FMHA 1S1MA 1GCGA 4DVJA 1F1JA 4PONA 1VPEA 1FJXA 3W9YA 1K4KA 1QFSA 3UFXB 2JAWA 3B1JA 3VU8A 5K6TA 2UUOA 4FZRA 3FW1A 4M1YA 3V1LA 1NN0A 4IFBA 1VKOA 3UHPA 3WBBA 5JVDA 1OGYA 3H5VA 3KFLA 1ZIDA 4C6TB 5CX4A 3N8HA 2V45A 1YA4A 4OHUA 1Z06A 3TH5A 1TU4A 1M6HA 1GZVA 1TYBE 1BS2A 4XQGA 5GAJA 1VECA 2BM0A 4IO0A 4LHSA 1IN1A 1ODCA 4JXKA 4JOSA 3AC0A 4X97A 4YV0A 4Y8VA 4YUYA 4JP8A 4M7WA 6ADHA 3W2GA 2V0NA 3LFUA 5JRJA 1SXIA 2GZRA 4PNPA 1D6MA 4S3MA 2OP0A 1A72A 2P9HA 3BCUA 1RTKA 2O8NA 3M34A 4YAEA 4N12A 3U3RA 1R1DA 5I7FA 2AC4A 5C18A 5K0SA 4G0WA 1PG2A 3KZCA 5JMPA 1SXPA 1KOGA 2OAGA 5IXYA 4G4GA 2VK2A 2MYNA 3D6UA 3K0AA 4MI6A 2X0KA 4BQSA 3QXCA 3PHBE 4F12A 3GFOA 4O8CA 4I0WB 3S1AA 1CNEA 2WJYA 4IUDS 3FTPA 2EBFX 4KCGA 1B8VA 5SYMA 5U4QA 1VIYA 3RUAA 3A1DA 4GF5A 2YTZA 3TZ6A 3U3JA 3VTFA 4YI3A 4E5KA 5BMVB 1TKBA 1W8IA 1GTVA 3DMTC 3C98A 3IP6A 3LLMA 3LV8A 5ESDA 3ZEIA 1ZEMA 4C0BA 4BQIA 1YOVB 1GA4A 2D4HA 4HS4A 5JCZA 4FXOA 4I1OA 3U19A 4C0XA 3NBZC 4NCKA 5FNVF 3OZFA 4HFRA 4WZBB 5JMWA 1OKKA 2ANBA 2G6TA 2IEYA 2YZMA 3DC2A 3DPSA 1SN7A 3HZOA 4IUCS 3VOBA 2OO5A 3WDSA 1YDMA 2ENWA 1YMQA 5HSGA 1OKKD 3OEHA 2WKRA 4Q1EA 3JVEA 1X7ZA 4NS4A 4MGKR 4DUYB 3A2NA 2UZAA 2OECA 3OEHD 4MIOA 3SC6A 2NTVA 1FLNA 2H1IA 3EPLA 4UNNA 3GARA 4R1QA 5JZOA 1I1OA 1XYYA 2XEXA 1MO5A 4L4ZA 5FV4A 1IULA 2PWAA 4KOAA 2GA8A 4AWAA 4ID9A 5JSHA 4F6RA 2QMZA 1KYZA 1QP8A 3FRHA 4HWGA 3RODA 1FFWA 4WKBA 3UBTA 1K3FA 3QIAA 2QI9C 1RP7A 3CISA 3WGMA 1FDWA 3EGVA 3ROTA 3ANLA 4RPJA 3IE1A 1M1NB 1RWXA 5CVTA 1BXRA 2O5RA 1Q14A 1GKLA 3CE6A 1E5DA 2HEIA 3FLEA 4CCYA 3HKBB 2VBIA 2I65A 4ZAZA 3RTDA 4JOCA 4MO9A 3CRNA 1R8SA 3OLCX 2CV1A 4A23A 1KMQA 2ZUTA 3GLFE 4Y18A 4PQGA 1M1YB 2WWTA 2QX8A 2GPYA 3DXYA 1PUXA 3ZVNA 4GM0A 2OWEA 4O4JA 3P4YA 3NI2A 1E3LA 2PKYX 3DZDA 3VNRA 4RA6B 3HWWA 3O9MA 1VJ0A 4ME6A 2JFUA 4G1FA 3R7LA 4V1CA 1R50A 1UFVA 2BZ0A 2DLDA 4TTAA 2J6HA 2P5SA 4FX5A 5AUOB 3R5FA 1TT5A 4UBMA 2NNWB 3A4TA 3T7CA 3M4JA 2VZLA 1HC7A 5B7PA 3MRXA 3QBTA 4N40A 3WGNA 3ETLA 1ZICA 5DM4A 2Y1GA 3G2LA 3OZ7A 1M2OA 2H9YA 1X38A 2PS0A 3G5MA 4OYYA 4PS0A 2OZLA 4ZTUB 4IDBA 5IG2A 1YQQA 3EQ8A 3GZ4A 3SS8A 5B4UA 1SBYA 2Q5IA 4DHWA 1J6UA 3NEAA 1KZ1A 3ZH2A 3LT0A 3P2OA 3P1JA 1CEQA 3L7JA 2FB9A 2WQZA 5C31A 5TY0A 4MGYR 4UBNA 4DQXA 4JI4B 3VJLA 2D1TA 1HQCA 1Q0SA 3OPNA 4M6WB 3MZ0A 3N2YA 1H69A 3OKFA 3ZWVA 2CD9A 4KUEA 4UPVA 2F1RA 4JP2A 4OHWA 3P2KA 4LJLA 4OXQA 1DT3A 2GEKA 4IEEA 4RGQA 1JLRA 2VRBA 2JAXA 3L41A 3VO8A 3FROA 5J58A 5THKA 1PR5A 5K01A 1CJCA 2R8BA 3W3AH 3UGQA 4PTYA 5FYDA 4MVJI 5DXAA 2AWOA 2BH2A 1T9HA 5KIAA 5AICA 3OA2A 4NOKA 3KT3A 1QHGA 2WF5A 2YCBA 1JS1X 1PJCA 4PQFA 4K1XA 2FUG6 3BE6A 1YACA 5PGMA 3WADA 2VT3A 4ZA2A 4KVFA 2XVXA 1T9GR 3KQQA 1NF3A 3WGYA 4Y7CA 4ENTA 3KKKA 2M32A 3BWYA 5FUVA 1V11B 4OLAA 3LDAA 4U2BA 1DFHA 4KQXA 4I2VA 2OV6A 3LM8A 3B85A 2GF0A 1YI0A 3VYWA 2IUSA 2XCQA 3G88A 4ZV7A 2B0CA 1VE6A 1NKTA 1RLTA 1K7EB 2NYRA 4YYZA 4DREA 5C1BA 4B3HA 1T5IA 5KAMA 1DIAA 3RC3A 3HXQA 1P5FA 1WL8A 3B6EA 1LLCA 3NW9A 4N6GA 5DHSA 2PL5A 2QX7A 2EQAA 2AQ8A 4FBLA 1GZUA 1Y7IA 2ZS8A 1PK7A 2CVZA 4TS3A 3UT6A 1YIAA 3U0VA 1KJQA 1OTYA 2ASEA 4RCVA 1ZY2A 4YAWA 3UNXA 3MT0A 4OBWA 1SUEA 2MDTA 2PD3A 1C9MA 1T8RA 3B3QA 4XJTA 2Y9MB 3Q7RA 3VHLB 4EVSA 1VIAA 2KS6A 4NY1A 5CR9A 2H7XA 1G7RA 1PUJA 3ZWMA 2XSZA 4M1QA 4IIGA 3MTAA 1GQSA 1Z22A 2QNBA 3RE1A 3LQ2A 4G0PA 4R98A 2BI7A 2XSZD 3M83A 4KWIA 3ZDCA 1YB4A 1RNLA 5JJCA 1OBHA 4KEAA 1NASA 4PN3A 2VHZA 4JU8A 1TKRA 3OCYA 2C1EA 3I2HA 4G0NA 5A4FS 2HMAA 2DUNA 4OKNA 4M1MA 5T6BA 4XM1A 3SEQA 3P96A 3CLVA 3EEYA 3TM4A 2XVMA 2IU4A 3IPLA 1UINA 3ZDXB 2EV9A 5CH3A 4X20B 1G8SA 3RVMA 3OCXA 2E1PA 3WHLA 4HUQA 4CCAA 4F9EA 5JDCC 4RACA 1OREA 2IYUA 3DAFA 4A2CA 4HAWA 1P3DA 3DL2A 2CLMB 3D4IA 5AUNB 1XXHB 1NATA 2H1WA 4NDNE 3W7VA 4HCJA 4ND2A 5EUMA 1V45E 2O2XA 2MSEB 1ODSA 5HE8A 3TQCA 3MWEB 2HADA 3QLEA 4ZOLA 2QUJA 3W3AA 4EBFA 4E2FA 5HP4A 1NUUA 2XYGA 1IY2A 3OPMA 2P41A 2JAOA 2UYQA 1OFIA 1EVZA 3E7FA 1WZ2A 1NVWQ 1X7XA 5E0OA 4RFSB 3W8NA 3BK2A 5SY9A 3LGSA 2PUAA 1R64A 5K3DA 4ZYXA 4YAOA 1QF7A 2RHLA 5I6DA 1CF2O 1NP6A 3L8ZA 3MM4A 1AM4D 4D99A 5ALZA 3AKZA 3KRTA 4GL4A 4D02A 4W8GA 1ZUNB 1IONA 1G4HA 1WUHS 1ZI6A 3KB1A 4QT4A 2X42A 4FYJA 5CFMA 2BGRA 2EW1A 3G3EA 1RYHA 3JD2A 5DGCA 4ZCLA 2QVXX 1AKMA 3ZWNA 2W4QA 1XV5A 3QWFA 3RD5A 1WRBA 4Y0VA 3QE0A 2BE9A 5LD2B 1MTOA 3ELDA 4GLJA 1V3TA 5K99A 3JTEA 1TFRA 4FFVA 1KMHB 3A26A 1SHZA 5IXSA 3RSFA 2GM9A 4BPRA 2DR0A 4FOOA 5HG0A 1DAMA 1RM3A 4PRKA 2LZ0A 4N7MA 4DPMA 2OB1A 3HDHA 4XD7D 5I5GA 4CYMA 1DO2A 5CD9A 4XGQA 4ANFA 3JRXA 2GPWA 4J0CA 4REMA 3I2YX 5F73A 7ABPA 1ZD9A 2O7QA 4LWPA 5TDHA 4P08A 2NZXA 4MB6A 4DSTA 1IWPB 3EUWA 5ICCA 1J5EB 2BEWB 3L6OO 1V7ZA 5DWDA 4G0UA 1Y9AA 2J4CA 3QEKA 1Z6PA 9ABPA 4LY9A 3KLBA 2JGMA 3K09A 3T3GA 4CMEC 4BKPA 1TDJA 1WW2A 1UK7A 4Q3KA 4RJJA 1NWCA 5DK6A 2AFVA 3KTAA 1TM2A 3HK2A 3F7OA 5IPFA 4F4HA 3NFYA 2QTMA 4BFXA 4K9DA 2YDXA 5CW2A 2YASA 5E4TA 4EDHA 1JG4A 1E63A 2W6NA 5EPOA 3TM5A 3JQBC 4AJIA 4D57A 4IYJA 1PFYA 4D8YA 2WU8A 1VC2A 4OFZA 4UTOA 4PC3A 2RG7A 3OD5A 4D0GA 1SGWA 2HSEA 1EWQA 3L4KA 2YRFA 4F5YA 1KSHA 3DV2A 1F60A 3NX4A 4HEA6 3TTYA 4XDHA 5CRIA 1TQ2A 1C7ZA 2B1IA 2P77A 1CIVA 2Q5QA 1QE5A 3DBHA 3PXEA 1NG1A 5K0GA 4QBHA 3GEDA 1KY5A 2YIVX 3LYHA 3TN7A 4F85A 3D02A 1RXSA 2QP3A 3AJDA 4JIGA 4OHXA 3LNTA 3HJGA 5DIZA 1F14A 1KH3A 2I4NA 3NIBA 3EIXA 5AWFC 2AA3A 3HXLA 2PBFA 4J1SA 2HIAA 4G9GA 1W8DA 3OZGA 1SWVA 2VF5X 5CT4A 2PRSA 1ZJWA 3ZDZB 2OP1A 3O4HA 4WFJA 2OXEA 4WLOA 5G3ZA 1H5UA 1Z6TA 1ZK0A 2Q46A 3F2VA 3I34X 4Q03A 4QNRA 4EPWA 3ZCUA 3TBKA 3U7EB 3A4NA 1JKXA 1G6Q1 2JFQA 1VOTA 1E2LA 2RJOA 3BWDD 2GZSA 4QICA 5L4SA 1M67A 3V97A 2IEZA 2YC2C 3UT0A 2GS9A 3EVTA 2VDWA 1J0DA 4CM4B 2JZCA 2UYCA 4K6FA 1W0JA 3HWRA 2R8YA 3TGLA 5KREA 3WK6A 5DN6A 4BFTA 1KDVA 1A9YA 1JEQA 2PLNA 4TWRA 1GPWB 1N5IA 1W0JD 2GO1A 2RKBA 2YDYA 3DWGA 2FFJA 3VC2A 2Y71A 5DN6D 3EA5A 1N0WA 5DV9A 4Z99A 4C14A 1EK2A 1IHUA 1T3ZA 2P27A 3CLSC 2WP0A 4C7OA 1EP2B 3V7FA 4BCDA 2CDRA 4HYEA 2WHYA 3L0DA 1WDTA 2F1OA 3SQDA 1UT6A 3KZ1E 4OUDB 5CLGA 1HWYA 5DLPA 1CUSA 3LWZA 3RYHB 4B3CA 3SKVA 2R8EA 3HKCB 4RHYA 4WBNA 3U1TA 3LP5A 2ZIXB 1D6JA 3F5SA 4NMHA 3HUTA 4GO1A 2ZRAA 2VZ9A 3QENA 2Y0BA 4JOBA 5U1PA 2YMLA 4XW2A 1XC7A 4ZEXA 3TLXA 4DXAA 1V16B 2Z30A 4O25A 4X1KB 5J1SB 4TLEA 1U7UA 3IR7A 1JSXA 4IS3A 2XRMA 1Q12A 4G9BA 3OFNA 5GGXA 2RI0A 4ARZB 3OWHA 1AKEA 3B1YA 1BFUA 3EODA 3OFND 2DJIA 1VB5A 4B8ZA 4ZK2A 4JXJA 3VOTA 1HNWB 3S8MA 1J24A 1Y9DA 1GKYA 3GGPA 2DBYA 1NJ1A 3M82A 4LXYA 5T41A 4Q9KA 1HSZA 5KC9A 3BE8A 1TAQA 1Z5UA 1EXDA 1XZNA 1JEAA 1XZQA 4WEOA 4G5HA 4YWHA 1XHFA 3SR4A 3VZQA 2B2NA 1FX0A 2EWMA 4YXWD 2CLSA 1FCJA 2ILTA 3C43A 1FE8A 3M89A 4PQYA 4R2MA 1JG2A 3SYRA 1TA0A 1BE6A 3H8JA 4QULA 1UDXA 4X7BA 2BFOA 3B5IA 1T8PA 2A5GA 2WYOA 4RPKA 3TJZA 4A91A 1TQ4A 2GWHA 1TAHA 5DHRA 3AM3A 3UOWA 1EFPA 2QYHA 2MIIA 2EBHX 1USUA 3OHMA 3RVSA 3BMNA 4FJ2A 1D4OA 1GA1A 2AEEA 5ECGC 3WOHA 3SN6A 4BMCA 5AOVA 1D2NA 4QOSA 4HQFA 4QYWA 5IZCC 4IJQA 3AVWA 3UYLA 2AJTA 1XTKA 2PBZA 1DHTA 1JHDA 4P4TA 4LGYA 3UTCA 4E5NA 3RUFA 1NVFA 1AKTA 1QO7A 2XJ9A 4MTCA 4MW0A 4REOA 2PZ8A 1QJCA 2QRZA 3OH8A 5J5CA 4EWLA 4YUWA 5LQKA 2F62A 5JEEA 3IP1A 3DOEA 3BREA 4JU9A 3LMKA 3SM9A 1WW8A 3VPFA 2I6FA 2NZ2A 5F9MA 3II6X 4ALIA 1Z74A 2XA9A 4MI9A 1OWMA 2OE2A 3UXMA 1E5VA 1E60A 4MWZA 4Q6WA 4YBRA 3IAEA 4R6WA 2VSFA 5KSOA 1UBCA 2QLMA 2VDMB 1X13A 1NLUA 3M4XA 2OBMA 4DV0B 3VC3A 4NIMA 1NP7A 2YZGA 1Z38A 3GMTA 4NNOA 1VCHA 1PJQA 4IV0A 3KB8A 4OQEA 4QL3A 5AJWA 3WA7A 3L1VA 3WWOA 3KSZO 2EEZA 5B3KA 2OFFA 1AT1A 1Q0PA 1SVOA 2HQBA 4YAGA 2ZIVB 3ZHVA 1ZM9A 1TF5A 3KZMA 4KDRA 3H6HA 3WK9A 2V0GA 1J09A 2HU8A 3A3OA 4F4FA 4IQ0A 4MKHA 4NZ9A 3M3DA 3FNBA 3ANSA 1V25A 1OOEA 4RH0A 4IYRA 4RHXA 1UP6A 2F1JA 3HN7A 1X8KA 2NAPA 2PZMA 3V8RA 5KCZA 2G17A 3M6AA 3OTGA 2KM1A 4LJAA 5E7MA 4DGSA 4YLYA 1JVBA 1GG2A 4YUVA 3RVQA 4L4YA 1OV6A 2B9VA 1B43A 3I58A 3PRHA 4ROSA 2UXDB 3QEMB 1HQKA 1T0IA 2AXPA 3R6DA 5BT9A 3LRXA 1EQUA 1FXWA 4GPIB 1I01A 2PGOA 1XAJA 3PI6A 4WCVA 3VBCA 5LXTB 2ZFUA 3O1IC 4HAUA 1G2OA 3AR2A 2AEFA 3BTUA 4WFKA 4XKJA 4B73A 3CW2A 4UBOA 2KQUA 4DCNA 3FOAA 4K9MA 5EY5B 3KO8A 2XB8A 4LBYA 4EHAA 5FH9A 2JFNA 3NALA 4WY8A 2RAPA 8ATCA 1CE8B 2Q27A 1FMFA 3D8TA 4D80A 5JC8A 1DEOA 3PQFA 4BMNA 1HDYA 4QHYA 4CV3A 5GJBA 4XR9A 1PJBA 1VI6A 4PF1A 2QZJA 2W2PA 2FPKA 1KU0A 3M1YA 3OJXA 2WKQA 4N4AA 3TR6A 5EJGA 1A1SA 1SVWA 2ZBDA 1JH8A 1YS6A 3CINA 1P1CA 2PU7A 2YOGA 4M55A 4AXXA 5CT6A 3IEIA 3PDUA 3MSXA 4TX1A 4U7HA 4Y6LA 5GJVC 5MFPA 1KI1A 2Z6AA 3AZOA 4XUDA 3VO2A 3GA7A 1B0UA 1XI2A 4JT8A 2G82A 5L3ZA 4QLBA 2XDYA 3H9GA 2J0UB 1G8YA 4BIMA 1ECPA 1DQSA 1M83A 3KUCA 5FBLB 3AEQA 3ZWAA 1JR4A 4GMGA 1X7WB 3QX3A 1ZD5A 2NTYC 4EG8A 1M2NA 4DPLA 3L6UA 3TNDA 3M1IA 4EYEA 4FHFA 3M70A 2H4WA 4FDTA 1QYWA 3BFVA 2P9ZA 2QD3A 3DUFB 2YWJA 3GZNA 2GN2A 3G2OA 4PZCA 1KEPA 1LB1B 1M9NA 4WTOA 1VRVA 3DHEA 1KFJB 2P1ZA 3F6SA 3FUVA 1JYEA 3AI7A 1DC5A 3QE4A 1TO2E 3OUUA 1CEYA 2WYVA 3GJRA 4IWNA 2FAXA 3ZBPA 3O47A 2EG9A 721PA 2WBLC 3RYCA 2PUVA 1U8TA 4LXXA 3MRSA 1H65A 4PIMA 2AQIA 4KH0A 3H5RA 1L5OA 1W73A 4YCDA 3C14C 4EMUA 4L3OA 1FP4A 4AN0A 3I01M 1CHDA 1P81A 4HX2A 1ZL2A 4C6RA 2YVAA 3KJEA 3BORA 2YHAA 2IOYA 4K9SA 1EB9A 4B6SA 2BKVA 3Q10A 4J1TA 4B6OA 2O9JA 1EG7A 5CU7A 4RQBA 1J39A 4XGRA 5YASA 1R0WA 3UATA 3VPSA 2A14A 4N6NA 4YT4A 4U3JB 4HWOA 3AF4A 4KIJA 1X0XA 2B69A 2ZIWB 1NY6A 4QOIA 4MR8A 3RWMB 1U7OA 2J9FA 1W2WB 3QLTA 1J2YA 3K0FB 5CXSA 2Z1NA 4BB9A 2IS1A 3ZC3A 3HTXA 2PUBA 1XTBA 3IS3A 3BE5A 3OQPA 3FOZA 1UT8A 3TOCA 4WXRA 2P68A 3PHGA 5IABA 2EJBA 5KNCH 3UAXA 5DK4A 4A27A 4R71A 1TU3A 1ZDMA 5FUQA 4N9WA 4ZHQF 1BHQ1 2NADA 4GOND 3VVCA 2RGNA 2O54A 2VSOA 2ACVA 4MGHA 4B4OA 1QTRA 4G25A 1N7IA 1N36B 4TKMA 3LKBA 5BUZA 4H6XA 2X5NA 3GVIA 5EE5B 1X92A 4N5MA 5EQTA 4IDEA 3DBRA 1ZQ1A 3L49A 3JQDA 1JF8A 4C1NA 1G291 3AL2A 3PNVA 1CEXA 3UICA 2RHJA 2TECE 1U8AA 1VYTA 3QMMA 1HUQA 1ZH4A 4Q9JA 4B33A 5JC1A 3L3BA 3OIYA 1K9SA 4J1QA 1E66A 3HACA 3TVYA 2F55A 1V2GA 1WCIA 3E3LA 4GI1A 3KUKA 1L6IA 3V1YA 1K88A 1E3QA 4UVGA 3UJ6A 4ER6A 4N0MA 1DX6A 4JASB 1G6OA 2XX3A 4R1LA 1UEIA 4BQQA 4CMGA 1PJLA 4LYYA 1I1HA 2MWMA 3G8YA 2JGAA 4EG1A 1RWBA 1PJTA 1ZI9A 4MPTA 2OT3B 4BTEA 4MCHA 1OIWA 3HLTA 3KQYA 4F9FA 5HIKA 3AEUB 3P9SA 3VYUB 4FDUA 1TIKA 2IZ1A 4WBNF 4M88A 2ZXUA 2IITA 2LTAA 4G0XA 2WLTA 3SFVA 3LHIA 4Q9LA 5B6IA 1BU8A 4RZ2A 5IC6A 4RZSA 3HDYA 4ZDKA 3V1KA 3MWKA 5ELXA 1ULAA 5TPWA 5I51A 5JQGF 4C6SA 4CQJA 3QPWA 1WJGA 2XH8A 1NZDA 3JRNA 5LFAA 5BN5B 3P0RA 1TECE 1VI5A 1XAHA 3EH1A 5KJFA 4FD3A 1R74A 2EIXA 5AVQA 1MJ5A 3ZK7A 4IX9A 3I8XA 2PH3A 1QGED 2P0YA 5ECYA 2IY9A 3IVRA 1EVIA 2OCGA 4EHFA 1I33A 5LIRA 5IVKA 2R1VA 4M1SA 3EDCA 1CY0A 5CUQA 2VQFB 4X61A 3EE6A 2ZT8A 4EUNA 1E2JA 2LXNA 4AZVA 4YROA 1P5JA 5AKIA 3KHSA 1KWGA 5KNCA 1MQ8B 1IYZA 2HDOA 1ZZGA 5A7GA 5HJ7A 2E4VA 1S3GA 3B78A 3THSA 5KNCD 4BATA 5CIYA 2FOXA 2EC5A 1SOMA 5AHRA 2RG1A 1JMYA 1XA3A 2QV7A 1A3CA 5ULLA 1DCTA 1SUBA 3D3WB 2B30A 2Z8YA 2VC2B 4REQA 1U3FA 2BLNA 3JAWB 5JWHA 1EHIA 2H9IA 5PNTA 1C50A 4B3DA 4CWAA 4QT0A 5K0CA 1PS0A 3DZFA 1VMEA 4K9RA 2F3SA 4GVPA 1N9GA 1NC3A 2HJGA 5IUJC 3ASUA 3GJQA 2OZEA 4CT4B 3NJRA 3Q1LA 1HTTA 2XB6A 3CB2A 4TTRA 3MCWA 4K1LA 4UBIA 2WD8A 4D74A 3IUMA 3L43A 1JW9B 1STOA 3QEJA 3ZQ6A 2A0WA 1LPSA 4C08A 2ZP1A 2A58A 2BUAA 1CF4A 3G2JA 1L2TA 4PYRA 3GLIA 2QZZA 2ZVDA 2ONKA 5AVRA 2F8TA 5K8LA 4WZBE 4DDMA 3I6ZA 2BKLA 3S3TA 4WUVA 4N54A 4YV2A 4FUTA 3U44B 2GK4A 1HKUA 2DFPA 3UJDA 3LE8A 1I4EB 4ESOA 1EK0A 4FGKA 3AOGA 2FLWA 2VPQA 2GBLC 3SHFA 2AJCA 4KO1S 3ZU3A 4A9AA 4DZZA 5AVTA 2P9TA 1W2HA 1YCHA 3G6WA 3OX2A 4FMBB 2OQRA 4ISCA 2EL7A 2JCBA 2I54A 3K1AB 3K5WA 4RQAA 4B43A 1Q1NA 5JATA 3GMSA 3DOOA 1OYWA 3ZE0B 2XD9A 4FM9A 4M36A 3C97A 2WHPB 3NV9A 4DLYA 2IK8A 3GD7A 4IHAA 4J0HA 1ZM7A 1DJNA 2K87A 1J23A 3CMCO 3DTVA 5HF6A 3I8SA 2WIKA 2PUTA 4G1MB 4BU1A 1HZZC 1NVAA 1V4BA 2ZUSA 4MUGA 1M1YE 3LA6A 4LSWA 4DWWA 4WADA 1NULA 3IBSA 3JATA 4LJ4A 3FRIA 4N7JA 3NBXX 4XEUA 1NF9A 1ZGGA 3HYRA 4DANA 5FTKA 1OUMA 4BOYA 3K9FC 3C3MA 1KI6B 2N9UA 4NAVA 4RH3A 4L16A 5FEMA 4M46A 4Q37A 4J43A 3WDMA 4DJTA 1ZN8A 1YS1X 3FHJA 3TZLA 4JBXA 1YQUA 2PVPA 3D43A 2WIBA 4KSCA 4QUJA 1VDMA 1XJ0A 2D1RA 4FLMA 3QVXA 2W2OA 4JROA 4OMUA 5C8ZA 3PPWA 3L0PA 2G06A 5D5PA 3NEPX 1NAHA 4IDPA 3KHTA 1T2VA 2WWRA 5EWLB 1GRCA 2A9PA 4ERXA 2R6ZA 3ECCA 4MV8A 5AKJA 1E5LA 3PFWO 1L3CA 3GLHA 2H0QA 3RYFA 4DLKA 4KPYA 3A27A 4R69A 2CV2A 1KY4A 2J09A 1WM1A 2QUKA 4IM7A 1IUOA 4EYGA 3B8HA 4AULA 1AJEA 2QGFA 3DYBA 3UXYA 1O6BA 1CUUA 5BV7A 4XWAA 1TZKA 5K9ZA 4L15A 4MK4A 2C42A 2P5TB 3SNHA 3FOBA 1LXCA 3B89A 4R2HA 3DZCA 2FSFA 1MC8A 3P9CA 5ES3A 1L1FA 4LCEA 3TVDA 3ESQA 4BNVA 1WBJB 1E1YA 4U63A 4CIAA 4NEQA 1V3QE 2W11A 5A7FA 1G42A 2DXIA 1XNRB 4BO4A 5BN3B 4BX0A 2JGIA 3D6JA 1KBOA 1VRCA 4FGUA 4FXPA 4Q9AA 1QQ6A 2I55A 3IXMA 3P0IA 3BMCA 3CZMA 1CSEE 1V71A 1T3TA 4NYIQ 4IDAA 4XA8A 1Z47A 5AXCA 1ZMBA 3E8XA 1M0WA 1WUIS 3AG5A 3EN0A 3G8BA 3MTBA 2J6CA 4XX0B 4BO7A 2RI1A 4L6CA 4C2AA 2VUSA 2VHWA 5C1PA 2QE7A 4KPGA 2VYCA 2GO7A 2VKQA 4EBBA 1DCMA 3HB7A 4RS3A 4Z0NA 5SV2A 1Z35A 1IK6A 2QE7D 3IQDB 3NIFB 5EHIA 1L5NA 3W6NA 2PZAA 2EWVA 3ZE7A 4DLLA 5CYGA 3N76A 1M6VA 5EIBD 3RUEA 3INGA 4F21A 2CHVA 1QF9A 4RTOA 4OB6A 1DQNA 1CDDA 2OAQ1 2IXGA 1X42A 3JVUA 4AJ2A 4TYYA 2IJGX 1SCDA 2ZI5A 4MVJE 1JXOA 3SXJA 3B1XA 1X1QA 2W8ZA 4LXTA 2FX3A 1RWOA 4EUHA 5A4MS 3ZWOA 3WICA 3OQBA 2YUTA 1VHDA 2VCYA 1NSYA 3E2IA 3PC3A 2JFXA 2WT8A 2QZ9A 1IWBB 4L7QA 4JA0A 1SPXA 1E9EA 1KEUA 3DAPA 4LVUA 2PGXA 1BE8A 1HQYE 4EG4A 1C30B 3O91A 1P9WA 5FAKA 2CE7A 2XRYA 2BFMA 4ZXFA 2J3HA 4NZOA 3I5MA 3ND8A 5FDFA 2QP9X 3DNFA 3CO5A 4EAAA 1AZLA 1E2HA 1JWBB 1V1MA 3F9IA 3SZRA 5AW3A 2E6UX 4CT5A 5C7YA 3VC7A 3IP9A 4YJ2B 4PFQA 1IPHA 4F91B 1TUBA 2ICAA 4QPNA 3WKBA 1U9YA 5F5XA 2GTPA 3M6IA 4XLZA 4PHFA 3VNBA 1A8PA 3PCTA 1FZTA 2JAQA 3G2QA 3JYPA 1Y4AE 3W79A 5GY7A 1OLSA 2GHIA 3RFUA 3HDJA 4ZRMA 4E4RA 4EITA 3HXMA 2PL9A 4A03A 1V5EA 4F2PA 2IP4A 2HA2A 5E2AA 2XA1A 1MJFA 2LD4A 1M8KA 4I5FA 5AI9A 3BFXA 3PDWA 3K2QA 3GDHA 2VF4X 3T61A 5HZKA 5JTUA 3F97A 4WOJA 1OWOA 1XXHE 2C2KA 1M8JA 2BPOA 1DEXA 2HZ7A 3OC6A 2WZCA 3OJWA 3QELB 2YJZA 1V3UA 4P3NA 1Y1LA 4O3FA 5KTYA 1MC1A 3BTVA 2X8AA 4Q7JB 4F2DA 5GIOE 1Z8HA 5I8PA 3PVZA 4YACA 1VFNA 4E7PA 3RVNA 2QN2A 4MLCA 3F6YA 4RAQA 3MCTA 4KYVA 4AU1A 4OOEA 2AI3A 3E6AA 2B4KA 2I2XB 3ZGNA 1X7GA 2Y99A 4D3FA 4XGKA 1KK1A 3CLUC 3LECA 2GJAA 4Y2RA 4O4IB 5IT4A 5IT9A 4DCPA 4H1UA 4E21A 1B6GA 1JAXA 4JL5A 4DQUA 4ZOQI 3FCOA 1AC5A 4QFDA 5KC8A 2BWJA 3MA0A 1TCAA 4U5XA 2Y4NA 4WCFA 5KYUB 4FGWA 2GDJA 2Z43A 1L5YA 1U6KA 3GCWA 4K9LA 3SYTA 3WGLA 5JFTA 2GJ9A 2RK6A 2WVJA 3O8BA 5LUAA 1NUSA 2ZYAA 2QVCA 1V8PA 3QKRA 1G55A 1U99A 4TZ6A 5D5QA 3ZW7A 1L3IA 1I32A 2F6RA 2PUJA 1ESCA 4IZHA 3KM0A 3T5BA 4MQLA 4MGEA 5DHUA 2P5YA 2ZGVA 2XXAB 2MYTA 4DMMA 4EY8A 2B1RA 5I7AA 2GNPA 4AIIA 1IJKA 2C4HA 1T6ZA 1CDOA 1J1ZA 2IDKA 3NGXA 1JNXX 3HEBA 2YYZA 1UJNA 5AVKA 1IBCA 1YGYA 3X2FA 3DQZA 3NAMA 3WGZA 2ZAIA 4EI9A 3LUGA 5DMXA 1L6RA 4JI0B 4DQKA 3CB4A 1VTKA 1UBUS 1YZKA 2EWWA 1M54A 4QTZA 1WMFA 1JKJB 4QZVA 4BXOA 2V7UA 2KMLA 3DEAA 1LNZA 2OYRA 1RXVA 5BN4B 2E2WA 2OCPA 1WG8A 2WT4A 5CAEA 3RNLA 1Y8RB 2IQIA 3QK7A 2JJ2A 2PAAA 4WRRA 5D86A 1JL3A 1MNAA 4F3NA 3S44A 2GPJA 3E7PA 1KRXA 2JJ2D 3ORYA 4R0MA 4PU0A 4PXYA 2WAXA 3KB6A 1PSDA 3K20A 3KD3A 1CJVC 1ZJYA 3MYYA 3SSOA 1QHXA 1N1GA 3GLGA 4YAIA 2UVQA 1Z7BA 2VKTA 3I9JA 5I5EA 4I9NA 3K5IA 5BWMA 1M2VA 5J4HA 4MCIA 4P4UA 5BSTA 3OQIB 1GOTA 2L0XA 4S2UA 2H1RA 4L28A 5EZYB 1J42A 5TQ2B 1D2CA 1ZQ9A 4J0GA 4IVQA 1U9JA 1WOMA 3TLEA 2H9AA 1CZKA 1G66A 1A50B 2C7VA 4LBVA 4TQGA 3WBKA 2OFPA 4E51A 2G71A 2W93A 4ENSA 5LKAA 3UCEA 2Q8QA 2YHIB 5D3KA 1XLWA 4Z3KA 3UHJA 3TIGA 3ENQA 3PWKA 2GN6A 2HSGA 5DISB 4HB0A 3PQ8A 4KAXA 1O54A 5E7QA 4DCUA 3NHMA 3H2IA 5IJ0A 1E9AA 1Q1GA 2QPAA 4DVGA 2GX6A 3IQWA 4CEIA 1QIJA 3IERA 4JBHA 3SF8B 3W8FA 4UREA 2K5UA 3T9CA 2BFBA 3PL1A 4OQ4A 421PA 1J2EA 3QU7A 1XVUA 1RJ9A 1LLUA 2Q6LA 2ZAOA 3OC0A 5H68A 2OCLA 3RUCA 1JEEA 3DMHA 2W8BA 4Z9BA 2C4TA 2J3IA 1POXA 4JQCA 4UASA 1E3JA 1QH8A 5IP5A 3OE1A 3CE9A 2BFCB 1I1NA 1ULHA 5AT1A 1I8TA 3A31A 4L5YA 1ISPA 4YJHA 3EGDB 4DNQA 3DS8A 3ESZA 4GOOD 3REQA 2I80A 4OXIA 4IHJA 3G7UA 3P20A 3PHJA 1LDYA 4U9IS 4Y6SA 4EQ6B 4DSNA 4X7MA 3EZ7A 3BA1A 4O2BB 2P40A 3EEQA 1IJBA 1EPUA 1REQA 3EGIA 1SOAA 4N8EA 3E3OA 1IAVA 3I1FA 4RY8A 2OWDA 5ARCA 4F0JA 1I51A 4IKOA 3ZH9B 1CX9B 4PQRA 3ZDBA 5AJXA 5IVIA 1KS9A 1L9XA 1N5OX 1XP8A 2VUTA 4ED9A 3Q8MA 2JJ1A 3QEOA 2ZRDA 4RKRA 3HGMA 5FTLA 4WINA 4NG4A 4JBNA 4KAAA 5CVCA 1JLHA 1FK8A 2CDBA 2QN8A 4GMKA 2IYTA 5LU8A 1OFGA 3R75A 3DE3X 1U3TA 3I72A 3DYIA 2FPLA 3S4YA 5KWVA 2V9CA 2Q6OA 2XQVA 4QBGB 2GLUA 2WSBA 2FFBA 5INTA 1GFIA 4G9EA 5CB4B 5HEKA 1KNQA 4G56A 4BPBA 3ED5A 3I12A 1JKIA 2PJUA 1YIOA 4TTTS 4UM8B 1CUVA 2O8DA 3K30A 1Z6XA 1MH1A 1AKRA 3BIFA 5J4KA 1OI7A 1CJTC 4X3CA 1RR6A 1RRGA 4B9EA 4KHPB 3BL5A 4B6PA 5FTJA 3NU1A 3C3XA 3SBEA 1QQAA 2QBYA 1QQTA 2BLLA 4CIXA 2AHRA 1GUYA 2CK3A 3EF1A 4A2WA 3O8QA 3GBVA 4ABTA 3KHUA 1P2VA 4LOHA 1K7XB 1O2DA 2A7XA 2DBRA 3OA0A 5AI8A 2CK3D 3A6EA 3OJ0A 4U4AA 3Q1KA 3SEAA 4RHFA 4DAOA 1IRIA 4ZI7B 4TVOA 5ELMA 4MR9B 3TDMA 4ZJUA 4LDJA 4Q3NA 4M1WA 1UFRA 5I7VA 1DBWA 3I9OA 1DWPA 3PUXA 5LDGA 4F71A 3VJRA 1DRUA 1L7EA 1AA6A 1DKRA 1U2DC 4WDRA 3CRZA 5KTRA 3USES 5K3CA 3CJQA 4NVRA 5BPFA 3LKZA 3PFFA 1MUUA 4GI7A 2NPIA 4OV6B 2OCBA 1F12A 1E9SA 2J7PA 3VR6H 1LBQA 3DDHA 2JW5A 2H65A 3RHSA 3IUJA 3KPUA 1O87A 1DKUA 2J7PD 1CUWA 3DAYA 2XMZA 4CQMB 2AMVA 1VPLA 1KYVA 3T52A 3GPBA 3WRYC 1DX4A 4EG7A 4KPEC 4PC6A 3MPUA 4NOJA 4R2JA 1PFGA 2SICE 1ZJJA 3PIDA 1JHYA 4OATA 1E99A 2J7KA 4Y9UA 4X6LA 1U1EA 2A9OA 2OM2A 4YJ3A 5T5QA 1Z62A 3I0ZA 3EOAI 3RGWS 3TRHA 7YASA 3CZ4A 2AFIA 6AT1A 4JT4A 3VH3A 2CF6A 3BUSA 3TBFA 2V74B 4C06A 1GZ4A 1EXNA 1BCRA 3SZMA 4U7PB 4JHXA 4XSHA 4IIVA 1R9GA 2IW3A 2AOTB 3TINA 4MCJA 1TE2A 4XQCA 2XUKA 2FVYA 3O2JA 3T6KA 1JWLA 1F2UB 4ZPXA 1RXIA 4JBIA 3GHHA 4CHGA 4Q4HA 3KJGA 5FBVB 1YR8A 2MSWA 5LWHA 1CQPA 3KZVA 4R81A 1OZFA 2HRRA 4Z51A 3RYTC 1IG0A 1PE0A 2X77A 3G2HA 4BBJA 1EFCA 4RU1A 2I6TA 3LUDA 4JLOA 4RD0A 3K8ZA 4ATNA 1LPOA 5FP0A 1KQ3A 3BD6A 1MV8A 2VHUA 3BRSA 1GILA 4FTWA 2VWPA 2AFHA 1E1QA 5CT5A 2A67A 4DOMA 3K70D 4WSOA 4D4LA 4PHTA 1M10A 3ZTTA 1E1QD 5IYZB 1P45A 3E9ZA 5FWYA 2HHAA 2P1RA 3QG5A 3JASB 4BGIA 4RULA 3WFIA 1QIIA 5HGXA 4G5RA 1OPXA 1NJGA 1UM9B 3TNYA 2QQ0A 1SCQA 2JL1A 1FYXA 2WJIA 2FETA 4MEBA 4QHSA 5DH9A 3KOXA 1KJYA 5FPQA 1KNXA 2A4KA 4HXEB 5KVAA 2O19A 1IQ0A 3U61B 2C98A 3L02A 2OXTA 1IXKA 2ECPA 4V39A 3STTA 4BJ5A 5KQLA 4FE3A 2O5VA 4B3IA 5KSPA 2PY6A 3FYUB 1HNZB 2ZJBA 3AF0A 3HO1A 2MYUA 4ENWA 1MHTA 1WUKS 5TQ0A 4BAUA 4LHEA 4N7BA 3RF7A 1IU9A 2A92A 2D8MA 4GZ5A 1UAGA 3TQSA 1M0SA 2H57A 4I1PA 1Q1BA 2XPCA 1QKKA 3WR5A 2UZ1A 3PUKA 5D1HA 2XVZA 2BKAA 1N5KA 1HLDA 2NUTB 3RWOA 3UQYS 3H5OA 1PEDA 1P7PA 1TVKB 3SLGA 4ZVVA 4IDNA 1H6DA 1PVVA 3BAFA 3CLRC 3HJUA 2ZBVA 3AEZA 1BE0A 3MRVA 4QGHA 1P9RA 3REOA 2PV0A 4R1UA 3ULKA 1SZJG 3PSHA 3AY6A 4F3TA 2C4KA 5H81A 3HJAA 1YK0A 2HGSA 4MVJG 4BZZA 2QNIA 4AM8A 2YJ4A 3AP2A 1KI4A 1RRMA 2BDTA 3LFTA 2B94A 4RQUA 1RXEA 4PG6A 5DBGA 4LYGA 1DAOA 1W34A 3QV2A 5IJ9B 1A2BA 3Q9LA 2CUKA 1QFJA 3NZEA 4ML3A 5CK5A 2UVDA 4AO6A 3LL4A 4BNIA 1K6XA 2YJGA 1Y1SA 3IKVA 3JVIA 1DXHA 2CLLB 1TTHA 3EFHA 4R3UC 5LXTF 3I83A 3VVMA 1RXUA 1TUGA 4CPDA 1I2CA 2JANA 2K7ZA 3IC5A 2JIBA 4DM4A 5KWJA 3ZE6A 2C00A 5L3QB 3T1HB 3IR5A 1PBNA 2G1JA 3CJTA 3GRRA 3PUYA 3Q3EA 4UJ5A 2B8EA 3D4BA 3IT0A 4HNAA 1MZPA 2FXVA 1CQIB 3IRVA 3C6KA 3RVOA 4D8TA 3I28A 1U8CB 4GOKA 4HH1A 4LVCA 1NQAO 3CIFA 4Y67A 1V39A 1IOVA 3MAAC 1XNHA 4JXXA 3PV0A 2WJAA 1EFRA 5GONA 3BFKA 4KUGA 4X91A 1H9BA 1UKZA 2NYUA 1EFRD 4HUJA 4JCOA 1Y5LA 5TPZA 3PYXA 5L9AA 4II3A 4E5DA 3N87A 1WOYA 3D2LA 5TPZD 4Q1CA 2J41A 3KZOA 1FTWA 3NKFA 1KYQA 4QSMA 4RVOA 3RFFA 4I7EA 5BNZA 4ZKEA 1KIFA 1WHSB 3F7NA 3FDZA 4RGBA 4YAJA 1GQ2A 1J20A 1QMPA 2FDCA 4AZTA 3MT8A 2QTHA 3REFA 4Z7NB 3WO1A 5G4KB 5ICEA 4N8SA 1R0RE 2O3SA 3IAS1 1XCMA 2FA9A 4C0HA 3SE7A 3NBYC 4JR2A 3ROPA 4FMDB 2C2WA 2GTIA 1YJ8A 2V4MA 2ZRCA 1GT91 1IQUA 1QFZA 1AKQA 1F4VA 2BEVB 4BMXA 1KGSA 3EWIA 3ICOA 2Z56A 2GGSA 3OHSX 4D0RA 1MA3A 3C3YA 4TSFA 2XZLA 3CN7A 3H11A 4HWKA 3V4OA 1MJHA 2C9CA 2QXTA 3TSOA 4TV9B 2H2DA 2CMDA 3FLAA 4WT7A 4TSFD 4CUZA 3VNSA 1JYSA 3WYBA 4OJQA 3QGMA 1MEEA 3L7LA 3NNSA 1B16A 1MVOA 2J67A 4P92A 3GJYA 1ONSA 2CLDX 4XXHA 2W43A 2C0QA 2VZ0A 3ZUPA 3K5HA 1U1IA 3KYDA 3PFGA 4EECA 1EE9A 4G09A 3QUTA 3DZGA 3TECE 2LVBA 4BMSA 4MICA 4XIFA 1IBRA 1LTQA 2FK8A 3UEOA 2G28A 4E14A 1P8JA 2RGCA 1T6YA 5A5FA 3FNIA 2MINB 2DJ5A 1L7XA 2IX9A 3BXEA 4P35A 4ROTA 3ZY4A 2H5IA 1E2MA 4XYBA 2R00C 3ESAA 4O08A 5G41A 1T8WA 1K0FA 5KMGB 1E4YA 2VEDA 2E55A 3PFKA 2ZQZA 4Q1FA 1B1AA 2JIZA 3GEHA 1N0VC 1LX6A 1XTRA 3MVEA 4M4SA 1L7RA 2FZ5A 1IEVA 4BKMA 4BVAA 2O8FA 3EXHB 2ZRFA 4ZIRB 1A2KC 2JIZD 2KB0A 4FU0A 5JO0A 3JZMA 4BLTA 1T8TA 3ZI7A 1K2WA 1VLZA 3ZCXA 2UYGA 5ALDA 3NOQA 4BMVA 1DQZA 1QC5A 2XUQA 3F9RA 4H3VA 4QAJA 4BQEA 2QUHA 4EFNA 9ATCA 4KLZA 2P4QA 1P6QA 5EMJA 3RAPR 4J0JA 2LKCA 4L1KA 4FHCA 1MVNA 4MS1A 4BNXA 2XQIA 4MIYA 3A9VA 4RV9A 4QU8A 5CPBA 4CDRA 2XE4A 2C7OA 1BVRA 4UHKA 2IPOA 4RZIA 1YR1A 4DA6A 4CMIB 2JGDA 4N3NA 3CNEA 1RE0A 4X95A 2Z8ZA 4CTKA 4PTZA 3KBBA 2UZ3A 3IHTA 3SBXA 2R86A 2QT1A 2YMMA 4Q16A 3SIPA 4DIDA 2FG6C 2FRXA 3PB3A 4Y1RA 3WWPA 5L40A 3F73A 3FDXA 3EGCA 3DOUA 2VJLA 2DE0X 4HXGA 2BKUA 3GNQA 3GDWA 4DEXA 1YR2A 4GKKB 3LQQA 4ZV4A 5AW4A 4BGEA 3DB1A 2XCUA 1UOOA 1TK9A 2BBSA 3I2KA 4NWIA 4DF3A 5KWEA 3JVVA 3TNJA 2FP4A 1T24A 1RYBA 2ORWA 1L4LA 1ZAKA 4FB5A 4BX2A 4FDVA 4X64B 1ZR2A 1RXWA 1G9SA 1MH9A 1NT2A 3SXPA 3SDSA 3T15A 3G2MA 3W5BA 5H59A 4JB3A 1FU4A 4GR5A 4INAA 4YRKA 2O8EA 1D3AA 3NDJA 1BD4A 2YY5A 3S2ZA 5EEGA 4JVOA 4R54A 1TX4B 2VYVA 3IT2A 2VPWA 3KSRA 1G5PA 3SIXA 2ZRHA 3AG6A 2PD6A 2VYVD 4DM7A 2VF8A 2DBZA 3MMXA 4KU4A 1MJGA 3OF2A 3BGWA 1AX9A 2JLRA 5F7ZA 3PUHA 2RGYA 3SI7A 5IM4A 2QE6A 3MPOA 1Z7WA 3K71B 2GJ4A 1EDEA 3FGNA 5EVJA 3UKDA 1NJ2A 1UMKA 1DPGA 2BMVA 3KT8A 4EKYA 2BEJA 2NU8B 1HK7A 3BT7A 2Q9BA 4NCJA 3ZLBA 5A9TA 1RWWA 2O7NA 3I0MA 1LV7A 1K7FB 2COEA 4Z53A 4HDMB 1U6IA 3ILHA 5DNAA 4P3PA 4X6UA 4NBSA 1AQJA 5LQSA 2X40A 4KKVA 4ND8A 2OBBA 2WLSA 1JKJA 4Q9IA 2CFSA 4Z1MA 3F6PA 3W1EA 1GSIA 1Y1RA 2JC3A 3A58B 1E32A 2ODNA 5AK6A 1RI2A 1ZJ6A 1J7KA 4P4SA 4QUGA 3KQHA 1AGPA 5DM1A 4BRWA 1EBFA 1I7QB 3THWB 1UDRA 1XEFA 4CL3A 1NQXA 1U1DA 3UUGA 1DQPA 1M5TA 3SOZA 3QWHA 4H4DA 3E9MA 4Q3OA 2F9FA 1LWOA 3LLUA 5KHOC 2XBMA 4TWBA 3H4MA 1QG6A 2O8BA 3V7NA 4EJ6A 1AV7A 1GN8A 1OIVA 1R8JA 3HDQA 1F7UA 1JSRA 2I6XA 4I4IA 3LLVA 2JA1A 3A1SA 4ZVSA 1HR0B 3BFJA 5ALVA 2ZAMA 2VDPB 1YTUA 4XFJA 3D5QA 3HBFA 1UJBA 4BLOA 4QUBA 1ZOPA 4HDKA 1U3UA 4IS2A 1WHTA 4KR6A 1WKBA 2O7SA 1K5PA 2QTBA 4NXNB 2CJWA 3TFWA 5LZ9A 1KQPA 5AM3A 2AG0A 1C5KA 1YNSA 2X0IA 5F5LA 3E9YA 3X1ZA 3GJ7A 1MOZA 3ORFA 3TLAA 3U7IA 2WHEA 2XNKA 2ZTVA 4HRVA 3S1SA 1SQSA 3O21A 4JLSA 3WY9A 3ENWA 4LJ7A 4Q6BA 1V47A 1QXSA 2QTGA 4QBKA 2IUTA 5JCOC 3M0EA 4AS1A 1U3GA 5EP2A 3VUEA 2CNKA 4PC7A 1G4UR 5DOZA 4URFA 3I64A 1ICIA 3L5KA 3JQQA 2WZBA 3T4PA 2H1OA 2WA2A 3E4DA 4QTXA 1KAHA 3TMAA 3WJAA 5CG1A 3V8NA 1UJ4A 2D5AA 2JI6A 2BR4A 1H9CA 1VA5A 3CMMA 3OTOB 3U48A 4EVIA 4MUEA 4UOZA 4MYSA 1RMYA 1CLUA 4F3KA 1V6AA 5IRCD 3THYB 1GNLA 1R4ZA 5E1DA 2OV8A 2QAGA 4GZ3A 5CVJA 2R66A 1NQVA 3DEJA 3PC7A 2ZM5A 4YCSA 2IX3A 1OWLA 2QJOA 3RPEA 2G1PA 3L06A 2HCRA 3PC2A 2H1LA 4U6QA 4DJFC 3GDFA 3NBUA 4YP5A 4PVDA 1VKNA 2A94A 3Q8WA 3VKGA 1LNQA 1OLUB 2XI4A 4AQYB 1Z56C 1TC1A 4V2IA 3FCYA 2FQXA 2QVBA 3IGFA 1NMZA 4M9RA 3CFYA 1I2DA 3WX0A 1GTG1 4W82A 4RESA 3A9CA 3SC3A 1VJRA 3T7TA 4L0MA 4J2TA 3L8YA 2JKZA 3WHKA 4L5IA 1JR3E 1FW8A 2FN8A 5FCDA 3Q7PA 2IEIA 1L7MA 3VTAA 2B7BA 2ZJ5A 2XXBA 2C96A 5KJCA 2FW0A 4GXNA 2A1UB 2Q6VA 2QB5A 4EYSA 5KOHA 3TW4A 2VTBB 4E09A 2SBTA 2HPVA 1J21A 4PHCA 3ZLVA 4XGIA 1ABBA 3TSCA 2BH9A 3CH5A 3WWCA 5I01A 3WG9A 1OC2A 1F1BA 1OYOA 4NJEB 5DFAA 5EZSA 2PWBA 1ZBQA 1ZGBA 2HJWA 1PJZA 3LPDA 4IOJA 4BNKA 5DLYA 3DT9A 1CEEA 3AQ4A 3GRPA 3GJ8A 2JIRA 3QOXA 2B25A 1O94A 2X4DA 3FH0A 4YAFA 3WRWA 3FX2A 4DJ5X 1O94D 1SAYA 1PNVA 2QLLA 2WMOB 3FIJA 1GR1A 3UAZA 3K32A 3K9BA 5ITZA 1D4FA 1TQHA 2JD1A 4MW2A 3NT2A 4OHPA 16PKA 1S8AA 1WNTA 3LCUA 4IJKA 1T6NA 1T3GA 2G5CA 4KPUB 1U0TA 5CXUA 1NP3A 4JJIA 4M0UA 3PT5A 1N2CA 2DWUA 3VVLA 1OH7A 3SGLA 5ABPA 2RGDA 3OEWA 2H63A 3EX7C 3Q7EA 1YJ5A 2MSCB 4JJGA 2GZMA 2XYHA 3ETHA 3M3PA 1XELA 1CY4A 2ID9A 2NSHA 3AHCA 3BSYA 3KPVA 3PWSA 1DUIA 1ECJA 1ZMRA 3MLBA 4PGHA 1N3BA 2WNHA 1LJUA 1PJRA 1T36B 3LU1A 3ED1A 1ML4A 1PJ4A 3BULA 3ZHXA 1B15A 3BXOA 1KDYA 4BVEA 1UOEA 5E6SA 3BWCA 4QOFA 4RQTA 1QVWA 2IXDA 4JH0A 4G86A 3AWIA 4CQMA 5G4LA 2RDMA 3STWA 3KKMA 5DVZA 4CFSA 1JTVA 4CQMD 1IJEA 1U11A 4AD8A 3O8LA 3BMXA 2BJVA 2PUGA 3SMQA 4OK5A 1YRBA 2DQYA 4FK8A 1VP9A 4H08A 4LTDA 2XNDA 4BNYA 8OHMA 5JNWA 2MMCA 1SU8A 3GROA 3RUHA 2XNDD 1E2EA 4H35A 3U7FB 3UJCA 2HF7A 3B2QA 3KQKA 4D7AA 3MJEA 2ESRA 4PLFA 3ZZ1A 4PO8A 3GD5A 4XOIA 5I4KA 3VPBA 4TWJA 3Q41A 1HI9A 3NVMB 1QIGA 2PSEA 1XTJA 2FPPB 1NJ6A 3MJVA 3EZNA 4B44A 3P9KA 2V98A 4JELA 4MA0A 1MC5A 1UKBA 4G8JA 3L0ZA 3EZXA 3FLBA 4URXR 4S1VA 1SUFA 3QW2A 3RLIA 4B80A 1HMYA 1DJLA 2I03A 3IVGA 4MV7A 1GO2A 5BSKA 1LRJA 3W2FA 1ZNXA 2HK9A 2G8LA 3EXFB 3FE2A 4RF3A 1SVUA 4YJ2F 3ZD8A 2D7DA 1AUOA 1YAJA 4J3NA 1OPRA 4B9AA 4CCWA 2TMKA 3R44A 2G09A 4L0CA 5CXXA 4KE8A 4Y9DA 1NHWA 3JASA 5JXIA 3O3MB 3TRDA 1DJQA 3DHNA 3OT1B 3FSRA 3Q7IA 4E6PA 2V7WA 1Z17A 3W04A 3OKPA 2GCEA 2NVOA 4YJFB 1G6KA 4P84A 2BR3A 3EQ6A 1ZLYA 2FOLA 2P6MA 2VDRB 2V7EA 3P9RA 2GPBA 2FVXA 1DWUA 3AR8A 4N3GA 1PJSA 3BC1A 2R7NA 4MJXA 5DSXA 1PN3A 4BMYA 4LRWA 1G2QA 1SXJB 4FJ0A 3GWGA 2NOAA 3INNA 3IP3A 3Q6NA 3NIGB 2QYTA 4M9QA 5DTMA 4L95C 4TS9A 1R3DA 5E6UA 4WZAB 1H66A 3KXPA 4RVNA 1Y37A 4ZPJA 4ZANA 3NM4A 1DAEA 1R6DA 1YULA 4LPKA 3MWJA 3W7BA 4D9MA 3GT3A 5ENVA 4BFCA 3OVMA 3ZLJA 3AB7A 4BRUA 1ZGZA 3B3JA 4FINA 3ABZA 4Y1EA 4RSRA 1RC8A 3H2HA 4XDYA 4BX8A 4YLEA 5BO5A 1TA9A 3QQ5A 2F43B 4DS3A 1UR5A 3HVUA 4G07A 5H9WA 5LWQA 4JQOA 3R5XA 3ADKA 4FYHA 4HNHA 4UUQA 4EGAA 4F6CA 3IAFA 3OWOA 5HKOA 3H1FA 1ZKMA 3LQKA 2PHZA 1DC8A 4RK7A 4NL4H 4QVGA 4ARSA 2R6HA 3PQCA 3MFQA 2Q0XA 2I76A 3SG0A 4YRIA 1WZCA 1MFZA 1SKQA 3OEEA 1O3YA 2LR0A 4I55B 2IGBA 5K8UA 3UAVA 4W5QA 4XE5A 5L3SA 1JDJA 1RRCA 3OEED 1P2FA 1Q0UA 1KJ8A 1K27A 1M8GA 4IGKA 4OXKA 3WYNA 1Y6FA 5K8CA 2GRJA 5JPIA 2EOAA 4IXDA 3QEBZ 1K8XB 3TLYA 3SFTA 1JB9A 5F3WB 1LK5A 1T91A 2DBQA 2HXGA 4GWKA 3DOHA 3H2BA 4FFPA 1IPEA 1RQLA 3K0EA 3T8YA 3ANYB 2M9MA 3AXTA 2VJBA 2C04A 3OSUA 5AKYA 1RDFA 1G9XA 1CERA 4I14A 4YRZA 1G5TA 4DQLA 2V6BA 3EXEB 3KTFA 4RD1A 4BEBA 1G21A 2II6A 4ZRDA 4CBVA 1FFSA 2I4MA 1US8A 1J0AA 4UHEA 1DAHA 2AOUB 4EKEA 2JGFA 3AHJA 3WK5A 3PC4A 2HV8A 5EZYF 3TW6A 4RJKA 4X3PA 4ZCRA 2R6R1 5EMHA 2E48A 1FYDA 2FY8A 1RZVA 1N57A 3Q5EA 4FSDA 5CYFA 3ILYA 3A9WA 5D6OA 4A5SA 3V34A 2X2EA 4XDZA 4XM0A 3ZU4A 4DUPA 3WI7A 1ZGAA 1C4XA 1YRQA 5G4KA 2L17A 3K0CC 1FPQA 3EZYA 1C4OA 1C41A 4P3XA 5HJEA 3IMFA 3KAKA 1RFLA 4A8JA 1KVRA 2H2IA 3O73A 3WIDA 1TRKA 4JYCA 1QGUA 3D8RA 3D6TB 3H2JA 3CVWA 1DI0A 1GQFA 2IRWA 1NM5C 2WE7A 1RMTA 1TQ6A 1MDBA 1SBNE 4BJ1A 5B7GA 1F0KA 1K7YA 3AVOA 3K9NA 4FILA 3WLFA 2ZSDA 3HSYA 5CIQA 2W6CX 1MF7A