1NS3A

Structure of hcv protease (bk strain)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
178
structure length
178
Chain Sequence
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NS3 PROTEASE
publication title Complex of NS3 protease and NS4A peptide of BK strain hepatitis C virus: a 2.2 A resolution structure in a hexagonal crystal form.
pubmed rcsb
source organism Hepatitis c virus
molecule tags Complex (hydrolase/peptide)
total genus 37
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1ns3A02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1ns3A01
1V2MT 4CRBA 3ZZ8A 1QHRB 3S69A 1Z8GA 1GBCA 3LJJA 1PPEE 4ABGA 1BRBE 3M35A 4MQAA 1AY6H 3TIUA 2O8TA 2G00A 3EA8A 1ACBE 3MU8A 1ZTLA 2ZIQH 1J16A 1GBFA 4DURA 1O2VA 4MPWA 5SGAE 2J95A 3BEUA 1ELEE 1K1IA 2BY7X 3M7UA 1M9UA 1O3JA 1GI2A 3RMMH 3E16B 1N1LA 4WMEA 2Y82A 3EAJA 3P8NA 1DWEH 2OQ5A 1KLIH 4MVNA 3RMLH 5HMAA 2A0QB 1HLTH 2PKSC 3PMBB 1D3PB 1ABJH 1TE0A 2AMQA 4F4OC 1MTNB 3TGIE 2H6MA 2JH0D 1O3PB 1CT2E 2BOKA 1EPTB 1C2HA 5C2ZA 4TPIZ 2BD8A 2FEQH 4I7YH 1GMDG 2Y7XA 1RIWC 1V2NT 3A81A 1D3TB 3GYMA 1MQ6A 3OY5U 3GY6A 3EDXB 1BTZA 4ZKSU 1G32B 1Z1JA 1C1MA 1ZJKA 2FTMA 5IYTA 1A7SA 4I8JA 3U98H 3SJKA 2TPIZ 3BG4C 1YPJH 1O38A 6CHAB 1C2DA 2ZDVH 1SMFE 3M3SA 5JBAS 1T8NA 3P95A 5LPEA 4NA7A 4ZH8A 4D7FA 2YNAA 3M5LA 3BTTE 2G8TA 1NROH 5G4BA 3KIDU 3ZYEA 2OXSA 4VGCC 2BDGA 3CS0A 2PW8H 4B2AA 7LPRA 2UWOA 1TLDA 2ZHDA 3UY9A 2RA3A 3C27B 3P8GA 2VWNA 1QIXB 3CS7A 1A0HB 1KXFA 3BTHE 1EX3A 1UHBB 3ZZDA 2GD4B 3OTJE 3A8CA 1KXCA 4Y10E 5A8YA 1JOUB 1PQ8A 2ZHWH 2Z9IA 1QL7A 2ZG0H 3P8OA 2XXLA 3VB4A 1K22H 1OYTH 2NU3E 2Y5FA 4NFEA 3O8RA 1IQHA 1O2JA 5JBTA 4TY6A 5PTPA 2C93B 2A31A 2ZTZA 3A83A 3MTYA 5F03A 3JZ1B 5L30H 1GBEA 1O3BA 2A2QH 4AZ2B 3RMOH 2ANWA 2QV1A 1QQ4A 2OQUA 4BAQB 1IQJA 1O3MA 4ISNA 2FOFA 5ETXA 1T4UH 1RTFB 3DD2H 2GV6A 1P2KA 2Z9LA 5FX5A 3E8LA 5A0CA 2NU2E 1JRTA 5A2MH 1O34A 2BLVA 1O2HA 2J92A 4WMDA 2XW9A 1J17T 5E2PA 1EQ9A 1V2ST 1ZOMA 5GPIB 4B6EA 2QF0A 3KEEA 4TWWA 1Q3XA 4A1XA 1XXFA 2F9VA 1RD3B 1RTKA 1J9CH 4A7IB 1MKWH 3KQBA 3GY3A 5JPMH 3KCGH 3BTQE 1BJUA 4JZEH 1IQNA 1C2JA 1QBOA 4HZHA 1EZQA 4YZUA 4K3JA 4KTCA 3RU4E 1G3CA 1O35A 1ELCA 2CXVA 3ATWA 4WWYA 1LQEA 1EPTA 3K2UA 3M37A 3IWMA 4XOJA 3MU1A 1GL1A 4IC6A 4Y8XA 2XBWA 5FPYA 5LPFA 5EGMA 1FIWA 3GDUA 1TMTH 3VB5A 1FXYA 3ZZ5A 1O30A 1GVLA 1L1JA 3TK5A 4WXVA 4BAKB 1K1LA 1OWIA 3D65E 1OP2A 3RP2A 2IN2A 2SGQE 1V2RT 1P2NA 1Y3UA 2B7DH 2SNWA 4BTTB 2ULLA 3BG4B 1O36A 1YP9A 4B71A 1DXWA 2BY9X 1O5EH 1TX8A 4BNRA 1H9HE 3Q3YA 4UFFH 5EXLA 4RKOB 3WY8A 1BMNH 1KXBA 1UK3A 2RDLA 2F83A 2QXHA 3UOPA 1ZZZA 4MNWA 2FM2A 2BDYA 1P04A 5FPTA 3PMJA 1V2TT 1H8DH 1F5LA 1YLCA 1UHBA 3FP6E 1SGPE 1HB0B 3TK9A 1G9IE 1TMUH 1Z7KA 1CO7E 2GKVE 4AG2A 1H4WA 1GI6A 4ZMAH 3LC5A 1XVOA 2G51A 3LGIA 3TJOA 5DKMA 1QTFA 3N7OA 1EKBB 4I8GA 2F4LA 2ZGXH 3VGCB 1WXRA 4XBDA 1EJMA 1ESAA 2BHGA 3ATIA 1DITH 2QC2A 1DUEA 3FAOA 2P8OB 1F5KU 4WMFA 2BDCA 2QIQA 3PMAB 2H5CA 3RXBA 1GMDF 1VR1H 1SGQE 4GHQA 2EA3A 4LZ4B 3GYLB 2VIPA 5EXMA 1Y5UT 2C8WB 1P3CA 4X2WA 1UTJA 1NO9H 1SFIA 2PGQB 1AE5A 3ITIA 2PKAA 3V12A 2BQWB 1Q2WA 4R8TB 4OS5A 3FZZA 1BRUP 2GMTC 2FWWA 4H42U 2Y6TA 3Q3XA 4UD9H 5H4IB 4GSOA 3ZVEA 2ANKH 2PFEA 3LGTA 4CRGA 2J34A 1NS3A 4J2YB 2V3OH 3ZYDA 2H1UA 5FAHA 2I6QA 3JZ2B 1OWDA 1UTQA 3QX5H 3SI4H 4ISLA 3MU5A 1CQQA 1GI9B 2QXIA 1TYNA 4AYVB 5HM2A 4OM9A 3I78A 1LQDB 1E38B 2SFAA 4Q7ZA 4DT7B 2Q6DA 1K1NA 1P2OA 4FU7A 2ASUB 2VWMA 5GDSH 1FY4A 1HAZB 1VGCB 2O8WA 1SGFA 1O5BB 3U8RH 2XC0A 1CGHA 1C2LA 2ZGCA 3PLKA 2ZCLP 3HGNA 2NU1E 1NTPA 2PUQH 3OU0A 1AB9B 1HDTH 3Q76A 1F0UA 4XBBA 1ARBA 3A8BA 2QXJA 1NFXA 3KNXA 4CRDA 3A7VA 1FONA 2FOHA 1V2PT 1QFKH 4FU9A 3RC6A 1TGSZ 1EAWA 2ZFFH 1DWDH 1YPKH 4KKDA 1TX7A 2ZPQA 2BB4A 4H4FA 1UVOA 3D49H 4F49A 3SNDA 1GBLA 5EOKA 1GBBA 3UNSA 3MHWU 4RKJB 2XWAA 1HAVB 3BSQA 1T31A 3H5CB 1HAXB 1ELTA 1P2MA 3GCHC 3SUGA 1ANEA 1CA0C 1A3EH 3ENSB 1SLUB 1C5PA 1IQLA 1D6WA 2AEIH 1DWCH 1ZLRA 1ESTA 5AFZH 3H7OA 2GCTC 1BOQA 2GCHG 1TA6A 1HJ9A 1ZSJA 1T8MA 3P8FA 2D26C 3TH2H 5A0AE 2XBVA 1RXPA 4X1RU 2VH6A 2ZECA 4U30A 3FP7E 4ABEA 3T27A 4DG4A 1GJ5H 3KN2A 1HJ8A 5FBIA 7GCHG 2SGFE 3BTDE 1WAYB 1YC0A 4CR5A 5IDKA 2ZU1A 1HGTH 1XKAC 1A2CH 1EZUC 1QB9A 1IHSH 3ZV8A 3BN9A 3U8TH 4O97A 4ISIH 4DOQA 1FY8E 3GDVA 1FZZA 1L4ZA 1GGDB 1L1GA 5FCKA 1EASA 2PGBB 4XFQA 4ABHA 2HNTF 1TALA 2SGEE 5EG4A 4BAMB 1Y3VA 2PSXA 1O2XA 1L1NA 1O3FA 4DIIH 1GI7B 1LCYA 1C9TA 2TGTA 3LONA 1UO6A 3HKIB 1GBMA 1C1TA 1QJ1B 5E8EH 1ZSKA 1RJXB 3MH7A 2J2UA 1NZQH 4Q80A 1KDQA 4B1TA 1VZQH 4NGAH 1XVMA 1IOEA 3F9GA 1HAHH 1VITH 3PTBA 4FU8A 3AASA 2O8UA 2AGEX 3TH3H 1SHHB 4AOQA 4D9RA 2A7CA 2PTNA 2Z6BD 1MD8A 2VB0A 3SW2B 3FANA 1FY3A 2OK5A 2ZA5A 3A7XA 2A5IA 4MPVA 4E7RG 2JKHA 4X8VH 3GY5A 2HVXA 3SV8A 2TGDA 1Y59T 1AI8H 1Z8RA 2R3YA 1YCPK 3O8BA 4CH8B 3MNCA 1RFNA 1TMBH 3RXSA 3SU3A 2Z3DA 3LGUA 1Z71A 2G81E 4CBOA 3SJIA 4FUFA 1MAYA 1MTNC 3FFGA 4TYDA 2IPHA 3MWIU 3SNAA 3F9FA 2FTLE 2F9NA 1P10A 1W7GH 3RXGA 1V2LT 1AHTH 1W8BH 1T4VH 2P93A 1MAXA 1P12E 1ZHPA 5A0BA 2HGTH 1E0FD 2ZTXA 4E05H 1G30B 1PYTC 1AZZA 3E91A 2WV9A 1C2IA 1TABE 1UTLM 1C5LH 1K28D 4YT7H 1YPHC 4XSKU 2DE9A 1LVOA 4A1VA 1VCQA 3GCHB 3V0XA 1O2ZA 1CA0B 1AMHA 4HTCH 2H9EH 6CHAC 2EI6A 2XBXA 1O3EA 4FVDA 1QBNA 2GCTB 3FP8E 4I32A 2OUAA 4MPXA 2ZFRH 1C5NH 1W13U 3AW1A 1S81A 2TGAA 3RXMA 3LKWA 1AO5A 1MBMA 4WJG2 1TBQH 1DSUA 1SPJA 4JK6A 1SQTA 1N6YA 1SQAA 4YOGA 1DXPA 1AWHB 3A86A 2BLWA 1QJ7B 3ZVAA 3SHAH 1DLKB 4X8TH 2VJ1A 1HAPH 5HM9A 1V2WT 3M3TA 4NCYA 1ETSH 2A7JA 2ZU5A 4INHA 4X1QU 3LDXH 1P2JA 1QRXA 1BMAA 1UVSH 4ZKOU 4KTSA 7ESTE 2FOGA 2FOEA 4NSVA 4H6SB 1E36B 2EEKA 2FS8A 2VIDA 3A84A 3L33A 1BJVA 1RTLA 2AERH 3HPTB 1TQ7B 4YLQH 3ZVFA 1GJ9B 4OS6A 3SQHE 3STIA 1DSTA 1MCTA 1F0SA 2WPMS 3OYPA 3W95A 2XRCA 1FQ3A 4MPUA 4THNH 1O3AA 1C5QA 1TBZH 2V3HH 2GT7A 4NZLA 1P9UA 1TX6A 1PFXC 1HXFH 4K2YA 2VVCA 1BT7A 2IJD1 3RLYH 1A3BH 1K1MA 4CBNA 1AUJA 3ZVBA 1F0TA 2AS9A 2ZGHA 1UTNA 1BBRK 1K1OA 4Q7YA 1GBTA 4JZDH 1C5VA 4ZAEA 3E90B 2FO9A 1NY22 1ELVA 3F1SB 1TRMA 3HKJB 2VGCC 2HNTC 2OP9A 1QB1A 1TFXA 5ESTE 3EYDA 3RUOA 1C5SA 1O5GH 1KLJH 2FZZA 2ZFQH 3M7QA 4WVPE 2GCHF 1O3DA 1GI1A 2TBSA 2A4RA 4AYYB 2FX4A 1TNJA 1DLEA 4Y11E 4OS7A 4X6NA 1B0EA 2H9TH 1ORFA 2GZ7A 1F2SE 3TNTA 1GPZA 1MKWK 1P9SA 2C8YB 1AGJA 2ZDMA 3T29A 7GCHF 1EP6A 1O2IA 1A1RA 1GJ7B 3E0NB 3RMNH 3SOSA 5JBCS 3LH1A 3SUEA 5EPNA 2VBCA 3LT3A 3HK3B 1B0FA 1AFEH 3M7TA 4CRAA 2FOAA 3VB3A 1MU6B 2WPJS 5E0GA 1TNHA 1WBGB 2XC5A 3LGWA 4MTBA 1C4U2 1PPHE 1SI5H 1HCGA 1BTHH 4WH8A 5C1XA 2ZQ2A 1VCWA 1TNIA 1K1JA 1ZTKA 3SV7A 2ZPSA 1SGNE 1D4PB 2J9NA 4MNXA 1QB6A 2ZFTA 4E06H 1CSOE 1Z1IA 2SGPE 1WV7H 2UUKB 3S9AA 1UCYH 1IHTH 1KYNA 2CF9H 1V2OT 3UTUH 3VB6A 1BB0B 1W0ZU 1NM6A 1VJ9U 4D8NA 4WY3A 3UQVA 3P92A 1TGBA 3R0FA 3RXVA 1ELBA 2B8OH 3KHVA 3M5NA 4GHTA 2A5AA 1O2WA 1O3GA 1K9OE 1C5YB 4KGAA 5DP9A 2IOTA 1FIZA 1HIAA 2QY0B 1GJCB 1WTHD 2XNIA 3SU0A 1JMOH 2BVRH 3PM3A 3RXJA 1NRNH 1U6QA 1ETRH 8ESTE 3QK1A 3VGCC 2C90B 1EP5A 3PMHB 3E6PH 1P2IA 2VINA 2D8WA 4RSPA 2G4TA 1H9LB 2P8OC 2QN5T 3EA7A 4Y0ZE 5C3NA 2WV4A 1C2KA 1HRTH 3TK6A 4B6FA 1PQ7A 2BD3A 1P06A 4YOJA 3OTPA 2O8LA 2GZ9A 1WYKA 3C1KA 3PYHA 5HXFA 3OX7U 3GCTG 3K65B 3GY8A 5DP3A 1UTOA 3LH3A 3SNEA 2QAAA 1QRZA 2VGCB 1H9IE 1L4DA 1P09A 4O3TA 4I33A 3DUXH 3URCA 4K8YA 2OC1A 4I8HA 1LDTT 5E2OA 3F9HA 4IC5A 1RGQA 1EJNA 3F68H 4JMYA 5C1YA 2BLOA 5B6LA 4E7NA 1O2NA 2QGRA 3RXIA 1C1VH 2SNVA 2RG3A 2VVVA 3AVZA 4U32A 3SU5A 4IMQA 3T25A 1C5ZB 3MOCA 3PTNA 2Y5GA 3CP7A 1D3QB 1ETTH 2ODYB 3P17H 3DA9B 3H09A 1T8OA 2STAE 1ARCA 2F3CE 1G36A 2FS9A 3QGJA 1CVWH 4X6PA 4Y71A 1THSH 1VGCC 5I46H 2RA0A 1LHEH 1YLDA 5DP8A 2ANMH 1GG6C 2VH0A 2ZGJA 1FJSA 1OP0A 2GX4A 4ISOA 1QRWA 4AN7A 4ASHA 1YPLH 4AG1A 1S0RA 1TGCA 4OS1A 1AB9C 3TVJB 3KGPA 1O32A 1XMNB 2AGGX 5AF9H 5K7RA 3RLWH 1A0LA 1AE8H 1H1BA 3A87A 3E3TA 3M3VA 3PWCA 1ID5H 4ZKRU 1TA2A 3U8OH 2B9LA 1QA0A 2WINI 3CENA 4FUJA 3DHKH 1KXAA 2A45B 3UPEA 1SVPA 2BDIA 2J4IA 4IGDA 4ZHAA 1CHOG 4DIHH 1FN6A 2CV3A 1GHXH 1P03A 1ANBA 2UUJB 2XTTB 3BTFE 2BXUH 4FUHA 4FUCA 3RDZA 1AWFH 1EOJA 1YPGH 4JK5A 7KMEH 2ZDLA 1T7CA 1P0SH 1EOLA 2ZFSA 1Z8IB 5LPRA 1NRPH 1OWKA 1FPCH 2VIQA 1WCZA 1TOCB 3MO6A 3UFAA 3UUZA 1S85A 1T8LA 2DUCA 3MYWA 4AORA 1GCTB 3IG6B 2W7UA 3VXEH 2G4UA 3UWJH 2VU8E 1AN1E 4IN2A 1GHVH 1HAGE 3MNSA 1O33A 4GLYA 1XM1A 2WV5A 3GCNA 3NPSA 3SU6A 4CRCA 1C1SA 2WPLS 1EATA 1BA8B 2Y81A 3MO9A 3SGQE 1O39A 4LK4A 1GHWH 3RXUA 3SZEA 1OXGA 1YYY1 2FOBA 1ZPZA 1FY1A 1ANDA 1O3NA 3GOVB 1UTKA 3TLOA 2A4OA 1OWEA 1CT4E 4K1EA 1Y5AT 1GGDC 2VIVA 3RXLA 1V2UT 1UTMA 3BTKE 5J4SA 3MO3A 2FLRH 3QN7A 2ZNKH 3UREA 2OC8A 5DGJA 1ZRKA 1YPMH 3Q00A 1TPSA 4J1YA 2YNBA 1O2RA 4TPYA 4NIVA 3TGJE 4AFUA 1JWTA 4UFEH 2C8XB 1FAXA 4NA8A 1K1PA 4ZXXH 3SGAE 1ZSLA 3DT0H 1SLVB 2Z3EA 2FDAA 1VITG 9ESTA 4Y76A 1P57B 3RM0H 2ZU2A 3A80A 4IMZA 1A0JA 1TRNA 1TNLA 1O2MA 3BTEE 1HUTH 1C2EA 1AZ8A 2GZ8A 3RXHA 3GY2A 5AVDA 1ZTJA 4GUXA 2BM2A 5F8ZA 1B5GH 1KTSB 1IQEA 1GG6B 1UJ1A 1WTGH 1PQAA 1ZMNA 3M5OA 3SUDA 2F9PA 1DWBH 4HGCA 3SJOA 2QF3A 1UK4A 4MNVA 1DX5M 1UCYE 3EE0B 5EW1H 1IQFA 1OKXA 1MD7A 2FI3E 5F8XA 3H7TA 1TNKA 3RXDA 1EB1H 3TITA 1GJ4H 3W94A 3ZZ6A 1DUAA 5AFYH 3RC4A 3GCTF 8GCHF 3GDSA 5JB9S 1O0DH 4ZROA 3T5FH 3ODFA 1DOJA 2WUCA 4JZIA 2GVFA 2ZPRA 4KTUA 3BIUH 2FYRA 2Q6GA 2ZFPH 4AFQA 1W2KH 3PLPA 3RXAA 4B73A 3MH6A 4MG3A 2PV9B 1G37A 4D76A 1QA7A 4NIXA 1DFPA 3U9AH 4ABJA 4X8SH 2C8ZB 1ZPBA 3S7KB 3KQCA 3NXPA 1C1QA 3HGPA 1GBJA 2FX6A 2H9HA 2VWOA 2ZHQH 2A1DB 5FBEA 3U69H 1QNJA 1GJBB 1OPHB 1Z6JH 3IITA 3KQEA 3VPKA 3L6PA 1XUHA 1NRRH 4YO9A 2CMYA 5GNDA 1MU8B 1E37B 3MMGA 1Y3XA 3PV4A 3P70B 5EPYA 4UDWH 1ZJDA 2O9QA 2P3UB 3F9EA 1V6DA 2AGIX 3A85A 1PJPA 2SGAA 3PB1E 1UMAH 3B9FH 3A7TA 2BDAA 3NZIA 2BOHB 3LIWA 3TPIZ 5DO4H 5LH8A 1LPKB 1IQKA 1SGEE 2VNTA 1QURH 3E1XB 4O9VA 4BTUB 3QLPH 1LVYA 1O2KA 4INLA 1CHOF 3ZZBA 3ATKA 4Y7BA 3ZZ4A 1GHAF 2CN0H 3SJ9A 3V3MA 1GI4A 2B0FA 4CRFA 1QJ6B 2BY8X 2EI7A 4DW2U 5T6FA 1XUIA 1XUJA 2DE8A 4GVUA 3GCOA 1TQ0B 1FUJA 1NFUA 1EAUA 3AW0A 2R2WU 3S9BA 1GJAB 1FAKH 3SN8A 5EQSA 4YM9A 1HNEE 1KY9A 1LMWB 3SQEE 1TNGA 2PLXA 4FXGH 1C1NA 4OGYA 4D7GA 1GI5A 1QQUA 2Z9JA 1C2MA 3MU0A 3RXRA 1EZSC 1GJ6A 4NA9H 3STJA 1QL9A 2BQ6B 3NWUA 5ESBA 2G5NA 1W11U 1ANCA 2A2XH 1PPFE 2AIPA 3SGBE 2D1JA 4TY7A 1SSXA 1MTSA 2W26A 3NK8A 3EA9A 2VWLA 1D3DB 5BRRE 1V2QT 3K6ZA 3BTGE 1FY5A 2NWNA 2BTCE 3B8JA 2THFB 5DP4A 2EC9H 1CHGA 1C9PA 1EB2A 1BTYA 2ALVA 2PUXB 2G55A 1P2QA 2KAIB 4OGXA 1YM0A 1HAVA 3URDA 2TIOA 3U1IB 2WHXA 1NU9A 2WUBA 1GBAA 6ESTA 1HAOH 2OCVB 1MTVA 2PWXA 1W0YH 1DY8A 1F5RA 3TJNA 2FODA 1OWHA 2I6SA 4A5TS 5L2ZH 5CHAC 1V3XA 1PPGE 3TNSA 2J38A 4YOIA 1VITF 3UR9A 5DJ7A 1V2KT 2WZQA 1AVXA 4H6TA 4JYVH 1NN6A 4QT8C 3BF6H 2R0KA 1C5OH 5GIBA 1GJDB 1TPAE 4IBLH 1W3CA 4Y7AA 2RCEA 3MFJA 2ZP0H 1CT0E 5FXLA 3VXFH 3SU1A 8LPRA 1V2JT 4BAHB 2QYIA 1F0RA 3EQ0H 1HV7A 3LU9B 4Y8ZA 3TGKE 1BMMH 1N6XA 1SG8B 1TGNA 5EU8A 1FV9A 1LVMA 3SU2A 1S82A 4DCDA 2W7SA 1DE7H 1GHZA 1W7XH 1TONA 5A8XA 2BD2A 1C2FA 4Y6DA 1S6FA 2ILNA 3TH4H 1DVAH 1SC8U 3KF2A 3UNQA 1JIRA 1C1RA 2W5EA 4B2CA 1TGTA 1SGRE 3LPRA 2BVXH 4CR9A 1DT2A 1WQVH 1XKBC 4MDSA 3R3GB 1TPOA 5A8ZA 3OY6U 1OS8A 3QO6A 3QZRA 1IQIA 4UFGH 2SGDE 2CGAA 2PR3A 1L2EA 1EUFA 3S7HB 3V7TA 1G3DA 4GCHG 4NIYA 2ZU3A 4X6MA 2AMDA 1AKSB 3QTVH 1Z6EA 3SUFA 3U1JB 4Z6AH 5L6NH 1BHXB 3MNBA 5TCCA 1KSNA 1MKXH 4FUDA 4X0WU 1PPBH 1Y5BT 1MUEB 2J94A 2BD5A 5T3HA 2C4FH 3UNRA 1GI3A 1JBUH 1O2OA 4CREA 3DFLA 1GHBG 1SGTA 5DG6A 3RC5A 3PO1C 2FP7B 1YCPH 2GT8A 2KAIA 1NRQH 2JETC 4M9FA 4NFFA 1CA8B 1DICA 1GJ8B 4BANB 2OD3B 3S0NA 1J8AA 1QGFA 1XXDA 3A8DA 2HNTE 4GAWA 1HFDA 1O5DH 3MNXA 2ANYA 4AX9H 5DP6A 3ZVCA 3O8CA 3QWCH 1NPMA 1C5UA 3RXFA 3PLBA 1BIOA 1UVUH 2H2ZA 3MI4A 3AAUA 3VEQB 1SGCA 2ZHEH 5CHAB 2WPHS 3Q3KA 3MH5A 4NZQA 4ZUHA 1TIOA 1GVZA 4UONA 4Q2KA 5EXNA 4MLFB 5T1VA 3SZNA 4AB9A 1W14U 2G52A 1NT1A 4K69A 4NIWA 3RM2H 4K60A 3T26A 1GMHG 1BITA 1LPGB 2R0LA 2FOMB 2BXTH 1A4WH 1S84A 2OLGA 2BD9A 3NCLA 5C1UA 1C2GA 5BPEA 4ISHH 3BEIB 2FOCA 1JRSA 3B23B 3UR6A 2AIQA 1CE5A 2Z9KA 1GDNA 1Q31A 3QTOH 1GCTC 3ZZCA 5JYIA 1KXDA 1S6HA 2ZDKA 3BTME 4DVAU 4XDEA 1F7ZA 1IAUA 2BX4A 3L3TA 4BAOB 3ZVDA 2ZHFH 3Q77A 3ZVGA 1S0QA 1KTTB 1MZAA 1OX1A 3RXPA 2ZU4A 3E0PB 4FUGA 2BY5X 2CF8H 4ZXYH 1PYTD 2AMPA 1DM4B 4NG9H 4CHAC 1ELDE 1BTXA 1SB1H 8GCHG 1O3LA 4A92A 1KLTA 1GBIA 2UWPA 3FVFB 3S9CA 1C1WH 1EXFA 3K9XB 1P11E 3LGYA 1EAXA 4YESB 3M61U 1O3KA 1HJAB 1S83A 3BEFB 2Y5HA 1FN8A 1BBRH 1SL3A 5L2YH 4B2BA 1AKSA 1O5AB 1BRCE 1NFWA 3EGKH 2ZC9H 3A7WA 4YT6H 2P59A 1BTUA 1OYQA 3SO3A 1NRSH 1K2I1 4U01A 4WF8A 1JXPA 5EQRA 1OOKB 1YPEH 4IW4E 1CU1A 1TWXB 2Y80A 3NKKA 4X1PU 5DPAA 1GL0E 3A89A 2ZO3H 1G3BA 1W10U 2PKAB 4X8UH 3ESTA 1AIXH 2HLCA 1LO6A 4INKA 4X2YA 3D62A 3PO1B 1MBQA 2OBQA 1Y3WA 4ESTE 2JETB 2P94A 2TRMA 3RXKA 4D9QA 1F92A 1SLXB 3UWIA 1LHDH 2HWLB 1XUGA 4WXIA 3I77A 2PKSB 4IS5A 2ZF0H 1DPOA 4X6OA 5GCHG 2F91A 2YOLA 1C5MD 1DY9A 1SLWB 2ZTYA 3O8DA 4Z0KA 4KELA 2Z7FE 5FHTA 2ZDNA 1SOTA 2BDHA 2OC0A 1GHYH 3HATH 1P01A 1RRKA 4O03A 6LPRA 1BMLA 3MU4A 3SV9A 2OC7A 4AGKA 1SHYA 1RIWB 1BTWA 2GTBA 2W3KA 1SGDE 1A5HA 3QZQA 3RXOA 3LOXA 5HYOA 4SGBE 1A5IA 2LPRA 1CGIE 4U2WA 1O2TA 1HYLA 4BXWA 1T32A 1C5WB 1MZDA 3LC3A 3SORA 1PPZA 3F6UH 1GHAG 2OINA 2GDEH 2B5TB 2Q1JA 1O2PA 1Z8JB 4GCHF 1ZHRA 1ZR0A 1O3CA 2FMJA 1SGIB 3SNCA 1BDAA 1XUFA 1TAWA 2IJOB 1GVKB 3SJ8A 2UWLA 1TPPA 1YGCH 2PSYA 4OS4A 5TJXA 2ODQA 2V0BA 4DY7B 2H5DA 2VVUA 1GBDA 1UVTH 2GP9B 3ZZ3A 4DJZB 4OS2A 1O3OA 4VGCB 2FI5E 2ODPA 4ABIA 1C1OA 3SI3H 2PHBA 1GI0A 1GWAA 1QCPA 1GHBF 2STBE 1AUTC 5CMXH 3SNBA 4JYTA 3BG8A 4K8BA 5T6GA 4Q7XA 5TCAA 4CHAB 3HK6B 3A7YA 4KP0A 2XWBI 3UQOA 4B74A 3ZZ9A 4R0IA 3RU4T 1O31A 1TB6H 2AFQB 1E35B 1ESBA 3MH4A 3SV2H 1YF4A 1BCUH 5FPSA 1NESE 3SYJA 1A61H 2ZZUH 2BD7A 1SGFG 1JIMA 3D23A 3A88A 1TOMH 3GY7A 1MTWA 1MTUA 1O2SA 2WYJA 1ZRBA 2BLQA 2FLBH 2Y7ZA 2A4QA 3KL6A 1AFQC 1SR5C 2ZI2H 2XCNA 3VFEA 1DDJA 3NUMA 5I25A 5JDUB 4B75A 1WSSH 1WU1A 4ABBA 1QBVH 5B6OA 1L0ZA 1GMHF 1BHXF 3I29A 5FCRA 3OSYA 1C4Y2 2JH6D 2K1QA 3A7ZA 2XCFA 2Z94A 4CH2B 5K0HA 1AD8H 1GMCG 1QR3E 1EZXC 2WYGA 1V2VT 1LVBA 3SV6A 2HRVA 3G01A 4AFZA 4SGAE 2W3IA 1CBWC 1TRYA 1WOFA 5JB8S 2ZWLH 2XBYA 1VCPA 3PWBA 4NWLA 2HPQH 1OWJA 4HI3A 1KDQB 1C1UH 8KME2 1J14A 1AVWA 1GDUA 4ZKNU 1BUIA 1ELGA 2XC4A 1TBRH 1AVGH 1X7AC 4DGJA 1BTPA 1THPB 2V35A 1P05A 2Z3CA 1O3HA 4WH6A 1O37A 2BZ6H 4ZHMU 2WPKS 2P16A 3RXCA 1SFQB 3RU4D 1YKTA 2R2MB 5A09A 1PQ5A 2VIWA 2F9UA 2ZEBA 2O8MA 3GISB 4NSYA 1LKAA 5AHGH 3QGNB 4K1SA 2CHAC 2BMGB 3QUMP 3QDZB 3K6YA 3TU7H 1IQMA 4MNYA 1OSSA 1N8OC 1FI8A 1O2LA 2ZQ1A 3UIRA 1ZGVA 2GV7A 6GCHG 3A82A 2FIRH 1GI8B 1Y8TA 1LPZB 4UE7H 1D9IA 4I8KA 3KQDA 4XBCA 1LHFH 3SU4A 1C5XB 3LJOA 4X1NU 4BXSA 1SOZA 2UUYA 2EI8A 3ZZAA 1VJAU 1E34B 5JBBS 1XUKA 1W12U 4BOHA 4ABAA 1XX9A 3RXEA 5GXPA 2P3TB 4M7GA 1DANH 4O3UA 4AB8A 1EAIA 1ZPCA 4AFSA 4K5ZA 2CJIA 1THRH 2BQ7B 1DS2E 5DP7A 5GCHF 1HBTH 1BBRE 2ZDAH 1EJAA 4TWYA 1C1PA 3TJUA 2FI4E 1ZMJA 4FUBA 1BQYA 4HFPB 3ATLA 2FPZA 2WPIS 4LOYH 1OP8A 4XE4A 1FNIA 5ABWA 1C4V2 2M5TA 2HPPH 4JZFH 1FMGA 3T2NA 1AFQB 4AGJA 1BZXE 1WUNH 2C3SA 2HALA 5CE1A 3GY4A 1ZGIA 2F9OA 1G2LA 1Y3YA 1INCA 3ODDA 4JYUH 1PPCE 2R9PA 5C67A 1UVPA 4FUIA 2GMTB 2JH5D 5T6DA 5EODA 1NFYA 2BVSH 2A32A 4X2VA 4GPGA 5GJ4B 1ZYOA 3RXQA 2Z9GA 3ZV9A 3M36A 2ESTE 3SBKA 4ABFA 3M5MA 5E0HA 3FZDA 3P6ZB 1AQ7A 1NU7B 3VB7A 3V13A 4RN6A 1GCDA 4A1TA 1CBWB 2P95A 2QCYA 1IQGA 4X2XA 9LPRA 1SQOA 1C5TA 5C20A 1LKBA 1YCPM 1G2MA 4B76A 2VIOA 1ZHMA 1YBWA 1MH0A 1MKXK 1FLEE 4A6LA 1SGYE 2R3UA 1K21H 1P8VC 3T28A 1AU8A 2QXGA 2BDBA 2ALPA 1O2YA 2AH4X 3ATMA 2F9BH 3PV2A 4Y8YA 1A5GH 1HAYB 2P3FH 2ZKSA 1MCVA 3T62A 4LXBH 3DFJA 2BY6X 2BZAA 3UOUA 4X1SU 2Q6FA 1B7XB 2CHAB 4FUEA 4FVBA 2ZCKP 5DK1A 4JCNA 5C5NA 1O5FH 5EQQA 4UFDH 1HPGA 2FESH 3BTWE 1N8OB 1EPTC 1BRAA 4LZ1H 1WQSA 5E0JA 1O2UA 1P02A 4RI0A 1FDPA 1NC6A 2UUFB 3BV9B 5F6MA 1O2GH 1UCYK 1LHCH 1S5SA 2BX3A 2GGVB 4PROA 2BYAX 2ZCHP 1HXEH 2D2DA 4K1TA 5GWZA 1QL8A 5F8TA 1FPHH 2OTVA 1GMCF 2A5KA 2BD4A 4YLUA 4I8LA 3AAVA 2FXRA 1P3EA 3TJVA 1LTOA 1ABIH 4JZ1A 5FX6A 1ELFA 2QA9E 2TGPZ 4Y0YE 5LGOA 2PTCE 3LGVA 4I31A 1CGJE 3PROA 1HAIH 5HGGA 1ELAA 1KIGH 1MMJN 2AYWA 3AK5A 1UTPA 1YPHE 2ZGBH 5EW2H 2GDDA 1UK2A 1G3EA 2V6NA 2G5VA 3ZZ7A 1O5CB 1GBKA 4BTIB 3BIVH 2LNCA 2A4GA 2NU0E 1C5RA 1GDQA 1O2QA 3GICB 4ZHLU 2A7HA 1HIAB 1A46H 1KXEA 2XYAA 1H8IH 3A8AA 1MQ5A 4IN1A 3PV5A 2HOBA 1ZMLA 1J15A 1SBWA 1LHGH 1GBHA 4UEHH 1HJAC 1QY6A 1D6RA 3RXTA 4NWKA 1O3IA 4ABDA 2FYQA 4YTAA 5DP5A 5J4QA 3SHCH 6GCHF 3ELAH 2OBOA 5C5OA 2NU4E 1RS0A 4Y79A
chains in the Genus database with same CATH superfamily
1V2MT 4CRBA 3ZZ8A 1QHRB 3S69A 1Z8GA 1GBCA 3LJJA 2LP6A 1PPEE 4ABGA 1BRBE 3M35A 4MQAA 1AY6H 3TIUA 2O8TA 2G00A 3EA8A 1ACBE 3MU8A 1ZTLA 2ZIQH 1UW7A 1J16A 1GBFA 4DURA 1O2VA 4MPWA 5SGAE 2J95A 3BEUA 1ELEE 1K1IA 2BY7X 3M7UA 1M9UA 1O3JA 1GI2A 3RMMH 3E16B 1N1LA 4WMEA 2Y82A 3EAJA 3P8NA 1DWEH 2OQ5A 1KLIH 4MVNA 3RMLH 5HMAA 2A0QB 1HLTH 2PKSC 3PMBB 1D3PB 1ABJH 1TE0A 2AMQA 4F4OC 1MTNB 3TGIE 2H6MA 2JH0D 1O3PB 1CT2E 2BOKA 1EPTB 1C2HA 5C2ZA 4RT1A 4TPIZ 2BD8A 2FEQH 4I7YH 1GMDG 2Y7XA 1RIWC 1V2NT 3A81A 1D3TB 3GYMA 1MQ6A 3OY5U 3GY6A 3EDXB 1BTZA 4ZKSU 1G32B 1Z1JA 1C1MA 1ZJKA 2FTMA 5IYTA 1A7SA 4I8JA 3U98H 3SJKA 2TPIZ 3BG4C 1YPJH 1O38A 6CHAB 1C2DA 2ZDVH 1SMFE 3M3SA 5F53A 5JBAS 1T8NA 3P95A 5LPEA 4NA7A 4ZH8A 4D7FA 2YNAA 3M5LA 3BTTE 2G8TA 1NROH 2XOKD 5G4BA 3KIDU 3ZYEA 2OXSA 4VGCC 2BDGA 3CS0A 2PW8H 4B2AA 7LPRA 2UWOA 1TLDA 2ZHDA 3UY9A 2RA3A 3C27B 3P8GA 2VWNA 1QIXB 3CS7A 1A0HB 1KXFA 3BTHE 1EX3A 1UHBB 3ZZDA 2GD4B 3OTJE 3A8CA 1KXCA 4Y10E 5A8YA 2YMSD 1JOUB 1PQ8A 2ZHWH 2Z9IA 1QL7A 2J98A 2ZG0H 3P8OA 2XXLA 3VB4A 1K22H 2CK3D 1OYTH 2NU3E 2Y5FA 4NFEA 3O8RA 1IQHA 1O2JA 5JBTA 4TY6A 5PTPA 2C93B 2A31A 2ZTZA 3A83A 3MTYA 5F03A 3JZ1B 5L30H 1GBEA 1O3BA 2A2QH 4AZ2B 3RMOH 2ANWA 2QV1A 1QQ4A 2OQUA 4BAQB 1IQJA 1O3MA 4ISNA 2FOFA 5ETXA 1T4UH 1RTFB 3DD2H 2GV6A 1P2KA 2Z9LA 2PP6A 5FX5A 3E8LA 5A0CA 2NU2E 1JRTA 5A2MH 1O34A 2BLVA 1O2HA 2J92A 4WMDA 2XW9A 1J17T 5E2PA 1EQ9A 1V2ST 1ZOMA 5GPIB 4B6EA 2QF0A 3KEEA 4TWWA 1Q3XA 4A1XA 1XXFA 2F9VA 1RD3B 1RTKA 1J9CH 4A7IB 1MKWH 3KQBA 3GY3A 5JPMH 3KCGH 3BTQE 5EJZA 1BJUA 4JZEH 1IQNA 3FOAA 1C2JA 1QBOA 4HZHA 1EZQA 4YZUA 3NRLA 4K3JA 4KTCA 5DN6D 3RU4E 1G3CA 1O35A 1ELCA 2CXVA 3ATWA 4WWYA 1LQEA 1EPTA 3K2UA 3M37A 3IWMA 4XOJA 3MU1A 1GL1A 4IC6A 4Y8XA 2XBWA 5FPYA 5LPFA 5EGMA 1FIWA 3GDUA 1TMTH 3VB5A 1FXYA 3ZZ5A 1O30A 1GVLA 1L1JA 3TK5A 4WXVA 4BAKB 1K1LA 1OWIA 3D65E 1OP2A 3RP2A 2IN2A 2SGQE 2EY4C 1V2RT 1P2NA 1Y3UA 2B7DH 2SNWA 4BTTB 2ULLA 2WSSD 3BG4B 1O36A 1YP9A 4B71A 1DXWA 2BY9X 1O5EH 1TX8A 3EE7A 4BNRA 1H9HE 3Q3YA 4P02A 4UFFH 5EXLA 4RKOB 3WY8A 1BMNH 1KXBA 1UK3A 2RDLA 2F83A 2QXHA 3UOPA 1ZZZA 4MNWA 2FM2A 2BDYA 1P04A 5FPTA 3PMJA 1V2TT 1H8DH 1F5LA 1YLCA 1UHBA 3FP6E 1SGPE 2LELA 1HB0B 3TK9A 1G9IE 1TMUH 1Z7KA 1CO7E 2GKVE 4AG2A 1H4WA 1GI6A 4ZMAH 3LC5A 1E1RD 1XVOA 2G51A 3LGIA 3TJOA 5DKMA 1QTFA 3N7OA 1EKBB 2F4LA 4I8GA 2ZGXH 3VGCB 1WXRA 4XBDA 1EJMA 1ESAA 2BHGA 3ATIA 1DITH 2QC2A 1DUEA 3FAOA 2P8OB 1F5KU 4WMFA 2BDCA 3CNRA 2QIQA 3PMAB 2H5CA 3RXBA 1GMDF 2KX4A 1VR1H 1SGQE 4GHQA 2EA3A 4LZ4B 3GYLB 2VIPA 5EXMA 1Y5UT 2C8WB 1P3CA 4X2WA 1UTJA 1NO9H 1SFIA 2PGQB 1AE5A 3ITIA 2PKAA 3V12A 2BQWB 1Q2WA 4R8TB 4OS5A 5KGOA 3FZZA 1BRUP 2GMTC 2FWWA 4H42U 2Y6TA 3Q3XA 4UD9H 5H4IB 4GSOA 3ZVEA 2ANKH 1NBMD 2PFEA 3LGTA 2KFWA 4CRGA 2J34A 1NS3A 4J2YB 2V3OH 3ZYDA 2H1UA 5FAHA 2I6QA 3JZ2B 1OWDA 1UTQA 3DSPA 3QX5H 3SI4H 4ISLA 3MU5A 1CQQA 1GI9B 2QXIA 1TYNA 4AYVB 5HM2A 4OM9A 3I78A 1LQDB 1E38B 2SFAA 4Q7ZA 4DT7B 2Q6DA 1K1NA 1P2OA 4FU7A 2ASUB 2VWMA 5GDSH 1FY4A 1HAZB 1VGCB 2O8WA 1SGFA 3UB0A 1O5BB 3U8RH 2XC0A 1CGHA 1C2LA 2ZGCA 3PLKA 2ZCLP 3HGNA 2NU1E 1NTPA 2PUQH 3OU0A 1VKYA 1AB9B 1HDTH 3Q76A 1F0UA 4XBBA 1ARBA 3A8BA 2QXJA 1NFXA 3KNXA 1BMFD 3A7VA 4CRDA 1FONA 2FOHA 1V2PT 1QFKH 1KMHB 4FU9A 3RC6A 1TGSZ 1EAWA 2ZFFH 1DWDH 1YPKH 4KKDA 1TX7A 2ZPQA 2BB4A 4H4FA 1UVOA 3D49H 4F49A 3SNDA 1GBLA 1FX0B 5EOKA 1GBBA 3UNSA 3MHWU 4RKJB 2XWAA 1HAVB 3BSQA 1T31A 3H5CB 1HAXB 1ELTA 1P2MA 3GCHC 3SUGA 1ANEA 1CA0C 1A3EH 3ENSB 1SLUB 1C5PA 1IQLA 1D6WA 2AEIH 1DWCH 1ZLRA 1ESTA 5AFZH 3H7OA 2GCTC 1BOQA 2GCHG 1TA6A 1HJ9A 1ZSJA 1T8MA 3P8FA 2D26C 3TH2H 5A0AE 2XBVA 1RXPA 4X1RU 2VH6A 2ZECA 4U30A 3FP7E 4ABEA 3T27A 4DG4A 1SKYE 1GJ5H 3KN2A 1HJ8A 5FBIA 7GCHG 2SGFE 3BTDE 1WAYB 1YC0A 4CR5A 5IDKA 2ZU1A 1HGTH 1XKAC 1A2CH 1EZUC 1QB9A 1IHSH 3ZV8A 3BN9A 3U8TH 4O97A 4ISIH 4DOQA 1FY8E 3GDVA 1FZZA 1L4ZA 1GGDB 1L1GA 4TSFD 5FCKA 1EASA 2PGBB 4XFQA 4ABHA 2HNTF 1TALA 2SGEE 5EG4A 4BAMB 1Y3VA 2PSXA 2QF5A 1O2XA 4XRNA 1L1NA 1O3FA 4DIIH 1GI7B 1LCYA 1C9TA 2TGTA 3LONA 1UO6A 2JDID 3HKIB 2KCYA 4XD7D 1H8ED 1GBMA 1EFRD 1C1TA 1QJ1B 5E8EH 1ZSKA 1RJXB 3MH7A 2J2UA 1NZQH 4Q80A 1KDQA 4B1TA 1VZQH 4NGAH 1XVMA 1IOEA 3F9GA 1HAHH 1VITH 3PTBA 4FU8A 3AASA 2O8UA 2AGEX 3TH3H 1SHHB 4AOQA 4D9RA 2A7CA 2PTNA 2Z6BD 4ASUD 1MD8A 2VB0A 3SW2B 1YLNA 3FANA 1FY3A 2OK5A 2ZA5A 3A7XA 2A5IA 4MPVA 4E7RG 2JKHA 4X8VH 3GY5A 2HVXA 3SV8A 2TGDA 1Y59T 1AI8H 1Z8RA 2R3YA 1YCPK 3O8BA 4CH8B 3MNCA 1RFNA 1TMBH 3RXSA 3SU3A 2Z3DA 3LGUA 1Z71A 2G81E 4CBOA 3SJIA 4FUFA 5C0UA 1MAYA 1MTNC 3FFGA 4TYDA 2IPHA 3MWIU 3SNAA 3F9FA 2FTLE 2F9NA 1P10A 1W7GH 3RXGA 1V2LT 1AHTH 1W8BH 1T4VH 2P93A 1MAXA 1P12E 1ZHPA 5A0BA 2HGTH 1E0FD 2ZTXA 4E05H 1G30B 1PYTC 1AZZA 3E91A 2WV9A 1C2IA 1TABE 1UTLM 1C5LH 1K28D 4YT7H 1YPHC 4XSKU 2DE9A 1LVOA 4A1VA 1VCQA 3GCHB 3V0XA 1O2ZA 1CA0B 1AMHA 4HTCH 2KCAA 2H9EH 6CHAC 2EI6A 2XBXA 1O3EA 4FVDA 1QBNA 2GCTB 3FP8E 4I32A 2OUAA 4MPXA 2ZFRH 1C5NH 1W13U 3AW1A 1S81A 2TGAA 3RXMA 3LKWA 1AO5A 1MBMA 4WJG2 1TBQH 1DSUA 1SPJA 4JK6A 1SQTA 1N6YA 1SQAA 4YOGA 1DXPA 1AWHB 3A86A 1OHHD 1QJ7B 2BLWA 3ZVAA 3SHAH 1DLKB 4X8TH 2VJ1A 1HAPH 5HM9A 1V2WT 3M3TA 4NCYA 1ETSH 2A7JA 2ZU5A 4INHA 4X1QU 3LDXH 4ACAA 1P2JA 1QRXA 1BMAA 1UVSH 4ZKOU 4KTSA 7ESTE 2FOGA 2FOEA 4NSVA 4H6SB 1E36B 2EEKA 2FS8A 2VIDA 3A84A 3L33A 1BJVA 1RTLA 2AERH 3HPTB 1TQ7B 4YLQH 3ZVFA 1GJ9B 4OS6A 3SQHE 3STIA 1DSTA 1MCTA 1F0SA 2WPMS 3OYPA 3W95A 2XRCA 1FQ3A 4MPUA 4THNH 1O3AA 1C5QA 1TBZH 2V3HH 2GT7A 4NZLA 1P9UA 1TX6A 1PFXC 1S6LA 1HXFH 4K2YA 2VVCA 1BT7A 2IJD1 3RLYH 1A3BH 1K1MA 4CBNA 1AUJA 3ZVBA 1F0TA 2AS9A 2ZGHA 1UTNA 2KZ4A 1BBRK 1K1OA 4Q7YA 1GBTA 4JZDH 1C5VA 4ZAEA 3E90B 2FO9A 1NY22 1ELVA 3F1SB 1TRMA 3HKJB 4TT3D 2J5UA 2VGCC 2HNTC 2OP9A 1QB1A 1TFXA 5ESTE 3EYDA 3RUOA 1C5SA 1O5GH 1KLJH 2FZZA 2ZFQH 3M7QA 4WVPE 2GCHF 1O3DA 1GI1A 2TBSA 2A4RA 4AYYB 2FX4A 1TNJA 1DLEA 4Y11E 4OS7A 4X6NA 1B0EA 2H9TH 1ORFA 2GZ7A 1F2SE 3TNTA 1GPZA 1MKWK 1P9SA 2C8YB 5HKKD 1AGJA 2ZDMA 3T29A 7GCHF 1EP6A 1O2IA 1A1RA 1GJ7B 3E0NB 3RMNH 3SOSA 5JBCS 3LH1A 3SUEA 5EPNA 2VBCA 3LT3A 2W6JD 3HK3B 1B0FA 1AFEH 3M7TA 4CRAA 2FOAA 3VB3A 1MU6B 2WPJS 5E0GA 1TNHA 1WBGB 2XC5A 3LGWA 4MTBA 1C4U2 1PPHE 1SI5H 1HCGA 1BTHH 4WH8A 5C1XA 2ZQ2A 1VCWA 1TNIA 1K1JA 1ZTKA 2JJ2D 3SV7A 2ZPSA 1SGNE 1D4PB 2J9NA 4MNXA 1QB6A 2ZFTA 4E06H 1CSOE 1Z1IA 2SGPE 1WV7H 2UUKB 3S9AA 1UCYH 1IHTH 1KYNA 2CF9H 1V2OT 3UTUH 3VB6A 1BB0B 1W0ZU 5HIZA 1NM6A 1VJ9U 4D8NA 4WY3A 3UQVA 3P92A 1TGBA 3R0FA 3RXVA 1ELBA 2B8OH 3N7DA 3KHVA 3M5NA 4GHTA 2A5AA 1O2WA 1O3GA 3WWBA 1K9OE 1C5YB 4KGAA 5DP9A 2IOTA 1FIZA 1HIAA 2QY0B 1GJCB 1WTHD 2XNIA 3SU0A 1JMOH 2BVRH 3PM3A 3RXJA 1NRNH 1U6QA 1ETRH 8ESTE 3QK1A 3VGCC 1W0KD 2C90B 1EP5A 3PMHB 3E6PH 1P2IA 2VINA 2D8WA 4RSPA 5EJLA 2G4TA 1H9LB 2P8OC 2QN5T 3EA7A 4Y0ZE 5C3NA 2WV4A 1C2KA 1HRTH 3TK6A 4B6FA 1PQ7A 2BD3A 1P06A 4YOJA 3OTPA 4F55A 2O8LA 2GZ9A 1WYKA 3C1KA 3PYHA 5HXFA 3OX7U 3GCTG 3K65B 3GY8A 1NBME 5DP3A 5CDFE 1UTOA 3LH3A 3SNEA 2QAAA 1QRZA 2VGCB 1H9IE 1L4DA 1P09A 4O3TA 4I33A 3DUXH 3URCA 4K8YA 2OC1A 4I8HA 1LDTT 5E2OA 3F9HA 4IC5A 2QE7D 1RGQA 1EJNA 2EQNA 3F68H 4JMYA 5C1YA 2BLOA 5B6LA 1YWUA 4E7NA 1O2NA 2QGRA 3RXIA 1C1VH 2SNVA 2RG3A 2VVVA 3AVZA 4U32A 3SU5A 4IMQA 3T25A 1C5ZB 3MOCA 3PTNA 2Y5GA 3CP7A 1D3QB 1ETTH 2ODYB 1K0HA 3P17H 3DA9B 3H09A 1T8OA 2STAE 1ARCA 2F3CE 1G36A 2FS9A 3QGJA 1CVWH 4X6PA 4Y71A 1THSH 1VGCC 5I46H 2RA0A 1LHEH 1YLDA 2KM0A 5DP8A 2ANMH 1GG6C 2VH0A 2ZGJA 1FJSA 1OP0A 2GX4A 4ISOA 1QRWA 4AN7A 4ASHA 1YPLH 4AG1A 1S0RA 4FETA 1TGCA 4OS1A 1AB9C 3TVJB 3KGPA 1O32A 1XMNB 2AGGX 3KYGA 5AF9H 5K7RA 3RLWH 1A0LA 1AE8H 1H1BA 3A87A 3E3TA 3M3VA 3PWCA 1ID5H 4ZKRU 1TA2A 3U8OH 2B9LA 1QA0A 2WINI 2IPQX 3CENA 4FUJA 2KR7A 3DHKH 1KXAA 2A45B 3UPEA 1SVPA 2BDIA 2J4IA 4IGDA 4ZHAA 1CHOG 4DIHH 1FN6A 2CV3A 1GHXH 1P03A 1ANBA 2UUJB 2XTTB 3BTFE 2BXUH 4FUHA 4FUCA 3RDZA 1AWFH 1EOJA 1YPGH 4JK5A 7KMEH 2ZDLA 1T7CA 1P0SH 1EOLA 2ZFSA 1Z8IB 5LPRA 1NRPH 1OWKA 1FPCH 2VIQA 1WCZA 1TOCB 3MO6A 3UFAA 3UUZA 4ACBA 1S85A 1T8LA 2DUCA 3MYWA 4AORA 1GCTB 3IG6B 2W7UA 3VXEH 2G4UA 3UWJH 2VU8E 1AN1E 4IN2A 1GHVH 1HAGE 3MNSA 1O33A 4GLYA 1XM1A 2WV5A 3GCNA 3KQ5A 3NPSA 3SU6A 4CRCA 1C1SA 2WPLS 1EATA 1BA8B 2Y81A 3MO9A 3SGQE 1O39A 4LK4A 1GHWH 3RXUA 3SZEA 5FL7D 1OXGA 1YYY1 2FOBA 1ZPZA 1FY1A 1ANDA 1O3NA 3GOVB 1UTKA 3TLOA 2A4OA 1OWEA 1CT4E 2JJ1D 4K1EA 1Y5AT 1GGDC 2VIVA 3RXLA 2J97A 1V2UT 1UTMA 3BTKE 5J4SA 3MO3A 2FLRH 3QN7A 2ZNKH 3UREA 2OC8A 5DGJA 1ZRKA 3F0PA 1YPMH 3Q00A 1TPSA 4J1YA 2YNBA 1O2RA 4TPYA 4NIVA 3TGJE 4AFUA 1JWTA 4UFEH 2C8XB 1FAXA 4NA8A 1K1PA 4ZXXH 3SGAE 1ZSLA 3DT0H 1SLVB 2Z3EA 3F2FA 2FDAA 1VITG 9ESTA 4Y76A 1P57B 3RM0H 2ZU2A 3A80A 3OFND 1A0JA 4IMZA 1TRNA 1TNLA 1O2MA 3BTEE 1HUTH 1C2EA 1AZ8A 2GZ8A 3RXHA 3GY2A 5AVDA 1ZTJA 4GUXA 2BM2A 5F8ZA 1B5GH 1KTSB 1IQEA 1GG6B 1H8HD 1UJ1A 1PQAA 1WTGH 1ZMNA 3M5OA 3SUDA 2F9PA 1DWBH 4HGCA 3SJOA 2QF3A 1UK4A 4MNVA 1DX5M 1UCYE 3EE0B 5EW1H 1IQFA 1OKXA 1MD7A 2FI3E 5F8XA 3H7TA 1TNKA 3RXDA 1EB1H 3TITA 1GJ4H 3W94A 3ZZ6A 1DUAA 5AFYH 3RC4A 3GCTF 8GCHF 3GDSA 5JB9S 1O0DH 4ZROA 3T5FH 3ODFA 1DOJA 2WUCA 4JZIA 2GVFA 2ZPRA 4KTUA 3BIUH 2FYRA 2Q6GA 2ZFPH 4AFQA 1W2KH 3PLPA 3RXAA 4B73A 3MH6A 3GS9A 4MG3A 2PV9B 1G37A 4D76A 1QA7A 4NIXA 1DFPA 3U9AH 4ABJA 4X8SH 2C8ZB 1ZPBA 3S7KB 3KQCA 3NXPA 2WPDD 1C1QA 3HGPA 1GBJA 2FX6A 2H9HA 2VWOA 2ZHQH 2A1DB 5FBEA 3U69H 1QNJA 1GJBB 1OPHB 1Z6JH 3IITA 3KQEA 3VPKA 3L6PA 1XUHA 1NRRH 4YO9A 2CMYA 5GNDA 3UAIC 1MU8B 1E37B 3MMGA 1Y3XA 3PV4A 3P70B 5EPYA 4UDWH 1ZJDA 2O9QA 2P3UB 3F9EA 1V6DA 2AGIX 3A85A 1PJPA 2SGAA 3PB1E 1UMAH 3B9FH 3A7TA 2BDAA 3NZIA 2BOHB 3DSOA 3LIWA 3TPIZ 5DO4H 5LH8A 1LPKB 1IQKA 1SGEE 2VNTA 1QURH 3E1XB 4O9VA 4BTUB 4FOUC 3QLPH 1LVYA 1O2KA 4INLA 1CHOF 3ZZBA 3ATKA 1W0JD 4Y7BA 3ZZ4A 1GHAF 3F0OA 2CN0H 3SJ9A 3V3MA 1GI4A 2B0FA 4CRFA 1QJ6B 2BY8X 2EI7A 4DW2U 5T6FA 1XUIA 1XUJA 2DE8A 4GVUA 3GCOA 1TQ0B 1FUJA 3F2HA 1NFUA 1EAUA 3WW7A 3AW0A 2R2WU 3S9BA 1GJAB 1FAKH 3SN8A 5EQSA 4YM9A 1HNEE 1KY9A 1LMWB 3SQEE 1TNGA 2PLXA 4FXGH 1C1NA 4OGYA 4D7GA 1GI5A 1QQUA 2Z9JA 1C2MA 3MU0A 3RXRA 1EZSC 1GJ6A 4NA9H 3STJA 1QL9A 2BQ6B 3NWUA 5ESBA 2G5NA 1W11U 1ANCA 2A2XH 1PPFE 2AIPA 3SGBE 2D1JA 4TY7A 1SSXA 1MTSA 2W26A 3NK8A 3EA9A 2VWLA 4ZCNA 1D3DB 5BRRE 1V2QT 3K6ZA 3BTGE 1FY5A 2NWNA 2BTCE 3B8JA 2THFB 5DP4A 2EC9H 1CHGA 1C9PA 1EB2A 1BTYA 2ALVA 2PUXB 2YMSC 2G55A 1P2QA 2KAIB 4OGXA 1YM0A 1HAVA 2KCPA 3URDA 2TIOA 3U1IB 2WHXA 1NU9A 2WUBA 1GBAA 6ESTA 5KEDA 1HAOH 2OCVB 1MTVA 2PWXA 1W0YH 1DY8A 1F5RA 3TJNA 2FODA 1OWHA 2I6SA 4A5TS 5L2ZH 5CHAC 1V3XA 1PPGE 3TNSA 2J38A 4YOIA 1VITF 3UR9A 5DJ7A 1V2KT 2WZQA 1AVXA 4H6TA 1SQRA 4JYVH 1NN6A 4QT8C 3BF6H 2R0KA 1C5OH 5GIBA 1GJDB 1TPAE 4IBLH 1W3CA 4Y7AA 2RCEA 3MFJA 2ZP0H 1CT0E 5FXLA 3VXFH 3SU1A 8LPRA 1V2JT 4BAHB 2QYIA 1WDIA 1F0RA 3EQ0H 1HV7A 3LU9B 4Y8ZA 3TGKE 3FKSD 1BMMH 1N6XA 1SG8B 1TGNA 5EU8A 1FV9A 1LVMA 3SU2A 1S82A 4DCDA 2W7SA 1DE7H 1GHZA 1W7XH 1TONA 5A8XA 2BD2A 1C2FA 4Y6DA 1S6FA 2ILNA 3TH4H 1DVAH 1SC8U 3KF2A 3UNQA 1JIRA 1C1RA 2W5EA 4B2CA 1TGTA 1SGRE 3LPRA 2BVXH 4CR9A 1DT2A 1WQVH 3F2GA 1XKBC 4MDSA 3R3GB 1TPOA 5A8ZA 3OY6U 1OS8A 3QO6A 3QZRA 1IQIA 4UFGH 2SGDE 2CGAA 2PR3A 1L2EA 1EUFA 3S7HB 3V7TA 1G3DA 4GCHG 4NIYA 2ZU3A 4X6MA 2AMDA 1AKSB 3QTVH 1Z6EA 3SUFA 3U1JB 4Z6AH 5L6NH 1BHXB 3MNBA 5C17A 5TCCA 1KSNA 1MKXH 4FUDA 4F48B 4I86A 4X0WU 1PPBH 1Y5BT 1MUEB 2J94A 5EIYA 2BD5A 5T3HA 2C4FH 3UNRA 1GI3A 1JBUH 1O2OA 4CREA 3DFLA 1GHBG 1SGTA 5DG6A 3RC5A 3PO1C 2FP7B 1YCPH 2GT8A 2KAIA 1NRQH 2JETC 4M9FA 4NFFA 1CA8B 1DICA 1GJ8B 2YMSB 4BANB 2OD3B 3S0NA 1J8AA 1QGFA 1XXDA 3A8DA 2HNTE 4GAWA 1HFDA 1O5DH 3MNXA 2ANYA 4AX9H 5DP6A 3ZVCA 3O8CA 3QWCH 1NPMA 1C5UA 3RXFA 3PLBA 1BIOA 1UVUH 2H2ZA 3MI4A 3AAUA 3VEQB 1SGCA 2ZHEH 5CHAB 2WPHS 3Q3KA 3MH5A 4NZQA 4ZUHA 1YY3A 1TIOA 1GVZA 4UONA 4Q2KA 2F43B 5EXNA 4MLFB 5T1VA 3SZNA 4AB9A 1W14U 2G52A 1NT1A 4K69A 4NIWA 3RM2H 4K60A 3T26A 1GMHG 1BITA 1LPGB 2R0LA 2FOMB 2BXTH 1A4WH 1S84A 2OLGA 2BD9A 3NCLA 5C1UA 1C2GA 5BPEA 3PRBA 4ISHH 3BEIB 2RFKC 1E79D 2FOCA 1JRSA 3B23B 3UR6A 2AIQA 1CE5A 2Z9KA 1GDNA 1Q31A 3QTOH 1GCTC 3ZZCA 5JYIA 1KXDA 1S6HA 2ZDKA 3BTME 4DVAU 4XDEA 1F7ZA 1IAUA 2BX4A 3L3TA 4BAOB 3ZVDA 2ZHFH 3Q77A 3ZVGA 1S0QA 1KTTB 1MZAA 3VG8A 1OX1A 4Q4LA 2ZU4A 3RXPA 3E0PB 5EJ1A 4FUGA 2BY5X 2CF8H 4ZXYH 1PYTD 2AMPA 1DM4B 2XNDD 4NG9H 1ELDE 4CHAC 1BTXA 1SB1H 8GCHG 1O3LA 4A92A 1KLTA 1GBIA 2UWPA 3FVFB 3S9CA 1C1WH 1EXFA 3K9XB 1P11E 3LGYA 1EAXA 4YESB 3M61U 1O3KA 1E1QD 1HJAB 1S83A 3BEFB 2Y5HA 1FN8A 1BBRH 1SL3A 5L2YH 4B2BA 1AKSA 1O5AB 1BRCE 1NFWA 3EGKH 2ZC9H 3A7WA 4YT6H 2P59A 1BTUA 1OYQA 3SO3A 1NRSH 1K2I1 4U01A 4WF8A 5DSFA 1JXPA 5EQRA 1OOKB 5CHBA 1YPEH 4IW4E 1CU1A 1TWXB 2Y80A 3NKKA 4X1PU 5DPAA 1GL0E 3A89A 2ZO3H 1G3BA 1W10U 2PKAB 4X8UH 3ESTA 5C0TA 1AIXH 2HLCA 3OAAD 1LO6A 4INKA 3FO8D 4X2YA 3D62A 3PO1B 1MBQA 2OBQA 3OEHD 1Y3WA 4ESTE 2JETB 2P94A 2TRMA 3RXKA 4D9QA 1F92A 1SLXB 3UWIA 1LHDH 2HWLB 1XUGA 4WXIA 3I77A 2PKSB 4IS5A 2ZF0H 1DPOA 4X6OA 5GCHG 2F91A 2YOLA 1COWD 1C5MD 1DY9A 1SLWB 2ZTYA 3O8DA 4Z0KA 4KELA 2Z7FE 5FHTA 2ZDNA 1SOTA 2BDHA 2OC0A 1GHYH 3HATH 1P01A 1RRKA 2K0QA 4O03A 6LPRA 1BMLA 3MU4A 3SV9A 2OC7A 4AGKA 1SHYA 1RIWB 1BTWA 2GTBA 2W3KA 1SGDE 1A5HA 3QZQA 3RXOA 3LOXA 5HYOA 4SGBE 1A5IA 2LPRA 1CGIE 4U2WA 1O2TA 1HYLA 4BXWA 1T32A 1C5WB 1MZDA 3LC3A 3SORA 1PPZA 3F6UH 1GHAG 2OINA 2GDEH 2B5TB 3OE7D 2Q1JA 1O2PA 1Z8JB 4GCHF 1ZHRA 1ZR0A 1O3CA 2FMJA 1SGIB 3SNCA 1BDAA 1XUFA 1TAWA 2IJOB 1GVKB 3SJ8A 2UWLA 1TPPA 1MABB 1YGCH 2PSYA 4OS4A 5TJXA 2ODQA 2V0BA 4DY7B 2H5DA 2VVUA 1GBDA 1UVTH 2GP9B 3ZZ3A 4DJZB 4OS2A 1O3OA 4VGCB 2FI5E 2ODPA 4ABIA 1C1OA 3N7EA 3SI3H 2PHBA 1GI0A 2M2AA 1GWAA 1QCPA 1GHBF 2STBE 3WWFA 1AUTC 5CMXH 4HG6A 3SNBA 4JYTA 3BG8A 4K8BA 5T6GA 4Q7XA 2JIZD 5TCAA 4CHAB 3HK6B 3A7YA 4KP0A 2XWBI 3UQOA 4B74A 3ZZ9A 4R0IA 3RU4T 1O31A 1TB6H 2AFQB 1E35B 1ESBA 3MH4A 3SV2H 1YF4A 1BCUH 5FPSA 1NESE 3SYJA 1A61H 2ZZUH 2BD7A 1SGFG 1JIMA 3D23A 3A88A 1TOMH 3GY7A 1MTWA 1MTUA 1O2SA 3U28C 2WYJA 1ZRBA 2BLQA 4RT0A 2FLBH 2Y7ZA 2A4QA 3KL6A 1AFQC 1SR5C 2ZI2H 2XCNA 3VFEA 1DDJA 3NUMA 5I25A 2V7QD 5JDUB 4B75A 1WSSH 1WU1A 3DCLA 1QBVH 4ABBA 5B6OA 1L0ZA 1GMHF 1BHXF 3I29A 5FCRA 3OSYA 1C4Y2 2JH6D 2K1QA 3A7ZA 2XCFA 2Z94A 4DT4A 4CH2B 5K0HA 1AD8H 1GMCG 1QR3E 1EZXC 2WYGA 1V2VT 1LVBA 3SV6A 2HRVA 3G01A 4AFZA 4SGAE 2W3IA 1CBWC 1TRYA 1WOFA 5JB8S 2ZWLH 2XBYA 1VCPA 3PWBA 4NWLA 2HPQH 1OWJA 4HI3A 1KDQB 1C1UH 8KME2 1J14A 1AVWA 1GDUA 4ZKNU 1BUIA 1ELGA 2XC4A 1TBRH 1AVGH 1X7AC 4DGJA 1BTPA 1THPB 2V35A 1P05A 2Z3CA 1O3HA 4WH6A 1O37A 2BZ6H 4ZHMU 2WPKS 2P16A 3RXCA 1SFQB 3RU4D 1YKTA 2R2MB 2W6ID 5A09A 1PQ5A 2VIWA 2F9UA 2ZEBA 2O8MA 3GISB 4NSYA 1LKAA 5AHGH 3QGNB 4K1SA 2AHME 2CHAC 2BMGB 2L6OA 1QZ8A 2L74A 3QDZB 3QUMP 3K6YA 3TU7H 1IQMA 3OEED 4AC9A 4MNYA 1OSSA 1N8OC 1FI8A 1O2LA 2ZQ1A 3UIRA 1ZGVA 2GV7A 6GCHG 3A82A 2FIRH 1GI8B 1Y8TA 1LPZB 4UE7H 1D9IA 4I8KA 3KQDA 4XBCA 1LHFH 3SU4A 1C5XB 3LJOA 4X1NU 4BXSA 1SOZA 2UUYA 2EI8A 3ZZAA 1VJAU 5KECA 1E34B 5JBBS 1XUKA 1W12U 4BOHA 4ABAA 1XX9A 3RXEA 5GXPA 2P3TB 4M7GA 1DANH 4O3UA 4AB8A 1EAIA 1ZPCA 4AFSA 4K5ZA 4Q63A 2CJIA 1THRH 2BQ7B 1DS2E 5C94A 5DP7A 5GCHF 1HBTH 1BBRE 2ZDAH 1EJAA 4TWYA 1C1PA 3TJUA 2FI4E 1ZMJA 4FUBA 1BQYA 3F3BA 4HFPB 3ATLA 2FPZA 2WPIS 3N99A 4LOYH 1OP8A 4XE4A 1FNIA 5ABWA 1C4V2 2M5TA 2HPPH 2QF4A 3W1EA 4JZFH 1FMGA 3T2NA 1AFQB 4AGJA 1BZXE 1WUNH 2C3SA 2HALA 5CE1A 3GY4A 1ZGIA 2F9OA 1G2LA 1Y3YA 1INCA 3ODDA 4JYUH 1PPCE 2R9PA 5C67A 1UVPA 4FUIA 2GMTB 2JH5D 5T6DA 5EODA 1NFYA 2BVSH 3MQKC 2A32A 4X2VA 4GPGA 3FN8A 5GJ4B 1ZYOA 3RXQA 2Z9GA 3ZV9A 3M36A 2ESTE 3SBKA 5IK2D 4ABFA 2V3MA 3M5MA 5E0HA 3FZDA 3P6ZB 1AQ7A 1NU7B 3VB7A 3V13A 4RN6A 1GCDA 4A1TA 1CBWB 2P95A 2QCYA 1IQGA 4X2XA 9LPRA 1SQOA 1C5TA 5C20A 1LKBA 1YCPM 1G2MA 4B76A 2VIOA 1ZHMA 1YBWA 1MH0A 1MKXK 1FLEE 4A6LA 1SGYE 2R3UA 1K21H 1P8VC 3T28A 1AU8A 2QXGA 2BDBA 2ALPA 4Z1MD 1O2YA 2AH4X 3ATMA 2F9BH 3PV2A 4Y8YA 2KCOA 1A5GH 1HAYB 2P3FH 2ZKSA 1MCVA 3T62A 4LXBH 3DFJA 2BY6X 2BZAA 3UOUA 4X1SU 2Q6FA 1B7XB 2CHAB 4FUEA 4FVBA 2ZCKP 5DK1A 2HVYB 4JCNA 5C5NA 1O5FH 5EQQA 4UFDH 1HPGA 2FESH 3BTWE 1N8OB 1EPTC 1BRAA 4LZ1H 1WQSA 5E0JA 1O2UA 1P02A 4RI0A 1FDPA 1NC6A 2UUFB 3BV9B 5F6MA 1O2GH 1UCYK 1LHCH 1S5SA 2BX3A 2GGVB 4PROA 2BYAX 2ZCHP 1HXEH 2D2DA 4K1TA 5GWZA 1QL8A 2RDEA 1FPHH 5F8TA 2OTVA 1GMCF 2A5KA 2BD4A 4YLUA 4I8LA 3AAVA 2FXRA 1P3EA 3TJVA 1LTOA 1ABIH 4JZ1A 5FX6A 1ELFA 2QA9E 2TGPZ 4Y0YE 5LGOA 2PTCE 3LGVA 4I31A 5HIYA 3PRDA 4P00A 1CGJE 3PROA 1HAIH 4YXWD 5HGGA 1ELAA 1KIGH 1MMJN 2AYWA 3AK5A 1UTPA 1YPHE 2ZGBH 5EW2H 2GDDA 1UK2A 1G3EA 2V6NA 2G5VA 3ZZ7A 1O5CB 1GBKA 2HLDD 4BTIB 3BIVH 2LNCA 2A4GA 2NU0E 1C5RA 2K8IA 1GDQA 1O2QA 3GICB 4ZHLU 2A7HA 1HIAB 1A46H 3DSGA 1KXEA 2XYAA 1H8IH 3A8AA 2J98B 1MQ5A 4IN1A 3PV5A 2HOBA 1ZMLA 1J15A 2GJGA 1SBWA 1LHGH 3ZIAD 1GBHA 4UEHH 1HJAC 1QY6A 3KYFA 1D6RA 3RXTA 4NWKA 1O3IA 4ABDA 2FYQA 4YTAA 5DP5A 5J4QA 3SHCH 6GCHF 3ELAH 2OBOA 5C5OA 2NU4E 1RS0A 4Y79A
chains in the Genus database with same CATH topology
1V2MT 4CRBA 3ZZ8A 1QHRB 3S69A 1Z8GA 1GBCA 3LJJA 1PPEE 4ABGA 1BRBE 3M35A 4MQAA 1AY6H 3TIUA 2O8TA 2G00A 3EA8A 1ACBE 3MU8A 1ZTLA 2ZIQH 1J16A 1GBFA 4DURA 1O2VA 4MPWA 5SGAE 2J95A 3BEUA 1ELEE 1K1IA 2BY7X 3M7UA 1M9UA 1O3JA 1GI2A 3RMMH 3E16B 1N1LA 4WMEA 2Y82A 3EAJA 3P8NA 1DWEH 2OQ5A 1KLIH 4MVNA 3RMLH 5HMAA 2A0QB 1HLTH 2PKSC 3PMBB 1D3PB 1ABJH 1TE0A 2AMQA 4F4OC 1MTNB 3TGIE 2H6MA 2JH0D 1O3PB 1CT2E 2BOKA 1EPTB 1C2HA 5C2ZA 4TPIZ 2BD8A 2FEQH 4I7YH 1GMDG 2Y7XA 1RIWC 1V2NT 3A81A 1D3TB 3GYMA 1MQ6A 3OY5U 3GY6A 3EDXB 1BTZA 4ZKSU 1G32B 1Z1JA 1C1MA 1ZJKA 2FTMA 5IYTA 1A7SA 4I8JA 3U98H 3SJKA 2TPIZ 3BG4C 1YPJH 1O38A 6CHAB 1C2DA 2ZDVH 1SMFE 3M3SA 5F53A 5JBAS 1T8NA 3P95A 5LPEA 4NA7A 4ZH8A 4D7FA 2YNAA 3M5LA 3BTTE 2G8TA 1NROH 2XOKD 5G4BA 3KIDU 3ZYEA 2OXSA 4VGCC 2BDGA 3CS0A 2PW8H 4B2AA 7LPRA 2UWOA 1TLDA 2ZHDA 3UY9A 2RA3A 3C27B 3P8GA 2VWNA 1QIXB 3CS7A 1A0HB 1KXFA 3BTHE 1EX3A 1UHBB 3ZZDA 2GD4B 3OTJE 3A8CA 1KXCA 4Y10E 5A8YA 2YMSD 1JOUB 1PQ8A 2ZHWH 2Z9IA 1QL7A 2ZG0H 3P8OA 2XXLA 3VB4A 1K22H 2CK3D 1OYTH 2NU3E 2Y5FA 4NFEA 3O8RA 1IQHA 1O2JA 5JBTA 4TY6A 5PTPA 2C93B 2A31A 2ZTZA 3A83A 3MTYA 5F03A 3JZ1B 5L30H 1GBEA 1O3BA 2A2QH 4AZ2B 3RMOH 2ANWA 2QV1A 1QQ4A 2OQUA 4BAQB 1IQJA 1O3MA 4ISNA 2FOFA 5ETXA 1T4UH 1RTFB 3DD2H 2GV6A 1P2KA 2Z9LA 5FX5A 3E8LA 5A0CA 2NU2E 1JRTA 5A2MH 1O34A 2BLVA 1O2HA 2J92A 4WMDA 2XW9A 1J17T 5E2PA 1EQ9A 1V2ST 1ZOMA 5GPIB 4B6EA 2QF0A 3KEEA 4TWWA 1Q3XA 4A1XA 1XXFA 2F9VA 1RD3B 1RTKA 1J9CH 4A7IB 1MKWH 3KQBA 3GY3A 5JPMH 3KCGH 3BTQE 1BJUA 4JZEH 1IQNA 3FOAA 1C2JA 1QBOA 4HZHA 1EZQA 4YZUA 3NRLA 4K3JA 4KTCA 5DN6D 3RU4E 1G3CA 1O35A 1ELCA 2CXVA 3ATWA 4WWYA 1LQEA 1EPTA 3K2UA 3M37A 3IWMA 4XOJA 3MU1A 1GL1A 4IC6A 4Y8XA 2XBWA 5FPYA 5LPFA 5EGMA 1FIWA 3GDUA 1TMTH 3VB5A 1FXYA 3ZZ5A 1O30A 1GVLA 1L1JA 3TK5A 4WXVA 4BAKB 1K1LA 1OWIA 3D65E 1OP2A 3RP2A 2IN2A 2SGQE 1V2RT 1P2NA 1Y3UA 2B7DH 2SNWA 4BTTB 2ULLA 2WSSD 3BG4B 1O36A 1YP9A 4B71A 1DXWA 2BY9X 1O5EH 1TX8A 4BNRA 1H9HE 3Q3YA 4UFFH 5EXLA 4RKOB 3WY8A 1BMNH 1KXBA 1UK3A 2RDLA 2F83A 2QXHA 3UOPA 1ZZZA 4MNWA 2FM2A 2BDYA 1P04A 5FPTA 3PMJA 1V2TT 1H8DH 1F5LA 1YLCA 1UHBA 3FP6E 1SGPE 2LELA 1HB0B 3TK9A 1G9IE 1TMUH 1Z7KA 1CO7E 2GKVE 4AG2A 1H4WA 1GI6A 4ZMAH 3LC5A 1XVOA 2G51A 1E1RD 3LGIA 3TJOA 5DKMA 1QTFA 3N7OA 1EKBB 4I8GA 2F4LA 2ZGXH 3VGCB 1WXRA 4XBDA 1EJMA 1ESAA 2BHGA 3ATIA 1DITH 2QC2A 1DUEA 3FAOA 2P8OB 1F5KU 4WMFA 2BDCA 2QIQA 3PMAB 2H5CA 3RXBA 1GMDF 1VR1H 1SGQE 4GHQA 2EA3A 4LZ4B 3GYLB 2VIPA 5EXMA 1Y5UT 2C8WB 1P3CA 4X2WA 1UTJA 1NO9H 1SFIA 2PGQB 1AE5A 3ITIA 2PKAA 3V12A 2BQWB 1Q2WA 4R8TB 4OS5A 3FZZA 1BRUP 2GMTC 2FWWA 4H42U 2Y6TA 3Q3XA 4UD9H 5H4IB 4GSOA 3ZVEA 2ANKH 1NBMD 2PFEA 3LGTA 2KFWA 4CRGA 2J34A 1NS3A 4J2YB 2V3OH 3ZYDA 2H1UA 5FAHA 2I6QA 3JZ2B 1OWDA 1UTQA 3QX5H 3DSPA 3SI4H 4ISLA 3MU5A 1CQQA 1GI9B 2QXIA 1TYNA 4AYVB 5HM2A 4OM9A 3I78A 1LQDB 1E38B 2SFAA 4Q7ZA 4DT7B 2Q6DA 1K1NA 1P2OA 4FU7A 2ASUB 2VWMA 5GDSH 1FY4A 1HAZB 1VGCB 2O8WA 1SGFA 3UB0A 1O5BB 3U8RH 2XC0A 1CGHA 1C2LA 2ZGCA 3PLKA 2ZCLP 3HGNA 2NU1E 1NTPA 2PUQH 3OU0A 1AB9B 1HDTH 3Q76A 1F0UA 4XBBA 1ARBA 3A8BA 2QXJA 1NFXA 3KNXA 4CRDA 3A7VA 1BMFD 1FONA 2FOHA 1V2PT 1QFKH 1KMHB 4FU9A 3RC6A 1TGSZ 1EAWA 2ZFFH 1DWDH 1YPKH 4KKDA 1TX7A 2ZPQA 2BB4A 4H4FA 1UVOA 3D49H 4F49A 3SNDA 1GBLA 1FX0B 5EOKA 1GBBA 3UNSA 3MHWU 4RKJB 2XWAA 1HAVB 3BSQA 1T31A 3H5CB 1HAXB 1ELTA 1P2MA 3GCHC 3SUGA 1ANEA 1CA0C 1A3EH 3ENSB 1SLUB 1C5PA 1IQLA 1D6WA 2AEIH 1DWCH 1ZLRA 1ESTA 5AFZH 3H7OA 2GCTC 1BOQA 2GCHG 1TA6A 1HJ9A 1ZSJA 1T8MA 3P8FA 2D26C 3TH2H 5A0AE 2XBVA 1RXPA 4X1RU 2VH6A 2ZECA 4U30A 3FP7E 4ABEA 3T27A 4DG4A 1SKYE 1GJ5H 3KN2A 1HJ8A 5FBIA 7GCHG 2SGFE 3BTDE 1WAYB 1YC0A 4CR5A 5IDKA 2ZU1A 1HGTH 1XKAC 1A2CH 1EZUC 1QB9A 1IHSH 3ZV8A 3BN9A 3U8TH 4O97A 4ISIH 4DOQA 1FY8E 3GDVA 1FZZA 1L4ZA 1GGDB 1L1GA 5FCKA 4TSFD 1EASA 2PGBB 4XFQA 4ABHA 2HNTF 1TALA 2SGEE 5EG4A 4BAMB 1Y3VA 2PSXA 2QF5A 1O2XA 1L1NA 1O3FA 4DIIH 1GI7B 1LCYA 1C9TA 2TGTA 3LONA 1UO6A 2JDID 3HKIB 2KCYA 4XD7D 1H8ED 1GBMA 1EFRD 1C1TA 1QJ1B 5E8EH 1ZSKA 1RJXB 3MH7A 2J2UA 1NZQH 4Q80A 1KDQA 4B1TA 1VZQH 4NGAH 1XVMA 1IOEA 3F9GA 1HAHH 1VITH 3PTBA 4FU8A 3AASA 2O8UA 2AGEX 3TH3H 1SHHB 4AOQA 4D9RA 2A7CA 2PTNA 2Z6BD 4ASUD 1MD8A 2VB0A 3SW2B 3FANA 1FY3A 2OK5A 2ZA5A 3A7XA 2A5IA 4MPVA 4E7RG 2JKHA 4X8VH 3GY5A 2HVXA 3SV8A 2TGDA 1Y59T 1AI8H 1Z8RA 2R3YA 1YCPK 3O8BA 4CH8B 3MNCA 1RFNA 1TMBH 3RXSA 3SU3A 2Z3DA 3LGUA 1Z71A 2G81E 4CBOA 3SJIA 4FUFA 5C0UA 1MAYA 1MTNC 3FFGA 4TYDA 2IPHA 3MWIU 3SNAA 3F9FA 2FTLE 2F9NA 1P10A 1W7GH 3RXGA 1V2LT 1AHTH 1W8BH 1T4VH 2P93A 1MAXA 1P12E 1ZHPA 5A0BA 2HGTH 1E0FD 2ZTXA 4E05H 1G30B 1PYTC 1AZZA 3E91A 2WV9A 1C2IA 1TABE 1UTLM 1C5LH 1K28D 4YT7H 1YPHC 4XSKU 2DE9A 1LVOA 4A1VA 1VCQA 3GCHB 3V0XA 1O2ZA 1CA0B 1AMHA 4HTCH 2KCAA 2H9EH 6CHAC 2EI6A 2XBXA 1O3EA 4FVDA 1QBNA 2GCTB 3FP8E 4I32A 2OUAA 4MPXA 2ZFRH 1C5NH 1W13U 3AW1A 1S81A 2TGAA 3RXMA 3LKWA 1AO5A 1MBMA 4WJG2 1TBQH 1DSUA 1SPJA 4JK6A 1SQTA 1N6YA 1SQAA 4YOGA 1DXPA 1AWHB 3A86A 2BLWA 1QJ7B 3ZVAA 1OHHD 3SHAH 1DLKB 4X8TH 2VJ1A 1HAPH 5HM9A 1V2WT 3M3TA 4NCYA 1ETSH 2A7JA 2ZU5A 4INHA 4X1QU 3LDXH 1P2JA 1QRXA 1BMAA 1UVSH 4ZKOU 4KTSA 7ESTE 2FOGA 2FOEA 4NSVA 4H6SB 1E36B 2EEKA 2FS8A 2VIDA 3A84A 3L33A 1BJVA 1RTLA 2AERH 3HPTB 1TQ7B 4YLQH 3ZVFA 1GJ9B 4OS6A 3SQHE 3STIA 1DSTA 1MCTA 1F0SA 2WPMS 3OYPA 3W95A 2XRCA 1FQ3A 4MPUA 4THNH 1O3AA 1C5QA 1TBZH 2V3HH 2GT7A 4NZLA 1P9UA 1TX6A 1PFXC 1S6LA 1HXFH 4K2YA 2VVCA 1BT7A 2IJD1 3RLYH 1A3BH 1K1MA 4CBNA 1AUJA 3ZVBA 1F0TA 2AS9A 2ZGHA 1UTNA 2KZ4A 1BBRK 1K1OA 4Q7YA 1GBTA 4JZDH 1C5VA 4ZAEA 3E90B 2FO9A 1NY22 1ELVA 3F1SB 1TRMA 3HKJB 4TT3D 2VGCC 2J5UA 2HNTC 2OP9A 1QB1A 1TFXA 5ESTE 3EYDA 3RUOA 1C5SA 1O5GH 1KLJH 2FZZA 2ZFQH 3M7QA 4WVPE 2GCHF 1O3DA 1GI1A 2TBSA 2A4RA 4AYYB 2FX4A 1TNJA 1DLEA 4Y11E 4OS7A 4X6NA 1B0EA 2H9TH 1ORFA 2GZ7A 1F2SE 3TNTA 1GPZA 1MKWK 1P9SA 2C8YB 5HKKD 1AGJA 2ZDMA 3T29A 7GCHF 1EP6A 1O2IA 1A1RA 1GJ7B 3E0NB 3RMNH 3SOSA 5JBCS 3LH1A 3SUEA 5EPNA 2VBCA 3LT3A 2W6JD 3HK3B 1B0FA 1AFEH 3M7TA 4CRAA 2FOAA 3VB3A 1MU6B 2WPJS 5E0GA 1TNHA 1WBGB 2XC5A 3LGWA 4MTBA 1C4U2 1PPHE 1SI5H 1HCGA 1BTHH 4WH8A 5C1XA 2ZQ2A 1VCWA 1TNIA 1K1JA 1ZTKA 2JJ2D 3SV7A 2ZPSA 1SGNE 1D4PB 2J9NA 4MNXA 1QB6A 2ZFTA 4E06H 1CSOE 1Z1IA 2SGPE 1WV7H 2UUKB 3S9AA 1UCYH 1IHTH 1KYNA 2CF9H 1V2OT 3UTUH 3VB6A 1BB0B 1W0ZU 1NM6A 1VJ9U 4D8NA 4WY3A 3UQVA 3P92A 1TGBA 3R0FA 3RXVA 1ELBA 2B8OH 3N7DA 3KHVA 3M5NA 4GHTA 2A5AA 1O2WA 1O3GA 3WWBA 1K9OE 1C5YB 4KGAA 5DP9A 2IOTA 1FIZA 1HIAA 2QY0B 1GJCB 1WTHD 2XNIA 3SU0A 1JMOH 2BVRH 3PM3A 3RXJA 1NRNH 1U6QA 1ETRH 8ESTE 3QK1A 3VGCC 1W0KD 2C90B 1EP5A 3PMHB 3E6PH 1P2IA 2VINA 2D8WA 4RSPA 2G4TA 1H9LB 2P8OC 2QN5T 3EA7A 4Y0ZE 5C3NA 2WV4A 1C2KA 1HRTH 3TK6A 4B6FA 1PQ7A 2BD3A 1P06A 4YOJA 3OTPA 4F55A 2O8LA 2GZ9A 1WYKA 3C1KA 3PYHA 5HXFA 3OX7U 3GCTG 3K65B 3GY8A 1NBME 5DP3A 5CDFE 1UTOA 3LH3A 3SNEA 2QAAA 1QRZA 2VGCB 1H9IE 1L4DA 1P09A 4O3TA 4I33A 3DUXH 3URCA 4K8YA 2OC1A 4I8HA 1LDTT 5E2OA 3F9HA 4IC5A 2QE7D 1RGQA 1EJNA 3F68H 4JMYA 5C1YA 2BLOA 5B6LA 4E7NA 1O2NA 2QGRA 3RXIA 1C1VH 2SNVA 2RG3A 2VVVA 3AVZA 4U32A 3SU5A 4IMQA 3T25A 1C5ZB 3MOCA 3PTNA 2Y5GA 3CP7A 1D3QB 1ETTH 2ODYB 3P17H 3DA9B 3H09A 1T8OA 2STAE 1ARCA 2F3CE 1G36A 2FS9A 3QGJA 1CVWH 4X6PA 4Y71A 1THSH 1VGCC 5I46H 2RA0A 1LHEH 1YLDA 5DP8A 2KM0A 2ANMH 1GG6C 2VH0A 2ZGJA 1FJSA 1OP0A 2GX4A 4ISOA 1QRWA 4AN7A 4ASHA 1YPLH 4AG1A 1S0RA 4FETA 1TGCA 4OS1A 1AB9C 3TVJB 3KGPA 1O32A 1XMNB 2AGGX 5AF9H 5K7RA 3RLWH 1A0LA 1AE8H 1H1BA 3A87A 3E3TA 3M3VA 3PWCA 1ID5H 4ZKRU 1TA2A 3U8OH 2B9LA 1QA0A 2WINI 3CENA 4FUJA 3DHKH 2KR7A 1KXAA 2A45B 3UPEA 1SVPA 2BDIA 2J4IA 4IGDA 4ZHAA 1CHOG 4DIHH 1FN6A 2CV3A 1GHXH 1P03A 1ANBA 2UUJB 2XTTB 3BTFE 2BXUH 4FUHA 4FUCA 3RDZA 1AWFH 1EOJA 1YPGH 4JK5A 7KMEH 2ZDLA 1T7CA 1P0SH 1EOLA 2ZFSA 1Z8IB 5LPRA 1NRPH 1OWKA 1FPCH 2VIQA 1WCZA 1TOCB 3MO6A 3UFAA 3UUZA 1S85A 1T8LA 2DUCA