1NS4A

Crystal structure of galactose mutarotase from lactococcus lactis mutant e304q complexed with glucose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFQCQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns4A00
2BRPA 1N7PA 1J0NA 1SNZA 1LOHA 2JKPA 3VD3A 1NS7A 1W3YA 3IAPA 3NJXA 1X1JA 1X1HA 1JZ4A 2CIQA 4BZGA 2WDAA 1MMXA 3A24A 1L7JA 2XHNA 3K25A 4DUVA 1NSMA 1UG9A 1K1YA 1JYWA 1NS8A 3OB8A 3Q1NA 1JOVA 1NS4A 3VD7A 1JYNA 4DUXA 1JZ3A 4TTGA 1OJPA 3MUY1 1HN1A 1DP0A 1NSZA 1TXKA 3DYOA 4BZHA 3J7HA 1F4HA 3T0DA 1LF9A 3T0BA 4RNLA 1RWHA 1Z45A 2JKAA 1JZ6A 3T08A 1NSVA 1JZ8A 1YGAA 2HTAA 2CIRA 1NS2A 1MN0A 3DECA 1N7NA 3MV11 1HN0A 3DYMA 4DUWA 3VD4A 5A1AA 1ULVA 1K1WA 2CISA 2E24A 1JZ5A 1YQ2A 1HM3A 1NSXA 1OJNA 1LF6A 2WCOA 2JKEA 4BZFA 2E22A 1K1XA 1PX4A 1NSRA 3VDBA 1NS0A 2WW0A 1JYXA 2XSGA 4AQ0A 1J0MA 1RWAA 2ZXQA 3T09A 1N7RA 3BGAA 2WW3A 1LXKA 1N7QA 3VDCA 3MUZ1 3WFAA 1MMUA 1OJOA 3MV01 1RW9A 3I3DA 1C82A 1LXMA 1N7OA 2WW2A 1JZ7A 2HTBA 1LURA 5E1QA 3T2QA 3NJVA 1SO0A 3CZJA 3I3EA 2Q1FA 2BRWA 3MWXA 3DYPA 3T2OA 1MMZA 1PX3A 1X1IA 1HMWA 2WVXB 1JYVA 2BRVX 1EGUA 1F4AA 3IAQA 1HM2A 1RWGA 2WVZA 1RWCA 2WW1A 2WVYA 1OJMA 2WVXA 3E1F1 2X03A 3T0AA 3NREA 1F1SA 1MMYA 1F9GA 1NSSA 1NKGA 3VD9A 1HMUA 3T2PA 4BZEA 3I3BA 3ECQA 2D73A 3VDAA 1RWFA 1L7KA 3SEPA 1JZ2A 3VD5A 1I8QA 3OBAA 3DCDA 3IMHA 2WZSA 2ZQ0A 1CB8A 1NSUA 3OS7A
chains in the Genus database with same CATH superfamily
2BRPA 2F1AA 1IQYA 3VD3A 3AMOB 1W3YA 3DX4A 2WOFA 3NJXA 4BTYA 3NBBA 2OW6A 4BTXA 1UG9A 3BVXA 2CFKA 1W6CA 1JOVA 1NS4A 3D4ZA 1HXKA 1SPUA 1JYNA 4DUXA 3EJSA 3RRSA 3D3IA 3QG0A 1UI7A 1NSZA 3DYOA 4BZHA 4NEIA 4MMHA 1SIIA 3BUDA 2OOVC 2F7OA 3T0BA 4RNLA 1RWHA 1Z45A 2D1WA 1NS2A 3D51A 3BVTA 1MN0A 1QX1A 2CISA 2F7QA 5JMDA 2F7RA 2WCOA 2JKEA 2E22A 3RSYA 1K1XA 2Y74A 1PX4A 1RWAA 2FUQA 3BGAA 3VDCA 3ACSA 1QWUA 1RW9A 3I3DA 1C82A 3PGBA 3DDGA 4KFEA 3W7XA 2ALWA 1QAKA 3DYPA 1H54A 3T2OA 2CG0A 2WVXB 1HM2A 2WVZA 5GW7A 1D6ZA 4FNPA 3E1F1 2FUTA 3WVFA 1IVVA 1HMUA 3A0OA 3I3BA 3ECQA 3LOYA 2WYIA 3X3ZA 3CV5A 4EV5A 3OBAA 3DCDA 4OK4A 2C10A 4FNUA 3WIRA 4K3AA 3MPHA 3S4CA 1LOHA 1TQVA 4K35A 3N9HA 2OQEC 3D4YA 1X1JA 3X42A 1IVWA 1JZ4A 3AMOA 1MMXA 3QFZA 3BUPA 3EJTA 1LVNA 3K25A 2CQSA 1NS8A 3Q1NA 1AVKA 1JZ3A 4BTWA 3ACTA 3BVUA 3MI6A 1JZ6A 1O7DD 2CWTA 2WYHA 1NSVA 2HTAA 1WMOA 2C11A 2CIRA 3MV11 1N7NA 1HN0A 4DUWA 2WGQA 3BVVA 1K1WA 1YQ2A 1OJNA 4BZFA 3HIGA 3VDBA 3EJRA 4AQ0A 1LXKA 1N7QA 4KTPA 3X3XA 3WFAA 1MMUA 1RJOA 1W5ZA 3BUQA 3MV01 2EADA 1LXMA 1JZ7A 5E1QA 4OK2A 1QWNA 3CZJA 1TQTA 1DYUA 1MMZA 1X1IA 4MMIA 1JYVA 3K5TA 2FYVA 4UFCA 1RWGA 2WW1A 1US1A 2WVYA 1OJMA 2EABA 2WVXA 2X03A 2ZL8A 1QAFA 4EV2A 3S4BA 2YX9A 4BZEA 2D73A 1RWFA 1L7KA 2WO0A 3VD5A 3W7WA 1TQWA 1V7VA 1CB8A 2W0QA 1NSUA 1J0NA 2CWUA 1NS7A 1X1HA 2CIQA 3W7UA 2WDAA 3E7JA 3A24A 2XN0A 4DUVA 3T0UA 3AFJA 1K1YA 2BT3A 1JYWA 1AV4A 4FNTA 3VD7A 1OACA 1HWWA 3CZSA 2CFWA 2E2VA 3BLCA 1EKMA 2E2UA 1DP0A 1TXKA 3WA2X 3BVWA 3J7HA 1QALA 1JZ8A 2OQEA 1W4NA 1IVXA 5A1AA 1A2VA 2E24A 3WA3A 3E80A 2F18A 1V7WA 3NBJA 1NS0A 3HIIA 5JMFA 1JYXA 4KFDA 1J0MA 2ZXQA 1N7RA 3VSMA 1N7OA 2WW2A 3BLBA 2HTBA 2F1BA 3T2QA 3NJVA 1SO0A 1UI8A 3I3EA 2Q1FA 3W7TA 3VSNA 1PX3A 1HMWA 2BRVX 1EGUA 4OJZA 3X41A 3T0AA 3S4DA 3NREA 3X40A 1F1SA 1MMYA 1F9GA 1N9EA 3VD9A 3EJPA 2OOVA 3T2PA 3EJQA 5KBPA 1W7CA 3SEPA 3EJUA 1I8QA 2XN1A 3IMHA 2WZSA 5CA3A 1R34A 3OS7A 1N7PA 1SNZA 2JKPA 1IU7A 2CG1A 4FNQA 3IAPA 3HI7A 3W7SA 4FNVA 2CQTA 1L7JA 3AFLA 2XHNA 4FNSA 3BUBA 2WOHA 1NSMA 3TY1A 3OB8A 2CFLA 3CZNA 1D6YA 2F7PA 2EACA 4J5TA 4TTGA 1OJPA 2E2TA 3MUY1 1PU4A 1HN1A 1F4HA 3T0DA 1LF9A 2JKAA 3T08A 3DDFA 3BUIA 3DX3A 1YGAA 1SIHA 1D6UA 2CFGA 3DECA 1PS3A 3DYMA 3VD4A 3DX0A 1ULVA 1JZ5A 1IVUA 1HM3A 1NSXA 1IQXA 1LF6A 1TQSA 3ALAA 1NSRA 2PNCA 3WIQA 2WW0A 2XSGA 3LVTA 3T09A 2WW3A 3MUZ1 3D52A 1OJOA 3BS6A 3SXXA 2YFOA 1LURA 1WMPA 1W6GA 2BRWA 4FNRA 3MWXA 1TU5A 1W2ZA 2OW7A 3S4AA 1F4AA 1HTYA 2YFNA 1KSIA 3IAQA 3SX1A 3KN4A 4KFFA 1RWCA 2CWVA 3DX1A 1TQUA 3X3YA 3DX2A 1NSSA 1NKGA 2EAEA 1JRQA 1R33A 4KTRA 3VDAA 3QFYA 1RKYA 3QDEA 1JZ2A 2RDYA 3D50A 1AVLA 1V7XA 2XN2A 2Y73A 1WMNA 2CFDA 2ZQ0A 3KIIA 4BZGA
chains in the Genus database with same CATH topology
2BRPA 1N7PA 1J0NA 1SNZA 1LOHA 2JKPA 3VD3A 1NS7A 1W3YA 3IAPA 3NJXA 1X1JA 1X1HA 1JZ4A 2CIQA 4BZGA 2WDAA 3E7JA 1MMXA 3A24A 4FNVA 1L7JA 3AFLA 2XHNA 3K25A 4DUVA 1NSMA 3TY1A 1UG9A 1K1YA 1JYWA 1NS8A 3OB8A 3Q1NA 1JOVA 1NS4A 3VD7A 1JYNA 4DUXA 4J5TA 1JZ3A 4TTGA 3BLCA 1OJPA 3MUY1 1HN1A 1DP0A 1NSZA 1TXKA 3DYOA 4BZHA 3J7HA 4NEIA 4MMHA 1F4HA 3T0DA 1LF9A 3T0BA 4RNLA 1RWHA 1Z45A 2JKAA 1JZ6A 3T08A 1NSVA 1JZ8A 1YGAA 2HTAA 2CIRA 1NS2A 1MN0A 3DECA 1N7NA 3MV11 1HN0A 3DYMA 4DUWA 3VD4A 5A1AA 1ULVA 1K1WA 2CISA 2E24A 1JZ5A 1YQ2A 1HM3A 1NSXA 1OJNA 5JMDA 1LF6A 3E80A 2WCOA 2JKEA 4BZFA 2E22A 1K1XA 1PX4A 1NSRA 3VDBA 1NS0A 2WW0A 5JMFA 1JYXA 2XSGA 4AQ0A 1J0MA 1RWAA 2FUQA 2ZXQA 3T09A 1N7RA 3BGAA 2WW3A 1LXKA 1N7QA 3VDCA 3MUZ1 3WFAA 1MMUA 1OJOA 3BS6A 3MV01 1RW9A 3VSMA 3I3DA 1C82A 1LXMA 1N7OA 2WW2A 1JZ7A 2HTBA 1LURA 5E1QA 3T2QA 4OK2A 3NJVA 1SO0A 3CZJA 3I3EA 2Q1FA 2BRWA 3MWXA 3DYPA 3T2OA 1MMZA 3VSNA 1PX3A 1X1IA 1HMWA 2WVXB 4MMIA 1JYVA 2BRVX 1EGUA 1F4AA 3IAQA 4OJZA 1HM2A 1RWGA 2WVZA 1RWCA 2WW1A 2WVYA 1OJMA 2WVXA 3E1F1 2X03A 2FUTA 3T0AA 3NREA 1F1SA 1MMYA 1F9GA 1NSSA 1NKGA 3WVFA 3VD9A 1HMUA 3A0OA 3T2PA 4BZEA 3I3BA 3ECQA 2D73A 3VDAA 1RWFA 1L7KA 3SEPA 1JZ2A 3VD5A 1I8QA 3OBAA 3DCDA 4OK4A 3IMHA 2WZSA 2ZQ0A 1CB8A 1NSUA 3OS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BRP A;  1N7P A;  1J0N A;  1SNZ A;  1LOH A;  2JKP A;  3VD3 A;  1NS7 A;  1W3Y A;  3IAP A;  3NJX A;  1X1J A;  1X1H A;  1JZ4 A;  2CIQ A;  4BZG A;  2WDA A;  1MMX A;  3A24 A;  1L7J A;  2XHN A;  3K25 A;  4DUV A;  1NSM A;  1UG9 A;  1K1Y A;  1JYW A;  1NS8 A;  3OB8 A;  3Q1N A;  1JOV A;  1NS4 A;  3VD7 A;  1JYN A;  4DUX A;  1JZ3 A;  4TTG A;  1OJP A;  3MUY 1;  1HN1 A;  1DP0 A;  1NSZ A;  1TXK A;  3DYO A;  4BZH A;  3J7H A;  1F4H A;  3T0D A;  1LF9 A;  3T0B A;  4RNL A;  1RWH A;  1Z45 A;  2JKA A;  1JZ6 A;  3T08 A;  1NSV A;  1JZ8 A;  1YGA A;  2HTA A;  2CIR A;  1NS2 A;  1MN0 A;  3DEC A;  1N7N A;  3MV1 1;  1HN0 A;  3DYM A;  4DUW A;  3VD4 A;  5A1A A;  1ULV A;  1K1W A;  2CIS A;  2E24 A;  1JZ5 A;  1YQ2 A;  1HM3 A;  1NSX A;  1OJN A;  1LF6 A;  2WCO A;  2JKE A;  4BZF A;  2E22 A;  1K1X A;  1PX4 A;  1NSR A;  3VDB A;  1NS0 A;  2WW0 A;  1JYX A;  2XSG A;  4AQ0 A;  1J0M A;  1RWA A;  2ZXQ A;  3T09 A;  1N7R A;  3BGA A;  2WW3 A;  1LXK A;  1N7Q A;  3VDC A;  3MUZ 1;  3WFA A;  1MMU A;  1OJO A;  3MV0 1;  1RW9 A;  3I3D A;  1C82 A;  1LXM A;  1N7O A;  2WW2 A;  1JZ7 A;  2HTB A;  1LUR A;  5E1Q A;  3T2Q A;  3NJV A;  1SO0 A;  3CZJ A;  3I3E A;  2Q1F A;  2BRW A;  3MWX A;  3DYP A;  3T2O A;  1MMZ A;  1PX3 A;  1X1I A;  1HMW A;  2WVX B;  1JYV A;  2BRV X;  1EGU A;  1F4A A;  3IAQ A;  1HM2 A;  1RWG A;  2WVZ A;  1RWC A;  2WW1 A;  2WVY A;  1OJM A;  2WVX A;  3E1F 1;  2X03 A;  3T0A A;  3NRE A;  1F1S A;  1MMY A;  1F9G A;  1NSS A;  1NKG A;  3VD9 A;  1HMU A;  3T2P A;  4BZE A;  3I3B A;  3ECQ A;  2D73 A;  3VDA A;  1RWF A;  1L7K A;  3SEP A;  1JZ2 A;  3VD5 A;  1I8Q A;  3OBA A;  3DCD A;  3IMH A;  2WZS A;  2ZQ0 A;  1CB8 A;  1NSU A;  3OS7 A; 
#chains in the Genus database with same CATH topology
 2BRP A;  2F1A A;  1IQY A;  3VD3 A;  3AMO B;  1W3Y A;  3DX4 A;  2WOF A;  3NJX A;  4BTY A;  3NBB A;  2OW6 A;  4BTX A;  1UG9 A;  3BVX A;  2CFK A;  1W6C A;  1JOV A;  1NS4 A;  3D4Z A;  1HXK A;  1SPU A;  1JYN A;  4DUX A;  3EJS A;  3RRS A;  3D3I A;  3QG0 A;  1UI7 A;  1NSZ A;  3DYO A;  4BZH A;  4NEI A;  4MMH A;  1SII A;  3BUD A;  2OOV C;  2F7O A;  3T0B A;  4RNL A;  1RWH A;  1Z45 A;  2D1W A;  1NS2 A;  3D51 A;  3BVT A;  1MN0 A;  1QX1 A;  2CIS A;  2F7Q A;  5JMD A;  2F7R A;  2WCO A;  2JKE A;  2E22 A;  3RSY A;  1K1X A;  2Y74 A;  1PX4 A;  1RWA A;  2FUQ A;  3BGA A;  3VDC A;  3ACS A;  1QWU A;  1RW9 A;  3I3D A;  1C82 A;  3PGB A;  3DDG A;  4KFE A;  3W7X A;  2ALW A;  1QAK A;  3DYP A;  1H54 A;  3T2O A;  2CG0 A;  2WVX B;  1HM2 A;  2WVZ A;  5GW7 A;  1D6Z A;  4FNP A;  3E1F 1;  2FUT A;  3WVF A;  1IVV A;  1HMU A;  3A0O A;  3I3B A;  3ECQ A;  3LOY A;  2WYI A;  3X3Z A;  3CV5 A;  4EV5 A;  3OBA A;  3DCD A;  4OK4 A;  2C10 A;  4FNU A;  3WIR A;  4K3A A;  3MPH A;  3S4C A;  1LOH A;  1TQV A;  4K35 A;  3N9H A;  2OQE C;  3D4Y A;  1X1J A;  3X42 A;  1IVW A;  1JZ4 A;  3AMO A;  1MMX A;  3QFZ A;  3BUP A;  3EJT A;  1LVN A;  3K25 A;  2CQS A;  1NS8 A;  3Q1N A;  1AVK A;  1JZ3 A;  4BTW A;  3ACT A;  3BVU A;  3MI6 A;  1JZ6 A;  1O7D D;  2CWT A;  2WYH A;  1NSV A;  2HTA A;  1WMO A;  2C11 A;  2CIR A;  3MV1 1;  1N7N A;  1HN0 A;  4DUW A;  2WGQ A;  3BVV A;  1K1W A;  1YQ2 A;  1OJN A;  4BZF A;  3HIG A;  3VDB A;  3EJR A;  4AQ0 A;  1LXK A;  1N7Q A;  4KTP A;  3X3X A;  3WFA A;  1MMU A;  1RJO A;  1W5Z A;  3BUQ A;  3MV0 1;  2EAD A;  1LXM A;  1JZ7 A;  5E1Q A;  4OK2 A;  1QWN A;  3CZJ A;  1TQT A;  1DYU A;  1MMZ A;  1X1I A;  4MMI A;  1JYV A;  3K5T A;  2FYV A;  4UFC A;  1RWG A;  2WW1 A;  1US1 A;  2WVY A;  1OJM A;  2EAB A;  2WVX A;  2X03 A;  2ZL8 A;  1QAF A;  4EV2 A;  3S4B A;  2YX9 A;  4BZE A;  2D73 A;  1RWF A;  1L7K A;  2WO0 A;  3VD5 A;  3W7W A;  1TQW A;  1V7V A;  1CB8 A;  2W0Q A;  1NSU A;  1J0N A;  2CWU A;  1NS7 A;  1X1H A;  2CIQ A;  3W7U A;  2WDA A;  3E7J A;  3A24 A;  2XN0 A;  4DUV A;  3T0U A;  3AFJ A;  1K1Y A;  2BT3 A;  1JYW A;  1AV4 A;  4FNT A;  3VD7 A;  1OAC A;  1HWW A;  3CZS A;  2CFW A;  2E2V A;  3BLC A;  1EKM A;  2E2U A;  1DP0 A;  1TXK A;  3WA2 X;  3BVW A;  3J7H A;  1QAL A;  1JZ8 A;  2OQE A;  1W4N A;  1IVX A;  5A1A A;  1A2V A;  2E24 A;  3WA3 A;  3E80 A;  2F18 A;  1V7W A;  3NBJ A;  1NS0 A;  3HII A;  5JMF A;  1JYX A;  4KFD A;  1J0M A;  2ZXQ A;  1N7R A;  3VSM A;  1N7O A;  2WW2 A;  3BLB A;  2HTB A;  2F1B A;  3T2Q A;  3NJV A;  1SO0 A;  1UI8 A;  3I3E A;  2Q1F A;  3W7T A;  3VSN A;  1PX3 A;  1HMW A;  2BRV X;  1EGU A;  4OJZ A;  3X41 A;  3T0A A;  3S4D A;  3NRE A;  3X40 A;  1F1S A;  1MMY A;  1F9G A;  1N9E A;  3VD9 A;  3EJP A;  2OOV A;  3T2P A;  3EJQ A;  5KBP A;  1W7C A;  3SEP A;  3EJU A;  1I8Q A;  2XN1 A;  3IMH A;  2WZS A;  5CA3 A;  1R34 A;  3OS7 A;  1N7P A;  1SNZ A;  2JKP A;  1IU7 A;  2CG1 A;  4FNQ A;  3IAP A;  3HI7 A;  3W7S A;  4FNV A;  2CQT A;  1L7J A;  3AFL A;  2XHN A;  4FNS A;  3BUB A;  2WOH A;  1NSM A;  3TY1 A;  3OB8 A;  2CFL A;  3CZN A;  1D6Y A;  2F7P A;  2EAC A;  4J5T A;  4TTG A;  1OJP A;  2E2T A;  3MUY 1;  1PU4 A;  1HN1 A;  1F4H A;  3T0D A;  1LF9 A;  2JKA A;  3T08 A;  3DDF A;  3BUI A;  3DX3 A;  1YGA A;  1SIH A;  1D6U A;  2CFG A;  3DEC A;  1PS3 A;  3DYM A;  3VD4 A;  3DX0 A;  1ULV A;  1JZ5 A;  1IVU A;  1HM3 A;  1NSX A;  1IQX A;  1LF6 A;  1TQS A;  3ALA A;  1NSR A;  2PNC A;  3WIQ A;  2WW0 A;  2XSG A;  3LVT A;  3T09 A;  2WW3 A;  3MUZ 1;  3D52 A;  1OJO A;  3BS6 A;  3SXX A;  2YFO A;  1LUR A;  1WMP A;  1W6G A;  2BRW A;  4FNR A;  3MWX A;  1TU5 A;  1W2Z A;  2OW7 A;  3S4A A;  1F4A A;  1HTY A;  2YFN A;  1KSI A;  3IAQ A;  3SX1 A;  3KN4 A;  4KFF A;  1RWC A;  2CWV A;  3DX1 A;  1TQU A;  3X3Y A;  3DX2 A;  1NSS A;  1NKG A;  2EAE A;  1JRQ A;  1R33 A;  4KTR A;  3VDA A;  3QFY A;  1RKY A;  3QDE A;  1JZ2 A;  2RDY A;  3D50 A;  1AVL A;  1V7X A;  2XN2 A;  2Y73 A;  1WMN A;  2CFD A;  2ZQ0 A;  3KII A;  4BZG A; 
#chains in the Genus database with same CATH homology
 2BRP A;  1N7P A;  1J0N A;  1SNZ A;  1LOH A;  2JKP A;  3VD3 A;  1NS7 A;  1W3Y A;  3IAP A;  3NJX A;  1X1J A;  1X1H A;  1JZ4 A;  2CIQ A;  4BZG A;  2WDA A;  3E7J A;  1MMX A;  3A24 A;  4FNV A;  1L7J A;  3AFL A;  2XHN A;  3K25 A;  4DUV A;  1NSM A;  3TY1 A;  1UG9 A;  1K1Y A;  1JYW A;  1NS8 A;  3OB8 A;  3Q1N A;  1JOV A;  1NS4 A;  3VD7 A;  1JYN A;  4DUX A;  4J5T A;  1JZ3 A;  4TTG A;  3BLC A;  1OJP A;  3MUY 1;  1HN1 A;  1DP0 A;  1NSZ A;  1TXK A;  3DYO A;  4BZH A;  3J7H A;  4NEI A;  4MMH A;  1F4H A;  3T0D A;  1LF9 A;  3T0B A;  4RNL A;  1RWH A;  1Z45 A;  2JKA A;  1JZ6 A;  3T08 A;  1NSV A;  1JZ8 A;  1YGA A;  2HTA A;  2CIR A;  1NS2 A;  1MN0 A;  3DEC A;  1N7N A;  3MV1 1;  1HN0 A;  3DYM A;  4DUW A;  3VD4 A;  5A1A A;  1ULV A;  1K1W A;  2CIS A;  2E24 A;  1JZ5 A;  1YQ2 A;  1HM3 A;  1NSX A;  1OJN A;  5JMD A;  1LF6 A;  3E80 A;  2WCO A;  2JKE A;  4BZF A;  2E22 A;  1K1X A;  1PX4 A;  1NSR A;  3VDB A;  1NS0 A;  2WW0 A;  5JMF A;  1JYX A;  2XSG A;  4AQ0 A;  1J0M A;  1RWA A;  2FUQ A;  2ZXQ A;  3T09 A;  1N7R A;  3BGA A;  2WW3 A;  1LXK A;  1N7Q A;  3VDC A;  3MUZ 1;  3WFA A;  1MMU A;  1OJO A;  3BS6 A;  3MV0 1;  1RW9 A;  3VSM A;  3I3D A;  1C82 A;  1LXM A;  1N7O A;  2WW2 A;  1JZ7 A;  2HTB A;  1LUR A;  5E1Q A;  3T2Q A;  4OK2 A;  3NJV A;  1SO0 A;  3CZJ A;  3I3E A;  2Q1F A;  2BRW A;  3MWX A;  3DYP A;  3T2O A;  1MMZ A;  3VSN A;  1PX3 A;  1X1I A;  1HMW A;  2WVX B;  4MMI A;  1JYV A;  2BRV X;  1EGU A;  1F4A A;  3IAQ A;  4OJZ A;  1HM2 A;  1RWG A;  2WVZ A;  1RWC A;  2WW1 A;  2WVY A;  1OJM A;  2WVX A;  3E1F 1;  2X03 A;  2FUT A;  3T0A A;  3NRE A;  1F1S A;  1MMY A;  1F9G A;  1NSS A;  1NKG A;  3WVF A;  3VD9 A;  1HMU A;  3A0O A;  3T2P A;  4BZE A;  3I3B A;  3ECQ A;  2D73 A;  3VDA A;  1RWF A;  1L7K A;  3SEP A;  1JZ2 A;  3VD5 A;  1I8Q A;  3OBA A;  3DCD A;  4OK4 A;  3IMH A;  2WZS A;  2ZQ0 A;  1CB8 A;  1NSU A;  3OS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...