1NS4A

Crystal structure of galactose mutarotase from lactococcus lactis mutant e304q complexed with glucose
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
339
structure length
339
Chain Sequence
b'SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFQCQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 98
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns4A00
1F9GA 2CIRA 2HTAA 2WDAA 3MWXA 3NREA 1NKGA 3VD3A 1JZ6A 3SEPA 1HM2A 3OS7A 4BZEA 2WZSA 4DUVA 3WFAA 3DECA 4DUWA 2WW1A 3VD9A 1MMYA 3VD7A 2XHNA 3NJXA 4RNLA 1RWAA 2HTBA 3OBAA 1N7QA 3VDBA 1RWHA 1YGAA 1MN0A 1JZ2A 1YQ2A 1DP0A 1K1WA 1F4AA 1SO0A 1TXKA 2WVXB 2WW3A 4DUXA 1CB8A 2WW0A 1K1YA 2Q1FA 1MMZA 3T0DA 3VDAA 1NS7A 1OJOA 3VDCA 1JZ7A 1RW9A 1HN0A 3T0AA 3VD5A 1N7RA 3MV11 1LF9A 2JKAA 5E1QA 1NS0A 1OJMA 3I3EA 2X03A 4AQ0A 4BZFA 3IMHA 2CIQA 1HM3A 1C82A 2BRWA 3CZJA 1Z45A 1NSSA 1JYXA 1JZ4A 1N7NA 1RWFA 3T2PA 1W3YA 4BZHA 1JYWA 1SNZA 1JOVA 1NSXA 3I3DA 3VD4A 1JZ3A 1OJNA 1JYNA 2XSGA 1LXMA 2ZXQA 1NSUA 3MUZ1 1X1JA 2CISA 1L7KA 3MUY1 1HN1A 2E24A 4BZGA 1PX3A 1ULVA 3OB8A 1LXKA 1NS2A 3Q1NA 3ECQA 3IAPA 1J0NA 1HMUA 1L7JA 1LOHA 1F1SA 3A24A 2WW2A 3T2QA 3DYPA 1N7PA 1JZ8A 2BRVX 1I8QA 1RWCA 3T0BA 1HMWA 1NSVA 1RWGA 3E1F1 3K25A 3MV01 1K1XA 1PX4A 1MMUA 2D73A 2JKEA 3DCDA 3T2OA 1JZ5A 1NSZA 5A1AA 1NS4A 2BRPA 2WVXA 1MMXA 1OJPA 2ZQ0A 1NSRA 1UG9A 4TTGA 1F4HA 1N7OA 2WCOA 3IAQA 1JYVA 3T09A 1J0MA 3NJVA 1LF6A 3T08A 1NS8A 2JKPA 3I3BA 3J7HA 1EGUA 1X1IA 3BGAA 2WVZA 2WVYA 1LURA 3DYMA 1NSMA 1X1HA 2E22A 3DYOA
chains in the Genus database with same CATH superfamily
1SIHA 1F9GA 3NREA 3AMOB 1OACA 4BZEA 2WZSA 3QFYA 1QX1A 4FNVA 2YFNA 3NJXA 3BUDA 3D52A 3OBAA 3VDBA 3W7TA 3SXXA 1W5ZA 3X3ZA 4DUXA 1CB8A 2WW0A 2C10A 1NS7A 1TQSA 3WIQA 1HN0A 3DX0A 3X40A 3KIIA 3I3EA 2X03A 2CIQA 3K5TA 4BTYA 1Z45A 1W3YA 3BVVA 1JYWA 2CWVA 4FNUA 1NSXA 1WMOA 1JZ3A 1OJNA 1JYNA 2D1WA 1LXMA 1L7KA 2WGQA 3BUBA 4K3AA 1PX3A 3AFLA 3MI6A 3ECQA 1J0NA 1HMUA 1F1SA 3DYPA 2FYVA 2BRVX 1SPUA 3W7SA 3W7XA 1K1XA 1MMUA 1QAFA 1MMXA 3D4YA 1QALA 2F1AA 4FNPA 4TTGA 1JYVA 1H54A 1J0MA 3NJVA 3T08A 1NS8A 3WIRA 2JKPA 1HTYA 2CWUA 1X1IA 1LVNA 3BLBA 2CFGA 1PS3A 4NEIA 3DYMA 3QG0A 3DYOA 2HTAA 4KFEA 3X41A 1JZ6A 3KN4A 2CFKA 3D4ZA 3WFAA 3DX1A 4DUWA 4KFDA 2E2TA 3VD9A 1RWAA 1IVUA 2FUTA 1MN0A 1JZ2A 1RJOA 1TXKA 1IQYA 2CFLA 1K1YA 4FNSA 1MMZA 3T0DA 2BT3A 3TY1A 3VDCA 1D6YA 3CZNA 3T0AA 2CQSA 3MV11 2CG0A 2WOFA 1AVKA 1LF9A 1TQTA 1W6GA 1NS0A 4AQ0A 3DX3A 1HM3A 1C82A 1V7XA 5GW7A 3CZJA 4OK2A 1RWFA 2OW6A 4BZHA 3QDEA 3I3DA 2ZXQA 4BTXA 2YFOA 1HWWA 1NSUA 3BVTA 3MUZ1 3EJQA 1TQVA 3LOYA 4BZGA 2C11A 2CWTA 1ULVA 1LXKA 4OJZA 4K35A 2W0QA 1QAKA 1JZ8A 2F7RA 1NSVA 3S4AA 4EV5A 4FNTA 2F7QA 1NS4A 2BRPA 2WVXA 2OQEA 2ZL8A 2OOVA 1N9EA 3LVTA 1F4HA 3IAQA 3BLCA 3I3BA 3WVFA 3VSNA 3PGBA 3WA3A 1EKMA 1HXKA 1A2VA 1O7DD 1W2ZA 2WVYA 1SIIA 2EAEA 4MMIA 4BTWA 1W4NA 2WDAA 1TQUA 2WO0A 1NKGA 1UI8A 2E2VA 3AFJA 3D51A 3VSMA 4J5TA 1HM2A 3BUPA 3OS7A 3DECA 3X42A 2OW7A 1MMYA 2XHNA 1R34A 1IQXA 2HTBA 1UI7A 1N7QA 1RWHA 5CA3A 1YGAA 2F7OA 1IVXA 3BS6A 3E7JA 3ALAA 1YQ2A 1DP0A 3WA2X 1F4AA 1SO0A 2CG1A 3DX4A 2YX9A 2Q1FA 4UFCA 1OJOA 2Y74A 3QFZA 3S4CA 2JKAA 3W7UA 1IVWA 5E1QA 3D50A 4FNRA 2OQEC 2OOVC 1QWUA 1D6UA 3EJPA 3T2PA 5JMDA 3MPHA 2CFDA 1SNZA 1W6CA 3EJRA 2XSGA 3S4DA 2Y73A 3W7WA 1X1JA 2CISA 3CV5A 3MUY1 2F7PA 4KFFA 1NS2A 3AMOA 1JRQA 3DDFA 1LOHA 5KBPA 2WYIA 2EACA 2WW2A 3T2QA 2WYHA 1N7PA 3X3YA 2ALWA 1I8QA 2WOHA 1RWGA 3E1F1 3K25A 3MV01 1PX4A 3HIGA 4OK4A 2D73A 2JKEA 2RDYA 3T2OA 1JZ5A 2XN0A 1NSZA 5A1AA 3BUQA 1WMNA 2ZQ0A 1NSRA 3HIIA 3BUIA 3T09A 3NBJA 3BGAA 5JMFA 2WVZA 4FNQA 1LURA 3BVWA 1AV4A 3Q1NA 4KTRA 2CIRA 3NBBA 3A0OA 3MWXA 3ACSA 3VD3A 3X3XA 4EV2A 3SEPA 3RRSA 1QWNA 4DUVA 3HI7A 2WW1A 3VD7A 1US1A 2PNCA 4RNLA 2FUQA 3BVUA 3BVXA 2CQTA 1TQWA 2F1BA 2WVXB 1K1WA 2WW3A 3EJTA 3VDAA 1IVVA 1JZ7A 1D6ZA 1RW9A 3VD5A 1N7RA 2F18A 2CFWA 1OJMA 4BZFA 3IMHA 3N9HA 2BRWA 1PU4A 3D3IA 1KSIA 1NSSA 1JYXA 1JZ4A 1N7NA 1JOVA 3VD4A 1HN1A 2E24A 3SX1A 1RKYA 3OB8A 1V7VA 3IAPA 1L7JA 1TU5A 3A24A 1IU7A 3ACTA 3RSYA 1RWCA 3T0BA 2E2UA 1HMWA 4KTPA 2XN2A 3DCDA 3T0UA 1WMPA 2XN1A 1DYUA 1OJPA 1UG9A 3EJUA 4MMHA 2EABA 1N7OA 2WCOA 1AVLA 1LF6A 1W7CA 3S4BA 3J7HA 1EGUA 3DDGA 3CZSA 3E80A 1V7WA 3DX2A 2EADA 1NSMA 1X1HA 3EJSA 2E22A 1R33A
chains in the Genus database with same CATH topology
1F9GA 2CIRA 2HTAA 2WDAA 3A0OA 3MWXA 1NKGA 3NREA 3VD3A 1JZ6A 3SEPA 3VSMA 4J5TA 1HM2A 3OS7A 4BZEA 2WZSA 4DUVA 3WFAA 3DECA 4FNVA 4DUWA 2WW1A 3VD9A 1MMYA 3VD7A 2XHNA 3NJXA 4RNLA 1RWAA 2FUQA 2HTBA 3OBAA 1N7QA 3VDBA 1RWHA 2FUTA 1YGAA 1MN0A 3BS6A 3E7JA 1JZ2A 1YQ2A 1DP0A 1K1WA 1F4AA 1SO0A 1TXKA 2WVXB 2WW3A 4DUXA 1CB8A 2WW0A 1K1YA 2Q1FA 1MMZA 3T0DA 3VDAA 1NS7A 1OJOA 3TY1A 3VDCA 1JZ7A 1RW9A 1HN0A 3T0AA 3VD5A 1N7RA 3MV11 1LF9A 2JKAA 5E1QA 1NS0A 1OJMA 3I3EA 2X03A 4AQ0A 4BZFA 3IMHA 2CIQA 1HM3A 1C82A 2BRWA 3CZJA 1Z45A 1NSSA 1JYXA 1JZ4A 1N7NA 4OK2A 1RWFA 3T2PA 5JMDA 1W3YA 4BZHA 1JYWA 1SNZA 1JOVA 1NSXA 3I3DA 3VD4A 1JZ3A 1OJNA 1JYNA 2XSGA 1LXMA 2ZXQA 1NSUA 3MUZ1 1X1JA 2CISA 1L7KA 3MUY1 1HN1A 2E24A 4BZGA 1PX3A 3AFLA 1ULVA 3OB8A 1LXKA 4OJZA 1NS2A 3Q1NA 3ECQA 3IAPA 1J0NA 1HMUA 1L7JA 1LOHA 1F1SA 3A24A 2WW2A 3T2QA 3DYPA 1N7PA 1JZ8A 2BRVX 1I8QA 1RWCA 3T0BA 1HMWA 1NSVA 1RWGA 3E1F1 3K25A 3MV01 1K1XA 1PX4A 1MMUA 2D73A 2JKEA 4OK4A 3DCDA 3T2OA 1JZ5A 1NSZA 5A1AA 1NS4A 2BRPA 2WVXA 1MMXA 1OJPA 2ZQ0A 1NSRA 1UG9A 4MMHA 4TTGA 1F4HA 1N7OA 2WCOA 3IAQA 1JYVA 3T09A 1J0MA 3NJVA 1LF6A 3T08A 1NS8A 3BLCA 2JKPA 3I3BA 3J7HA 1EGUA 1X1IA 3BGAA 3VSNA 3WVFA 5JMFA 2WVZA 2WVYA 3E80A 1LURA 4NEIA 3DYMA 1NSMA 1X1HA 4MMIA 2E22A 3DYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9G A;  2CIR A;  2HTA A;  2WDA A;  3MWX A;  3NRE A;  1NKG A;  3VD3 A;  1JZ6 A;  3SEP A;  1HM2 A;  3OS7 A;  4BZE A;  2WZS A;  4DUV A;  3WFA A;  3DEC A;  4DUW A;  2WW1 A;  3VD9 A;  1MMY A;  3VD7 A;  2XHN A;  3NJX A;  4RNL A;  1RWA A;  2HTB A;  3OBA A;  1N7Q A;  3VDB A;  1RWH A;  1YGA A;  1MN0 A;  1JZ2 A;  1YQ2 A;  1DP0 A;  1K1W A;  1F4A A;  1SO0 A;  1TXK A;  2WVX B;  2WW3 A;  4DUX A;  1CB8 A;  2WW0 A;  1K1Y A;  2Q1F A;  1MMZ A;  3T0D A;  3VDA A;  1NS7 A;  1OJO A;  3VDC A;  1JZ7 A;  1RW9 A;  1HN0 A;  3T0A A;  3VD5 A;  1N7R A;  3MV1 1;  1LF9 A;  2JKA A;  5E1Q A;  1NS0 A;  1OJM A;  3I3E A;  2X03 A;  4AQ0 A;  4BZF A;  3IMH A;  2CIQ A;  1HM3 A;  1C82 A;  2BRW A;  3CZJ A;  1Z45 A;  1NSS A;  1JYX A;  1JZ4 A;  1N7N A;  1RWF A;  3T2P A;  1W3Y A;  4BZH A;  1JYW A;  1SNZ A;  1JOV A;  1NSX A;  3I3D A;  3VD4 A;  1JZ3 A;  1OJN A;  1JYN A;  2XSG A;  1LXM A;  2ZXQ A;  1NSU A;  3MUZ 1;  1X1J A;  2CIS A;  1L7K A;  3MUY 1;  1HN1 A;  2E24 A;  4BZG A;  1PX3 A;  1ULV A;  3OB8 A;  1LXK A;  1NS2 A;  3Q1N A;  3ECQ A;  3IAP A;  1J0N A;  1HMU A;  1L7J A;  1LOH A;  1F1S A;  3A24 A;  2WW2 A;  3T2Q A;  3DYP A;  1N7P A;  1JZ8 A;  2BRV X;  1I8Q A;  1RWC A;  3T0B A;  1HMW A;  1NSV A;  1RWG A;  3E1F 1;  3K25 A;  3MV0 1;  1K1X A;  1PX4 A;  1MMU A;  2D73 A;  2JKE A;  3DCD A;  3T2O A;  1JZ5 A;  1NSZ A;  5A1A A;  1NS4 A;  2BRP A;  2WVX A;  1MMX A;  1OJP A;  2ZQ0 A;  1NSR A;  1UG9 A;  4TTG A;  1F4H A;  1N7O A;  2WCO A;  3IAQ A;  1JYV A;  3T09 A;  1J0M A;  3NJV A;  1LF6 A;  3T08 A;  1NS8 A;  2JKP A;  3I3B A;  3J7H A;  1EGU A;  1X1I A;  3BGA A;  2WVZ A;  2WVY A;  1LUR A;  3DYM A;  1NSM A;  1X1H A;  2E22 A;  3DYO A; 
#chains in the Genus database with same CATH topology
 1SIH A;  1F9G A;  3NRE A;  3AMO B;  1OAC A;  4BZE A;  2WZS A;  3QFY A;  1QX1 A;  4FNV A;  2YFN A;  3NJX A;  3BUD A;  3D52 A;  3OBA A;  3VDB A;  3W7T A;  3SXX A;  1W5Z A;  3X3Z A;  4DUX A;  1CB8 A;  2WW0 A;  2C10 A;  1NS7 A;  1TQS A;  3WIQ A;  1HN0 A;  3DX0 A;  3X40 A;  3KII A;  3I3E A;  2X03 A;  2CIQ A;  3K5T A;  4BTY A;  1Z45 A;  1W3Y A;  3BVV A;  1JYW A;  2CWV A;  4FNU A;  1NSX A;  1WMO A;  1JZ3 A;  1OJN A;  1JYN A;  2D1W A;  1LXM A;  1L7K A;  2WGQ A;  3BUB A;  4K3A A;  1PX3 A;  3AFL A;  3MI6 A;  3ECQ A;  1J0N A;  1HMU A;  1F1S A;  3DYP A;  2FYV A;  2BRV X;  1SPU A;  3W7S A;  3W7X A;  1K1X A;  1MMU A;  1QAF A;  1MMX A;  3D4Y A;  1QAL A;  2F1A A;  4FNP A;  4TTG A;  1JYV A;  1H54 A;  1J0M A;  3NJV A;  3T08 A;  1NS8 A;  3WIR A;  2JKP A;  1HTY A;  2CWU A;  1X1I A;  1LVN A;  3BLB A;  2CFG A;  1PS3 A;  4NEI A;  3DYM A;  3QG0 A;  3DYO A;  2HTA A;  4KFE A;  3X41 A;  1JZ6 A;  3KN4 A;  2CFK A;  3D4Z A;  3WFA A;  3DX1 A;  4DUW A;  4KFD A;  2E2T A;  3VD9 A;  1RWA A;  1IVU A;  2FUT A;  1MN0 A;  1JZ2 A;  1RJO A;  1TXK A;  1IQY A;  2CFL A;  1K1Y A;  4FNS A;  1MMZ A;  3T0D A;  2BT3 A;  3TY1 A;  3VDC A;  1D6Y A;  3CZN A;  3T0A A;  2CQS A;  3MV1 1;  2CG0 A;  2WOF A;  1AVK A;  1LF9 A;  1TQT A;  1W6G A;  1NS0 A;  4AQ0 A;  3DX3 A;  1HM3 A;  1C82 A;  1V7X A;  5GW7 A;  3CZJ A;  4OK2 A;  1RWF A;  2OW6 A;  4BZH A;  3QDE A;  3I3D A;  2ZXQ A;  4BTX A;  2YFO A;  1HWW A;  1NSU A;  3BVT A;  3MUZ 1;  3EJQ A;  1TQV A;  3LOY A;  4BZG A;  2C11 A;  2CWT A;  1ULV A;  1LXK A;  4OJZ A;  4K35 A;  2W0Q A;  1QAK A;  1JZ8 A;  2F7R A;  1NSV A;  3S4A A;  4EV5 A;  4FNT A;  2F7Q A;  1NS4 A;  2BRP A;  2WVX A;  2OQE A;  2ZL8 A;  2OOV A;  1N9E A;  3LVT A;  1F4H A;  3IAQ A;  3BLC A;  3I3B A;  3WVF A;  3VSN A;  3PGB A;  3WA3 A;  1EKM A;  1HXK A;  1A2V A;  1O7D D;  1W2Z A;  2WVY A;  1SII A;  2EAE A;  4MMI A;  4BTW A;  1W4N A;  2WDA A;  1TQU A;  2WO0 A;  1NKG A;  1UI8 A;  2E2V A;  3AFJ A;  3D51 A;  3VSM A;  4J5T A;  1HM2 A;  3BUP A;  3OS7 A;  3DEC A;  3X42 A;  2OW7 A;  1MMY A;  2XHN A;  1R34 A;  1IQX A;  2HTB A;  1UI7 A;  1N7Q A;  1RWH A;  5CA3 A;  1YGA A;  2F7O A;  1IVX A;  3BS6 A;  3E7J A;  3ALA A;  1YQ2 A;  1DP0 A;  3WA2 X;  1F4A A;  1SO0 A;  2CG1 A;  3DX4 A;  2YX9 A;  2Q1F A;  4UFC A;  1OJO A;  2Y74 A;  3QFZ A;  3S4C A;  2JKA A;  3W7U A;  1IVW A;  5E1Q A;  3D50 A;  4FNR A;  2OQE C;  2OOV C;  1QWU A;  1D6U A;  3EJP A;  3T2P A;  5JMD A;  3MPH A;  2CFD A;  1SNZ A;  1W6C A;  3EJR A;  2XSG A;  3S4D A;  2Y73 A;  3W7W A;  1X1J A;  2CIS A;  3CV5 A;  3MUY 1;  2F7P A;  4KFF A;  1NS2 A;  3AMO A;  1JRQ A;  3DDF A;  1LOH A;  5KBP A;  2WYI A;  2EAC A;  2WW2 A;  3T2Q A;  2WYH A;  1N7P A;  3X3Y A;  2ALW A;  1I8Q A;  2WOH A;  1RWG A;  3E1F 1;  3K25 A;  3MV0 1;  1PX4 A;  3HIG A;  4OK4 A;  2D73 A;  2JKE A;  2RDY A;  3T2O A;  1JZ5 A;  2XN0 A;  1NSZ A;  5A1A A;  3BUQ A;  1WMN A;  2ZQ0 A;  1NSR A;  3HII A;  3BUI A;  3T09 A;  3NBJ A;  3BGA A;  5JMF A;  2WVZ A;  4FNQ A;  1LUR A;  3BVW A;  1AV4 A;  3Q1N A;  4KTR A;  2CIR A;  3NBB A;  3A0O A;  3MWX A;  3ACS A;  3VD3 A;  3X3X A;  4EV2 A;  3SEP A;  3RRS A;  1QWN A;  4DUV A;  3HI7 A;  2WW1 A;  3VD7 A;  1US1 A;  2PNC A;  4RNL A;  2FUQ A;  3BVU A;  3BVX A;  2CQT A;  1TQW A;  2F1B A;  2WVX B;  1K1W A;  2WW3 A;  3EJT A;  3VDA A;  1IVV A;  1JZ7 A;  1D6Z A;  1RW9 A;  3VD5 A;  1N7R A;  2F18 A;  2CFW A;  1OJM A;  4BZF A;  3IMH A;  3N9H A;  2BRW A;  1PU4 A;  3D3I A;  1KSI A;  1NSS A;  1JYX A;  1JZ4 A;  1N7N A;  1JOV A;  3VD4 A;  1HN1 A;  2E24 A;  3SX1 A;  1RKY A;  3OB8 A;  1V7V A;  3IAP A;  1L7J A;  1TU5 A;  3A24 A;  1IU7 A;  3ACT A;  3RSY A;  1RWC A;  3T0B A;  2E2U A;  1HMW A;  4KTP A;  2XN2 A;  3DCD A;  3T0U A;  1WMP A;  2XN1 A;  1DYU A;  1OJP A;  1UG9 A;  3EJU A;  4MMH A;  2EAB A;  1N7O A;  2WCO A;  1AVL A;  1LF6 A;  1W7C A;  3S4B A;  3J7H A;  1EGU A;  3DDG A;  3CZS A;  3E80 A;  1V7W A;  3DX2 A;  2EAD A;  1NSM A;  1X1H A;  3EJS A;  2E22 A;  1R33 A; 
#chains in the Genus database with same CATH homology
 1F9G A;  2CIR A;  2HTA A;  2WDA A;  3A0O A;  3MWX A;  1NKG A;  3NRE A;  3VD3 A;  1JZ6 A;  3SEP A;  3VSM A;  4J5T A;  1HM2 A;  3OS7 A;  4BZE A;  2WZS A;  4DUV A;  3WFA A;  3DEC A;  4FNV A;  4DUW A;  2WW1 A;  3VD9 A;  1MMY A;  3VD7 A;  2XHN A;  3NJX A;  4RNL A;  1RWA A;  2FUQ A;  2HTB A;  3OBA A;  1N7Q A;  3VDB A;  1RWH A;  2FUT A;  1YGA A;  1MN0 A;  3BS6 A;  3E7J A;  1JZ2 A;  1YQ2 A;  1DP0 A;  1K1W A;  1F4A A;  1SO0 A;  1TXK A;  2WVX B;  2WW3 A;  4DUX A;  1CB8 A;  2WW0 A;  1K1Y A;  2Q1F A;  1MMZ A;  3T0D A;  3VDA A;  1NS7 A;  1OJO A;  3TY1 A;  3VDC A;  1JZ7 A;  1RW9 A;  1HN0 A;  3T0A A;  3VD5 A;  1N7R A;  3MV1 1;  1LF9 A;  2JKA A;  5E1Q A;  1NS0 A;  1OJM A;  3I3E A;  2X03 A;  4AQ0 A;  4BZF A;  3IMH A;  2CIQ A;  1HM3 A;  1C82 A;  2BRW A;  3CZJ A;  1Z45 A;  1NSS A;  1JYX A;  1JZ4 A;  1N7N A;  4OK2 A;  1RWF A;  3T2P A;  5JMD A;  1W3Y A;  4BZH A;  1JYW A;  1SNZ A;  1JOV A;  1NSX A;  3I3D A;  3VD4 A;  1JZ3 A;  1OJN A;  1JYN A;  2XSG A;  1LXM A;  2ZXQ A;  1NSU A;  3MUZ 1;  1X1J A;  2CIS A;  1L7K A;  3MUY 1;  1HN1 A;  2E24 A;  4BZG A;  1PX3 A;  3AFL A;  1ULV A;  3OB8 A;  1LXK A;  4OJZ A;  1NS2 A;  3Q1N A;  3ECQ A;  3IAP A;  1J0N A;  1HMU A;  1L7J A;  1LOH A;  1F1S A;  3A24 A;  2WW2 A;  3T2Q A;  3DYP A;  1N7P A;  1JZ8 A;  2BRV X;  1I8Q A;  1RWC A;  3T0B A;  1HMW A;  1NSV A;  1RWG A;  3E1F 1;  3K25 A;  3MV0 1;  1K1X A;  1PX4 A;  1MMU A;  2D73 A;  2JKE A;  4OK4 A;  3DCD A;  3T2O A;  1JZ5 A;  1NSZ A;  5A1A A;  1NS4 A;  2BRP A;  2WVX A;  1MMX A;  1OJP A;  2ZQ0 A;  1NSR A;  1UG9 A;  4MMH A;  4TTG A;  1F4H A;  1N7O A;  2WCO A;  3IAQ A;  1JYV A;  3T09 A;  1J0M A;  3NJV A;  1LF6 A;  3T08 A;  1NS8 A;  3BLC A;  2JKP A;  3I3B A;  3J7H A;  1EGU A;  1X1I A;  3BGA A;  3VSN A;  3WVF A;  5JMF A;  2WVZ A;  2WVY A;  3E80 A;  1LUR A;  4NEI A;  3DYM A;  1NSM A;  1X1H A;  4MMI A;  2E22 A;  3DYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...