1NS7A

Crystal structure of galactose mutarotase from lactococcus lactis mutant e304a complexed with glucose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
339
structure length
339
Chain Sequence
b'SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFACQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 96
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns7A00
3J7HA 1JYNA 3VD5A 2BRPA 3IMHA 2XSGA 3DCDA 3OBAA 1SO0A 1RWHA 4AQ0A 1OJMA 2E24A 1NKGA 1NS7A 2WZSA 1LURA 1L7JA 3BGAA 1N7RA 3DYOA 1ULVA 3DYPA 3VDAA 1NS4A 1SNZA 4BZFA 3NJXA 1JZ4A 1NSXA 1HN0A 3VD7A 1JYWA 1JZ2A 2ZQ0A 1MMXA 2WVYA 3DECA 3T2QA 2HTBA 1PX3A 3CZJA 1HM2A 3T09A 1PX4A 1JZ7A 3NJVA 1LF6A 3DYMA 1NSRA 3T0BA 2WVXA 1NS2A 1LXKA 5E1QA 2WW0A 3I3EA 3OB8A 2XHNA 3IAPA 3I3DA 3K25A 1JZ6A 1X1HA 5A1AA 2BRVX 1X1IA 1NSMA 1I8QA 1X1JA 3IAQA 1JOVA 2CIRA 3MUZ1 2HTAA 2Q1FA 2D73A 1K1XA 1OJNA 1YQ2A 1OJOA 1JYXA 1LXMA 4RNLA 1NSSA 1MN0A 1N7QA 1RWCA 1UG9A 2WVZA 2BRWA 1F9GA 1LF9A 2JKPA 2ZXQA 3Q1NA 3T0AA 3T08A 2CISA 1JZ8A 3VDBA 1RWAA 1EGUA 2CIQA 3OS7A 1RW9A 1MMUA 3VD4A 1L7KA 1LOHA 1W3YA 2JKAA 3MV11 1OJPA 3MWXA 3NREA 3T0DA 1C82A 1HM3A 4BZHA 1J0MA 2WW1A 1NSVA 3SEPA 2WVXB 4TTGA 2WDAA 1N7NA 4DUWA 1YGAA 1K1WA 1HMWA 1NSZA 3E1F1 3VD9A 1RWFA 1F1SA 4BZEA 3VDCA 1NSUA 3MUY1 2E22A 1TXKA 2WW3A 3T2PA 1JYVA 1F4HA 1NS0A 1HN1A 1MMYA 2X03A 1CB8A 4BZGA 3ECQA 3WFAA 1N7OA 3A24A 3T2OA 1RWGA 1Z45A 1DP0A 3VD3A 2WW2A 4DUXA 1HMUA 2JKEA 1MMZA 1JZ3A 4DUVA 1N7PA 3I3BA 1J0NA 1JZ5A 1NS8A 1F4AA 1K1YA 2WCOA 3MV01
chains in the Genus database with same CATH superfamily
3D51A 3CV5A 3DCDA 2EADA 3OBAA 4AQ0A 5CA3A 1HXKA 1NS7A 2WZSA 3S4AA 1L7JA 1W4NA 1N7RA 3DX0A 1JZ4A 4FNTA 1NSXA 3WIRA 1UI7A 3DECA 3TY1A 4BTXA 3DDGA 3QFZA 3T0BA 2WVXA 5JMFA 2FUQA 5E1QA 2CG0A 2XN1A 3K25A 2CWTA 2D1WA 1JZ6A 3D50A 4K3AA 1TU5A 3HIIA 3KIIA 2CIRA 3MUZ1 2HTAA 1K1XA 3S4CA 1YQ2A 4FNQA 1W6CA 3DX3A 1MN0A 2CWUA 1N7QA 1HTYA 3DX2A 2BRWA 2JKPA 3SX1A 4FNRA 4FNPA 2CISA 1JZ8A 3BUDA 3NBJA 2CQSA 3RRSA 2OOVC 3WIQA 1IVVA 1MMUA 1SPUA 2JKAA 3MV11 3MWXA 3BVWA 1C82A 1LVNA 1HM3A 1O7DD 2CFWA 3MPHA 1IVXA 3T0UA 3SEPA 3AFJA 1WMNA 2CFDA 4TTGA 2WDAA 1N7NA 3E1F1 3S4BA 3VD9A 1F1SA 3BS6A 3VDCA 2OQEC 3ACTA 4KFEA 1TQSA 1F4HA 1UI8A 1EKMA 3E80A 2FYVA 3QDEA 1RWGA 2FUTA 1V7WA 3VD3A 3CZSA 2C10A 2JKEA 1JZ3A 3I3BA 2WOFA 1K1YA 1WMPA 2F7QA 3X3XA 1SO0A 3BVUA 4OK4A 2E24A 1US1A 2Y73A 1NKGA 1LURA 2ALWA 3D52A 3LOYA 2F7PA 5JMDA 3DYPA 1OACA 2XN2A 1SNZA 3EJQA 1QAKA 2BT3A 3T2QA 2HTBA 1PX3A 3MI6A 1IVUA 1R34A 1LF6A 3DX4A 1NSRA 3EJPA 3HI7A 4KTPA 2WW0A 3RSYA 3IAPA 1W7CA 1IVWA 2WO0A 1PS3A 1V7XA 4RNLA 3X42A 1RKYA 5GW7A 1RWCA 3EJUA 2WVZA 1F9GA 3Q1NA 2F7OA 3T0AA 1IU7A 1RWAA 1RW9A 1W3YA 1OJPA 3T0DA 1J0MA 1D6ZA 4KFFA 4MMIA 3BLBA 1NSVA 1K1WA 2PNCA 1SIHA 3BVTA 2CFGA 3MUY1 1AVLA 3S4DA 3VSMA 1JYVA 2X03A 4BZGA 3AFLA 3ECQA 3WFAA 3A24A 1PU4A 3ALAA 4K35A 1W6GA 1W5ZA 3X40A 1DP0A 4KTRA 3AMOA 4DUXA 1HMUA 2WYHA 1MMZA 1N7PA 3E7JA 1JZ5A 1F4AA 2CWVA 2WCOA 3NBBA 3J7HA 1JYNA 3IMHA 1HWWA 2XSGA 2ZL8A 1RWHA 3X3ZA 1OJMA 3WA3A 3BUQA 2YX9A 3DYOA 3VDAA 4FNVA 2Y74A 1NS4A 4BZFA 3NJXA 3DDFA 1HN0A 1KSIA 2OOVA 2OW6A 1JYWA 3X41A 1MMXA 3CZJA 3T09A 1QWUA 3W7SA 1V7VA 4BTYA 1LXKA 3D4ZA 3I3EA 3OB8A 2OQEA 1WMOA 2XN0A 2BRVX 1X1IA 1I8QA 1IQXA 1QAFA 2Q1FA 2D73A 1OJNA 1OJOA 1JYXA 1LXMA 1NSSA 2YFNA 1A2VA 1DYUA 1AVKA 2F1BA 2CFLA 2OW7A 3WVFA 1EGUA 1TQUA 4MMHA 3VD4A 3A0OA 1L7KA 1LOHA 3NREA 1D6UA 1N9EA 3WA2X 2WVXB 4DUWA 1YGAA 1NSZA 4BZEA 1NSUA 1TXKA 2WW3A 3T2PA 2EAEA 1HN1A 1MMYA 2F18A 3T2OA 4J5TA 1IQYA 2YFOA 2C11A 3BUIA 3K5TA 2WW2A 4FNUA 3KN4A 3VSNA 4BTWA 3PGBA 2RDYA 4DUVA 1W2ZA 3ACSA 1NS8A 1JRQA 1R33A 1H54A 3EJSA 3DX1A 3VD5A 2BRPA 3D3IA 3QFYA 3AMOB 1TQVA 3HIGA 3BGAA 1ULVA 3W7WA 3BLCA 3BUPA 3VD7A 2CG1A 1JZ2A 3N9HA 2ZQ0A 2WVYA 1HM2A 1PX4A 1QALA 2CFKA 1JZ7A 3NJVA 3DYMA 4EV2A 3W7XA 2F7RA 1NS2A 2F1AA 4NEIA 2CQTA 2XHNA 3I3DA 4UFCA 1X1HA 5A1AA 1TQWA 1NSMA 4OK2A 4KFDA 1X1JA 1D6YA 2WOHA 3IAQA 1JOVA 1RJOA 4EV5A 2E2TA 1AV4A 2W0QA 3SXXA 3EJTA 1UG9A 2ZXQA 1LF9A 3EJRA 2WGQA 3D4YA 2E2UA 3T08A 3VDBA 2EABA 2CIQA 3OS7A 1TQTA 2WYIA 3W7TA 4BZHA 3X3YA 4FNSA 2E2VA 2WW1A 1QX1A 3QG0A 3CZNA 1HMWA 1RWFA 2E22A 3BVXA 1NS0A 1CB8A 3BUBA 1N7OA 4OJZA 1Z45A 2EACA 3LVTA 3W7UA 1QWNA 1J0NA 3BVVA 1SIIA 3MV01 5KBPA
chains in the Genus database with same CATH topology
3J7HA 1JYNA 3VD5A 2BRPA 3IMHA 2XSGA 3DCDA 3OBAA 1SO0A 1RWHA 4AQ0A 4OK4A 1OJMA 2E24A 1NKGA 1NS7A 2WZSA 1LURA 1L7JA 3BGAA 5JMDA 1N7RA 3DYOA 1ULVA 3DYPA 4FNVA 3VDAA 1NS4A 1SNZA 4BZFA 3NJXA 1JZ4A 3BLCA 1NSXA 1HN0A 3VD7A 1JYWA 1JZ2A 2ZQ0A 1MMXA 2WVYA 3DECA 3T2QA 2HTBA 3TY1A 1PX3A 3CZJA 1HM2A 3T09A 1PX4A 1JZ7A 3NJVA 1LF6A 3DYMA 1NSRA 3T0BA 2WVXA 1NS2A 1LXKA 5JMFA 2FUQA 5E1QA 2WW0A 3I3EA 3OB8A 4NEIA 2XHNA 3IAPA 3I3DA 3K25A 1JZ6A 1X1HA 5A1AA 2BRVX 1X1IA 1NSMA 4OK2A 1I8QA 1X1JA 3IAQA 1JOVA 2CIRA 3MUZ1 2HTAA 2Q1FA 2D73A 1K1XA 1OJNA 1YQ2A 1OJOA 1JYXA 1LXMA 4RNLA 1NSSA 1MN0A 1N7QA 1RWCA 1UG9A 2WVZA 2BRWA 1F9GA 1LF9A 2JKPA 2ZXQA 3Q1NA 3T0AA 3T08A 2CISA 3WVFA 1JZ8A 3VDBA 1RWAA 1EGUA 2CIQA 3OS7A 1RW9A 4MMHA 1MMUA 3VD4A 3A0OA 1L7KA 1LOHA 1W3YA 2JKAA 3MV11 1OJPA 3MWXA 3NREA 3T0DA 1C82A 1HM3A 4BZHA 1J0MA 4MMIA 2WW1A 1NSVA 3SEPA 2WVXB 4TTGA 2WDAA 1N7NA 4DUWA 1YGAA 1K1WA 1HMWA 1NSZA 3E1F1 3VD9A 1RWFA 1F1SA 3BS6A 4BZEA 3VDCA 1NSUA 3MUY1 2E22A 1TXKA 2WW3A 3T2PA 3VSMA 1F4HA 1NS0A 1HN1A 1MMYA 2X03A 1JYVA 1CB8A 4BZGA 3AFLA 3ECQA 3WFAA 3E80A 1N7OA 3A24A 3T2OA 4J5TA 1RWGA 2FUTA 4OJZA 1Z45A 1DP0A 3VD3A 2WW2A 4DUXA 1HMUA 2JKEA 1MMZA 3VSNA 1JZ3A 4DUVA 1N7PA 3I3BA 3E7JA 1J0NA 1JZ5A 1NS8A 1F4AA 1K1YA 2WCOA 3MV01
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7H A;  1JYN A;  3VD5 A;  2BRP A;  3IMH A;  2XSG A;  3DCD A;  3OBA A;  1SO0 A;  1RWH A;  4AQ0 A;  1OJM A;  2E24 A;  1NKG A;  1NS7 A;  2WZS A;  1LUR A;  1L7J A;  3BGA A;  1N7R A;  3DYO A;  1ULV A;  3DYP A;  3VDA A;  1NS4 A;  1SNZ A;  4BZF A;  3NJX A;  1JZ4 A;  1NSX A;  1HN0 A;  3VD7 A;  1JYW A;  1JZ2 A;  2ZQ0 A;  1MMX A;  2WVY A;  3DEC A;  3T2Q A;  2HTB A;  1PX3 A;  3CZJ A;  1HM2 A;  3T09 A;  1PX4 A;  1JZ7 A;  3NJV A;  1LF6 A;  3DYM A;  1NSR A;  3T0B A;  2WVX A;  1NS2 A;  1LXK A;  5E1Q A;  2WW0 A;  3I3E A;  3OB8 A;  2XHN A;  3IAP A;  3I3D A;  3K25 A;  1JZ6 A;  1X1H A;  5A1A A;  2BRV X;  1X1I A;  1NSM A;  1I8Q A;  1X1J A;  3IAQ A;  1JOV A;  2CIR A;  3MUZ 1;  2HTA A;  2Q1F A;  2D73 A;  1K1X A;  1OJN A;  1YQ2 A;  1OJO A;  1JYX A;  1LXM A;  4RNL A;  1NSS A;  1MN0 A;  1N7Q A;  1RWC A;  1UG9 A;  2WVZ A;  2BRW A;  1F9G A;  1LF9 A;  2JKP A;  2ZXQ A;  3Q1N A;  3T0A A;  3T08 A;  2CIS A;  1JZ8 A;  3VDB A;  1RWA A;  1EGU A;  2CIQ A;  3OS7 A;  1RW9 A;  1MMU A;  3VD4 A;  1L7K A;  1LOH A;  1W3Y A;  2JKA A;  3MV1 1;  1OJP A;  3MWX A;  3NRE A;  3T0D A;  1C82 A;  1HM3 A;  4BZH A;  1J0M A;  2WW1 A;  1NSV A;  3SEP A;  2WVX B;  4TTG A;  2WDA A;  1N7N A;  4DUW A;  1YGA A;  1K1W A;  1HMW A;  1NSZ A;  3E1F 1;  3VD9 A;  1RWF A;  1F1S A;  4BZE A;  3VDC A;  1NSU A;  3MUY 1;  2E22 A;  1TXK A;  2WW3 A;  3T2P A;  1JYV A;  1F4H A;  1NS0 A;  1HN1 A;  1MMY A;  2X03 A;  1CB8 A;  4BZG A;  3ECQ A;  3WFA A;  1N7O A;  3A24 A;  3T2O A;  1RWG A;  1Z45 A;  1DP0 A;  3VD3 A;  2WW2 A;  4DUX A;  1HMU A;  2JKE A;  1MMZ A;  1JZ3 A;  4DUV A;  1N7P A;  3I3B A;  1J0N A;  1JZ5 A;  1NS8 A;  1F4A A;  1K1Y A;  2WCO A;  3MV0 1; 
#chains in the Genus database with same CATH topology
 3D51 A;  3CV5 A;  3DCD A;  2EAD A;  3OBA A;  4AQ0 A;  5CA3 A;  1HXK A;  1NS7 A;  2WZS A;  3S4A A;  1L7J A;  1W4N A;  1N7R A;  3DX0 A;  1JZ4 A;  4FNT A;  1NSX A;  3WIR A;  1UI7 A;  3DEC A;  3TY1 A;  4BTX A;  3DDG A;  3QFZ A;  3T0B A;  2WVX A;  5JMF A;  2FUQ A;  5E1Q A;  2CG0 A;  2XN1 A;  3K25 A;  2CWT A;  2D1W A;  1JZ6 A;  3D50 A;  4K3A A;  1TU5 A;  3HII A;  3KII A;  2CIR A;  3MUZ 1;  2HTA A;  1K1X A;  3S4C A;  1YQ2 A;  4FNQ A;  1W6C A;  3DX3 A;  1MN0 A;  2CWU A;  1N7Q A;  1HTY A;  3DX2 A;  2BRW A;  2JKP A;  3SX1 A;  4FNR A;  4FNP A;  2CIS A;  1JZ8 A;  3BUD A;  3NBJ A;  2CQS A;  3RRS A;  2OOV C;  3WIQ A;  1IVV A;  1MMU A;  1SPU A;  2JKA A;  3MV1 1;  3MWX A;  3BVW A;  1C82 A;  1LVN A;  1HM3 A;  1O7D D;  2CFW A;  3MPH A;  1IVX A;  3T0U A;  3SEP A;  3AFJ A;  1WMN A;  2CFD A;  4TTG A;  2WDA A;  1N7N A;  3E1F 1;  3S4B A;  3VD9 A;  1F1S A;  3BS6 A;  3VDC A;  2OQE C;  3ACT A;  4KFE A;  1TQS A;  1F4H A;  1UI8 A;  1EKM A;  3E80 A;  2FYV A;  3QDE A;  1RWG A;  2FUT A;  1V7W A;  3VD3 A;  3CZS A;  2C10 A;  2JKE A;  1JZ3 A;  3I3B A;  2WOF A;  1K1Y A;  1WMP A;  2F7Q A;  3X3X A;  1SO0 A;  3BVU A;  4OK4 A;  2E24 A;  1US1 A;  2Y73 A;  1NKG A;  1LUR A;  2ALW A;  3D52 A;  3LOY A;  2F7P A;  5JMD A;  3DYP A;  1OAC A;  2XN2 A;  1SNZ A;  3EJQ A;  1QAK A;  2BT3 A;  3T2Q A;  2HTB A;  1PX3 A;  3MI6 A;  1IVU A;  1R34 A;  1LF6 A;  3DX4 A;  1NSR A;  3EJP A;  3HI7 A;  4KTP A;  2WW0 A;  3RSY A;  3IAP A;  1W7C A;  1IVW A;  2WO0 A;  1PS3 A;  1V7X A;  4RNL A;  3X42 A;  1RKY A;  5GW7 A;  1RWC A;  3EJU A;  2WVZ A;  1F9G A;  3Q1N A;  2F7O A;  3T0A A;  1IU7 A;  1RWA A;  1RW9 A;  1W3Y A;  1OJP A;  3T0D A;  1J0M A;  1D6Z A;  4KFF A;  4MMI A;  3BLB A;  1NSV A;  1K1W A;  2PNC A;  1SIH A;  3BVT A;  2CFG A;  3MUY 1;  1AVL A;  3S4D A;  3VSM A;  1JYV A;  2X03 A;  4BZG A;  3AFL A;  3ECQ A;  3WFA A;  3A24 A;  1PU4 A;  3ALA A;  4K35 A;  1W6G A;  1W5Z A;  3X40 A;  1DP0 A;  4KTR A;  3AMO A;  4DUX A;  1HMU A;  2WYH A;  1MMZ A;  1N7P A;  3E7J A;  1JZ5 A;  1F4A A;  2CWV A;  2WCO A;  3NBB A;  3J7H A;  1JYN A;  3IMH A;  1HWW A;  2XSG A;  2ZL8 A;  1RWH A;  3X3Z A;  1OJM A;  3WA3 A;  3BUQ A;  2YX9 A;  3DYO A;  3VDA A;  4FNV A;  2Y74 A;  1NS4 A;  4BZF A;  3NJX A;  3DDF A;  1HN0 A;  1KSI A;  2OOV A;  2OW6 A;  1JYW A;  3X41 A;  1MMX A;  3CZJ A;  3T09 A;  1QWU A;  3W7S A;  1V7V A;  4BTY A;  1LXK A;  3D4Z A;  3I3E A;  3OB8 A;  2OQE A;  1WMO A;  2XN0 A;  2BRV X;  1X1I A;  1I8Q A;  1IQX A;  1QAF A;  2Q1F A;  2D73 A;  1OJN A;  1OJO A;  1JYX A;  1LXM A;  1NSS A;  2YFN A;  1A2V A;  1DYU A;  1AVK A;  2F1B A;  2CFL A;  2OW7 A;  3WVF A;  1EGU A;  1TQU A;  4MMH A;  3VD4 A;  3A0O A;  1L7K A;  1LOH A;  3NRE A;  1D6U A;  1N9E A;  3WA2 X;  2WVX B;  4DUW A;  1YGA A;  1NSZ A;  4BZE A;  1NSU A;  1TXK A;  2WW3 A;  3T2P A;  2EAE A;  1HN1 A;  1MMY A;  2F18 A;  3T2O A;  4J5T A;  1IQY A;  2YFO A;  2C11 A;  3BUI A;  3K5T A;  2WW2 A;  4FNU A;  3KN4 A;  3VSN A;  4BTW A;  3PGB A;  2RDY A;  4DUV A;  1W2Z A;  3ACS A;  1NS8 A;  1JRQ A;  1R33 A;  1H54 A;  3EJS A;  3DX1 A;  3VD5 A;  2BRP A;  3D3I A;  3QFY A;  3AMO B;  1TQV A;  3HIG A;  3BGA A;  1ULV A;  3W7W A;  3BLC A;  3BUP A;  3VD7 A;  2CG1 A;  1JZ2 A;  3N9H A;  2ZQ0 A;  2WVY A;  1HM2 A;  1PX4 A;  1QAL A;  2CFK A;  1JZ7 A;  3NJV A;  3DYM A;  4EV2 A;  3W7X A;  2F7R A;  1NS2 A;  2F1A A;  4NEI A;  2CQT A;  2XHN A;  3I3D A;  4UFC A;  1X1H A;  5A1A A;  1TQW A;  1NSM A;  4OK2 A;  4KFD A;  1X1J A;  1D6Y A;  2WOH A;  3IAQ A;  1JOV A;  1RJO A;  4EV5 A;  2E2T A;  1AV4 A;  2W0Q A;  3SXX A;  3EJT A;  1UG9 A;  2ZXQ A;  1LF9 A;  3EJR A;  2WGQ A;  3D4Y A;  2E2U A;  3T08 A;  3VDB A;  2EAB A;  2CIQ A;  3OS7 A;  1TQT A;  2WYI A;  3W7T A;  4BZH A;  3X3Y A;  4FNS A;  2E2V A;  2WW1 A;  1QX1 A;  3QG0 A;  3CZN A;  1HMW A;  1RWF A;  2E22 A;  3BVX A;  1NS0 A;  1CB8 A;  3BUB A;  1N7O A;  4OJZ A;  1Z45 A;  2EAC A;  3LVT A;  3W7U A;  1QWN A;  1J0N A;  3BVV A;  1SII A;  3MV0 1;  5KBP A; 
#chains in the Genus database with same CATH homology
 3J7H A;  1JYN A;  3VD5 A;  2BRP A;  3IMH A;  2XSG A;  3DCD A;  3OBA A;  1SO0 A;  1RWH A;  4AQ0 A;  4OK4 A;  1OJM A;  2E24 A;  1NKG A;  1NS7 A;  2WZS A;  1LUR A;  1L7J A;  3BGA A;  5JMD A;  1N7R A;  3DYO A;  1ULV A;  3DYP A;  4FNV A;  3VDA A;  1NS4 A;  1SNZ A;  4BZF A;  3NJX A;  1JZ4 A;  3BLC A;  1NSX A;  1HN0 A;  3VD7 A;  1JYW A;  1JZ2 A;  2ZQ0 A;  1MMX A;  2WVY A;  3DEC A;  3T2Q A;  2HTB A;  3TY1 A;  1PX3 A;  3CZJ A;  1HM2 A;  3T09 A;  1PX4 A;  1JZ7 A;  3NJV A;  1LF6 A;  3DYM A;  1NSR A;  3T0B A;  2WVX A;  1NS2 A;  1LXK A;  5JMF A;  2FUQ A;  5E1Q A;  2WW0 A;  3I3E A;  3OB8 A;  4NEI A;  2XHN A;  3IAP A;  3I3D A;  3K25 A;  1JZ6 A;  1X1H A;  5A1A A;  2BRV X;  1X1I A;  1NSM A;  4OK2 A;  1I8Q A;  1X1J A;  3IAQ A;  1JOV A;  2CIR A;  3MUZ 1;  2HTA A;  2Q1F A;  2D73 A;  1K1X A;  1OJN A;  1YQ2 A;  1OJO A;  1JYX A;  1LXM A;  4RNL A;  1NSS A;  1MN0 A;  1N7Q A;  1RWC A;  1UG9 A;  2WVZ A;  2BRW A;  1F9G A;  1LF9 A;  2JKP A;  2ZXQ A;  3Q1N A;  3T0A A;  3T08 A;  2CIS A;  3WVF A;  1JZ8 A;  3VDB A;  1RWA A;  1EGU A;  2CIQ A;  3OS7 A;  1RW9 A;  4MMH A;  1MMU A;  3VD4 A;  3A0O A;  1L7K A;  1LOH A;  1W3Y A;  2JKA A;  3MV1 1;  1OJP A;  3MWX A;  3NRE A;  3T0D A;  1C82 A;  1HM3 A;  4BZH A;  1J0M A;  4MMI A;  2WW1 A;  1NSV A;  3SEP A;  2WVX B;  4TTG A;  2WDA A;  1N7N A;  4DUW A;  1YGA A;  1K1W A;  1HMW A;  1NSZ A;  3E1F 1;  3VD9 A;  1RWF A;  1F1S A;  3BS6 A;  4BZE A;  3VDC A;  1NSU A;  3MUY 1;  2E22 A;  1TXK A;  2WW3 A;  3T2P A;  3VSM A;  1F4H A;  1NS0 A;  1HN1 A;  1MMY A;  2X03 A;  1JYV A;  1CB8 A;  4BZG A;  3AFL A;  3ECQ A;  3WFA A;  3E80 A;  1N7O A;  3A24 A;  3T2O A;  4J5T A;  1RWG A;  2FUT A;  4OJZ A;  1Z45 A;  1DP0 A;  3VD3 A;  2WW2 A;  4DUX A;  1HMU A;  2JKE A;  1MMZ A;  3VSN A;  1JZ3 A;  4DUV A;  1N7P A;  3I3B A;  3E7J A;  1J0N A;  1JZ5 A;  1NS8 A;  1F4A A;  1K1Y A;  2WCO A;  3MV0 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...