1NS7A

Crystal structure of galactose mutarotase from lactococcus lactis mutant e304a complexed with glucose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFACQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
total genus 96
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns7A00
1LF9A 1ULVA 2WVXA 1SO0A 1L7JA 1LOHA 1OJPA 1RW9A 4DUVA 1HMUA 1NSVA 1RWGA 1X1IA 1JZ2A 2WZSA 4BZEA 1NKGA 1MMZA 1X1HA 1HN0A 1JYWA 1NSMA 3K25A 1NSZA 2HTBA 4BZHA 3VDBA 3SEPA 3IAPA 3VD4A 2E22A 1LURA 3Q1NA 2HTAA 2WW3A 3MUZ1 3T0DA 1NSSA 3MV01 1DP0A 2CIQA 1TXKA 3T0BA 3DCDA 1W3YA 2WVYA 1L7KA 3T09A 3IMHA 1N7OA 1JZ8A 1NSUA 1N7QA 2WW1A 3OBAA 3VD7A 3E1F1 1NS8A 1NSRA 1JZ3A 1MMUA 1PX3A 3IAQA 1JZ7A 1HN1A 1C82A 4AQ0A 4RNLA 3T0AA 1NS0A 1NSXA 1I8QA 1HM3A 2CIRA 1N7NA 3I3BA 1MMXA 3WFAA 3VD3A 1LXMA 1RWAA 1J0MA 2XHNA 1EGUA 2WW2A 2ZXQA 3T2OA 4BZFA 3DECA 3T2PA 1NS2A 3OS7A 3VD5A 1JZ5A 1K1YA 2ZQ0A 4BZGA 1RWCA 1JZ6A 3VDAA 1N7RA 1F4HA 3I3EA 3CZJA 2WVZA 3MUY1 1F1SA 1Z45A 4DUXA 2WW0A 1K1XA 1LXKA 1F9GA 3T2QA 1JZ4A 5A1AA 2JKAA 1OJMA 3VD9A 2BRWA 3DYMA 1CB8A 2WDAA 3A24A 2WVXB 3MV11 2WCOA 4DUWA 3J7HA 1YGAA 2X03A 3MWXA 1LF6A 3VDCA 1PX4A 2BRVX 1MMYA 1JYVA 1MN0A 1RWFA 1N7PA 2Q1FA 1F4AA 1K1WA 2JKPA 3BGAA 2XSGA 1UG9A 1OJNA 1RWHA 3NREA 1J0NA 1HM2A 5E1QA 1JOVA 1HMWA 3NJVA 3T08A 1NS4A 3DYOA 1X1JA 3DYPA 1NS7A 2D73A 3I3DA 1JYXA 2E24A 1SNZA 2JKEA 2CISA 3OB8A 3ECQA 4TTGA 1YQ2A 3NJXA 1OJOA 1JYNA 2BRPA
chains in the Genus database with same CATH superfamily
4FNTA 2WVXA 4DUVA 1HMUA 2XN0A 1RJOA 3D4ZA 4FNPA 2CFKA 2ZL8A 3NBJA 4BZEA 2BT3A 2W0QA 2HTBA 4KFDA 4MMIA 2E22A 3SXXA 2HTAA 2PNCA 3S4DA 1AV4A 2WW3A 3BLCA 3X3XA 4BTWA 3MV01 1DP0A 1TXKA 3T0BA 2D1WA 1L7KA 2WW1A 1QALA 1R34A 1TU5A 3E80A 3E1F1 1N9EA 1NSRA 1JZ3A 1MMUA 1HTYA 3DX1A 1WMPA 1C82A 2F1BA 4AQ0A 1IU7A 4RNLA 1IVWA 3TY1A 1V7VA 2OW6A 1HM3A 4BTXA 3I3BA 3MI6A 3VD3A 2XHNA 1EGUA 2ZXQA 1NS2A 3WIQA 3CZNA 1K1YA 1W7CA 2CQTA 2ZQ0A 3HI7A 1LVNA 1W6CA 3VDAA 3W7XA 1US1A 3I3EA 2WVZA 3WA2X 5JMFA 3MUY1 1K1XA 3BVVA 3KIIA 3LOYA 3T2QA 5KBPA 3X40A 2XN2A 3D52A 4UFCA 2WYHA 3W7TA 3MWXA 1LF6A 1MMYA 1MN0A 4BTYA 3BGAA 1UG9A 2WOHA 2CG1A 3D3IA 1W4NA 3I3DA 4KFFA 4J5TA 3OB8A 1D6ZA 3SX1A 3QG0A 3ALAA 2F7RA 3DX3A 2C10A 1PU4A 1SO0A 1JZ2A 2WZSA 3A0OA 1IVVA 1HN0A 4MMHA 3DDGA 2YFNA 2E2UA 3BVUA 3SEPA 1V7WA 3VD4A 3X3YA 3Q1NA 2OW7A 3T0DA 1NSSA 4NEIA 3BVTA 3EJUA 3CV5A 1NSUA 3DX0A 1JZ8A 1AVLA 1N7QA 3EJPA 3BVWA 5CA3A 1NS8A 1V7XA 2FYVA 1PX3A 3PGBA 1IVUA 3QDEA 1NS0A 2WOFA 1I8QA 3HIGA 3EJQA 3QFYA 1N7NA 4K3AA 3WFAA 5GW7A 3KN4A 1LXMA 1J0MA 3AFJA 4BZFA 3VD5A 3HIIA 3VSMA 1SPUA 2EAEA 3BUPA 4BZGA 3AFLA 1N7RA 4FNRA 1IVXA 3W7WA 1F1SA 1Z45A 2WW0A 3AMOA 3NBBA 1WMNA 1JZ4A 4OK4A 3W7SA 3DYMA 2F7OA 1CB8A 1A2VA 3A24A 2CFDA 2WVXB 3K5TA 4DUWA 2CWTA 3J7HA 4EV5A 3LVTA 3WA3A 2BRVX 3X42A 3D51A 2YFOA 3W7UA 2Q1FA 1F4AA 1TQSA 2XSGA 1RWHA 1DYUA 1HMWA 1NS4A 3DDFA 1NS7A 2D73A 3S4CA 3AMOB 2F1AA 4TTGA 2WO0A 2CWUA 2F18A 3VSNA 4KTRA 1LOHA 3EJSA 1NSVA 1RWGA 1R33A 2EABA 1NKGA 1AVKA 1MMZA 1X1HA 1JYWA 1NSMA 3EJTA 2YX9A 1NSZA 3E7JA 3S4AA 3IAPA 2CWVA 1LURA 1HWWA 1RKYA 2CIQA 1H54A 1W3YA 1IQYA 2FUQA 3T09A 3IMHA 1N7OA 3BS6A 3OBAA 4K35A 3VD7A 3EJRA 1UI8A 3T0AA 1NSXA 1D6UA 2WGQA 2CFLA 4FNVA 1W5ZA 1MMXA 1TQTA 1RWAA 3DX4A 2WW2A 3DECA 3T2PA 3OS7A 1JZ5A 4FNUA 3BUBA 1RWCA 2WYIA 3BUIA 3WVFA 3CZJA 2Y74A 1QWUA 4DUXA 1LXKA 3BLBA 3WIRA 1F9GA 5A1AA 2JKAA 1QAKA 2OOVC 1OJMA 3VD9A 2XN1A 2WDAA 2WCOA 2ALWA 1YGAA 2X03A 3VDCA 1PX4A 4KTPA 4FNSA 1RWFA 1N7PA 2JKPA 3NREA 1OJNA 2EADA 1J0NA 4KFEA 1HM2A 5E1QA 1JOVA 3BUQA 2F7PA 3T08A 4FNQA 3DYOA 3DYPA 4OK2A 4EV2A 2E24A 3DX2A 1SNZA 2JKEA 2CISA 2C11A 1YQ2A 1JYNA 3D50A 1QAFA 1LF9A 1ULVA 1L7JA 1OJPA 1RW9A 2CFGA 3ACTA 1JRQA 1X1IA 2CFWA 2Y73A 3X3ZA 2CG0A 3K25A 5JMDA 3VDBA 4BZHA 1TQWA 1WMOA 1SIHA 1O7DD 1OACA 3MUZ1 2E2TA 2OOVA 3DCDA 2WVYA 2CQSA 2OQEC 4OJZA 1QWNA 1HXKA 3CZSA 3IAQA 1JZ7A 1HN1A 2F7QA 2CIRA 3ACSA 1PS3A 3T2OA 3D4YA 1IQXA 3MPHA 3BUDA 1UI7A 1JZ6A 3QFZA 3S4BA 1F4HA 3BVXA 3RSYA 2BRWA 1W6GA 3MV11 2RDYA 3RRSA 1JYVA 1K1WA 2EACA 1KSIA 3NJVA 2FUTA 3X41A 1QX1A 1X1JA 1JYXA 1W2ZA 1TQVA 2E2VA 3N9HA 1TQUA 1EKMA 3T0UA 3ECQA 2OQEA 1SIIA 3NJXA 1OJOA 2BRPA 1D6YA
chains in the Genus database with same CATH topology
1LF9A 1ULVA 2WVXA 1SO0A 3VSNA 1L7JA 1LOHA 1OJPA 1RW9A 4DUVA 1HMUA 1NSVA 1RWGA 1X1IA 1JZ2A 2WZSA 4BZEA 1NKGA 1MMZA 1X1HA 1HN0A 3A0OA 4MMHA 1NSMA 1JYWA 3K25A 1NSZA 5JMDA 3E7JA 2HTBA 4BZHA 3VDBA 3SEPA 4MMIA 3IAPA 3VD4A 2E22A 1LURA 3Q1NA 2HTAA 2WW3A 3BLCA 3MUZ1 3T0DA 1NSSA 3MV01 1DP0A 2CIQA 1TXKA 4NEIA 3DCDA 1W3YA 3T0BA 2WVYA 1L7KA 2FUQA 3T09A 3IMHA 1N7OA 1JZ8A 1NSUA 3BS6A 1N7QA 2WW1A 3OBAA 4OJZA 3VD7A 3E80A 3E1F1 1NS8A 1NSRA 1JZ3A 1MMUA 1PX3A 3IAQA 1JZ7A 1HN1A 1C82A 4AQ0A 4RNLA 3TY1A 3T0AA 1NS0A 1NSXA 1I8QA 1HM3A 2CIRA 4FNVA 1N7NA 3I3BA 1MMXA 3WFAA 3VD3A 1LXMA 1RWAA 1J0MA 2XHNA 1EGUA 2WW2A 2ZXQA 3T2OA 4BZFA 3DECA 3T2PA 1NS2A 3OS7A 3VD5A 3VSMA 1JZ5A 1K1YA 2ZQ0A 4BZGA 1RWCA 3AFLA 1JZ6A 3VDAA 1N7RA 3WVFA 1F4HA 3I3EA 3CZJA 2WVZA 5JMFA 3MUY1 1F1SA 1Z45A 4DUXA 2WW0A 1K1XA 1LXKA 1F9GA 3T2QA 1JZ4A 5A1AA 2JKAA 1OJMA 3VD9A 4OK4A 2BRWA 3DYMA 1CB8A 2WDAA 3A24A 2WVXB 3MV11 2WCOA 4DUWA 3J7HA 1YGAA 2X03A 3MWXA 1LF6A 3VDCA 1PX4A 2BRVX 1MMYA 1JYVA 1MN0A 1RWFA 1N7PA 2Q1FA 1F4AA 1K1WA 2JKPA 3BGAA 2XSGA 1UG9A 1OJNA 1RWHA 3NREA 1J0NA 1HM2A 5E1QA 1JOVA 1HMWA 3NJVA 2FUTA 3T08A 1NS4A 3DYOA 1X1JA 3DYPA 1NS7A 2D73A 3I3DA 4OK2A 1JYXA 4J5TA 2E24A 1SNZA 2JKEA 2CISA 3OB8A 3ECQA 4TTGA 1YQ2A 3NJXA 1OJOA 1JYNA 2BRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LF9 A;  1ULV A;  2WVX A;  1SO0 A;  1L7J A;  1LOH A;  1OJP A;  1RW9 A;  4DUV A;  1HMU A;  1NSV A;  1RWG A;  1X1I A;  1JZ2 A;  2WZS A;  4BZE A;  1NKG A;  1MMZ A;  1X1H A;  1HN0 A;  1JYW A;  1NSM A;  3K25 A;  1NSZ A;  2HTB A;  4BZH A;  3VDB A;  3SEP A;  3IAP A;  3VD4 A;  2E22 A;  1LUR A;  3Q1N A;  2HTA A;  2WW3 A;  3MUZ 1;  3T0D A;  1NSS A;  3MV0 1;  1DP0 A;  2CIQ A;  1TXK A;  3T0B A;  3DCD A;  1W3Y A;  2WVY A;  1L7K A;  3T09 A;  3IMH A;  1N7O A;  1JZ8 A;  1NSU A;  1N7Q A;  2WW1 A;  3OBA A;  3VD7 A;  3E1F 1;  1NS8 A;  1NSR A;  1JZ3 A;  1MMU A;  1PX3 A;  3IAQ A;  1JZ7 A;  1HN1 A;  1C82 A;  4AQ0 A;  4RNL A;  3T0A A;  1NS0 A;  1NSX A;  1I8Q A;  1HM3 A;  2CIR A;  1N7N A;  3I3B A;  1MMX A;  3WFA A;  3VD3 A;  1LXM A;  1RWA A;  1J0M A;  2XHN A;  1EGU A;  2WW2 A;  2ZXQ A;  3T2O A;  4BZF A;  3DEC A;  3T2P A;  1NS2 A;  3OS7 A;  3VD5 A;  1JZ5 A;  1K1Y A;  2ZQ0 A;  4BZG A;  1RWC A;  1JZ6 A;  3VDA A;  1N7R A;  1F4H A;  3I3E A;  3CZJ A;  2WVZ A;  3MUY 1;  1F1S A;  1Z45 A;  4DUX A;  2WW0 A;  1K1X A;  1LXK A;  1F9G A;  3T2Q A;  1JZ4 A;  5A1A A;  2JKA A;  1OJM A;  3VD9 A;  2BRW A;  3DYM A;  1CB8 A;  2WDA A;  3A24 A;  2WVX B;  3MV1 1;  2WCO A;  4DUW A;  3J7H A;  1YGA A;  2X03 A;  3MWX A;  1LF6 A;  3VDC A;  1PX4 A;  2BRV X;  1MMY A;  1JYV A;  1MN0 A;  1RWF A;  1N7P A;  2Q1F A;  1F4A A;  1K1W A;  2JKP A;  3BGA A;  2XSG A;  1UG9 A;  1OJN A;  1RWH A;  3NRE A;  1J0N A;  1HM2 A;  5E1Q A;  1JOV A;  1HMW A;  3NJV A;  3T08 A;  1NS4 A;  3DYO A;  1X1J A;  3DYP A;  1NS7 A;  2D73 A;  3I3D A;  1JYX A;  2E24 A;  1SNZ A;  2JKE A;  2CIS A;  3OB8 A;  3ECQ A;  4TTG A;  1YQ2 A;  3NJX A;  1OJO A;  1JYN A;  2BRP A; 
#chains in the Genus database with same CATH topology
 4FNT A;  2WVX A;  4DUV A;  1HMU A;  2XN0 A;  1RJO A;  3D4Z A;  4FNP A;  2CFK A;  2ZL8 A;  3NBJ A;  4BZE A;  2BT3 A;  2W0Q A;  2HTB A;  4KFD A;  4MMI A;  2E22 A;  3SXX A;  2HTA A;  2PNC A;  3S4D A;  1AV4 A;  2WW3 A;  3BLC A;  3X3X A;  4BTW A;  3MV0 1;  1DP0 A;  1TXK A;  3T0B A;  2D1W A;  1L7K A;  2WW1 A;  1QAL A;  1R34 A;  1TU5 A;  3E80 A;  3E1F 1;  1N9E A;  1NSR A;  1JZ3 A;  1MMU A;  1HTY A;  3DX1 A;  1WMP A;  1C82 A;  2F1B A;  4AQ0 A;  1IU7 A;  4RNL A;  1IVW A;  3TY1 A;  1V7V A;  2OW6 A;  1HM3 A;  4BTX A;  3I3B A;  3MI6 A;  3VD3 A;  2XHN A;  1EGU A;  2ZXQ A;  1NS2 A;  3WIQ A;  3CZN A;  1K1Y A;  1W7C A;  2CQT A;  2ZQ0 A;  3HI7 A;  1LVN A;  1W6C A;  3VDA A;  3W7X A;  1US1 A;  3I3E A;  2WVZ A;  3WA2 X;  5JMF A;  3MUY 1;  1K1X A;  3BVV A;  3KII A;  3LOY A;  3T2Q A;  5KBP A;  3X40 A;  2XN2 A;  3D52 A;  4UFC A;  2WYH A;  3W7T A;  3MWX A;  1LF6 A;  1MMY A;  1MN0 A;  4BTY A;  3BGA A;  1UG9 A;  2WOH A;  2CG1 A;  3D3I A;  1W4N A;  3I3D A;  4KFF A;  4J5T A;  3OB8 A;  1D6Z A;  3SX1 A;  3QG0 A;  3ALA A;  2F7R A;  3DX3 A;  2C10 A;  1PU4 A;  1SO0 A;  1JZ2 A;  2WZS A;  3A0O A;  1IVV A;  1HN0 A;  4MMH A;  3DDG A;  2YFN A;  2E2U A;  3BVU A;  3SEP A;  1V7W A;  3VD4 A;  3X3Y A;  3Q1N A;  2OW7 A;  3T0D A;  1NSS A;  4NEI A;  3BVT A;  3EJU A;  3CV5 A;  1NSU A;  3DX0 A;  1JZ8 A;  1AVL A;  1N7Q A;  3EJP A;  3BVW A;  5CA3 A;  1NS8 A;  1V7X A;  2FYV A;  1PX3 A;  3PGB A;  1IVU A;  3QDE A;  1NS0 A;  2WOF A;  1I8Q A;  3HIG A;  3EJQ A;  3QFY A;  1N7N A;  4K3A A;  3WFA A;  5GW7 A;  3KN4 A;  1LXM A;  1J0M A;  3AFJ A;  4BZF A;  3VD5 A;  3HII A;  3VSM A;  1SPU A;  2EAE A;  3BUP A;  4BZG A;  3AFL A;  1N7R A;  4FNR A;  1IVX A;  3W7W A;  1F1S A;  1Z45 A;  2WW0 A;  3AMO A;  3NBB A;  1WMN A;  1JZ4 A;  4OK4 A;  3W7S A;  3DYM A;  2F7O A;  1CB8 A;  1A2V A;  3A24 A;  2CFD A;  2WVX B;  3K5T A;  4DUW A;  2CWT A;  3J7H A;  4EV5 A;  3LVT A;  3WA3 A;  2BRV X;  3X42 A;  3D51 A;  2YFO A;  3W7U A;  2Q1F A;  1F4A A;  1TQS A;  2XSG A;  1RWH A;  1DYU A;  1HMW A;  1NS4 A;  3DDF A;  1NS7 A;  2D73 A;  3S4C A;  3AMO B;  2F1A A;  4TTG A;  2WO0 A;  2CWU A;  2F18 A;  3VSN A;  4KTR A;  1LOH A;  3EJS A;  1NSV A;  1RWG A;  1R33 A;  2EAB A;  1NKG A;  1AVK A;  1MMZ A;  1X1H A;  1JYW A;  1NSM A;  3EJT A;  2YX9 A;  1NSZ A;  3E7J A;  3S4A A;  3IAP A;  2CWV A;  1LUR A;  1HWW A;  1RKY A;  2CIQ A;  1H54 A;  1W3Y A;  1IQY A;  2FUQ A;  3T09 A;  3IMH A;  1N7O A;  3BS6 A;  3OBA A;  4K35 A;  3VD7 A;  3EJR A;  1UI8 A;  3T0A A;  1NSX A;  1D6U A;  2WGQ A;  2CFL A;  4FNV A;  1W5Z A;  1MMX A;  1TQT A;  1RWA A;  3DX4 A;  2WW2 A;  3DEC A;  3T2P A;  3OS7 A;  1JZ5 A;  4FNU A;  3BUB A;  1RWC A;  2WYI A;  3BUI A;  3WVF A;  3CZJ A;  2Y74 A;  1QWU A;  4DUX A;  1LXK A;  3BLB A;  3WIR A;  1F9G A;  5A1A A;  2JKA A;  1QAK A;  2OOV C;  1OJM A;  3VD9 A;  2XN1 A;  2WDA A;  2WCO A;  2ALW A;  1YGA A;  2X03 A;  3VDC A;  1PX4 A;  4KTP A;  4FNS A;  1RWF A;  1N7P A;  2JKP A;  3NRE A;  1OJN A;  2EAD A;  1J0N A;  4KFE A;  1HM2 A;  5E1Q A;  1JOV A;  3BUQ A;  2F7P A;  3T08 A;  4FNQ A;  3DYO A;  3DYP A;  4OK2 A;  4EV2 A;  2E24 A;  3DX2 A;  1SNZ A;  2JKE A;  2CIS A;  2C11 A;  1YQ2 A;  1JYN A;  3D50 A;  1QAF A;  1LF9 A;  1ULV A;  1L7J A;  1OJP A;  1RW9 A;  2CFG A;  3ACT A;  1JRQ A;  1X1I A;  2CFW A;  2Y73 A;  3X3Z A;  2CG0 A;  3K25 A;  5JMD A;  3VDB A;  4BZH A;  1TQW A;  1WMO A;  1SIH A;  1O7D D;  1OAC A;  3MUZ 1;  2E2T A;  2OOV A;  3DCD A;  2WVY A;  2CQS A;  2OQE C;  4OJZ A;  1QWN A;  1HXK A;  3CZS A;  3IAQ A;  1JZ7 A;  1HN1 A;  2F7Q A;  2CIR A;  3ACS A;  1PS3 A;  3T2O A;  3D4Y A;  1IQX A;  3MPH A;  3BUD A;  1UI7 A;  1JZ6 A;  3QFZ A;  3S4B A;  1F4H A;  3BVX A;  3RSY A;  2BRW A;  1W6G A;  3MV1 1;  2RDY A;  3RRS A;  1JYV A;  1K1W A;  2EAC A;  1KSI A;  3NJV A;  2FUT A;  3X41 A;  1QX1 A;  1X1J A;  1JYX A;  1W2Z A;  1TQV A;  2E2V A;  3N9H A;  1TQU A;  1EKM A;  3T0U A;  3ECQ A;  2OQE A;  1SII A;  3NJX A;  1OJO A;  2BRP A;  1D6Y A; 
#chains in the Genus database with same CATH homology
 1LF9 A;  1ULV A;  2WVX A;  1SO0 A;  3VSN A;  1L7J A;  1LOH A;  1OJP A;  1RW9 A;  4DUV A;  1HMU A;  1NSV A;  1RWG A;  1X1I A;  1JZ2 A;  2WZS A;  4BZE A;  1NKG A;  1MMZ A;  1X1H A;  1HN0 A;  3A0O A;  4MMH A;  1NSM A;  1JYW A;  3K25 A;  1NSZ A;  5JMD A;  3E7J A;  2HTB A;  4BZH A;  3VDB A;  3SEP A;  4MMI A;  3IAP A;  3VD4 A;  2E22 A;  1LUR A;  3Q1N A;  2HTA A;  2WW3 A;  3BLC A;  3MUZ 1;  3T0D A;  1NSS A;  3MV0 1;  1DP0 A;  2CIQ A;  1TXK A;  4NEI A;  3DCD A;  1W3Y A;  3T0B A;  2WVY A;  1L7K A;  2FUQ A;  3T09 A;  3IMH A;  1N7O A;  1JZ8 A;  1NSU A;  3BS6 A;  1N7Q A;  2WW1 A;  3OBA A;  4OJZ A;  3VD7 A;  3E80 A;  3E1F 1;  1NS8 A;  1NSR A;  1JZ3 A;  1MMU A;  1PX3 A;  3IAQ A;  1JZ7 A;  1HN1 A;  1C82 A;  4AQ0 A;  4RNL A;  3TY1 A;  3T0A A;  1NS0 A;  1NSX A;  1I8Q A;  1HM3 A;  2CIR A;  4FNV A;  1N7N A;  3I3B A;  1MMX A;  3WFA A;  3VD3 A;  1LXM A;  1RWA A;  1J0M A;  2XHN A;  1EGU A;  2WW2 A;  2ZXQ A;  3T2O A;  4BZF A;  3DEC A;  3T2P A;  1NS2 A;  3OS7 A;  3VD5 A;  3VSM A;  1JZ5 A;  1K1Y A;  2ZQ0 A;  4BZG A;  1RWC A;  3AFL A;  1JZ6 A;  3VDA A;  1N7R A;  3WVF A;  1F4H A;  3I3E A;  3CZJ A;  2WVZ A;  5JMF A;  3MUY 1;  1F1S A;  1Z45 A;  4DUX A;  2WW0 A;  1K1X A;  1LXK A;  1F9G A;  3T2Q A;  1JZ4 A;  5A1A A;  2JKA A;  1OJM A;  3VD9 A;  4OK4 A;  2BRW A;  3DYM A;  1CB8 A;  2WDA A;  3A24 A;  2WVX B;  3MV1 1;  2WCO A;  4DUW A;  3J7H A;  1YGA A;  2X03 A;  3MWX A;  1LF6 A;  3VDC A;  1PX4 A;  2BRV X;  1MMY A;  1JYV A;  1MN0 A;  1RWF A;  1N7P A;  2Q1F A;  1F4A A;  1K1W A;  2JKP A;  3BGA A;  2XSG A;  1UG9 A;  1OJN A;  1RWH A;  3NRE A;  1J0N A;  1HM2 A;  5E1Q A;  1JOV A;  1HMW A;  3NJV A;  2FUT A;  3T08 A;  1NS4 A;  3DYO A;  1X1J A;  3DYP A;  1NS7 A;  2D73 A;  3I3D A;  4OK2 A;  1JYX A;  4J5T A;  2E24 A;  1SNZ A;  2JKE A;  2CIS A;  3OB8 A;  3ECQ A;  4TTG A;  1YQ2 A;  3NJX A;  1OJO A;  1JYN A;  2BRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...