1NS7A

Crystal structure of galactose mutarotase from lactococcus lactis mutant e304a complexed with glucose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
339
structure length
339
Chain Sequence
b'SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFACQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 96
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns7A00
1PX3A 3I3EA 3BGAA 1NSSA 3IAQA 1HN1A 3NJVA 2WVXB 3ECQA 3IMHA 1NS2A 4BZFA 4AQ0A 1F4AA 1EGUA 3DYMA 1PX4A 1MN0A 1CB8A 2XSGA 3K25A 1JZ5A 1K1WA 1JZ4A 1NKGA 2HTBA 1HN0A 1UG9A 2ZXQA 3DYPA 3T08A 1W3YA 1JZ7A 3DCDA 1F1SA 1ULVA 2ZQ0A 1LF6A 1SNZA 1HM2A 4DUWA 1HM3A 1LURA 3VDAA 3CZJA 1OJNA 1J0NA 3SEPA 1TXKA 2WW3A 1RWHA 1JZ6A 1C82A 4BZHA 3DECA 4BZGA 2HTAA 1NSMA 1JZ2A 3VD3A 1J0MA 1JOVA 1K1XA 1NS8A 3J7HA 2JKEA 1YQ2A 3A24A 3MUZ1 1YGAA 3T0DA 2E22A 2WVZA 3VD7A 1N7RA 3WFAA 1NS4A 3MV01 2CIRA 2D73A 1OJPA 1NSRA 2BRPA 1JYVA 2E24A 1NSXA 1N7QA 3OB8A 1RWFA 3I3BA 3I3DA 3VD9A 3E1F1 1MMUA 1SO0A 3DYOA 1N7OA 4DUVA 4TTGA 1MMXA 1I8QA 1RWGA 1L7KA 2WW0A 2WZSA 1LF9A 1JZ3A 1NS7A 2CIQA 3OBAA 2Q1FA 1JYNA 2WVXA 1L7JA 1JZ8A 1X1IA 1LOHA 1HMWA 3T09A 3VDBA 1LXMA 1Z45A 1NS0A 3VD4A 2WW1A 3MUY1 1X1JA 1X1HA 3T2QA 3MV11 3VD5A 1JYXA 1OJMA 1F4HA 2CISA 4DUXA 3OS7A 1MMZA 1N7NA 3NREA 1NSZA 4RNLA 1NSVA 1RW9A 3T2PA 1OJOA 1N7PA 2JKAA 2X03A 2WVYA 2BRVX 4BZEA 1K1YA 3T2OA 1DP0A 1LXKA 3MWXA 2WW2A 3Q1NA 5E1QA 3IAPA 3T0AA 2BRWA 5A1AA 2WCOA 3T0BA 1F9GA 1HMUA 2XHNA 2JKPA 1NSUA 1JYWA 2WDAA 1MMYA 3NJXA 3VDCA 1RWAA 1RWCA
chains in the Genus database with same CATH superfamily
3BGAA 1NSSA 3KIIA 3NJVA 5KBPA 3BS6A 4AQ0A 2C10A 3DYMA 1EGUA 3K25A 1K1WA 1DYUA 3AFJA 1JZ4A 1HN0A 1UG9A 2ZXQA 2CFDA 1HXKA 1JZ7A 3DCDA 1TQVA 3S4BA 3W7TA 4OJZA 3K5TA 1HM3A 3CZJA 1OJNA 3CV5A 1TXKA 2WOFA 1TQUA 4FNPA 2HTAA 3X3XA 3VD3A 1JOVA 3QDEA 3EJRA 3S4CA 4KFDA 2RDYA 3T0DA 2E22A 3VD7A 4FNVA 3MV01 2EACA 3HI7A 3ALAA 3AFLA 4NEIA 1OJPA 1QX1A 3D51A 2BRPA 3DX1A 1IVWA 3BLBA 3LVTA 1W6GA 3BVUA 2WYIA 1NS7A 3DX3A 2CG0A 4MMIA 1X1IA 1JZ8A 4EV5A 3D4ZA 3T09A 3VDBA 1Z45A 1NS0A 1QALA 1IQXA 2WW1A 1X1JA 1X1HA 1D6YA 1W7CA 2F7RA 3CZNA 2EABA 1OJMA 3OS7A 4FNRA 1IU7A 2XN2A 1NSZA 4RNLA 3HIGA 1N7PA 3X3YA 3BVTA 2F7OA 2OW6A 2BRVX 2F7PA 2E2VA 2F18A 2PNCA 1DP0A 1SPUA 1LXKA 3MWXA 2WW2A 3T0AA 2YFOA 3RRSA 2BT3A 1NSUA 1O7DD 2F1AA 3HIIA 2OQEA 3VDCA 2OOVA 2OQEC 1TQWA 2OOVC 5CA3A 3ECQA 3BVXA 3BUIA 3IMHA 3NBBA 1PX4A 1MN0A 1CB8A 2XSGA 1JZ5A 2ZL8A 1IQYA 2HTBA 3DYPA 3NBJA 2WOHA 1ULVA 2ZQ0A 1LF6A 4KFFA 1SIHA 1HM2A 1LURA 1R34A 3DX2A 1H54A 1JZ6A 1HWWA 1PU4A 4BZGA 1JZ2A 1IVUA 2CFWA 4BTYA 1NS8A 3MUZ1 1YGAA 1WMOA 3EJQA 1W4NA 2CIRA 3X40A 4BTXA 3AMOB 2C11A 1NSXA 1N7QA 1UI8A 1RWFA 3I3DA 1RKYA 3VD9A 3VSMA 2E2TA 1L7KA 2WW0A 2WZSA 3DX4A 3OBAA 3TY1A 2CWUA 1JYNA 3D50A 1AV4A 3WVFA 2CQTA 3VD5A 2CG1A 4DUXA 1N7NA 3NREA 2FYVA 3W7WA 1OJOA 5GW7A 2Y73A 2X03A 4J5TA 1TQTA 2W0QA 3D4YA 3KN4A 2WVYA 4OK4A 3Q1NA 5E1QA 2WO0A 3W7UA 2EADA 2BRWA 2YX9A 5A1AA 1F9GA 1UI7A 3EJUA 4OK2A 2CFKA 1PX3A 3I3EA 3W7SA 3N9HA 3IAQA 5JMDA 2WVXB 2XN0A 2E2UA 4BZFA 1NS2A 1F4AA 3BLCA 4FNQA 3MPHA 1PS3A 1NKGA 3EJSA 3T0UA 1V7XA 1W3YA 1F1SA 3QG0A 1SNZA 1V7VA 3D52A 3EJTA 1AVLA 2CFGA 3RSYA 1KSIA 1RWHA 3LOYA 3S4DA 3BUPA 3BVVA 4BZHA 3DECA 1R33A 4K35A 1YQ2A 1HTYA 4FNSA 1D6ZA 3BUBA 3WFAA 2D73A 1IVVA 2Y74A 3WIQA 1A2VA 3I3BA 4FNTA 1MMUA 1LVNA 3A0OA 4DUVA 3DDFA 1MMXA 1LF9A 2EAEA 1JZ3A 2CIQA 2WVXA 4FNUA 1QWUA 1HMWA 3VSNA 1W6CA 3VD4A 4BTWA 1V7WA 1TQSA 3T2QA 2FUTA 1MMZA 2YFNA 3X41A 2F7QA 3SX1A 1W2ZA 2JKAA 2F1BA 1EKMA 1N9EA 4BZEA 1K1YA 3T2OA 3E7JA 2CWTA 3T0BA 2CQSA 2XHNA 1OACA 3NJXA 1RWCA 1WMNA 1W5ZA 2XN1A 1HN1A 4K3AA 3DX0A 1QWNA 4MMHA 3BUQA 3X3ZA 3BUDA 3WA2X 3E80A 3W7XA 3T08A 1US1A 5JMFA 3WA3A 2CFLA 4DUWA 3VDAA 1J0NA 3SEPA 2WW3A 1D6UA 1C82A 3AMOA 3EJPA 3ACSA 1TU5A 1SIIA 1NSMA 3D3IA 1J0MA 1K1XA 3J7HA 2JKEA 3BVWA 3QFZA 4KTPA 3A24A 2FUQA 2WVZA 1N7RA 1IVXA 1NS4A 4UFCA 3WIRA 1NSRA 1JYVA 2E24A 3OB8A 2WYHA 4EV2A 2CWVA 3E1F1 3QFYA 1SO0A 3DYOA 1N7OA 4TTGA 1I8QA 1RWGA 1JRQA 2Q1FA 1L7JA 3MI6A 1LOHA 2WGQA 3ACTA 3SXXA 2D1WA 1LXMA 3DDGA 3MUY1 3CZSA 1WMPA 3MV11 1JYXA 1F4HA 2CISA 1NSVA 1QAKA 1RW9A 3T2PA 4KFEA 1AVKA 2OW7A 3PGBA 3S4AA 3IAPA 1QAFA 2WCOA 1HMUA 4KTRA 2JKPA 3X42A 1JYWA 2WDAA 1MMYA 2ALWA 1RWAA 1RJOA
chains in the Genus database with same CATH topology
1PX3A 3I3EA 3BGAA 1NSSA 3IAQA 1HN1A 3NJVA 5JMDA 2WVXB 3ECQA 3BS6A 3IMHA 1NS2A 4BZFA 4AQ0A 1F4AA 1EGUA 3BLCA 3DYMA 4MMHA 1PX4A 1MN0A 1CB8A 2XSGA 3K25A 1JZ5A 1K1WA 1JZ4A 1NKGA 2HTBA 1HN0A 1UG9A 2ZXQA 3E80A 3DYPA 3T08A 1W3YA 1JZ7A 3DCDA 1F1SA 1ULVA 2ZQ0A 5JMFA 1SNZA 1LF6A 1HM2A 4OJZA 4DUWA 1HM3A 1LURA 3VDAA 3CZJA 1OJNA 1J0NA 3SEPA 1TXKA 2WW3A 1RWHA 1JZ6A 1C82A 4BZHA 3DECA 4BZGA 2HTAA 1NSMA 1JZ2A 3VD3A 1J0MA 1JOVA 1K1XA 1NS8A 3J7HA 2JKEA 1YQ2A 3A24A 3MUZ1 1YGAA 3T0DA 2FUQA 2E22A 2WVZA 3VD7A 1N7RA 4FNVA 3WFAA 1NS4A 3MV01 2CIRA 3AFLA 4NEIA 2D73A 1OJPA 1NSRA 2BRPA 1JYVA 2E24A 1NSXA 1N7QA 3OB8A 1RWFA 3I3BA 3I3DA 3VD9A 3E1F1 3VSMA 1MMUA 1SO0A 3DYOA 3A0OA 1N7OA 4DUVA 4TTGA 1MMXA 1I8QA 1RWGA 1L7KA 2WW0A 2WZSA 1LF9A 1JZ3A 1NS7A 2CIQA 3OBAA 2Q1FA 3TY1A 1JYNA 2WVXA 1L7JA 4MMIA 1JZ8A 1X1IA 1LOHA 1HMWA 3VSNA 3T09A 3VDBA 1LXMA 1Z45A 1NS0A 3VD4A 2WW1A 3MUY1 3WVFA 1X1JA 1X1HA 3T2QA 3MV11 3VD5A 1JYXA 1OJMA 1F4HA 2CISA 4DUXA 3OS7A 2FUTA 1MMZA 1N7NA 3NREA 1NSZA 4RNLA 1NSVA 1RW9A 3T2PA 1OJOA 1N7PA 2JKAA 2X03A 4J5TA 2WVYA 2BRVX 4BZEA 1K1YA 4OK4A 3T2OA 1DP0A 1LXKA 3MWXA 2WW2A 3E7JA 3Q1NA 5E1QA 3IAPA 3T0AA 2BRWA 5A1AA 2WCOA 3T0BA 1F9GA 1HMUA 2XHNA 4OK2A 2JKPA 1NSUA 1JYWA 2WDAA 1MMYA 3NJXA 3VDCA 1RWAA 1RWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PX3 A;  3I3E A;  3BGA A;  1NSS A;  3IAQ A;  1HN1 A;  3NJV A;  2WVX B;  3ECQ A;  3IMH A;  1NS2 A;  4BZF A;  4AQ0 A;  1F4A A;  1EGU A;  3DYM A;  1PX4 A;  1MN0 A;  1CB8 A;  2XSG A;  3K25 A;  1JZ5 A;  1K1W A;  1JZ4 A;  1NKG A;  2HTB A;  1HN0 A;  1UG9 A;  2ZXQ A;  3DYP A;  3T08 A;  1W3Y A;  1JZ7 A;  3DCD A;  1F1S A;  1ULV A;  2ZQ0 A;  1LF6 A;  1SNZ A;  1HM2 A;  4DUW A;  1HM3 A;  1LUR A;  3VDA A;  3CZJ A;  1OJN A;  1J0N A;  3SEP A;  1TXK A;  2WW3 A;  1RWH A;  1JZ6 A;  1C82 A;  4BZH A;  3DEC A;  4BZG A;  2HTA A;  1NSM A;  1JZ2 A;  3VD3 A;  1J0M A;  1JOV A;  1K1X A;  1NS8 A;  3J7H A;  2JKE A;  1YQ2 A;  3A24 A;  3MUZ 1;  1YGA A;  3T0D A;  2E22 A;  2WVZ A;  3VD7 A;  1N7R A;  3WFA A;  1NS4 A;  3MV0 1;  2CIR A;  2D73 A;  1OJP A;  1NSR A;  2BRP A;  1JYV A;  2E24 A;  1NSX A;  1N7Q A;  3OB8 A;  1RWF A;  3I3B A;  3I3D A;  3VD9 A;  3E1F 1;  1MMU A;  1SO0 A;  3DYO A;  1N7O A;  4DUV A;  4TTG A;  1MMX A;  1I8Q A;  1RWG A;  1L7K A;  2WW0 A;  2WZS A;  1LF9 A;  1JZ3 A;  1NS7 A;  2CIQ A;  3OBA A;  2Q1F A;  1JYN A;  2WVX A;  1L7J A;  1JZ8 A;  1X1I A;  1LOH A;  1HMW A;  3T09 A;  3VDB A;  1LXM A;  1Z45 A;  1NS0 A;  3VD4 A;  2WW1 A;  3MUY 1;  1X1J A;  1X1H A;  3T2Q A;  3MV1 1;  3VD5 A;  1JYX A;  1OJM A;  1F4H A;  2CIS A;  4DUX A;  3OS7 A;  1MMZ A;  1N7N A;  3NRE A;  1NSZ A;  4RNL A;  1NSV A;  1RW9 A;  3T2P A;  1OJO A;  1N7P A;  2JKA A;  2X03 A;  2WVY A;  2BRV X;  4BZE A;  1K1Y A;  3T2O A;  1DP0 A;  1LXK A;  3MWX A;  2WW2 A;  3Q1N A;  5E1Q A;  3IAP A;  3T0A A;  2BRW A;  5A1A A;  2WCO A;  3T0B A;  1F9G A;  1HMU A;  2XHN A;  2JKP A;  1NSU A;  1JYW A;  2WDA A;  1MMY A;  3NJX A;  3VDC A;  1RWA A;  1RWC A; 
#chains in the Genus database with same CATH topology
 3BGA A;  1NSS A;  3KII A;  3NJV A;  5KBP A;  3BS6 A;  4AQ0 A;  2C10 A;  3DYM A;  1EGU A;  3K25 A;  1K1W A;  1DYU A;  3AFJ A;  1JZ4 A;  1HN0 A;  1UG9 A;  2ZXQ A;  2CFD A;  1HXK A;  1JZ7 A;  3DCD A;  1TQV A;  3S4B A;  3W7T A;  4OJZ A;  3K5T A;  1HM3 A;  3CZJ A;  1OJN A;  3CV5 A;  1TXK A;  2WOF A;  1TQU A;  4FNP A;  2HTA A;  3X3X A;  3VD3 A;  1JOV A;  3QDE A;  3EJR A;  3S4C A;  4KFD A;  2RDY A;  3T0D A;  2E22 A;  3VD7 A;  4FNV A;  3MV0 1;  2EAC A;  3HI7 A;  3ALA A;  3AFL A;  4NEI A;  1OJP A;  1QX1 A;  3D51 A;  2BRP A;  3DX1 A;  1IVW A;  3BLB A;  3LVT A;  1W6G A;  3BVU A;  2WYI A;  1NS7 A;  3DX3 A;  2CG0 A;  4MMI A;  1X1I A;  1JZ8 A;  4EV5 A;  3D4Z A;  3T09 A;  3VDB A;  1Z45 A;  1NS0 A;  1QAL A;  1IQX A;  2WW1 A;  1X1J A;  1X1H A;  1D6Y A;  1W7C A;  2F7R A;  3CZN A;  2EAB A;  1OJM A;  3OS7 A;  4FNR A;  1IU7 A;  2XN2 A;  1NSZ A;  4RNL A;  3HIG A;  1N7P A;  3X3Y A;  3BVT A;  2F7O A;  2OW6 A;  2BRV X;  2F7P A;  2E2V A;  2F18 A;  2PNC A;  1DP0 A;  1SPU A;  1LXK A;  3MWX A;  2WW2 A;  3T0A A;  2YFO A;  3RRS A;  2BT3 A;  1NSU A;  1O7D D;  2F1A A;  3HII A;  2OQE A;  3VDC A;  2OOV A;  2OQE C;  1TQW A;  2OOV C;  5CA3 A;  3ECQ A;  3BVX A;  3BUI A;  3IMH A;  3NBB A;  1PX4 A;  1MN0 A;  1CB8 A;  2XSG A;  1JZ5 A;  2ZL8 A;  1IQY A;  2HTB A;  3DYP A;  3NBJ A;  2WOH A;  1ULV A;  2ZQ0 A;  1LF6 A;  4KFF A;  1SIH A;  1HM2 A;  1LUR A;  1R34 A;  3DX2 A;  1H54 A;  1JZ6 A;  1HWW A;  1PU4 A;  4BZG A;  1JZ2 A;  1IVU A;  2CFW A;  4BTY A;  1NS8 A;  3MUZ 1;  1YGA A;  1WMO A;  3EJQ A;  1W4N A;  2CIR A;  3X40 A;  4BTX A;  3AMO B;  2C11 A;  1NSX A;  1N7Q A;  1UI8 A;  1RWF A;  3I3D A;  1RKY A;  3VD9 A;  3VSM A;  2E2T A;  1L7K A;  2WW0 A;  2WZS A;  3DX4 A;  3OBA A;  3TY1 A;  2CWU A;  1JYN A;  3D50 A;  1AV4 A;  3WVF A;  2CQT A;  3VD5 A;  2CG1 A;  4DUX A;  1N7N A;  3NRE A;  2FYV A;  3W7W A;  1OJO A;  5GW7 A;  2Y73 A;  2X03 A;  4J5T A;  1TQT A;  2W0Q A;  3D4Y A;  3KN4 A;  2WVY A;  4OK4 A;  3Q1N A;  5E1Q A;  2WO0 A;  3W7U A;  2EAD A;  2BRW A;  2YX9 A;  5A1A A;  1F9G A;  1UI7 A;  3EJU A;  4OK2 A;  2CFK A;  1PX3 A;  3I3E A;  3W7S A;  3N9H A;  3IAQ A;  5JMD A;  2WVX B;  2XN0 A;  2E2U A;  4BZF A;  1NS2 A;  1F4A A;  3BLC A;  4FNQ A;  3MPH A;  1PS3 A;  1NKG A;  3EJS A;  3T0U A;  1V7X A;  1W3Y A;  1F1S A;  3QG0 A;  1SNZ A;  1V7V A;  3D52 A;  3EJT A;  1AVL A;  2CFG A;  3RSY A;  1KSI A;  1RWH A;  3LOY A;  3S4D A;  3BUP A;  3BVV A;  4BZH A;  3DEC A;  1R33 A;  4K35 A;  1YQ2 A;  1HTY A;  4FNS A;  1D6Z A;  3BUB A;  3WFA A;  2D73 A;  1IVV A;  2Y74 A;  3WIQ A;  1A2V A;  3I3B A;  4FNT A;  1MMU A;  1LVN A;  3A0O A;  4DUV A;  3DDF A;  1MMX A;  1LF9 A;  2EAE A;  1JZ3 A;  2CIQ A;  2WVX A;  4FNU A;  1QWU A;  1HMW A;  3VSN A;  1W6C A;  3VD4 A;  4BTW A;  1V7W A;  1TQS A;  3T2Q A;  2FUT A;  1MMZ A;  2YFN A;  3X41 A;  2F7Q A;  3SX1 A;  1W2Z A;  2JKA A;  2F1B A;  1EKM A;  1N9E A;  4BZE A;  1K1Y A;  3T2O A;  3E7J A;  2CWT A;  3T0B A;  2CQS A;  2XHN A;  1OAC A;  3NJX A;  1RWC A;  1WMN A;  1W5Z A;  2XN1 A;  1HN1 A;  4K3A A;  3DX0 A;  1QWN A;  4MMH A;  3BUQ A;  3X3Z A;  3BUD A;  3WA2 X;  3E80 A;  3W7X A;  3T08 A;  1US1 A;  5JMF A;  3WA3 A;  2CFL A;  4DUW A;  3VDA A;  1J0N A;  3SEP A;  2WW3 A;  1D6U A;  1C82 A;  3AMO A;  3EJP A;  3ACS A;  1TU5 A;  1SII A;  1NSM A;  3D3I A;  1J0M A;  1K1X A;  3J7H A;  2JKE A;  3BVW A;  3QFZ A;  4KTP A;  3A24 A;  2FUQ A;  2WVZ A;  1N7R A;  1IVX A;  1NS4 A;  4UFC A;  3WIR A;  1NSR A;  1JYV A;  2E24 A;  3OB8 A;  2WYH A;  4EV2 A;  2CWV A;  3E1F 1;  3QFY A;  1SO0 A;  3DYO A;  1N7O A;  4TTG A;  1I8Q A;  1RWG A;  1JRQ A;  2Q1F A;  1L7J A;  3MI6 A;  1LOH A;  2WGQ A;  3ACT A;  3SXX A;  2D1W A;  1LXM A;  3DDG A;  3MUY 1;  3CZS A;  1WMP A;  3MV1 1;  1JYX A;  1F4H A;  2CIS A;  1NSV A;  1QAK A;  1RW9 A;  3T2P A;  4KFE A;  1AVK A;  2OW7 A;  3PGB A;  3S4A A;  3IAP A;  1QAF A;  2WCO A;  1HMU A;  4KTR A;  2JKP A;  3X42 A;  1JYW A;  2WDA A;  1MMY A;  2ALW A;  1RWA A;  1RJO A; 
#chains in the Genus database with same CATH homology
 1PX3 A;  3I3E A;  3BGA A;  1NSS A;  3IAQ A;  1HN1 A;  3NJV A;  5JMD A;  2WVX B;  3ECQ A;  3BS6 A;  3IMH A;  1NS2 A;  4BZF A;  4AQ0 A;  1F4A A;  1EGU A;  3BLC A;  3DYM A;  4MMH A;  1PX4 A;  1MN0 A;  1CB8 A;  2XSG A;  3K25 A;  1JZ5 A;  1K1W A;  1JZ4 A;  1NKG A;  2HTB A;  1HN0 A;  1UG9 A;  2ZXQ A;  3E80 A;  3DYP A;  3T08 A;  1W3Y A;  1JZ7 A;  3DCD A;  1F1S A;  1ULV A;  2ZQ0 A;  5JMF A;  1SNZ A;  1LF6 A;  1HM2 A;  4OJZ A;  4DUW A;  1HM3 A;  1LUR A;  3VDA A;  3CZJ A;  1OJN A;  1J0N A;  3SEP A;  1TXK A;  2WW3 A;  1RWH A;  1JZ6 A;  1C82 A;  4BZH A;  3DEC A;  4BZG A;  2HTA A;  1NSM A;  1JZ2 A;  3VD3 A;  1J0M A;  1JOV A;  1K1X A;  1NS8 A;  3J7H A;  2JKE A;  1YQ2 A;  3A24 A;  3MUZ 1;  1YGA A;  3T0D A;  2FUQ A;  2E22 A;  2WVZ A;  3VD7 A;  1N7R A;  4FNV A;  3WFA A;  1NS4 A;  3MV0 1;  2CIR A;  3AFL A;  4NEI A;  2D73 A;  1OJP A;  1NSR A;  2BRP A;  1JYV A;  2E24 A;  1NSX A;  1N7Q A;  3OB8 A;  1RWF A;  3I3B A;  3I3D A;  3VD9 A;  3E1F 1;  3VSM A;  1MMU A;  1SO0 A;  3DYO A;  3A0O A;  1N7O A;  4DUV A;  4TTG A;  1MMX A;  1I8Q A;  1RWG A;  1L7K A;  2WW0 A;  2WZS A;  1LF9 A;  1JZ3 A;  1NS7 A;  2CIQ A;  3OBA A;  2Q1F A;  3TY1 A;  1JYN A;  2WVX A;  1L7J A;  4MMI A;  1JZ8 A;  1X1I A;  1LOH A;  1HMW A;  3VSN A;  3T09 A;  3VDB A;  1LXM A;  1Z45 A;  1NS0 A;  3VD4 A;  2WW1 A;  3MUY 1;  3WVF A;  1X1J A;  1X1H A;  3T2Q A;  3MV1 1;  3VD5 A;  1JYX A;  1OJM A;  1F4H A;  2CIS A;  4DUX A;  3OS7 A;  2FUT A;  1MMZ A;  1N7N A;  3NRE A;  1NSZ A;  4RNL A;  1NSV A;  1RW9 A;  3T2P A;  1OJO A;  1N7P A;  2JKA A;  2X03 A;  4J5T A;  2WVY A;  2BRV X;  4BZE A;  1K1Y A;  4OK4 A;  3T2O A;  1DP0 A;  1LXK A;  3MWX A;  2WW2 A;  3E7J A;  3Q1N A;  5E1Q A;  3IAP A;  3T0A A;  2BRW A;  5A1A A;  2WCO A;  3T0B A;  1F9G A;  1HMU A;  2XHN A;  4OK2 A;  2JKP A;  1NSU A;  1JYW A;  2WDA A;  1MMY A;  3NJX A;  3VDC A;  1RWA A;  1RWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...