1NS7A

Crystal structure of galactose mutarotase from lactococcus lactis mutant e304a complexed with glucose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFACQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 96
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1ns7A00
1I8QA 1N7QA 1NS8A 1NSXA 1LF9A 2E22A 3BGAA 1HMWA 1RWAA 1X1HA 3I3EA 3T08A 1X1JA 3VDAA 3CZJA 2WVXB 2Q1FA 2CISA 3VD3A 3DCDA 3E1F1 3DYMA 3MUY1 1K1YA 1N7OA 1C82A 2BRPA 2WW3A 1MMZA 2WVYA 1ULVA 4AQ0A 1NSMA 1OJPA 1LURA 2BRWA 4BZEA 3NJXA 1N7RA 4DUXA 1K1XA 1OJMA 2HTAA 2ZQ0A 1F9GA 1JYVA 2JKEA 1NS4A 3T2PA 3MUZ1 1J0MA 1JYNA 1PX4A 1OJNA 1HMUA 4BZGA 3I3DA 3T0DA 3DYPA 1DP0A 1EGUA 1L7KA 1MMUA 1OJOA 3T09A 1HN0A 1LXMA 1NSZA 1X1IA 1SNZA 1YQ2A 3T0AA 2WW1A 2BRVX 2WCOA 2WZSA 2JKAA 2D73A 3VD9A 2XHNA 1JZ2A 3VD5A 3VDBA 1RW9A 1J0NA 1F1SA 1N7PA 3SEPA 1JOVA 1JZ6A 1N7NA 3OS7A 1RWHA 3DECA 3NREA 1RWFA 1LF6A 3A24A 1NKGA 4TTGA 3OB8A 1SO0A 1NS0A 1LOHA 2CIRA 1UG9A 3VDCA 1YGAA 1NSSA 1W3YA 1JYWA 1JZ7A 1NS2A 2JKPA 4DUWA 1HN1A 2WW0A 1RWGA 1NSUA 3IMHA 3VD4A 1NSVA 1NS7A 2HTBA 5A1AA 2XSGA 3I3BA 1F4HA 1MN0A 3ECQA 3Q1NA 1RWCA 1JZ5A 3MWXA 3MV11 3T0BA 3DYOA 2WVXA 2WDAA 4RNLA 3WFAA 2CIQA 1Z45A 4BZFA 1LXKA 1JZ4A 3VD7A 3MV01 3T2QA 3J7HA 2ZXQA 4DUVA 1K1WA 1NSRA 1JZ8A 3K25A 3T2OA 2WVZA 3NJVA 1TXKA 1MMYA 3OBAA 2E24A 1F4AA 1HM3A 3IAQA 5E1QA 1MMXA 1HM2A 2WW2A 3IAPA 1JYXA 2X03A 1CB8A 4BZHA 1L7JA 1JZ3A 1PX3A
chains in the Genus database with same CATH superfamily
5CA3A 3EJPA 3PGBA 3BGAA 3I3EA 3VDAA 1W7CA 2FUTA 2WVXB 3ALAA 2CISA 3DCDA 3MUY1 4FNQA 2ZL8A 4J5TA 2D1WA 2CWVA 3D4YA 1NSMA 1OJPA 2OQEA 3X3XA 1SIHA 2BRWA 3EJQA 4DUXA 1K1XA 2ZQ0A 1F9GA 3T2PA 1J0MA 1OJNA 2RDYA 3I3DA 3BVXA 3X40A 1DP0A 3DX3A 1OJOA 1D6ZA 3K5TA 2XN2A 1TQSA 1NSZA 1X1IA 2WW1A 2C10A 4EV2A 2WZSA 3WA2X 3VD9A 2FUQA 1W2ZA 1LVNA 3VD5A 3VDBA 2CFWA 1WMNA 1QALA 2CFGA 1RWHA 3DECA 3W7XA 3NREA 4EV5A 1IU7A 1N9EA 1RWFA 3A24A 1NKGA 2F7PA 3DX2A 1TQTA 3EJUA 1LOHA 3VDCA 1V7WA 2F1BA 1RWGA 1EKMA 3D4ZA 5A1AA 3EJRA 1JZ5A 1IQYA 3T0BA 4FNRA 3WFAA 3X3ZA 4KTPA 3EJSA 1JZ4A 3AFJA 2YX9A 3BUQA 3T2QA 3E80A 3QDEA 1QAKA 3BVVA 1K1WA 3DDFA 3NBBA 1US1A 3NJVA 1TXKA 3AFLA 1MMXA 2WW2A 3S4BA 1JYXA 1PX3A 1DYUA 3WIRA 2Y73A 1X1HA 1X1JA 3X41A 3CZJA 2XN0A 3BUDA 1W4NA 2BRPA 2YFNA 2WW3A 1MMZA 2WVYA 4AQ0A 2CFKA 3HIIA 4BZEA 4KFFA 4FNSA 2F7OA 1OJMA 2HTAA 1JYVA 1NS4A 3D50A 1QAFA 1JYNA 1IVWA 3HI7A 3T0DA 3DYPA 3MPHA 1AVKA 1L7KA 1MMUA 2E2TA 2F7RA 2F18A 1UI8A 4FNTA 4KTRA 3T0AA 2BT3A 2JKAA 1JZ2A 4FNPA 3X3YA 1JZ6A 1N7NA 2F7QA 3OS7A 1PU4A 4FNVA 4OJZA 1W6CA 3HIGA 2CIRA 1UG9A 4FNUA 2CWTA 1NSSA 2F1AA 1PS3A 3X42A 1JYWA 1IQXA 3RSYA 1V7VA 2OW7A 4BTWA 1HN1A 1NSUA 3IMHA 3LOYA 1QX1A 2CWUA 1TQUA 2XN1A 1V7XA 3Q1NA 4BTXA 1RWCA 3MWXA 3MV11 2CG1A 1TQVA 3DYOA 2WVXA 4RNLA 1Z45A 1AVLA 3VD7A 3W7UA 3S4DA 3MV01 3QFYA 2ZXQA 4DUVA 1NSRA 1TU5A 2WVZA 1MMYA 2CG0A 1F4AA 5E1QA 3D51A 2OQEC 1AV4A 1WMPA 4MMIA 2OOVA 4BZHA 2WGQA 1I8QA 2FYVA 3KN4A 1H54A 2E22A 1HMWA 2EABA 1RWAA 3DYMA 1N7OA 1C82A 2EAEA 1LURA 2WOFA 1N7RA 4K3AA 3CZNA 1IVUA 1PX4A 1HMUA 1D6UA 3T0UA 2WYHA 3A0OA 1EGUA 4UFCA 3CV5A 5GW7A 3WA3A 1JRQA 2CQSA 3AMOB 3W7WA 5KBPA 2CFDA 1SNZA 2BRVX 2WCOA 2XHNA 2YFOA 1RW9A 1F1SA 1HWWA 2E2UA 3SEPA 1JOVA 1R34A 1R33A 4BTYA 3QFZA 1KSIA 1LF6A 4TTGA 4KFDA 3D52A 3TY1A 1IVVA 1NS2A 3VSNA 3VD4A 1NSVA 2Y74A 3WIQA 3SX1A 2XSGA 3I3BA 1MN0A 2CFLA 3BVUA 1LXKA 3AMOA 3ACTA 3LVTA 3N9HA 1WMOA 4OK2A 3BVTA 1OACA 3VSMA 3W7SA 5JMFA 1D6YA 3DX1A 2CQTA 3EJTA 2WO0A 5JMDA 3K25A 3T2OA 2E2VA 3BS6A 2E24A 3IAQA 3SXXA 1HM2A 3IAPA 1IVXA 4KFEA 1CB8A 2X03A 1L7JA 1W5ZA 1UI7A 1N7QA 1NS8A 3DX0A 1NSXA 3NBJA 1LF9A 3DDGA 3QG0A 3T08A 1HTYA 2Q1FA 3CZSA 3VD3A 3E1F1 1K1YA 4OK4A 3KIIA 3E7JA 1ULVA 2WOHA 3NJXA 2WYIA 2JKEA 3MUZ1 3DX4A 4BZGA 1TQWA 1QWUA 2W0QA 1HXKA 3T09A 1HN0A 1LXMA 3BUPA 1YQ2A 3BUIA 2OW6A 2C11A 3W7TA 2D73A 1O7DD 1RJOA 2ALWA 3BUBA 1J0NA 1N7PA 3MI6A 2EADA 1SPUA 1W6GA 3OB8A 1SO0A 4NEIA 1NS0A 3BVWA 1YGAA 1W3YA 4MMHA 1JZ7A 2JKPA 4DUWA 2WW0A 1NS7A 2HTBA 2PNCA 1F4HA 3ECQA 1A2VA 2OOVC 2WDAA 3S4CA 1QWNA 2CIQA 3ACSA 4BZFA 3BLBA 1SIIA 3J7HA 3BLCA 1JZ8A 1RKYA 3RRSA 3OBAA 1HM3A 3D3IA 3S4AA 3WVFA 4K35A 1JZ3A 2EACA
chains in the Genus database with same CATH topology
1I8QA 1N7QA 1NS8A 1NSXA 1LF9A 2E22A 3BGAA 1HMWA 1RWAA 1X1HA 3I3EA 3T08A 1X1JA 3VDAA 3CZJA 2FUTA 2Q1FA 2WVXB 2CISA 3VD3A 3DCDA 3E1F1 3DYMA 3MUY1 1K1YA 1N7OA 4J5TA 1C82A 2BRPA 4OK4A 2WW3A 1MMZA 2WVYA 3E7JA 1ULVA 4AQ0A 1NSMA 1OJPA 1LURA 2BRWA 4BZEA 3NJXA 1N7RA 4DUXA 1K1XA 1OJMA 2HTAA 2ZQ0A 1F9GA 1JYVA 2JKEA 1NS4A 3T2PA 3MUZ1 1J0MA 1JYNA 1PX4A 1OJNA 1HMUA 4BZGA 3I3DA 3T0DA 3DYPA 1DP0A 3A0OA 1EGUA 1L7KA 1MMUA 1OJOA 3T09A 1HN0A 1LXMA 1NSZA 1X1IA 1SNZA 1YQ2A 3T0AA 2WW1A 2BRVX 2WCOA 2WZSA 2JKAA 2D73A 3VD9A 2XHNA 2FUQA 3VD5A 1JZ2A 3VDBA 1RW9A 1J0NA 1F1SA 1N7PA 3SEPA 1JOVA 1JZ6A 1N7NA 3OS7A 1RWHA 3DECA 4FNVA 3NREA 1RWFA 1LF6A 3A24A 1NKGA 4OJZA 4TTGA 3OB8A 1SO0A 4NEIA 3TY1A 1NS0A 1LOHA 2CIRA 1UG9A 3VDCA 1YGAA 1NSSA 1W3YA 1JYWA 4MMHA 1JZ7A 1NS2A 2JKPA 3VSNA 4DUWA 1HN1A 2WW0A 1RWGA 1NSUA 3IMHA 3VD4A 1NSVA 1NS7A 2HTBA 5A1AA 2XSGA 3I3BA 1F4HA 1MN0A 3ECQA 3Q1NA 1RWCA 1JZ5A 3MWXA 3MV11 3T0BA 3DYOA 2WVXA 2WDAA 4RNLA 3WFAA 2CIQA 1Z45A 4BZFA 1LXKA 1JZ4A 3VD7A 4OK2A 3VSMA 3MV01 3T2QA 3E80A 5JMFA 3J7HA 2ZXQA 4DUVA 3BLCA 1K1WA 1NSRA 1JZ8A 5JMDA 3K25A 3T2OA 2WVZA 3BS6A 1TXKA 1MMYA 3NJVA 3OBAA 2E24A 1F4AA 1HM3A 3AFLA 3IAQA 5E1QA 1MMXA 1HM2A 2WW2A 3IAPA 1JYXA 2X03A 3WVFA 1CB8A 4MMIA 1L7JA 4BZHA 1JZ3A 1PX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I8Q A;  1N7Q A;  1NS8 A;  1NSX A;  1LF9 A;  2E22 A;  3BGA A;  1HMW A;  1RWA A;  1X1H A;  3I3E A;  3T08 A;  1X1J A;  3VDA A;  3CZJ A;  2WVX B;  2Q1F A;  2CIS A;  3VD3 A;  3DCD A;  3E1F 1;  3DYM A;  3MUY 1;  1K1Y A;  1N7O A;  1C82 A;  2BRP A;  2WW3 A;  1MMZ A;  2WVY A;  1ULV A;  4AQ0 A;  1NSM A;  1OJP A;  1LUR A;  2BRW A;  4BZE A;  3NJX A;  1N7R A;  4DUX A;  1K1X A;  1OJM A;  2HTA A;  2ZQ0 A;  1F9G A;  1JYV A;  2JKE A;  1NS4 A;  3T2P A;  3MUZ 1;  1J0M A;  1JYN A;  1PX4 A;  1OJN A;  1HMU A;  4BZG A;  3I3D A;  3T0D A;  3DYP A;  1DP0 A;  1EGU A;  1L7K A;  1MMU A;  1OJO A;  3T09 A;  1HN0 A;  1LXM A;  1NSZ A;  1X1I A;  1SNZ A;  1YQ2 A;  3T0A A;  2WW1 A;  2BRV X;  2WCO A;  2WZS A;  2JKA A;  2D73 A;  3VD9 A;  2XHN A;  1JZ2 A;  3VD5 A;  3VDB A;  1RW9 A;  1J0N A;  1F1S A;  1N7P A;  3SEP A;  1JOV A;  1JZ6 A;  1N7N A;  3OS7 A;  1RWH A;  3DEC A;  3NRE A;  1RWF A;  1LF6 A;  3A24 A;  1NKG A;  4TTG A;  3OB8 A;  1SO0 A;  1NS0 A;  1LOH A;  2CIR A;  1UG9 A;  3VDC A;  1YGA A;  1NSS A;  1W3Y A;  1JYW A;  1JZ7 A;  1NS2 A;  2JKP A;  4DUW A;  1HN1 A;  2WW0 A;  1RWG A;  1NSU A;  3IMH A;  3VD4 A;  1NSV A;  1NS7 A;  2HTB A;  5A1A A;  2XSG A;  3I3B A;  1F4H A;  1MN0 A;  3ECQ A;  3Q1N A;  1RWC A;  1JZ5 A;  3MWX A;  3MV1 1;  3T0B A;  3DYO A;  2WVX A;  2WDA A;  4RNL A;  3WFA A;  2CIQ A;  1Z45 A;  4BZF A;  1LXK A;  1JZ4 A;  3VD7 A;  3MV0 1;  3T2Q A;  3J7H A;  2ZXQ A;  4DUV A;  1K1W A;  1NSR A;  1JZ8 A;  3K25 A;  3T2O A;  2WVZ A;  3NJV A;  1TXK A;  1MMY A;  3OBA A;  2E24 A;  1F4A A;  1HM3 A;  3IAQ A;  5E1Q A;  1MMX A;  1HM2 A;  2WW2 A;  3IAP A;  1JYX A;  2X03 A;  1CB8 A;  4BZH A;  1L7J A;  1JZ3 A;  1PX3 A; 
#chains in the Genus database with same CATH topology
 5CA3 A;  3EJP A;  3PGB A;  3BGA A;  3I3E A;  3VDA A;  1W7C A;  2FUT A;  2WVX B;  3ALA A;  2CIS A;  3DCD A;  3MUY 1;  4FNQ A;  2ZL8 A;  4J5T A;  2D1W A;  2CWV A;  3D4Y A;  1NSM A;  1OJP A;  2OQE A;  3X3X A;  1SIH A;  2BRW A;  3EJQ A;  4DUX A;  1K1X A;  2ZQ0 A;  1F9G A;  3T2P A;  1J0M A;  1OJN A;  2RDY A;  3I3D A;  3BVX A;  3X40 A;  1DP0 A;  3DX3 A;  1OJO A;  1D6Z A;  3K5T A;  2XN2 A;  1TQS A;  1NSZ A;  1X1I A;  2WW1 A;  2C10 A;  4EV2 A;  2WZS A;  3WA2 X;  3VD9 A;  2FUQ A;  1W2Z A;  1LVN A;  3VD5 A;  3VDB A;  2CFW A;  1WMN A;  1QAL A;  2CFG A;  1RWH A;  3DEC A;  3W7X A;  3NRE A;  4EV5 A;  1IU7 A;  1N9E A;  1RWF A;  3A24 A;  1NKG A;  2F7P A;  3DX2 A;  1TQT A;  3EJU A;  1LOH A;  3VDC A;  1V7W A;  2F1B A;  1RWG A;  1EKM A;  3D4Z A;  5A1A A;  3EJR A;  1JZ5 A;  1IQY A;  3T0B A;  4FNR A;  3WFA A;  3X3Z A;  4KTP A;  3EJS A;  1JZ4 A;  3AFJ A;  2YX9 A;  3BUQ A;  3T2Q A;  3E80 A;  3QDE A;  1QAK A;  3BVV A;  1K1W A;  3DDF A;  3NBB A;  1US1 A;  3NJV A;  1TXK A;  3AFL A;  1MMX A;  2WW2 A;  3S4B A;  1JYX A;  1PX3 A;  1DYU A;  3WIR A;  2Y73 A;  1X1H A;  1X1J A;  3X41 A;  3CZJ A;  2XN0 A;  3BUD A;  1W4N A;  2BRP A;  2YFN A;  2WW3 A;  1MMZ A;  2WVY A;  4AQ0 A;  2CFK A;  3HII A;  4BZE A;  4KFF A;  4FNS A;  2F7O A;  1OJM A;  2HTA A;  1JYV A;  1NS4 A;  3D50 A;  1QAF A;  1JYN A;  1IVW A;  3HI7 A;  3T0D A;  3DYP A;  3MPH A;  1AVK A;  1L7K A;  1MMU A;  2E2T A;  2F7R A;  2F18 A;  1UI8 A;  4FNT A;  4KTR A;  3T0A A;  2BT3 A;  2JKA A;  1JZ2 A;  4FNP A;  3X3Y A;  1JZ6 A;  1N7N A;  2F7Q A;  3OS7 A;  1PU4 A;  4FNV A;  4OJZ A;  1W6C A;  3HIG A;  2CIR A;  1UG9 A;  4FNU A;  2CWT A;  1NSS A;  2F1A A;  1PS3 A;  3X42 A;  1JYW A;  1IQX A;  3RSY A;  1V7V A;  2OW7 A;  4BTW A;  1HN1 A;  1NSU A;  3IMH A;  3LOY A;  1QX1 A;  2CWU A;  1TQU A;  2XN1 A;  1V7X A;  3Q1N A;  4BTX A;  1RWC A;  3MWX A;  3MV1 1;  2CG1 A;  1TQV A;  3DYO A;  2WVX A;  4RNL A;  1Z45 A;  1AVL A;  3VD7 A;  3W7U A;  3S4D A;  3MV0 1;  3QFY A;  2ZXQ A;  4DUV A;  1NSR A;  1TU5 A;  2WVZ A;  1MMY A;  2CG0 A;  1F4A A;  5E1Q A;  3D51 A;  2OQE C;  1AV4 A;  1WMP A;  4MMI A;  2OOV A;  4BZH A;  2WGQ A;  1I8Q A;  2FYV A;  3KN4 A;  1H54 A;  2E22 A;  1HMW A;  2EAB A;  1RWA A;  3DYM A;  1N7O A;  1C82 A;  2EAE A;  1LUR A;  2WOF A;  1N7R A;  4K3A A;  3CZN A;  1IVU A;  1PX4 A;  1HMU A;  1D6U A;  3T0U A;  2WYH A;  3A0O A;  1EGU A;  4UFC A;  3CV5 A;  5GW7 A;  3WA3 A;  1JRQ A;  2CQS A;  3AMO B;  3W7W A;  5KBP A;  2CFD A;  1SNZ A;  2BRV X;  2WCO A;  2XHN A;  2YFO A;  1RW9 A;  1F1S A;  1HWW A;  2E2U A;  3SEP A;  1JOV A;  1R34 A;  1R33 A;  4BTY A;  3QFZ A;  1KSI A;  1LF6 A;  4TTG A;  4KFD A;  3D52 A;  3TY1 A;  1IVV A;  1NS2 A;  3VSN A;  3VD4 A;  1NSV A;  2Y74 A;  3WIQ A;  3SX1 A;  2XSG A;  3I3B A;  1MN0 A;  2CFL A;  3BVU A;  1LXK A;  3AMO A;  3ACT A;  3LVT A;  3N9H A;  1WMO A;  4OK2 A;  3BVT A;  1OAC A;  3VSM A;  3W7S A;  5JMF A;  1D6Y A;  3DX1 A;  2CQT A;  3EJT A;  2WO0 A;  5JMD A;  3K25 A;  3T2O A;  2E2V A;  3BS6 A;  2E24 A;  3IAQ A;  3SXX A;  1HM2 A;  3IAP A;  1IVX A;  4KFE A;  1CB8 A;  2X03 A;  1L7J A;  1W5Z A;  1UI7 A;  1N7Q A;  1NS8 A;  3DX0 A;  1NSX A;  3NBJ A;  1LF9 A;  3DDG A;  3QG0 A;  3T08 A;  1HTY A;  2Q1F A;  3CZS A;  3VD3 A;  3E1F 1;  1K1Y A;  4OK4 A;  3KII A;  3E7J A;  1ULV A;  2WOH A;  3NJX A;  2WYI A;  2JKE A;  3MUZ 1;  3DX4 A;  4BZG A;  1TQW A;  1QWU A;  2W0Q A;  1HXK A;  3T09 A;  1HN0 A;  1LXM A;  3BUP A;  1YQ2 A;  3BUI A;  2OW6 A;  2C11 A;  3W7T A;  2D73 A;  1O7D D;  1RJO A;  2ALW A;  3BUB A;  1J0N A;  1N7P A;  3MI6 A;  2EAD A;  1SPU A;  1W6G A;  3OB8 A;  1SO0 A;  4NEI A;  1NS0 A;  3BVW A;  1YGA A;  1W3Y A;  4MMH A;  1JZ7 A;  2JKP A;  4DUW A;  2WW0 A;  1NS7 A;  2HTB A;  2PNC A;  1F4H A;  3ECQ A;  1A2V A;  2OOV C;  2WDA A;  3S4C A;  1QWN A;  2CIQ A;  3ACS A;  4BZF A;  3BLB A;  1SII A;  3J7H A;  3BLC A;  1JZ8 A;  1RKY A;  3RRS A;  3OBA A;  1HM3 A;  3D3I A;  3S4A A;  3WVF A;  4K35 A;  1JZ3 A;  2EAC A; 
#chains in the Genus database with same CATH homology
 1I8Q A;  1N7Q A;  1NS8 A;  1NSX A;  1LF9 A;  2E22 A;  3BGA A;  1HMW A;  1RWA A;  1X1H A;  3I3E A;  3T08 A;  1X1J A;  3VDA A;  3CZJ A;  2FUT A;  2Q1F A;  2WVX B;  2CIS A;  3VD3 A;  3DCD A;  3E1F 1;  3DYM A;  3MUY 1;  1K1Y A;  1N7O A;  4J5T A;  1C82 A;  2BRP A;  4OK4 A;  2WW3 A;  1MMZ A;  2WVY A;  3E7J A;  1ULV A;  4AQ0 A;  1NSM A;  1OJP A;  1LUR A;  2BRW A;  4BZE A;  3NJX A;  1N7R A;  4DUX A;  1K1X A;  1OJM A;  2HTA A;  2ZQ0 A;  1F9G A;  1JYV A;  2JKE A;  1NS4 A;  3T2P A;  3MUZ 1;  1J0M A;  1JYN A;  1PX4 A;  1OJN A;  1HMU A;  4BZG A;  3I3D A;  3T0D A;  3DYP A;  1DP0 A;  3A0O A;  1EGU A;  1L7K A;  1MMU A;  1OJO A;  3T09 A;  1HN0 A;  1LXM A;  1NSZ A;  1X1I A;  1SNZ A;  1YQ2 A;  3T0A A;  2WW1 A;  2BRV X;  2WCO A;  2WZS A;  2JKA A;  2D73 A;  3VD9 A;  2XHN A;  2FUQ A;  3VD5 A;  1JZ2 A;  3VDB A;  1RW9 A;  1J0N A;  1F1S A;  1N7P A;  3SEP A;  1JOV A;  1JZ6 A;  1N7N A;  3OS7 A;  1RWH A;  3DEC A;  4FNV A;  3NRE A;  1RWF A;  1LF6 A;  3A24 A;  1NKG A;  4OJZ A;  4TTG A;  3OB8 A;  1SO0 A;  4NEI A;  3TY1 A;  1NS0 A;  1LOH A;  2CIR A;  1UG9 A;  3VDC A;  1YGA A;  1NSS A;  1W3Y A;  1JYW A;  4MMH A;  1JZ7 A;  1NS2 A;  2JKP A;  3VSN A;  4DUW A;  1HN1 A;  2WW0 A;  1RWG A;  1NSU A;  3IMH A;  3VD4 A;  1NSV A;  1NS7 A;  2HTB A;  5A1A A;  2XSG A;  3I3B A;  1F4H A;  1MN0 A;  3ECQ A;  3Q1N A;  1RWC A;  1JZ5 A;  3MWX A;  3MV1 1;  3T0B A;  3DYO A;  2WVX A;  2WDA A;  4RNL A;  3WFA A;  2CIQ A;  1Z45 A;  4BZF A;  1LXK A;  1JZ4 A;  3VD7 A;  4OK2 A;  3VSM A;  3MV0 1;  3T2Q A;  3E80 A;  5JMF A;  3J7H A;  2ZXQ A;  4DUV A;  3BLC A;  1K1W A;  1NSR A;  1JZ8 A;  5JMD A;  3K25 A;  3T2O A;  2WVZ A;  3BS6 A;  1TXK A;  1MMY A;  3NJV A;  3OBA A;  2E24 A;  1F4A A;  1HM3 A;  3AFL A;  3IAQ A;  5E1Q A;  1MMX A;  1HM2 A;  2WW2 A;  3IAP A;  1JYX A;  2X03 A;  3WVF A;  1CB8 A;  4MMI A;  1L7J A;  4BZH A;  1JZ3 A;  1PX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...