1NSMA

Crystal structure of galactose mutarotase from lactococcus lactis mutant d243a complexed with galactose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIAHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
total genus 96
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsmA00
3T09A 1F4AA 2WZSA 1F1SA 1X1JA 3SEPA 1JZ7A 2JKEA 2WW0A 2WVXA 3MUY1 3VD5A 3IAQA 1JYXA 1LURA 2CISA 3OS7A 4RNLA 1HM2A 3I3BA 2WW3A 3MV01 1SNZA 4DUVA 1OJPA 3VD4A 2X03A 3T0BA 1NS0A 2BRVX 3T08A 1Z45A 3VD9A 1OJOA 3I3EA 3VD3A 1LXMA 1MMXA 1RWCA 2ZXQA 1JZ5A 3J7HA 3CZJA 1NSSA 4BZHA 1MN0A 4DUXA 3IMHA 4TTGA 1NS2A 1JZ4A 5E1QA 1HM3A 1ULVA 1RWHA 3WFAA 3T2QA 1L7KA 3DYOA 1RWGA 1HMWA 3A24A 1K1WA 3T0DA 1OJNA 1LF9A 3VDCA 1NSMA 1JYWA 2Q1FA 1NS7A 2WDAA 1DP0A 4BZFA 1RWAA 1LF6A 1NSZA 3DECA 3DYMA 2JKPA 1N7OA 1PX3A 2WVXB 1NKGA 3IAPA 1TXKA 1W3YA 1OJMA 3NJVA 1MMUA 3T2PA 3E1F1 3MUZ1 1HMUA 1K1XA 2HTAA 3I3DA 3MWXA 3T0AA 1JZ6A 1X1IA 1NSXA 1N7QA 1JZ2A 4DUWA 1RWFA 2WCOA 1EGUA 3Q1NA 3NJXA 1JZ8A 2CIRA 1CB8A 1YGAA 3DCDA 1JOVA 1N7RA 3BGAA 1K1YA 2XSGA 2CIQA 1NS4A 1JYNA 1MMZA 3OB8A 4BZGA 1JZ3A 1I8QA 2D73A 3K25A 4BZEA 2JKAA 3MV11 2BRWA 3OBAA 3T2OA 1N7NA 1YQ2A 3NREA 3VDAA 2E24A 2WVZA 1LXKA 1PX4A 2BRPA 1F9GA 1J0MA 1JYVA 1NSRA 1X1HA 1C82A 1J0NA 3ECQA 3DYPA 1F4HA 1MMYA 1NSUA 2ZQ0A 1L7JA 1NSVA 1HN1A 1SO0A 2HTBA 1NS8A 2WW2A 1UG9A 2WVYA 2XHNA 4AQ0A 3VDBA 1N7PA 5A1AA 2WW1A 2E22A 3VD7A 1HN0A 1RW9A 1LOHA
chains in the Genus database with same CATH superfamily
1A2VA 2WZSA 1F1SA 1X1JA 3BUDA 3K5TA 3SEPA 4FNRA 3MUY1 1JYXA 1RKYA 4RNLA 1IVXA 3I3BA 3ALAA 2D1WA 2CWUA 2XN0A 2BRVX 3T08A 1US1A 2YFOA 1N9EA 3DX3A 1V7VA 3LOYA 3DX0A 3CZJA 1D6UA 2F18A 1MN0A 4BZHA 3T0UA 3D50A 1ULVA 3WFAA 4EV5A 1K1WA 2CG0A 1LF9A 3VDCA 3X3XA 4KFFA 1SIHA 3ACTA 2PNCA 3DX1A 4FNQA 1NSZA 3DYMA 1PX3A 1NKGA 4KFEA 1MMUA 1WMNA 3BLCA 4KFDA 3E1F1 3T2PA 1TQSA 3QFYA 3W7UA 1K1XA 1JZ6A 1X1IA 2CFDA 1N7QA 1H54A 1RWFA 1SPUA 3W7TA 1JZ8A 3MI6A 2CIRA 3BVUA 3DCDA 3BUBA 3AFLA 3BGAA 1V7WA 1MMZA 3OB8A 1QWUA 2D73A 3K25A 1IU7A 3D4YA 3CZSA 5GW7A 1PU4A 1W7CA 1J0MA 1HXKA 1D6YA 2C11A 3TY1A 1C82A 3WA2X 3HI7A 2WOFA 2ZQ0A 4BTYA 2OW6A 2WW2A 3D52A 1EKMA 3QDEA 1PS3A 3D51A 3D4ZA 1HN0A 1F4AA 3D3IA 3X41A 2ZL8A 2EAEA 2WW0A 2WYIA 3VD5A 3IAQA 4FNTA 1HM2A 3HIIA 3BLBA 3MV01 1TQVA 3E7JA 4DUVA 3S4AA 5KBPA 3CV5A 2OOVA 1OJOA 3VD3A 1MMXA 3W7SA 4BTXA 2E2VA 3IMHA 3DX2A 4UFCA 4TTGA 1JZ4A 2WO0A 2F7OA 1QX1A 3T2QA 2WOHA 1L7KA 1IVVA 1RWGA 1AV4A 2YX9A 3A24A 2OOVC 3T0DA 5JMFA 1UI8A 3DDFA 4OK4A 1OJNA 1IQXA 3EJUA 1LF6A 1IVWA 3QFZA 2JKPA 2WVXB 3S4CA 1QWNA 3IAPA 2OQEA 1OJMA 2CG1A 1IQYA 2RDYA 2FYVA 3BS6A 1NSXA 1JZ2A 4DUWA 3NJXA 2F1BA 4EV2A 1TQUA 1K1YA 2CIQA 1JYNA 3W7WA 2W0QA 4BZGA 1TQTA 1JZ3A 3WA3A 3MV11 1W4NA 3OBAA 1JRQA 1YQ2A 3NREA 3VDAA 1KSIA 1LXKA 1PX4A 3VSMA 3NBBA 5CA3A 3DYPA 1W6CA 1NSUA 1NSVA 1HN1A 2WYHA 3EJSA 2HTBA 2WVYA 2CFKA 3BUIA 1R34A 2E22A 3A0OA 1RW9A 1LOHA 2EABA 3BVXA 3WIRA 2CFLA 3W7XA 1JZ7A 2JKEA 1LURA 3OS7A 1SNZA 1HTYA 1WMPA 2X03A 3T0BA 3VD9A 3I3EA 4K35A 1LXMA 3J7HA 2ALWA 3BUQA 4DUXA 1NS2A 5E1QA 3PGBA 3KN4A 2C10A 3X42A 3HIGA 1HMWA 3NBJA 2YFNA 2CQSA 3S4DA 1OACA 2Y73A 1NS7A 2WDAA 1TQWA 4BZFA 1RWAA 4K3AA 4MMHA 1V7XA 3DECA 1N7OA 1QAFA 3BUPA 3NJVA 3DX4A 1W6GA 4MMIA 3WIQA 2BT3A 2XN2A 2FUTA 1QALA 2F7QA 2WGQA 2WCOA 1EGUA 3Q1NA 3BVTA 1CB8A 1YGAA 2FUQA 3X3ZA 1N7RA 3N9HA 2XSGA 1NS4A 3X40A 1I8QA 2CFWA 2JKAA 3RRSA 2BRWA 4BTWA 3CZNA 1N7NA 3BVVA 3MPHA 2F7RA 2EADA 3VSNA 2E2TA 1DYUA 2E24A 3EJTA 1TU5A 3S4BA 1F9GA 1JYVA 3E80A 1F4HA 3KIIA 1HWWA 2CWTA 1NS8A 2XHNA 2OQEC 4KTRA 4AQ0A 3T09A 3DDGA 4FNVA 3EJRA 4OK2A 2WVXA 2CISA 2WW3A 1OJPA 4KTPA 2F7PA 3VD4A 1QAKA 1NS0A 3SX1A 1Z45A 3X3YA 1RWCA 5JMDA 1JZ5A 1NSSA 2EACA 3WVFA 1HM3A 4FNSA 3RSYA 1RWHA 2OW7A 3DYOA 1SIIA 1JYWA 1NSMA 2CQTA 2Q1FA 1DP0A 4OJZA 2XN1A 4FNPA 3LVTA 3SXXA 1TXKA 1W3YA 3AFJA 3MUZ1 1HMUA 1LVNA 2HTAA 3I3DA 3MWXA 3T0AA 3EJPA 1W5ZA 4J5TA 2CFGA 1JOVA 4BZEA 2CWVA 3T2OA 1O7DD 1AVLA 1IVUA 2WVZA 3QG0A 3BVWA 2BRPA 3EJQA 3AMOA 1AVKA 1NSRA 1X1HA 2Y74A 1J0NA 3ECQA 1MMYA 1RJOA 1R33A 1L7JA 3AMOB 1SO0A 2E2UA 4NEIA 1UG9A 1D6ZA 2F1AA 4FNUA 3VDBA 1N7PA 1UI7A 1WMOA 3ACSA 5A1AA 2WW1A 3VD7A 2ZXQA 1W2ZA
chains in the Genus database with same CATH topology
3T09A 1F4AA 4FNVA 2WZSA 1F1SA 1X1JA 4OK2A 3SEPA 1JZ7A 2JKEA 2WW0A 2WVXA 3MUY1 3VD5A 3IAQA 1JYXA 1LURA 2CISA 3OS7A 4RNLA 1HM2A 3I3BA 2WW3A 3MV01 1SNZA 3E7JA 4DUVA 1OJPA 3VD4A 2X03A 3T0BA 1NS0A 2BRVX 3T08A 1Z45A 3VD9A 1OJOA 3I3EA 3VD3A 1LXMA 1MMXA 1RWCA 2ZXQA 5JMDA 1JZ5A 3J7HA 3CZJA 1NSSA 4BZHA 1MN0A 4DUXA 3WVFA 3IMHA 4TTGA 1NS2A 1JZ4A 5E1QA 1HM3A 1ULVA 1RWHA 3WFAA 3T2QA 1L7KA 3DYOA 1RWGA 1HMWA 3A24A 1K1WA 3T0DA 5JMFA 4OK4A 1OJNA 1LF9A 3VDCA 1NSMA 1JYWA 2Q1FA 1NS7A 2WDAA 1DP0A 4BZFA 1RWAA 4MMHA 1LF6A 4OJZA 1NSZA 3DECA 3DYMA 2JKPA 1N7OA 1PX3A 2WVXB 1NKGA 3IAPA 1TXKA 1W3YA 1OJMA 3NJVA 1MMUA 3BLCA 3E1F1 3MUZ1 3T2PA 1HMUA 1K1XA 2HTAA 3I3DA 3MWXA 4MMIA 3T0AA 1JZ6A 1X1IA 3BS6A 1NSXA 1N7QA 1JZ2A 2FUTA 4DUWA 1RWFA 2WCOA 1EGUA 3Q1NA 3NJXA 1JZ8A 4J5TA 2CIRA 1CB8A 1YGAA 2FUQA 3DCDA 1JOVA 1N7RA 3AFLA 1K1YA 2XSGA 2CIQA 1NS4A 3BGAA 1JYNA 1MMZA 3OB8A 4BZGA 1JZ3A 1I8QA 2D73A 3K25A 4BZEA 2JKAA 3MV11 2BRWA 3OBAA 3T2OA 1N7NA 1YQ2A 3NREA 3VSNA 3VDAA 2E24A 2WVZA 1LXKA 1PX4A 3VSMA 2BRPA 1F9GA 1J0MA 1JYVA 3E80A 3TY1A 1NSRA 1X1HA 1C82A 1J0NA 3ECQA 3DYPA 1F4HA 1MMYA 1NSUA 2ZQ0A 1L7JA 1NSVA 1HN1A 1SO0A 2HTBA 1NS8A 2WW2A 1UG9A 4NEIA 2WVYA 2XHNA 4AQ0A 3VDBA 1N7PA 5A1AA 2WW1A 2E22A 3A0OA 3VD7A 1HN0A 1RW9A 1LOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T09 A;  1F4A A;  2WZS A;  1F1S A;  1X1J A;  3SEP A;  1JZ7 A;  2JKE A;  2WW0 A;  2WVX A;  3MUY 1;  3VD5 A;  3IAQ A;  1JYX A;  1LUR A;  2CIS A;  3OS7 A;  4RNL A;  1HM2 A;  3I3B A;  2WW3 A;  3MV0 1;  1SNZ A;  4DUV A;  1OJP A;  3VD4 A;  2X03 A;  3T0B A;  1NS0 A;  2BRV X;  3T08 A;  1Z45 A;  3VD9 A;  1OJO A;  3I3E A;  3VD3 A;  1LXM A;  1MMX A;  1RWC A;  2ZXQ A;  1JZ5 A;  3J7H A;  3CZJ A;  1NSS A;  4BZH A;  1MN0 A;  4DUX A;  3IMH A;  4TTG A;  1NS2 A;  1JZ4 A;  5E1Q A;  1HM3 A;  1ULV A;  1RWH A;  3WFA A;  3T2Q A;  1L7K A;  3DYO A;  1RWG A;  1HMW A;  3A24 A;  1K1W A;  3T0D A;  1OJN A;  1LF9 A;  3VDC A;  1NSM A;  1JYW A;  2Q1F A;  1NS7 A;  2WDA A;  1DP0 A;  4BZF A;  1RWA A;  1LF6 A;  1NSZ A;  3DEC A;  3DYM A;  2JKP A;  1N7O A;  1PX3 A;  2WVX B;  1NKG A;  3IAP A;  1TXK A;  1W3Y A;  1OJM A;  3NJV A;  1MMU A;  3T2P A;  3E1F 1;  3MUZ 1;  1HMU A;  1K1X A;  2HTA A;  3I3D A;  3MWX A;  3T0A A;  1JZ6 A;  1X1I A;  1NSX A;  1N7Q A;  1JZ2 A;  4DUW A;  1RWF A;  2WCO A;  1EGU A;  3Q1N A;  3NJX A;  1JZ8 A;  2CIR A;  1CB8 A;  1YGA A;  3DCD A;  1JOV A;  1N7R A;  3BGA A;  1K1Y A;  2XSG A;  2CIQ A;  1NS4 A;  1JYN A;  1MMZ A;  3OB8 A;  4BZG A;  1JZ3 A;  1I8Q A;  2D73 A;  3K25 A;  4BZE A;  2JKA A;  3MV1 1;  2BRW A;  3OBA A;  3T2O A;  1N7N A;  1YQ2 A;  3NRE A;  3VDA A;  2E24 A;  2WVZ A;  1LXK A;  1PX4 A;  2BRP A;  1F9G A;  1J0M A;  1JYV A;  1NSR A;  1X1H A;  1C82 A;  1J0N A;  3ECQ A;  3DYP A;  1F4H A;  1MMY A;  1NSU A;  2ZQ0 A;  1L7J A;  1NSV A;  1HN1 A;  1SO0 A;  2HTB A;  1NS8 A;  2WW2 A;  1UG9 A;  2WVY A;  2XHN A;  4AQ0 A;  3VDB A;  1N7P A;  5A1A A;  2WW1 A;  2E22 A;  3VD7 A;  1HN0 A;  1RW9 A;  1LOH A; 
#chains in the Genus database with same CATH topology
 1A2V A;  2WZS A;  1F1S A;  1X1J A;  3BUD A;  3K5T A;  3SEP A;  4FNR A;  3MUY 1;  1JYX A;  1RKY A;  4RNL A;  1IVX A;  3I3B A;  3ALA A;  2D1W A;  2CWU A;  2XN0 A;  2BRV X;  3T08 A;  1US1 A;  2YFO A;  1N9E A;  3DX3 A;  1V7V A;  3LOY A;  3DX0 A;  3CZJ A;  1D6U A;  2F18 A;  1MN0 A;  4BZH A;  3T0U A;  3D50 A;  1ULV A;  3WFA A;  4EV5 A;  1K1W A;  2CG0 A;  1LF9 A;  3VDC A;  3X3X A;  4KFF A;  1SIH A;  3ACT A;  2PNC A;  3DX1 A;  4FNQ A;  1NSZ A;  3DYM A;  1PX3 A;  1NKG A;  4KFE A;  1MMU A;  1WMN A;  3BLC A;  4KFD A;  3E1F 1;  3T2P A;  1TQS A;  3QFY A;  3W7U A;  1K1X A;  1JZ6 A;  1X1I A;  2CFD A;  1N7Q A;  1H54 A;  1RWF A;  1SPU A;  3W7T A;  1JZ8 A;  3MI6 A;  2CIR A;  3BVU A;  3DCD A;  3BUB A;  3AFL A;  3BGA A;  1V7W A;  1MMZ A;  3OB8 A;  1QWU A;  2D73 A;  3K25 A;  1IU7 A;  3D4Y A;  3CZS A;  5GW7 A;  1PU4 A;  1W7C A;  1J0M A;  1HXK A;  1D6Y A;  2C11 A;  3TY1 A;  1C82 A;  3WA2 X;  3HI7 A;  2WOF A;  2ZQ0 A;  4BTY A;  2OW6 A;  2WW2 A;  3D52 A;  1EKM A;  3QDE A;  1PS3 A;  3D51 A;  3D4Z A;  1HN0 A;  1F4A A;  3D3I A;  3X41 A;  2ZL8 A;  2EAE A;  2WW0 A;  2WYI A;  3VD5 A;  3IAQ A;  4FNT A;  1HM2 A;  3HII A;  3BLB A;  3MV0 1;  1TQV A;  3E7J A;  4DUV A;  3S4A A;  5KBP A;  3CV5 A;  2OOV A;  1OJO A;  3VD3 A;  1MMX A;  3W7S A;  4BTX A;  2E2V A;  3IMH A;  3DX2 A;  4UFC A;  4TTG A;  1JZ4 A;  2WO0 A;  2F7O A;  1QX1 A;  3T2Q A;  2WOH A;  1L7K A;  1IVV A;  1RWG A;  1AV4 A;  2YX9 A;  3A24 A;  2OOV C;  3T0D A;  5JMF A;  1UI8 A;  3DDF A;  4OK4 A;  1OJN A;  1IQX A;  3EJU A;  1LF6 A;  1IVW A;  3QFZ A;  2JKP A;  2WVX B;  3S4C A;  1QWN A;  3IAP A;  2OQE A;  1OJM A;  2CG1 A;  1IQY A;  2RDY A;  2FYV A;  3BS6 A;  1NSX A;  1JZ2 A;  4DUW A;  3NJX A;  2F1B A;  4EV2 A;  1TQU A;  1K1Y A;  2CIQ A;  1JYN A;  3W7W A;  2W0Q A;  4BZG A;  1TQT A;  1JZ3 A;  3WA3 A;  3MV1 1;  1W4N A;  3OBA A;  1JRQ A;  1YQ2 A;  3NRE A;  3VDA A;  1KSI A;  1LXK A;  1PX4 A;  3VSM A;  3NBB A;  5CA3 A;  3DYP A;  1W6C A;  1NSU A;  1NSV A;  1HN1 A;  2WYH A;  3EJS A;  2HTB A;  2WVY A;  2CFK A;  3BUI A;  1R34 A;  2E22 A;  3A0O A;  1RW9 A;  1LOH A;  2EAB A;  3BVX A;  3WIR A;  2CFL A;  3W7X A;  1JZ7 A;  2JKE A;  1LUR A;  3OS7 A;  1SNZ A;  1HTY A;  1WMP A;  2X03 A;  3T0B A;  3VD9 A;  3I3E A;  4K35 A;  1LXM A;  3J7H A;  2ALW A;  3BUQ A;  4DUX A;  1NS2 A;  5E1Q A;  3PGB A;  3KN4 A;  2C10 A;  3X42 A;  3HIG A;  1HMW A;  3NBJ A;  2YFN A;  2CQS A;  3S4D A;  1OAC A;  2Y73 A;  1NS7 A;  2WDA A;  1TQW A;  4BZF A;  1RWA A;  4K3A A;  4MMH A;  1V7X A;  3DEC A;  1N7O A;  1QAF A;  3BUP A;  3NJV A;  3DX4 A;  1W6G A;  4MMI A;  3WIQ A;  2BT3 A;  2XN2 A;  2FUT A;  1QAL A;  2F7Q A;  2WGQ A;  2WCO A;  1EGU A;  3Q1N A;  3BVT A;  1CB8 A;  1YGA A;  2FUQ A;  3X3Z A;  1N7R A;  3N9H A;  2XSG A;  1NS4 A;  3X40 A;  1I8Q A;  2CFW A;  2JKA A;  3RRS A;  2BRW A;  4BTW A;  3CZN A;  1N7N A;  3BVV A;  3MPH A;  2F7R A;  2EAD A;  3VSN A;  2E2T A;  1DYU A;  2E24 A;  3EJT A;  1TU5 A;  3S4B A;  1F9G A;  1JYV A;  3E80 A;  1F4H A;  3KII A;  1HWW A;  2CWT A;  1NS8 A;  2XHN A;  2OQE C;  4KTR A;  4AQ0 A;  3T09 A;  3DDG A;  4FNV A;  3EJR A;  4OK2 A;  2WVX A;  2CIS A;  2WW3 A;  1OJP A;  4KTP A;  2F7P A;  3VD4 A;  1QAK A;  1NS0 A;  3SX1 A;  1Z45 A;  3X3Y A;  1RWC A;  5JMD A;  1JZ5 A;  1NSS A;  2EAC A;  3WVF A;  1HM3 A;  4FNS A;  3RSY A;  1RWH A;  2OW7 A;  3DYO A;  1SII A;  1JYW A;  1NSM A;  2CQT A;  2Q1F A;  1DP0 A;  4OJZ A;  2XN1 A;  4FNP A;  3LVT A;  3SXX A;  1TXK A;  1W3Y A;  3AFJ A;  3MUZ 1;  1HMU A;  1LVN A;  2HTA A;  3I3D A;  3MWX A;  3T0A A;  3EJP A;  1W5Z A;  4J5T A;  2CFG A;  1JOV A;  4BZE A;  2CWV A;  3T2O A;  1O7D D;  1AVL A;  1IVU A;  2WVZ A;  3QG0 A;  3BVW A;  2BRP A;  3EJQ A;  3AMO A;  1AVK A;  1NSR A;  1X1H A;  2Y74 A;  1J0N A;  3ECQ A;  1MMY A;  1RJO A;  1R33 A;  1L7J A;  3AMO B;  1SO0 A;  2E2U A;  4NEI A;  1UG9 A;  1D6Z A;  2F1A A;  4FNU A;  3VDB A;  1N7P A;  1UI7 A;  1WMO A;  3ACS A;  5A1A A;  2WW1 A;  3VD7 A;  2ZXQ A;  1W2Z A; 
#chains in the Genus database with same CATH homology
 3T09 A;  1F4A A;  4FNV A;  2WZS A;  1F1S A;  1X1J A;  4OK2 A;  3SEP A;  1JZ7 A;  2JKE A;  2WW0 A;  2WVX A;  3MUY 1;  3VD5 A;  3IAQ A;  1JYX A;  1LUR A;  2CIS A;  3OS7 A;  4RNL A;  1HM2 A;  3I3B A;  2WW3 A;  3MV0 1;  1SNZ A;  3E7J A;  4DUV A;  1OJP A;  3VD4 A;  2X03 A;  3T0B A;  1NS0 A;  2BRV X;  3T08 A;  1Z45 A;  3VD9 A;  1OJO A;  3I3E A;  3VD3 A;  1LXM A;  1MMX A;  1RWC A;  2ZXQ A;  5JMD A;  1JZ5 A;  3J7H A;  3CZJ A;  1NSS A;  4BZH A;  1MN0 A;  4DUX A;  3WVF A;  3IMH A;  4TTG A;  1NS2 A;  1JZ4 A;  5E1Q A;  1HM3 A;  1ULV A;  1RWH A;  3WFA A;  3T2Q A;  1L7K A;  3DYO A;  1RWG A;  1HMW A;  3A24 A;  1K1W A;  3T0D A;  5JMF A;  4OK4 A;  1OJN A;  1LF9 A;  3VDC A;  1NSM A;  1JYW A;  2Q1F A;  1NS7 A;  2WDA A;  1DP0 A;  4BZF A;  1RWA A;  4MMH A;  1LF6 A;  4OJZ A;  1NSZ A;  3DEC A;  3DYM A;  2JKP A;  1N7O A;  1PX3 A;  2WVX B;  1NKG A;  3IAP A;  1TXK A;  1W3Y A;  1OJM A;  3NJV A;  1MMU A;  3BLC A;  3E1F 1;  3MUZ 1;  3T2P A;  1HMU A;  1K1X A;  2HTA A;  3I3D A;  3MWX A;  4MMI A;  3T0A A;  1JZ6 A;  1X1I A;  3BS6 A;  1NSX A;  1N7Q A;  1JZ2 A;  2FUT A;  4DUW A;  1RWF A;  2WCO A;  1EGU A;  3Q1N A;  3NJX A;  1JZ8 A;  4J5T A;  2CIR A;  1CB8 A;  1YGA A;  2FUQ A;  3DCD A;  1JOV A;  1N7R A;  3AFL A;  1K1Y A;  2XSG A;  2CIQ A;  1NS4 A;  3BGA A;  1JYN A;  1MMZ A;  3OB8 A;  4BZG A;  1JZ3 A;  1I8Q A;  2D73 A;  3K25 A;  4BZE A;  2JKA A;  3MV1 1;  2BRW A;  3OBA A;  3T2O A;  1N7N A;  1YQ2 A;  3NRE A;  3VSN A;  3VDA A;  2E24 A;  2WVZ A;  1LXK A;  1PX4 A;  3VSM A;  2BRP A;  1F9G A;  1J0M A;  1JYV A;  3E80 A;  3TY1 A;  1NSR A;  1X1H A;  1C82 A;  1J0N A;  3ECQ A;  3DYP A;  1F4H A;  1MMY A;  1NSU A;  2ZQ0 A;  1L7J A;  1NSV A;  1HN1 A;  1SO0 A;  2HTB A;  1NS8 A;  2WW2 A;  1UG9 A;  4NEI A;  2WVY A;  2XHN A;  4AQ0 A;  3VDB A;  1N7P A;  5A1A A;  2WW1 A;  2E22 A;  3A0O A;  3VD7 A;  1HN0 A;  1RW9 A;  1LOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...