1NSMA

Crystal structure of galactose mutarotase from lactococcus lactis mutant d243a complexed with galactose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIAHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 96
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsmA00
3VD5A 1JYVA 2Q1FA 1RWFA 3ECQA 1EGUA 1RW9A 2JKPA 2WZSA 3NJVA 3VD7A 1X1JA 2WW3A 3OB8A 1LF9A 1NS0A 1JYWA 3MUZ1 1HM3A 1JZ7A 3VD4A 2WVXA 3BGAA 1N7QA 1PX3A 1JZ5A 3J7HA 1HMWA 4RNLA 3WFAA 2ZQ0A 1HN0A 1NSSA 2WVYA 2HTAA 1L7JA 1HMUA 1F9GA 1HM2A 1C82A 1JOVA 1N7NA 1LOHA 3T09A 3Q1NA 1MMYA 1NKGA 1MMZA 2HTBA 4DUWA 1JZ4A 1Z45A 3OBAA 3DYPA 3MWXA 3DYMA 1K1XA 1NS7A 3VD3A 1MMUA 2WVZA 4AQ0A 4BZEA 1NSVA 1JYXA 1NSZA 1DP0A 1SNZA 2XHNA 1MN0A 3K25A 2CISA 1JZ3A 1JZ8A 2JKEA 3OS7A 3DCDA 1PX4A 1JZ2A 1YQ2A 1LXKA 3CZJA 3I3BA 3I3DA 1NS8A 2E24A 3A24A 2WVXB 3NREA 1HN1A 3NJXA 1NSUA 5A1AA 2WW1A 1N7OA 1F1SA 1NS2A 2BRVX 4DUXA 1X1HA 3MV01 4BZGA 3DECA 1OJPA 2CIQA 4DUVA 2BRWA 1W3YA 3T08A 1YGAA 3SEPA 2CIRA 1NS4A 1N7RA 3IAPA 2X03A 2WW0A 2E22A 3T0BA 2D73A 3VDCA 2BRPA 1CB8A 1MMXA 1L7KA 1OJOA 1RWAA 3VDAA 3MUY1 1OJNA 1LF6A 1SO0A 2ZXQA 3T0AA 4BZFA 1J0MA 2JKAA 1RWCA 1TXKA 1JYNA 1OJMA 1RWHA 1NSMA 2WCOA 1LURA 2XSGA 1ULVA 1N7PA 3I3EA 1NSXA 1LXMA 2WW2A 1F4AA 3T2QA 4BZHA 1UG9A 1RWGA 1K1WA 4TTGA 1JZ6A 3IMHA 3IAQA 3VDBA 3T2PA 3T0DA 3VD9A 1F4HA 1X1IA 1NSRA 3E1F1 1I8QA 3T2OA 1J0NA 3MV11 5E1QA 1K1YA 3DYOA 2WDAA
chains in the Genus database with same CATH superfamily
2EADA 3VD5A 2XN1A 2Q1FA 1RWFA 3HIGA 1EGUA 3MUZ1 1JZ7A 2PNCA 4FNRA 1WMPA 3BVTA 2OQEA 3DDGA 2ZQ0A 3KIIA 3W7SA 1L7JA 1HMUA 1F9GA 1JOVA 3T09A 2WYHA 4DUWA 2OOVA 3VD3A 2WOFA 1JYXA 1DP0A 2CG1A 1RKYA 3WIRA 2XHNA 1MN0A 2CISA 1JZ3A 1QWUA 1JZ8A 4FNTA 4UFCA 1W2ZA 2C11A 2CFWA 1PX4A 1JZ2A 2F18A 3A24A 2WVXB 3EJTA 3NREA 2YX9A 1H54A 2WW1A 1W4NA 2BRVX 5GW7A 4DUXA 1QWNA 1OJPA 4FNVA 4DUVA 1W3YA 3NBJA 1N7RA 4EV2A 3IAPA 2RDYA 3KN4A 4KFDA 1OJOA 2WOHA 3ACSA 1LF6A 3BUDA 2ZXQA 3PGBA 1QAKA 2JKAA 3DDFA 1TQSA 3D4YA 1NSXA 1QAFA 2CG0A 3W7XA 3DX2A 4BZHA 1UG9A 4FNSA 1JZ6A 3VDBA 3VD9A 1F4HA 4KFEA 3WIQA 2WYIA 3E1F1 3X40A 3BUPA 2ALWA 3D51A 1LVNA 3DX1A 2CWUA 3ECQA 1QX1A 2Y73A 4MMIA 2WW3A 1NS0A 2WGQA 1JYWA 1HM3A 1IU7A 3EJRA 3BVVA 3BGAA 1N7QA 4FNUA 3BUQA 4RNLA 3LVTA 2F7PA 4J5TA 2WVYA 1US1A 2OQEC 1HM2A 1LOHA 3E7JA 2CFDA 1MMZA 1R33A 2HTBA 1JZ4A 1Z45A 1W5ZA 3DYPA 3MWXA 1MMUA 4KFFA 3N9HA 3EJUA 2CFKA 3W7TA 3WA3A 2OOVC 3AMOA 3A0OA 2JKEA 3AFLA 1D6ZA 2D1WA 3AMOB 2W0QA 3NJXA 3VSNA 1V7VA 3EJSA 3MI6A 1NS2A 3MV01 2FUTA 3W7UA 3D50A 1IQXA 2YFOA 3RRSA 1TQWA 3QDEA 2X03A 1CB8A 2F7RA 1O7DD 3VDAA 1D6YA 2EABA 3MUY1 2C10A 4BZFA 1J0MA 1W6CA 4BTXA 1HWWA 1R34A 4EV5A 3AFJA 2XSGA 1N7PA 1LXMA 2F7QA 1IQYA 2WW2A 1F4AA 3T0UA 5CA3A 3S4AA 1SIHA 3T2PA 3TY1A 3X41A 2CWVA 1J0NA 3BUBA 3CZSA 3MV11 4BTYA 5E1QA 1K1YA 1AVLA 1IVVA 3EJQA 1JYVA 1KSIA 3RSYA 1RW9A 2JKPA 2WZSA 3NJVA 1X1JA 3OB8A 1LF9A 3X42A 4OK4A 1UI8A 1JZ5A 1HMWA 3WFAA 1NSSA 3DX4A 3BVUA 2HTAA 3LOYA 3VSMA 1C82A 1N7NA 2OW7A 1PU4A 3WVFA 2E2UA 5JMFA 1K1XA 1NS7A 2WVZA 4OJZA 1NSZA 4K35A 1PS3A 1SNZA 3OS7A 2CQTA 2CFLA 1V7WA 1YQ2A 1LXKA 3CZJA 3I3BA 3I3DA 3D4ZA 2ZL8A 2YFNA 5A1AA 3EJPA 1N7OA 1F1SA 1X1HA 3WA2X 3BLCA 1TQUA 1HTYA 1W6GA 1D6UA 4NEIA 3T08A 3MPHA 2CIRA 1NS4A 3ALAA 3X3XA 4KTRA 2WW0A 5KBPA 1L7KA 1TQTA 1OJNA 2BT3A 3BVXA 1N9EA 1RWCA 2E2TA 3D3IA 1OJMA 1QALA 1RWHA 3ACTA 3D52A 2WCOA 1LURA 1UI7A 1RWGA 4TTGA 1A2VA 3IMHA 1WMNA 1AVKA 1NSRA 1I8QA 3BUIA 2OW6A 1DYUA 3DYOA 1IVXA 3VD7A 3K5TA 2EAEA 3CV5A 2CFGA 3VD4A 2WVXA 1OACA 4K3AA 3S4DA 1PX3A 3J7HA 3NBBA 2XN2A 1V7XA 3E80A 1HN0A 3S4BA 1IVWA 3DX0A 1SPUA 1W7CA 3DX3A 3Q1NA 1MMYA 1NKGA 3OBAA 4AQ0A 3DYMA 4BZEA 3SX1A 1NSVA 2F1BA 1JRQA 3K25A 5JMDA 3HI7A 3HIIA 3X3ZA 1IVUA 3DCDA 2CWTA 3BVWA 4FNQA 3QG0A 1TU5A 1SIIA 1NS8A 2E24A 4BTWA 1HN1A 1NSUA 4KTPA 2XN0A 2FYVA 3QFZA 4BZGA 3DECA 2CIQA 2BRWA 3W7WA 1YGAA 1HXKA 3SEPA 3S4CA 1AV4A 2F1AA 2E2VA 3SXXA 2EACA 2E22A 3T0BA 2D73A 3VDCA 2BRPA 1MMXA 4MMHA 1RWAA 1EKMA 1SO0A 3T0AA 3X3YA 1TXKA 1JYNA 1NSMA 4OK2A 1ULVA 3I3EA 3QFYA 3CZNA 2WO0A 3T2QA 1RJOA 4FNPA 1K1WA 1WMOA 3IAQA 2F7OA 3T0DA 1TQVA 1X1IA 3BS6A 2Y74A 3T2OA 3BLBA 2FUQA 2CQSA 2WDAA
chains in the Genus database with same CATH topology
3VD5A 1JYVA 2Q1FA 1RWFA 3ECQA 1EGUA 1RW9A 2JKPA 2WZSA 3NJVA 4MMIA 3VD7A 1X1JA 2WW3A 3OB8A 1LF9A 1NS0A 1JYWA 3MUZ1 1HM3A 1JZ7A 3VD4A 2WVXA 3BGAA 4OK4A 1N7QA 1PX3A 1JZ5A 3J7HA 1HMWA 4RNLA 3WFAA 3E80A 2ZQ0A 1HN0A 1NSSA 4J5TA 2WVYA 2HTAA 1L7JA 1HMUA 3VSMA 1F9GA 1HM2A 1C82A 1JOVA 1N7NA 1LOHA 3E7JA 3T09A 3Q1NA 1MMYA 1NKGA 1MMZA 2HTBA 3WVFA 4DUWA 5JMFA 1Z45A 1JZ4A 3OBAA 3DYPA 3MWXA 3DYMA 1K1XA 1NS7A 3VD3A 1MMUA 2WVZA 4AQ0A 4BZEA 4OJZA 1NSVA 1JYXA 1NSZA 1DP0A 1SNZA 2XHNA 1MN0A 3K25A 5JMDA 2CISA 1JZ3A 3A0OA 1JZ8A 2JKEA 3OS7A 3AFLA 3DCDA 1PX4A 1JZ2A 1YQ2A 1LXKA 3CZJA 3I3BA 3I3DA 1NS8A 2E24A 3A24A 2WVXB 3NREA 1HN1A 3NJXA 1NSUA 5A1AA 3VSNA 2WW1A 1N7OA 1F1SA 1NS2A 2BRVX 4DUXA 1X1HA 2FUTA 3MV01 4BZGA 3BLCA 3DECA 1OJPA 4FNVA 2CIQA 4DUVA 2BRWA 1W3YA 4NEIA 3T08A 1YGAA 3SEPA 2CIRA 1NS4A 1N7RA 3IAPA 2X03A 2WW0A 2E22A 3T0BA 2D73A 3VDCA 2BRPA 1CB8A 1MMXA 4MMHA 1L7KA 1OJOA 1RWAA 3VDAA 3MUY1 1OJNA 1LF6A 1SO0A 2ZXQA 3T0AA 4BZFA 1J0MA 2JKAA 1RWCA 1TXKA 1JYNA 1OJMA 1RWHA 1NSMA 4OK2A 2WCOA 1LURA 2XSGA 1ULVA 1N7PA 3I3EA 1NSXA 1LXMA 2WW2A 1F4AA 3T2QA 4BZHA 1UG9A 1RWGA 1K1WA 4TTGA 1JZ6A 3IMHA 3IAQA 3VDBA 3T2PA 3TY1A 3T0DA 3VD9A 1F4HA 1X1IA 3BS6A 1NSRA 3E1F1 1I8QA 3T2OA 1J0NA 3MV11 5E1QA 1K1YA 2FUQA 3DYOA 2WDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VD5 A;  1JYV A;  2Q1F A;  1RWF A;  3ECQ A;  1EGU A;  1RW9 A;  2JKP A;  2WZS A;  3NJV A;  3VD7 A;  1X1J A;  2WW3 A;  3OB8 A;  1LF9 A;  1NS0 A;  1JYW A;  3MUZ 1;  1HM3 A;  1JZ7 A;  3VD4 A;  2WVX A;  3BGA A;  1N7Q A;  1PX3 A;  1JZ5 A;  3J7H A;  1HMW A;  4RNL A;  3WFA A;  2ZQ0 A;  1HN0 A;  1NSS A;  2WVY A;  2HTA A;  1L7J A;  1HMU A;  1F9G A;  1HM2 A;  1C82 A;  1JOV A;  1N7N A;  1LOH A;  3T09 A;  3Q1N A;  1MMY A;  1NKG A;  1MMZ A;  2HTB A;  4DUW A;  1JZ4 A;  1Z45 A;  3OBA A;  3DYP A;  3MWX A;  3DYM A;  1K1X A;  1NS7 A;  3VD3 A;  1MMU A;  2WVZ A;  4AQ0 A;  4BZE A;  1NSV A;  1JYX A;  1NSZ A;  1DP0 A;  1SNZ A;  2XHN A;  1MN0 A;  3K25 A;  2CIS A;  1JZ3 A;  1JZ8 A;  2JKE A;  3OS7 A;  3DCD A;  1PX4 A;  1JZ2 A;  1YQ2 A;  1LXK A;  3CZJ A;  3I3B A;  3I3D A;  1NS8 A;  2E24 A;  3A24 A;  2WVX B;  3NRE A;  1HN1 A;  3NJX A;  1NSU A;  5A1A A;  2WW1 A;  1N7O A;  1F1S A;  1NS2 A;  2BRV X;  4DUX A;  1X1H A;  3MV0 1;  4BZG A;  3DEC A;  1OJP A;  2CIQ A;  4DUV A;  2BRW A;  1W3Y A;  3T08 A;  1YGA A;  3SEP A;  2CIR A;  1NS4 A;  1N7R A;  3IAP A;  2X03 A;  2WW0 A;  2E22 A;  3T0B A;  2D73 A;  3VDC A;  2BRP A;  1CB8 A;  1MMX A;  1L7K A;  1OJO A;  1RWA A;  3VDA A;  3MUY 1;  1OJN A;  1LF6 A;  1SO0 A;  2ZXQ A;  3T0A A;  4BZF A;  1J0M A;  2JKA A;  1RWC A;  1TXK A;  1JYN A;  1OJM A;  1RWH A;  1NSM A;  2WCO A;  1LUR A;  2XSG A;  1ULV A;  1N7P A;  3I3E A;  1NSX A;  1LXM A;  2WW2 A;  1F4A A;  3T2Q A;  4BZH A;  1UG9 A;  1RWG A;  1K1W A;  4TTG A;  1JZ6 A;  3IMH A;  3IAQ A;  3VDB A;  3T2P A;  3T0D A;  3VD9 A;  1F4H A;  1X1I A;  1NSR A;  3E1F 1;  1I8Q A;  3T2O A;  1J0N A;  3MV1 1;  5E1Q A;  1K1Y A;  3DYO A;  2WDA A; 
#chains in the Genus database with same CATH topology
 2EAD A;  3VD5 A;  2XN1 A;  2Q1F A;  1RWF A;  3HIG A;  1EGU A;  3MUZ 1;  1JZ7 A;  2PNC A;  4FNR A;  1WMP A;  3BVT A;  2OQE A;  3DDG A;  2ZQ0 A;  3KII A;  3W7S A;  1L7J A;  1HMU A;  1F9G A;  1JOV A;  3T09 A;  2WYH A;  4DUW A;  2OOV A;  3VD3 A;  2WOF A;  1JYX A;  1DP0 A;  2CG1 A;  1RKY A;  3WIR A;  2XHN A;  1MN0 A;  2CIS A;  1JZ3 A;  1QWU A;  1JZ8 A;  4FNT A;  4UFC A;  1W2Z A;  2C11 A;  2CFW A;  1PX4 A;  1JZ2 A;  2F18 A;  3A24 A;  2WVX B;  3EJT A;  3NRE A;  2YX9 A;  1H54 A;  2WW1 A;  1W4N A;  2BRV X;  5GW7 A;  4DUX A;  1QWN A;  1OJP A;  4FNV A;  4DUV A;  1W3Y A;  3NBJ A;  1N7R A;  4EV2 A;  3IAP A;  2RDY A;  3KN4 A;  4KFD A;  1OJO A;  2WOH A;  3ACS A;  1LF6 A;  3BUD A;  2ZXQ A;  3PGB A;  1QAK A;  2JKA A;  3DDF A;  1TQS A;  3D4Y A;  1NSX A;  1QAF A;  2CG0 A;  3W7X A;  3DX2 A;  4BZH A;  1UG9 A;  4FNS A;  1JZ6 A;  3VDB A;  3VD9 A;  1F4H A;  4KFE A;  3WIQ A;  2WYI A;  3E1F 1;  3X40 A;  3BUP A;  2ALW A;  3D51 A;  1LVN A;  3DX1 A;  2CWU A;  3ECQ A;  1QX1 A;  2Y73 A;  4MMI A;  2WW3 A;  1NS0 A;  2WGQ A;  1JYW A;  1HM3 A;  1IU7 A;  3EJR A;  3BVV A;  3BGA A;  1N7Q A;  4FNU A;  3BUQ A;  4RNL A;  3LVT A;  2F7P A;  4J5T A;  2WVY A;  1US1 A;  2OQE C;  1HM2 A;  1LOH A;  3E7J A;  2CFD A;  1MMZ A;  1R33 A;  2HTB A;  1JZ4 A;  1Z45 A;  1W5Z A;  3DYP A;  3MWX A;  1MMU A;  4KFF A;  3N9H A;  3EJU A;  2CFK A;  3W7T A;  3WA3 A;  2OOV C;  3AMO A;  3A0O A;  2JKE A;  3AFL A;  1D6Z A;  2D1W A;  3AMO B;  2W0Q A;  3NJX A;  3VSN A;  1V7V A;  3EJS A;  3MI6 A;  1NS2 A;  3MV0 1;  2FUT A;  3W7U A;  3D50 A;  1IQX A;  2YFO A;  3RRS A;  1TQW A;  3QDE A;  2X03 A;  1CB8 A;  2F7R A;  1O7D D;  3VDA A;  1D6Y A;  2EAB A;  3MUY 1;  2C10 A;  4BZF A;  1J0M A;  1W6C A;  4BTX A;  1HWW A;  1R34 A;  4EV5 A;  3AFJ A;  2XSG A;  1N7P A;  1LXM A;  2F7Q A;  1IQY A;  2WW2 A;  1F4A A;  3T0U A;  5CA3 A;  3S4A A;  1SIH A;  3T2P A;  3TY1 A;  3X41 A;  2CWV A;  1J0N A;  3BUB A;  3CZS A;  3MV1 1;  4BTY A;  5E1Q A;  1K1Y A;  1AVL A;  1IVV A;  3EJQ A;  1JYV A;  1KSI A;  3RSY A;  1RW9 A;  2JKP A;  2WZS A;  3NJV A;  1X1J A;  3OB8 A;  1LF9 A;  3X42 A;  4OK4 A;  1UI8 A;  1JZ5 A;  1HMW A;  3WFA A;  1NSS A;  3DX4 A;  3BVU A;  2HTA A;  3LOY A;  3VSM A;  1C82 A;  1N7N A;  2OW7 A;  1PU4 A;  3WVF A;  2E2U A;  5JMF A;  1K1X A;  1NS7 A;  2WVZ A;  4OJZ A;  1NSZ A;  4K35 A;  1PS3 A;  1SNZ A;  3OS7 A;  2CQT A;  2CFL A;  1V7W A;  1YQ2 A;  1LXK A;  3CZJ A;  3I3B A;  3I3D A;  3D4Z A;  2ZL8 A;  2YFN A;  5A1A A;  3EJP A;  1N7O A;  1F1S A;  1X1H A;  3WA2 X;  3BLC A;  1TQU A;  1HTY A;  1W6G A;  1D6U A;  4NEI A;  3T08 A;  3MPH A;  2CIR A;  1NS4 A;  3ALA A;  3X3X A;  4KTR A;  2WW0 A;  5KBP A;  1L7K A;  1TQT A;  1OJN A;  2BT3 A;  3BVX A;  1N9E A;  1RWC A;  2E2T A;  3D3I A;  1OJM A;  1QAL A;  1RWH A;  3ACT A;  3D52 A;  2WCO A;  1LUR A;  1UI7 A;  1RWG A;  4TTG A;  1A2V A;  3IMH A;  1WMN A;  1AVK A;  1NSR A;  1I8Q A;  3BUI A;  2OW6 A;  1DYU A;  3DYO A;  1IVX A;  3VD7 A;  3K5T A;  2EAE A;  3CV5 A;  2CFG A;  3VD4 A;  2WVX A;  1OAC A;  4K3A A;  3S4D A;  1PX3 A;  3J7H A;  3NBB A;  2XN2 A;  1V7X A;  3E80 A;  1HN0 A;  3S4B A;  1IVW A;  3DX0 A;  1SPU A;  1W7C A;  3DX3 A;  3Q1N A;  1MMY A;  1NKG A;  3OBA A;  4AQ0 A;  3DYM A;  4BZE A;  3SX1 A;  1NSV A;  2F1B A;  1JRQ A;  3K25 A;  5JMD A;  3HI7 A;  3HII A;  3X3Z A;  1IVU A;  3DCD A;  2CWT A;  3BVW A;  4FNQ A;  3QG0 A;  1TU5 A;  1SII A;  1NS8 A;  2E24 A;  4BTW A;  1HN1 A;  1NSU A;  4KTP A;  2XN0 A;  2FYV A;  3QFZ A;  4BZG A;  3DEC A;  2CIQ A;  2BRW A;  3W7W A;  1YGA A;  1HXK A;  3SEP A;  3S4C A;  1AV4 A;  2F1A A;  2E2V A;  3SXX A;  2EAC A;  2E22 A;  3T0B A;  2D73 A;  3VDC A;  2BRP A;  1MMX A;  4MMH A;  1RWA A;  1EKM A;  1SO0 A;  3T0A A;  3X3Y A;  1TXK A;  1JYN A;  1NSM A;  4OK2 A;  1ULV A;  3I3E A;  3QFY A;  3CZN A;  2WO0 A;  3T2Q A;  1RJO A;  4FNP A;  1K1W A;  1WMO A;  3IAQ A;  2F7O A;  3T0D A;  1TQV A;  1X1I A;  3BS6 A;  2Y74 A;  3T2O A;  3BLB A;  2FUQ A;  2CQS A;  2WDA A; 
#chains in the Genus database with same CATH homology
 3VD5 A;  1JYV A;  2Q1F A;  1RWF A;  3ECQ A;  1EGU A;  1RW9 A;  2JKP A;  2WZS A;  3NJV A;  4MMI A;  3VD7 A;  1X1J A;  2WW3 A;  3OB8 A;  1LF9 A;  1NS0 A;  1JYW A;  3MUZ 1;  1HM3 A;  1JZ7 A;  3VD4 A;  2WVX A;  3BGA A;  4OK4 A;  1N7Q A;  1PX3 A;  1JZ5 A;  3J7H A;  1HMW A;  4RNL A;  3WFA A;  3E80 A;  2ZQ0 A;  1HN0 A;  1NSS A;  4J5T A;  2WVY A;  2HTA A;  1L7J A;  1HMU A;  3VSM A;  1F9G A;  1HM2 A;  1C82 A;  1JOV A;  1N7N A;  1LOH A;  3E7J A;  3T09 A;  3Q1N A;  1MMY A;  1NKG A;  1MMZ A;  2HTB A;  3WVF A;  4DUW A;  5JMF A;  1Z45 A;  1JZ4 A;  3OBA A;  3DYP A;  3MWX A;  3DYM A;  1K1X A;  1NS7 A;  3VD3 A;  1MMU A;  2WVZ A;  4AQ0 A;  4BZE A;  4OJZ A;  1NSV A;  1JYX A;  1NSZ A;  1DP0 A;  1SNZ A;  2XHN A;  1MN0 A;  3K25 A;  5JMD A;  2CIS A;  1JZ3 A;  3A0O A;  1JZ8 A;  2JKE A;  3OS7 A;  3AFL A;  3DCD A;  1PX4 A;  1JZ2 A;  1YQ2 A;  1LXK A;  3CZJ A;  3I3B A;  3I3D A;  1NS8 A;  2E24 A;  3A24 A;  2WVX B;  3NRE A;  1HN1 A;  3NJX A;  1NSU A;  5A1A A;  3VSN A;  2WW1 A;  1N7O A;  1F1S A;  1NS2 A;  2BRV X;  4DUX A;  1X1H A;  2FUT A;  3MV0 1;  4BZG A;  3BLC A;  3DEC A;  1OJP A;  4FNV A;  2CIQ A;  4DUV A;  2BRW A;  1W3Y A;  4NEI A;  3T08 A;  1YGA A;  3SEP A;  2CIR A;  1NS4 A;  1N7R A;  3IAP A;  2X03 A;  2WW0 A;  2E22 A;  3T0B A;  2D73 A;  3VDC A;  2BRP A;  1CB8 A;  1MMX A;  4MMH A;  1L7K A;  1OJO A;  1RWA A;  3VDA A;  3MUY 1;  1OJN A;  1LF6 A;  1SO0 A;  2ZXQ A;  3T0A A;  4BZF A;  1J0M A;  2JKA A;  1RWC A;  1TXK A;  1JYN A;  1OJM A;  1RWH A;  1NSM A;  4OK2 A;  2WCO A;  1LUR A;  2XSG A;  1ULV A;  1N7P A;  3I3E A;  1NSX A;  1LXM A;  2WW2 A;  1F4A A;  3T2Q A;  4BZH A;  1UG9 A;  1RWG A;  1K1W A;  4TTG A;  1JZ6 A;  3IMH A;  3IAQ A;  3VDB A;  3T2P A;  3TY1 A;  3T0D A;  3VD9 A;  1F4H A;  1X1I A;  3BS6 A;  1NSR A;  3E1F 1;  1I8Q A;  3T2O A;  1J0N A;  3MV1 1;  5E1Q A;  1K1Y A;  2FUQ A;  3DYO A;  2WDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...