1NSMA

Crystal structure of galactose mutarotase from lactococcus lactis mutant d243a complexed with galactose
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIAHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 96
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsmA00
1F9GA 5A1AA 3IMHA 3CZJA 3SEPA 3VD3A 3VD5A 1NSUA 1OJNA 3T2PA 1JYWA 1MMZA 2CIRA 3WFAA 2CISA 1OJOA 4DUVA 1CB8A 3IAQA 2XHNA 1NS2A 3MV11 3MUZ1 1NKGA 2Q1FA 2BRVX 1JOVA 1OJMA 2WVZA 4DUWA 1LF6A 4AQ0A 1Z45A 4BZHA 2ZXQA 3BGAA 3DECA 1HM3A 2ZQ0A 3T0DA 2E22A 2JKPA 1JZ8A 2BRPA 1C82A 3K25A 4RNLA 3IAPA 1N7RA 4BZFA 1L7KA 2HTAA 2JKAA 3E1F1 1L7JA 1PX4A 3VDCA 1K1WA 1RW9A 1K1YA 2WVYA 1N7PA 1DP0A 1JZ5A 2WW0A 1SNZA 1JYNA 1JZ7A 1NSVA 1X1JA 2XSGA 3NJVA 1JZ2A 1JYXA 2WW2A 2D73A 1HMWA 2X03A 3T0AA 1RWCA 1LURA 1X1IA 1X1HA 3T2QA 2WW1A 1LXKA 3DCDA 1LOHA 1N7OA 2WZSA 3OBAA 4TTGA 3T2OA 1UG9A 3I3BA 3NREA 1EGUA 3DYMA 3T09A 1J0NA 1N7NA 1HM2A 1NSRA 1JZ4A 3Q1NA 3J7HA 1NS8A 1TXKA 3VD9A 1HN0A 1NSSA 1MN0A 3I3EA 3DYPA 1MMYA 1MMUA 3OB8A 1YQ2A 1YGAA 3VD4A 1F4HA 1JZ6A 1JZ3A 2WCOA 4BZEA 1NS4A 1F1SA 1LXMA 1NS0A 3MV01 3VDAA 1RWAA 1RWFA 2HTBA 3A24A 1N7QA 2WDAA 3I3DA 1HN1A 3DYOA 1NSZA 1RWHA 3T08A 1OJPA 3NJXA 4DUXA 2CIQA 1MMXA 1LF9A 2WVXA 1J0MA 3ECQA 1PX3A 2E24A 2BRWA 1K1XA 1NSMA 1NSXA 1SO0A 1I8QA 3MWXA 3OS7A 3VD7A 1HMUA 1JYVA 5E1QA 3VDBA 1ULVA 2WVXB 2JKEA 4BZGA 3T0BA 1NS7A 1RWGA 1W3YA 3MUY1 1F4AA 2WW3A
chains in the Genus database with same CATH superfamily
1F9GA 5CA3A 5KBPA 3SEPA 3VD5A 1W6GA 1IVXA 2F18A 1OJOA 1CB8A 1TQVA 3LOYA 2CWUA 2Y74A 3MV11 2CFLA 2CWVA 1NKGA 4KFFA 3BUPA 4BTXA 4EV5A 1QX1A 3X3ZA 1Z45A 4BZHA 3D4YA 1V7XA 2OW7A 2Y73A 1HM3A 2CFKA 3DECA 2E22A 2EABA 2BRPA 3D51A 4OK2A 4RNLA 1N7RA 2FUQA 3BUIA 3HIGA 1K1WA 2WVYA 3EJSA 1JZ7A 1SPUA 2XSGA 1IQXA 3AMOA 1X1IA 1O7DD 1LXKA 3DCDA 3BLCA 3BVUA 3D3IA 2F7OA 4FNSA 3NBBA 2CFGA 1HM2A 3EJPA 3BUQA 3OB8A 3VD4A 1F4HA 1JZ3A 4BZEA 1NS4A 3BVVA 1QAKA 1F1SA 2CQSA 1HTYA 3CZNA 1RWFA 3DYOA 3W7WA 1NSZA 3QFZA 3WA3A 1QWUA 1AVKA 1JRQA 1V7VA 1HXKA 1SO0A 2CWTA 1HMUA 5E1QA 3VDBA 3ACTA 2F7RA 1AV4A 1DYUA 3DX3A 2YFOA 5A1AA 3EJTA 3TY1A 3VSMA 1JYWA 1MMZA 3WFAA 2YX9A 4OK4A 3IAQA 2CFDA 1TQUA 2Q1FA 1JOVA 3CZSA 3DX0A 1W2ZA 3AFJA 2ZXQA 2C11A 1QAFA 3T0UA 2ZQ0A 3E80A 4OJZA 1JZ8A 1EKMA 1W7CA 2HTAA 3X3XA 3BUDA 1PX4A 2WOHA 3MI6A 1LVNA 1DP0A 1SNZA 1X1JA 2F1AA 1JYXA 1D6UA 2F7PA 1A2VA 1QWNA 3BVXA 2WOFA 1HWWA 4TTGA 3T2OA 1PS3A 1UI7A 3X41A 3I3BA 1R33A 3T09A 2YFNA 1J0NA 2OOVC 2XN1A 1NSRA 1JZ4A 3Q1NA 3VD9A 3DYPA 3DX2A 2FUTA 1JZ6A 1QALA 4EV2A 1IVUA 1NS0A 2EACA 3HI7A 3VDAA 5JMFA 2E2UA 3A24A 2WDAA 5JMDA 1HN1A 3T08A 3NBJA 1SIHA 2E2VA 2OQEA 1OJPA 1LF9A 3RRSA 3W7TA 1W6CA 2E24A 1KSIA 1PU4A 3MWXA 4NEIA 3VD7A 3N9HA 2WVXB 3MUY1 2EADA 4BTYA 3VD3A 1NSUA 1OJNA 3DX4A 2WO0A 4DUVA 4FNVA 1NS2A 1OACA 2BRVX 1OJMA 2OW6A 3BS6A 2WVZA 1LF6A 4AQ0A 2ALWA 4KFDA 3W7XA 3T0DA 3EJQA 1TQWA 3BLBA 3SXXA 1IQYA 2D1WA 1RKYA 2W0QA 1C82A 2XN0A 2E2TA 3IAPA 4BZFA 5GW7A 4K3AA 3SX1A 3PGBA 1V7WA 1N7PA 3A0OA 1WMPA 1UI8A 2WW0A 2XN2A 1JYNA 3NJVA 2D73A 2X03A 1RWCA 1W5ZA 1X1HA 2ZL8A 3T2QA 1RJOA 3BVTA 2C10A 4MMHA 4FNUA 1TQTA 1NS8A 1TXKA 1HN0A 1IU7A 3I3EA 3DX1A 3W7SA 1MMYA 1YQ2A 2F1BA 2WCOA 1LXMA 2F7QA 1N9EA 3MV01 1RWAA 4FNTA 3I3DA 3E7JA 1D6YA 4MMIA 3X3YA 1RWHA 3VSNA 3ALAA 3QG0A 2WVXA 1MMXA 3EJUA 3ECQA 4KTRA 1NSXA 1I8QA 3OS7A 3DDFA 4FNRA 1JYVA 1ULVA 1R34A 2JKEA 3T0BA 4K35A 1W3YA 3WA2X 3S4AA 1H54A 3W7UA 2BT3A 3EJRA 3IMHA 3CZJA 1WMOA 3D4ZA 4FNQA 4KFEA 3S4CA 3T2PA 2CG1A 2CIRA 2CISA 2WGQA 3D52A 3BVWA 2PNCA 2XHNA 1SIIA 1WMNA 1IVVA 3MUZ1 4UFCA 2WYHA 1TU5A 3QFYA 3ACSA 4DUWA 2EAEA 3S4DA 3BGAA 3WIQA 1US1A 2FYVA 2JKPA 3K25A 3QDEA 1IVWA 1L7KA 2JKAA 3E1F1 1L7JA 3WVFA 3VDCA 1RW9A 1K1YA 3DDGA 1JZ5A 3K5TA 2WYIA 3WIRA 1NSVA 1JZ2A 1D6ZA 2CFWA 2WW2A 1HMWA 3T0AA 2CG0A 3AFLA 1LURA 3BUBA 2WW1A 3RSYA 1LOHA 1N7OA 2WZSA 3D50A 3OBAA 4J5TA 1UG9A 3MPHA 3AMOB 3NREA 2OQEC 1EGUA 3DYMA 1N7NA 1TQSA 3J7HA 1NSSA 1MN0A 3LVTA 1MMUA 1YGAA 3X40A 1W4NA 3S4BA 4BTWA 2HTBA 1N7QA 2CQTA 3KN4A 4KTPA 3NJXA 2OOVA 4DUXA 3CV5A 2CIQA 1J0MA 1PX3A 2BRWA 1K1XA 2RDYA 1NSMA 3X42A 1AVLA 3HIIA 4FNPA 4BZGA 1NS7A 1RWGA 3KIIA 1F4AA 2WW3A
chains in the Genus database with same CATH topology
1F9GA 5A1AA 3IMHA 3CZJA 3SEPA 3VD3A 3VD5A 1NSUA 1OJNA 3TY1A 3T2PA 3VSMA 1JYWA 1MMZA 2CIRA 3WFAA 2CISA 1OJOA 4DUVA 1CB8A 4FNVA 4OK4A 3IAQA 2XHNA 1NS2A 3MV11 3MUZ1 1NKGA 2Q1FA 2BRVX 1JOVA 1OJMA 3BS6A 2WVZA 4DUWA 1LF6A 4AQ0A 1Z45A 4BZHA 2ZXQA 3BGAA 3DECA 1HM3A 2ZQ0A 3T0DA 3E80A 2E22A 4OJZA 2JKPA 1JZ8A 2BRPA 1C82A 3K25A 4OK2A 4RNLA 3IAPA 1N7RA 4BZFA 1L7KA 2HTAA 2JKAA 2FUQA 3E1F1 1L7JA 3WVFA 1PX4A 3VDCA 1K1WA 1RW9A 1K1YA 2WVYA 1N7PA 1DP0A 3A0OA 1JZ5A 2WW0A 1SNZA 1JYNA 1JZ7A 1NSVA 1X1JA 2XSGA 3NJVA 1JZ2A 1JYXA 2WW2A 2D73A 1HMWA 2X03A 3T0AA 1RWCA 3AFLA 1LURA 1X1IA 1X1HA 3T2QA 2WW1A 1LXKA 3DCDA 1LOHA 1N7OA 2WZSA 3BLCA 3OBAA 4J5TA 4TTGA 3T2OA 1UG9A 4MMHA 3I3BA 3NREA 1EGUA 3DYMA 3T09A 1J0NA 1N7NA 1HM2A 1NSRA 1JZ4A 3Q1NA 3J7HA 1NS8A 1TXKA 3VD9A 1HN0A 1NSSA 1MN0A 3I3EA 3DYPA 1MMYA 1MMUA 3OB8A 1YQ2A 1YGAA 3VD4A 1F4HA 2FUTA 1JZ6A 1JZ3A 2WCOA 4BZEA 1NS4A 1F1SA 1LXMA 1NS0A 3MV01 3VDAA 5JMFA 1RWAA 1RWFA 2HTBA 3A24A 1N7QA 2WDAA 3I3DA 5JMDA 1HN1A 3DYOA 1NSZA 3E7JA 4MMIA 1RWHA 3VSNA 3T08A 1OJPA 3NJXA 4DUXA 2CIQA 1MMXA 1LF9A 2WVXA 1J0MA 3ECQA 1PX3A 2E24A 2BRWA 1K1XA 1NSMA 1NSXA 1SO0A 1I8QA 3MWXA 3OS7A 4NEIA 3VD7A 1HMUA 1JYVA 5E1QA 3VDBA 1ULVA 2WVXB 2JKEA 4BZGA 3T0BA 1NS7A 1RWGA 1W3YA 3MUY1 1F4AA 2WW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9G A;  5A1A A;  3IMH A;  3CZJ A;  3SEP A;  3VD3 A;  3VD5 A;  1NSU A;  1OJN A;  3T2P A;  1JYW A;  1MMZ A;  2CIR A;  3WFA A;  2CIS A;  1OJO A;  4DUV A;  1CB8 A;  3IAQ A;  2XHN A;  1NS2 A;  3MV1 1;  3MUZ 1;  1NKG A;  2Q1F A;  2BRV X;  1JOV A;  1OJM A;  2WVZ A;  4DUW A;  1LF6 A;  4AQ0 A;  1Z45 A;  4BZH A;  2ZXQ A;  3BGA A;  3DEC A;  1HM3 A;  2ZQ0 A;  3T0D A;  2E22 A;  2JKP A;  1JZ8 A;  2BRP A;  1C82 A;  3K25 A;  4RNL A;  3IAP A;  1N7R A;  4BZF A;  1L7K A;  2HTA A;  2JKA A;  3E1F 1;  1L7J A;  1PX4 A;  3VDC A;  1K1W A;  1RW9 A;  1K1Y A;  2WVY A;  1N7P A;  1DP0 A;  1JZ5 A;  2WW0 A;  1SNZ A;  1JYN A;  1JZ7 A;  1NSV A;  1X1J A;  2XSG A;  3NJV A;  1JZ2 A;  1JYX A;  2WW2 A;  2D73 A;  1HMW A;  2X03 A;  3T0A A;  1RWC A;  1LUR A;  1X1I A;  1X1H A;  3T2Q A;  2WW1 A;  1LXK A;  3DCD A;  1LOH A;  1N7O A;  2WZS A;  3OBA A;  4TTG A;  3T2O A;  1UG9 A;  3I3B A;  3NRE A;  1EGU A;  3DYM A;  3T09 A;  1J0N A;  1N7N A;  1HM2 A;  1NSR A;  1JZ4 A;  3Q1N A;  3J7H A;  1NS8 A;  1TXK A;  3VD9 A;  1HN0 A;  1NSS A;  1MN0 A;  3I3E A;  3DYP A;  1MMY A;  1MMU A;  3OB8 A;  1YQ2 A;  1YGA A;  3VD4 A;  1F4H A;  1JZ6 A;  1JZ3 A;  2WCO A;  4BZE A;  1NS4 A;  1F1S A;  1LXM A;  1NS0 A;  3MV0 1;  3VDA A;  1RWA A;  1RWF A;  2HTB A;  3A24 A;  1N7Q A;  2WDA A;  3I3D A;  1HN1 A;  3DYO A;  1NSZ A;  1RWH A;  3T08 A;  1OJP A;  3NJX A;  4DUX A;  2CIQ A;  1MMX A;  1LF9 A;  2WVX A;  1J0M A;  3ECQ A;  1PX3 A;  2E24 A;  2BRW A;  1K1X A;  1NSM A;  1NSX A;  1SO0 A;  1I8Q A;  3MWX A;  3OS7 A;  3VD7 A;  1HMU A;  1JYV A;  5E1Q A;  3VDB A;  1ULV A;  2WVX B;  2JKE A;  4BZG A;  3T0B A;  1NS7 A;  1RWG A;  1W3Y A;  3MUY 1;  1F4A A;  2WW3 A; 
#chains in the Genus database with same CATH topology
 1F9G A;  5CA3 A;  5KBP A;  3SEP A;  3VD5 A;  1W6G A;  1IVX A;  2F18 A;  1OJO A;  1CB8 A;  1TQV A;  3LOY A;  2CWU A;  2Y74 A;  3MV1 1;  2CFL A;  2CWV A;  1NKG A;  4KFF A;  3BUP A;  4BTX A;  4EV5 A;  1QX1 A;  3X3Z A;  1Z45 A;  4BZH A;  3D4Y A;  1V7X A;  2OW7 A;  2Y73 A;  1HM3 A;  2CFK A;  3DEC A;  2E22 A;  2EAB A;  2BRP A;  3D51 A;  4OK2 A;  4RNL A;  1N7R A;  2FUQ A;  3BUI A;  3HIG A;  1K1W A;  2WVY A;  3EJS A;  1JZ7 A;  1SPU A;  2XSG A;  1IQX A;  3AMO A;  1X1I A;  1O7D D;  1LXK A;  3DCD A;  3BLC A;  3BVU A;  3D3I A;  2F7O A;  4FNS A;  3NBB A;  2CFG A;  1HM2 A;  3EJP A;  3BUQ A;  3OB8 A;  3VD4 A;  1F4H A;  1JZ3 A;  4BZE A;  1NS4 A;  3BVV A;  1QAK A;  1F1S A;  2CQS A;  1HTY A;  3CZN A;  1RWF A;  3DYO A;  3W7W A;  1NSZ A;  3QFZ A;  3WA3 A;  1QWU A;  1AVK A;  1JRQ A;  1V7V A;  1HXK A;  1SO0 A;  2CWT A;  1HMU A;  5E1Q A;  3VDB A;  3ACT A;  2F7R A;  1AV4 A;  1DYU A;  3DX3 A;  2YFO A;  5A1A A;  3EJT A;  3TY1 A;  3VSM A;  1JYW A;  1MMZ A;  3WFA A;  2YX9 A;  4OK4 A;  3IAQ A;  2CFD A;  1TQU A;  2Q1F A;  1JOV A;  3CZS A;  3DX0 A;  1W2Z A;  3AFJ A;  2ZXQ A;  2C11 A;  1QAF A;  3T0U A;  2ZQ0 A;  3E80 A;  4OJZ A;  1JZ8 A;  1EKM A;  1W7C A;  2HTA A;  3X3X A;  3BUD A;  1PX4 A;  2WOH A;  3MI6 A;  1LVN A;  1DP0 A;  1SNZ A;  1X1J A;  2F1A A;  1JYX A;  1D6U A;  2F7P A;  1A2V A;  1QWN A;  3BVX A;  2WOF A;  1HWW A;  4TTG A;  3T2O A;  1PS3 A;  1UI7 A;  3X41 A;  3I3B A;  1R33 A;  3T09 A;  2YFN A;  1J0N A;  2OOV C;  2XN1 A;  1NSR A;  1JZ4 A;  3Q1N A;  3VD9 A;  3DYP A;  3DX2 A;  2FUT A;  1JZ6 A;  1QAL A;  4EV2 A;  1IVU A;  1NS0 A;  2EAC A;  3HI7 A;  3VDA A;  5JMF A;  2E2U A;  3A24 A;  2WDA A;  5JMD A;  1HN1 A;  3T08 A;  3NBJ A;  1SIH A;  2E2V A;  2OQE A;  1OJP A;  1LF9 A;  3RRS A;  3W7T A;  1W6C A;  2E24 A;  1KSI A;  1PU4 A;  3MWX A;  4NEI A;  3VD7 A;  3N9H A;  2WVX B;  3MUY 1;  2EAD A;  4BTY A;  3VD3 A;  1NSU A;  1OJN A;  3DX4 A;  2WO0 A;  4DUV A;  4FNV A;  1NS2 A;  1OAC A;  2BRV X;  1OJM A;  2OW6 A;  3BS6 A;  2WVZ A;  1LF6 A;  4AQ0 A;  2ALW A;  4KFD A;  3W7X A;  3T0D A;  3EJQ A;  1TQW A;  3BLB A;  3SXX A;  1IQY A;  2D1W A;  1RKY A;  2W0Q A;  1C82 A;  2XN0 A;  2E2T A;  3IAP A;  4BZF A;  5GW7 A;  4K3A A;  3SX1 A;  3PGB A;  1V7W A;  1N7P A;  3A0O A;  1WMP A;  1UI8 A;  2WW0 A;  2XN2 A;  1JYN A;  3NJV A;  2D73 A;  2X03 A;  1RWC A;  1W5Z A;  1X1H A;  2ZL8 A;  3T2Q A;  1RJO A;  3BVT A;  2C10 A;  4MMH A;  4FNU A;  1TQT A;  1NS8 A;  1TXK A;  1HN0 A;  1IU7 A;  3I3E A;  3DX1 A;  3W7S A;  1MMY A;  1YQ2 A;  2F1B A;  2WCO A;  1LXM A;  2F7Q A;  1N9E A;  3MV0 1;  1RWA A;  4FNT A;  3I3D A;  3E7J A;  1D6Y A;  4MMI A;  3X3Y A;  1RWH A;  3VSN A;  3ALA A;  3QG0 A;  2WVX A;  1MMX A;  3EJU A;  3ECQ A;  4KTR A;  1NSX A;  1I8Q A;  3OS7 A;  3DDF A;  4FNR A;  1JYV A;  1ULV A;  1R34 A;  2JKE A;  3T0B A;  4K35 A;  1W3Y A;  3WA2 X;  3S4A A;  1H54 A;  3W7U A;  2BT3 A;  3EJR A;  3IMH A;  3CZJ A;  1WMO A;  3D4Z A;  4FNQ A;  4KFE A;  3S4C A;  3T2P A;  2CG1 A;  2CIR A;  2CIS A;  2WGQ A;  3D52 A;  3BVW A;  2PNC A;  2XHN A;  1SII A;  1WMN A;  1IVV A;  3MUZ 1;  4UFC A;  2WYH A;  1TU5 A;  3QFY A;  3ACS A;  4DUW A;  2EAE A;  3S4D A;  3BGA A;  3WIQ A;  1US1 A;  2FYV A;  2JKP A;  3K25 A;  3QDE A;  1IVW A;  1L7K A;  2JKA A;  3E1F 1;  1L7J A;  3WVF A;  3VDC A;  1RW9 A;  1K1Y A;  3DDG A;  1JZ5 A;  3K5T A;  2WYI A;  3WIR A;  1NSV A;  1JZ2 A;  1D6Z A;  2CFW A;  2WW2 A;  1HMW A;  3T0A A;  2CG0 A;  3AFL A;  1LUR A;  3BUB A;  2WW1 A;  3RSY A;  1LOH A;  1N7O A;  2WZS A;  3D50 A;  3OBA A;  4J5T A;  1UG9 A;  3MPH A;  3AMO B;  3NRE A;  2OQE C;  1EGU A;  3DYM A;  1N7N A;  1TQS A;  3J7H A;  1NSS A;  1MN0 A;  3LVT A;  1MMU A;  1YGA A;  3X40 A;  1W4N A;  3S4B A;  4BTW A;  2HTB A;  1N7Q A;  2CQT A;  3KN4 A;  4KTP A;  3NJX A;  2OOV A;  4DUX A;  3CV5 A;  2CIQ A;  1J0M A;  1PX3 A;  2BRW A;  1K1X A;  2RDY A;  1NSM A;  3X42 A;  1AVL A;  3HII A;  4FNP A;  4BZG A;  1NS7 A;  1RWG A;  3KII A;  1F4A A;  2WW3 A; 
#chains in the Genus database with same CATH homology
 1F9G A;  5A1A A;  3IMH A;  3CZJ A;  3SEP A;  3VD3 A;  3VD5 A;  1NSU A;  1OJN A;  3TY1 A;  3T2P A;  3VSM A;  1JYW A;  1MMZ A;  2CIR A;  3WFA A;  2CIS A;  1OJO A;  4DUV A;  1CB8 A;  4FNV A;  4OK4 A;  3IAQ A;  2XHN A;  1NS2 A;  3MV1 1;  3MUZ 1;  1NKG A;  2Q1F A;  2BRV X;  1JOV A;  1OJM A;  3BS6 A;  2WVZ A;  4DUW A;  1LF6 A;  4AQ0 A;  1Z45 A;  4BZH A;  2ZXQ A;  3BGA A;  3DEC A;  1HM3 A;  2ZQ0 A;  3T0D A;  3E80 A;  2E22 A;  4OJZ A;  2JKP A;  1JZ8 A;  2BRP A;  1C82 A;  3K25 A;  4OK2 A;  4RNL A;  3IAP A;  1N7R A;  4BZF A;  1L7K A;  2HTA A;  2JKA A;  2FUQ A;  3E1F 1;  1L7J A;  3WVF A;  1PX4 A;  3VDC A;  1K1W A;  1RW9 A;  1K1Y A;  2WVY A;  1N7P A;  1DP0 A;  3A0O A;  1JZ5 A;  2WW0 A;  1SNZ A;  1JYN A;  1JZ7 A;  1NSV A;  1X1J A;  2XSG A;  3NJV A;  1JZ2 A;  1JYX A;  2WW2 A;  2D73 A;  1HMW A;  2X03 A;  3T0A A;  1RWC A;  3AFL A;  1LUR A;  1X1I A;  1X1H A;  3T2Q A;  2WW1 A;  1LXK A;  3DCD A;  1LOH A;  1N7O A;  2WZS A;  3BLC A;  3OBA A;  4J5T A;  4TTG A;  3T2O A;  1UG9 A;  4MMH A;  3I3B A;  3NRE A;  1EGU A;  3DYM A;  3T09 A;  1J0N A;  1N7N A;  1HM2 A;  1NSR A;  1JZ4 A;  3Q1N A;  3J7H A;  1NS8 A;  1TXK A;  3VD9 A;  1HN0 A;  1NSS A;  1MN0 A;  3I3E A;  3DYP A;  1MMY A;  1MMU A;  3OB8 A;  1YQ2 A;  1YGA A;  3VD4 A;  1F4H A;  2FUT A;  1JZ6 A;  1JZ3 A;  2WCO A;  4BZE A;  1NS4 A;  1F1S A;  1LXM A;  1NS0 A;  3MV0 1;  3VDA A;  5JMF A;  1RWA A;  1RWF A;  2HTB A;  3A24 A;  1N7Q A;  2WDA A;  3I3D A;  5JMD A;  1HN1 A;  3DYO A;  1NSZ A;  3E7J A;  4MMI A;  1RWH A;  3VSN A;  3T08 A;  1OJP A;  3NJX A;  4DUX A;  2CIQ A;  1MMX A;  1LF9 A;  2WVX A;  1J0M A;  3ECQ A;  1PX3 A;  2E24 A;  2BRW A;  1K1X A;  1NSM A;  1NSX A;  1SO0 A;  1I8Q A;  3MWX A;  3OS7 A;  4NEI A;  3VD7 A;  1HMU A;  1JYV A;  5E1Q A;  3VDB A;  1ULV A;  2WVX B;  2JKE A;  4BZG A;  3T0B A;  1NS7 A;  1RWG A;  1W3Y A;  3MUY 1;  1F4A A;  2WW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...