1NSRA

Crystal structure of galactose mutarotase from lactococcus lactis mutant d243n complexed with glucose
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGINHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 99
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsrA00
3T0AA 4DUVA 2WDAA 1X1HA 2JKAA 3VDBA 1NSUA 2WW3A 3SEPA 1W3YA 1N7NA 1MMXA 3MUY1 3T0DA 1RWHA 2D73A 3NJXA 3IMHA 1Z45A 1SO0A 1OJMA 2WW2A 5E1QA 1NS2A 3DYPA 3DECA 2E24A 2ZQ0A 2WVXA 1OJPA 1X1JA 2BRPA 1F1SA 1JZ3A 2WVZA 1HMUA 4BZHA 1K1WA 3OS7A 1F4HA 1HN0A 3WFAA 1N7QA 3T2QA 1YGAA 1RWAA 1K1YA 3NREA 1NSZA 1LOHA 3DYMA 3ECQA 2Q1FA 3K25A 1OJNA 1LXKA 2WZSA 3IAPA 3NJVA 1NS0A 2BRWA 3MWXA 3MUZ1 2ZXQA 3I3BA 3Q1NA 1RWGA 2JKPA 1RWFA 1JYVA 1NS7A 3J7HA 1PX3A 1LURA 1MMYA 1JZ2A 1L7JA 4RNLA 1DP0A 3I3DA 4BZFA 5A1AA 1JZ6A 2WW1A 2XSGA 3DYOA 1N7PA 3VD4A 3OBAA 1F9GA 1JYNA 2WVXB 1N7RA 1JZ7A 1UG9A 1JYXA 1MMUA 2WVYA 1PX4A 3I3EA 3A24A 1YQ2A 1LXMA 1F4AA 3BGAA 1C82A 3VD3A 2JKEA 2XHNA 2X03A 2WW0A 1HN1A 1JYWA 1NSRA 2HTAA 1SNZA 1NSXA 2CIQA 3MV01 1EGUA 1X1IA 3VDCA 3T09A 1JOVA 1JZ4A 4BZEA 4DUXA 1ULVA 3VD5A 1NSSA 2WCOA 1RW9A 4AQ0A 3T2OA 2CIRA 3IAQA 4TTGA 1OJOA 3T2PA 2E22A 3T0BA 1L7KA 1NS8A 4DUWA 3VD9A 1HMWA 1J0NA 1I8QA 3E1F1 1MMZA 2BRVX 1MN0A 3MV11 1CB8A 1HM2A 1NKGA 3VD7A 3CZJA 1TXKA 1JZ8A 1RWCA 3DCDA 3VDAA 1JZ5A 1J0MA 1LF6A 1K1XA 1NSMA 3T08A 1NS4A 1HM3A 2CISA 1N7OA 2HTBA 1LF9A 3OB8A 1NSVA 4BZGA
chains in the Genus database with same CATH superfamily
1V7WA 2YFOA 2JKAA 3AMOA 1MMXA 2WYIA 2C11A 1H54A 3AFLA 1RWHA 3NJXA 1RKYA 4KFEA 2CFKA 3X3YA 1OJMA 1W2ZA 2WOHA 2E24A 3S4BA 3CZSA 1R34A 1RJOA 2BRPA 2WVZA 4BZHA 4FNVA 1NSZA 2C10A 1W6GA 3X40A 3A0OA 2ZXQA 3Q1NA 2W0QA 1AV4A 1JYVA 2Y74A 1D6ZA 3MI6A 1QAFA 2EABA 4BZFA 5KBPA 1JZ6A 5A1AA 2F7QA 1TQSA 2RDYA 4FNTA 3AFJA 1JYNA 1N7RA 1JYXA 3A24A 1YQ2A 4BTYA 3BUBA 1WMNA 1EGUA 1X1IA 3VDCA 2F7RA 2WCOA 1RW9A 2CWVA 3WA3A 4TTGA 3HI7A 3QFYA 3WA2X 2CFWA 2E22A 1L7KA 4KFDA 2CG1A 1IVVA 1A2VA 1W6CA 1MMZA 3BUQA 1HM2A 4OK2A 3X41A 1JZ8A 3BVTA 2XN2A 1LF6A 2F18A 1K1XA 1TQTA 2PNCA 2CISA 3T0AA 4OJZA 4DUVA 2WDAA 1X1HA 3BVUA 3VDBA 1R33A 2D1WA 3D4ZA 3T0DA 3S4CA 3IMHA 3VSNA 1TU5A 1DYUA 1NS2A 2FUTA 2OOVC 3DYPA 3DECA 1OJPA 2OW7A 3T0UA 1JZ3A 3MPHA 1N7QA 3T2QA 3ECQA 3IAPA 4K35A 1WMPA 2FUQA 1QALA 2BRWA 3MWXA 3I3BA 2JKPA 3J7HA 1PX3A 3D52A 3E80A 3I3DA 3D51A 1QWUA 2WW1A 3OBAA 1F9GA 3BUDA 2WVXB 1PX4A 1UI8A 1IQYA 3VD3A 3D3IA 3WVFA 2JKEA 2X03A 1HN1A 1SNZA 1IVWA 4FNPA 1KSIA 3QDEA 4FNUA 3T09A 4MMHA 2OOVA 2WYHA 2CIRA 1WMOA 2OQEC 4FNQA 1QAKA 2WOFA 3D50A 1HXKA 1MN0A 1LVNA 1NKGA 3RRSA 2CWTA 2OW6A 2WGQA 3VDAA 1JZ5A 4OK4A 4MMIA 1JRQA 3W7SA 2YFNA 3E7JA 4K3AA 1NSUA 1SPUA 1N7NA 1TQUA 3MUY1 4EV5A 3BVVA 2BT3A 1PU4A 1SO0A 2WW2A 5E1QA 2FYVA 1EKMA 3DX4A 1W5ZA 2ZQ0A 3N9HA 2E2TA 3LOYA 2OQEA 1K1WA 1HN0A 3HIGA 1D6UA 1YGAA 1LOHA 3DYMA 2Q1FA 3X42A 3K25A 3DX3A 4FNRA 1NS0A 3AMOB 1RWGA 3EJTA 3DDFA 3LVTA 1L7JA 5JMDA 1DP0A 1AVKA 3TY1A 2F1BA 2F7OA 3DYOA 1N7PA 5CA3A 3VD4A 1QWNA 3EJUA 1JZ7A 1MMUA 3WIRA 2CFLA 3S4DA 1LXMA 2CQSA 3W7UA 3DDGA 3HIIA 3BLBA 1NSRA 1NSXA 2CIQA 3MV01 4KFFA 2EACA 2CWUA 4FNSA 1JZ4A 4UFCA 4BZEA 1ULVA 3CV5A 1NSSA 4AQ0A 3BS6A 2CG0A 3ACTA 3T2OA 3CZNA 3T2PA 3VD9A 1HMWA 1TQWA 1HTYA 5GW7A 2EAEA 3SX1A 1SIIA 2BRVX 3MV11 1CB8A 3VD7A 1SIHA 1IQXA 1TXKA 3DCDA 1J0MA 1IVUA 1OACA 1QX1A 4KTRA 2E2UA 3T08A 3EJRA 1NS4A 3NBBA 1PS3A 1HM3A 3VSMA 3OB8A 1IU7A 4BZGA 3WIQA 1TQVA 4BTXA 1V7XA 3D4YA 3W7XA 2WW3A 3SEPA 3W7TA 1W3YA 3EJQA 2D73A 4EV2A 1Z45A 3K5TA 3X3ZA 1O7DD 3DX1A 1W4NA 2EADA 2YX9A 1N9EA 1US1A 2WVXA 1X1JA 1F1SA 3S4AA 5JMFA 3QG0A 1HMUA 3OS7A 3WFAA 1F4HA 1RWAA 1K1YA 3NREA 3EJPA 1OJNA 1LXKA 2WZSA 3NJVA 2F7PA 3ALAA 3BVXA 3MUZ1 4KTPA 1RWFA 1D6YA 1NS7A 1UI7A 3W7WA 1LURA 1MMYA 1JZ2A 4RNLA 3NBJA 3DX0A 3BLCA 2XSGA 2XN0A 3BUPA 3PGBA 1UG9A 2WVYA 3I3EA 4BTWA 3EJSA 2CFDA 1F4AA 3ACSA 3BGAA 1C82A 1HWWA 1V7VA 2XHNA 3BUIA 3X3XA 2WW0A 1JYWA 3QFZA 2HTAA 2XN1A 2CFGA 2E2VA 3SXXA 1JOVA 3RSYA 4DUXA 1W7CA 3VD5A 3KIIA 1IVXA 3BVWA 2Y73A 3IAQA 1OJOA 2ALWA 3T0BA 1NS8A 4DUWA 1J0NA 1I8QA 2F1AA 3E1F1 2WO0A 3CZJA 4J5TA 3DX2A 4NEIA 2ZL8A 1RWCA 1NSMA 3KN4A 2CQTA 1N7OA 2HTBA 1LF9A 1NSVA 1AVLA
chains in the Genus database with same CATH topology
3T0AA 4OJZA 4DUVA 2WDAA 3E7JA 1X1HA 2JKAA 3VDBA 1NSUA 2WW3A 3SEPA 1W3YA 1N7NA 1MMXA 3MUY1 3T0DA 3AFLA 1RWHA 2D73A 3NJXA 3IMHA 1Z45A 1SO0A 1OJMA 2WW2A 5E1QA 3VSNA 1NS2A 2FUTA 3DYPA 3DECA 2E24A 2ZQ0A 2WVXA 1OJPA 1X1JA 2BRPA 1F1SA 1JZ3A 2WVZA 5JMFA 1HMUA 4BZHA 1K1WA 3OS7A 1F4HA 1HN0A 3WFAA 1N7QA 3T2QA 1YGAA 1RWAA 1K1YA 3NREA 4FNVA 1NSZA 1LOHA 3DYMA 3ECQA 1JZ2A 2Q1FA 3K25A 1OJNA 1LXKA 2WZSA 3IAPA 3NJVA 1NS0A 2FUQA 2BRWA 3MWXA 3MUZ1 3A0OA 2ZXQA 3I3BA 3Q1NA 1RWGA 2JKPA 1RWFA 1JYVA 1NS7A 3J7HA 1PX3A 1LURA 1MMYA 3E80A 1L7JA 4RNLA 1DP0A 3I3DA 3TY1A 4BZFA 5A1AA 5JMDA 1JZ6A 2WW1A 3BLCA 2XSGA 3DYOA 1N7PA 3VD4A 3OBAA 1F9GA 1JYNA 2WVXB 1N7RA 1JZ7A 1UG9A 1JYXA 1MMUA 2WVYA 1PX4A 3I3EA 3A24A 1YQ2A 1LXMA 1F4AA 3BGAA 1C82A 3VD3A 3WVFA 2JKEA 2XHNA 2X03A 2WW0A 1HN1A 1JYWA 1NSRA 2HTAA 1SNZA 1NSXA 2CIQA 3MV01 1EGUA 1X1IA 3VDCA 3T09A 1JOVA 4MMHA 1JZ4A 4BZEA 4DUXA 1ULVA 3VD5A 1NSSA 2WCOA 1RW9A 4AQ0A 3BS6A 3T2OA 2CIRA 3IAQA 4TTGA 1OJOA 3T2PA 2E22A 3T0BA 1L7KA 1NS8A 4DUWA 3VD9A 1HMWA 1J0NA 1I8QA 3E1F1 1MMZA 2BRVX 1MN0A 3MV11 1CB8A 1HM2A 1NKGA 3VD7A 3CZJA 4J5TA 4OK2A 1TXKA 4NEIA 1JZ8A 1RWCA 3DCDA 3VDAA 1JZ5A 1J0MA 1LF6A 1K1XA 1NSMA 3T08A 1NS4A 4OK4A 1HM3A 2CISA 1N7OA 2HTBA 3VSMA 1LF9A 4MMIA 3OB8A 1NSVA 4BZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T0A A;  4DUV A;  2WDA A;  1X1H A;  2JKA A;  3VDB A;  1NSU A;  2WW3 A;  3SEP A;  1W3Y A;  1N7N A;  1MMX A;  3MUY 1;  3T0D A;  1RWH A;  2D73 A;  3NJX A;  3IMH A;  1Z45 A;  1SO0 A;  1OJM A;  2WW2 A;  5E1Q A;  1NS2 A;  3DYP A;  3DEC A;  2E24 A;  2ZQ0 A;  2WVX A;  1OJP A;  1X1J A;  2BRP A;  1F1S A;  1JZ3 A;  2WVZ A;  1HMU A;  4BZH A;  1K1W A;  3OS7 A;  1F4H A;  1HN0 A;  3WFA A;  1N7Q A;  3T2Q A;  1YGA A;  1RWA A;  1K1Y A;  3NRE A;  1NSZ A;  1LOH A;  3DYM A;  3ECQ A;  2Q1F A;  3K25 A;  1OJN A;  1LXK A;  2WZS A;  3IAP A;  3NJV A;  1NS0 A;  2BRW A;  3MWX A;  3MUZ 1;  2ZXQ A;  3I3B A;  3Q1N A;  1RWG A;  2JKP A;  1RWF A;  1JYV A;  1NS7 A;  3J7H A;  1PX3 A;  1LUR A;  1MMY A;  1JZ2 A;  1L7J A;  4RNL A;  1DP0 A;  3I3D A;  4BZF A;  5A1A A;  1JZ6 A;  2WW1 A;  2XSG A;  3DYO A;  1N7P A;  3VD4 A;  3OBA A;  1F9G A;  1JYN A;  2WVX B;  1N7R A;  1JZ7 A;  1UG9 A;  1JYX A;  1MMU A;  2WVY A;  1PX4 A;  3I3E A;  3A24 A;  1YQ2 A;  1LXM A;  1F4A A;  3BGA A;  1C82 A;  3VD3 A;  2JKE A;  2XHN A;  2X03 A;  2WW0 A;  1HN1 A;  1JYW A;  1NSR A;  2HTA A;  1SNZ A;  1NSX A;  2CIQ A;  3MV0 1;  1EGU A;  1X1I A;  3VDC A;  3T09 A;  1JOV A;  1JZ4 A;  4BZE A;  4DUX A;  1ULV A;  3VD5 A;  1NSS A;  2WCO A;  1RW9 A;  4AQ0 A;  3T2O A;  2CIR A;  3IAQ A;  4TTG A;  1OJO A;  3T2P A;  2E22 A;  3T0B A;  1L7K A;  1NS8 A;  4DUW A;  3VD9 A;  1HMW A;  1J0N A;  1I8Q A;  3E1F 1;  1MMZ A;  2BRV X;  1MN0 A;  3MV1 1;  1CB8 A;  1HM2 A;  1NKG A;  3VD7 A;  3CZJ A;  1TXK A;  1JZ8 A;  1RWC A;  3DCD A;  3VDA A;  1JZ5 A;  1J0M A;  1LF6 A;  1K1X A;  1NSM A;  3T08 A;  1NS4 A;  1HM3 A;  2CIS A;  1N7O A;  2HTB A;  1LF9 A;  3OB8 A;  1NSV A;  4BZG A; 
#chains in the Genus database with same CATH topology
 1V7W A;  2YFO A;  2JKA A;  3AMO A;  1MMX A;  2WYI A;  2C11 A;  1H54 A;  3AFL A;  1RWH A;  3NJX A;  1RKY A;  4KFE A;  2CFK A;  3X3Y A;  1OJM A;  1W2Z A;  2WOH A;  2E24 A;  3S4B A;  3CZS A;  1R34 A;  1RJO A;  2BRP A;  2WVZ A;  4BZH A;  4FNV A;  1NSZ A;  2C10 A;  1W6G A;  3X40 A;  3A0O A;  2ZXQ A;  3Q1N A;  2W0Q A;  1AV4 A;  1JYV A;  2Y74 A;  1D6Z A;  3MI6 A;  1QAF A;  2EAB A;  4BZF A;  5KBP A;  1JZ6 A;  5A1A A;  2F7Q A;  1TQS A;  2RDY A;  4FNT A;  3AFJ A;  1JYN A;  1N7R A;  1JYX A;  3A24 A;  1YQ2 A;  4BTY A;  3BUB A;  1WMN A;  1EGU A;  1X1I A;  3VDC A;  2F7R A;  2WCO A;  1RW9 A;  2CWV A;  3WA3 A;  4TTG A;  3HI7 A;  3QFY A;  3WA2 X;  2CFW A;  2E22 A;  1L7K A;  4KFD A;  2CG1 A;  1IVV A;  1A2V A;  1W6C A;  1MMZ A;  3BUQ A;  1HM2 A;  4OK2 A;  3X41 A;  1JZ8 A;  3BVT A;  2XN2 A;  1LF6 A;  2F18 A;  1K1X A;  1TQT A;  2PNC A;  2CIS A;  3T0A A;  4OJZ A;  4DUV A;  2WDA A;  1X1H A;  3BVU A;  3VDB A;  1R33 A;  2D1W A;  3D4Z A;  3T0D A;  3S4C A;  3IMH A;  3VSN A;  1TU5 A;  1DYU A;  1NS2 A;  2FUT A;  2OOV C;  3DYP A;  3DEC A;  1OJP A;  2OW7 A;  3T0U A;  1JZ3 A;  3MPH A;  1N7Q A;  3T2Q A;  3ECQ A;  3IAP A;  4K35 A;  1WMP A;  2FUQ A;  1QAL A;  2BRW A;  3MWX A;  3I3B A;  2JKP A;  3J7H A;  1PX3 A;  3D52 A;  3E80 A;  3I3D A;  3D51 A;  1QWU A;  2WW1 A;  3OBA A;  1F9G A;  3BUD A;  2WVX B;  1PX4 A;  1UI8 A;  1IQY A;  3VD3 A;  3D3I A;  3WVF A;  2JKE A;  2X03 A;  1HN1 A;  1SNZ A;  1IVW A;  4FNP A;  1KSI A;  3QDE A;  4FNU A;  3T09 A;  4MMH A;  2OOV A;  2WYH A;  2CIR A;  1WMO A;  2OQE C;  4FNQ A;  1QAK A;  2WOF A;  3D50 A;  1HXK A;  1MN0 A;  1LVN A;  1NKG A;  3RRS A;  2CWT A;  2OW6 A;  2WGQ A;  3VDA A;  1JZ5 A;  4OK4 A;  4MMI A;  1JRQ A;  3W7S A;  2YFN A;  3E7J A;  4K3A A;  1NSU A;  1SPU A;  1N7N A;  1TQU A;  3MUY 1;  4EV5 A;  3BVV A;  2BT3 A;  1PU4 A;  1SO0 A;  2WW2 A;  5E1Q A;  2FYV A;  1EKM A;  3DX4 A;  1W5Z A;  2ZQ0 A;  3N9H A;  2E2T A;  3LOY A;  2OQE A;  1K1W A;  1HN0 A;  3HIG A;  1D6U A;  1YGA A;  1LOH A;  3DYM A;  2Q1F A;  3X42 A;  3K25 A;  3DX3 A;  4FNR A;  1NS0 A;  3AMO B;  1RWG A;  3EJT A;  3DDF A;  3LVT A;  1L7J A;  5JMD A;  1DP0 A;  1AVK A;  3TY1 A;  2F1B A;  2F7O A;  3DYO A;  1N7P A;  5CA3 A;  3VD4 A;  1QWN A;  3EJU A;  1JZ7 A;  1MMU A;  3WIR A;  2CFL A;  3S4D A;  1LXM A;  2CQS A;  3W7U A;  3DDG A;  3HII A;  3BLB A;  1NSR A;  1NSX A;  2CIQ A;  3MV0 1;  4KFF A;  2EAC A;  2CWU A;  4FNS A;  1JZ4 A;  4UFC A;  4BZE A;  1ULV A;  3CV5 A;  1NSS A;  4AQ0 A;  3BS6 A;  2CG0 A;  3ACT A;  3T2O A;  3CZN A;  3T2P A;  3VD9 A;  1HMW A;  1TQW A;  1HTY A;  5GW7 A;  2EAE A;  3SX1 A;  1SII A;  2BRV X;  3MV1 1;  1CB8 A;  3VD7 A;  1SIH A;  1IQX A;  1TXK A;  3DCD A;  1J0M A;  1IVU A;  1OAC A;  1QX1 A;  4KTR A;  2E2U A;  3T08 A;  3EJR A;  1NS4 A;  3NBB A;  1PS3 A;  1HM3 A;  3VSM A;  3OB8 A;  1IU7 A;  4BZG A;  3WIQ A;  1TQV A;  4BTX A;  1V7X A;  3D4Y A;  3W7X A;  2WW3 A;  3SEP A;  3W7T A;  1W3Y A;  3EJQ A;  2D73 A;  4EV2 A;  1Z45 A;  3K5T A;  3X3Z A;  1O7D D;  3DX1 A;  1W4N A;  2EAD A;  2YX9 A;  1N9E A;  1US1 A;  2WVX A;  1X1J A;  1F1S A;  3S4A A;  5JMF A;  3QG0 A;  1HMU A;  3OS7 A;  3WFA A;  1F4H A;  1RWA A;  1K1Y A;  3NRE A;  3EJP A;  1OJN A;  1LXK A;  2WZS A;  3NJV A;  2F7P A;  3ALA A;  3BVX A;  3MUZ 1;  4KTP A;  1RWF A;  1D6Y A;  1NS7 A;  1UI7 A;  3W7W A;  1LUR A;  1MMY A;  1JZ2 A;  4RNL A;  3NBJ A;  3DX0 A;  3BLC A;  2XSG A;  2XN0 A;  3BUP A;  3PGB A;  1UG9 A;  2WVY A;  3I3E A;  4BTW A;  3EJS A;  2CFD A;  1F4A A;  3ACS A;  3BGA A;  1C82 A;  1HWW A;  1V7V A;  2XHN A;  3BUI A;  3X3X A;  2WW0 A;  1JYW A;  3QFZ A;  2HTA A;  2XN1 A;  2CFG A;  2E2V A;  3SXX A;  1JOV A;  3RSY A;  4DUX A;  1W7C A;  3VD5 A;  3KII A;  1IVX A;  3BVW A;  2Y73 A;  3IAQ A;  1OJO A;  2ALW A;  3T0B A;  1NS8 A;  4DUW A;  1J0N A;  1I8Q A;  2F1A A;  3E1F 1;  2WO0 A;  3CZJ A;  4J5T A;  3DX2 A;  4NEI A;  2ZL8 A;  1RWC A;  1NSM A;  3KN4 A;  2CQT A;  1N7O A;  2HTB A;  1LF9 A;  1NSV A;  1AVL A; 
#chains in the Genus database with same CATH homology
 3T0A A;  4OJZ A;  4DUV A;  2WDA A;  3E7J A;  1X1H A;  2JKA A;  3VDB A;  1NSU A;  2WW3 A;  3SEP A;  1W3Y A;  1N7N A;  1MMX A;  3MUY 1;  3T0D A;  3AFL A;  1RWH A;  2D73 A;  3NJX A;  3IMH A;  1Z45 A;  1SO0 A;  1OJM A;  2WW2 A;  5E1Q A;  3VSN A;  1NS2 A;  2FUT A;  3DYP A;  3DEC A;  2E24 A;  2ZQ0 A;  2WVX A;  1OJP A;  1X1J A;  2BRP A;  1F1S A;  1JZ3 A;  2WVZ A;  5JMF A;  1HMU A;  4BZH A;  1K1W A;  3OS7 A;  1F4H A;  1HN0 A;  3WFA A;  1N7Q A;  3T2Q A;  1YGA A;  1RWA A;  1K1Y A;  3NRE A;  4FNV A;  1NSZ A;  1LOH A;  3DYM A;  3ECQ A;  1JZ2 A;  2Q1F A;  3K25 A;  1OJN A;  1LXK A;  2WZS A;  3IAP A;  3NJV A;  1NS0 A;  2FUQ A;  2BRW A;  3MWX A;  3MUZ 1;  3A0O A;  2ZXQ A;  3I3B A;  3Q1N A;  1RWG A;  2JKP A;  1RWF A;  1JYV A;  1NS7 A;  3J7H A;  1PX3 A;  1LUR A;  1MMY A;  3E80 A;  1L7J A;  4RNL A;  1DP0 A;  3I3D A;  3TY1 A;  4BZF A;  5A1A A;  5JMD A;  1JZ6 A;  2WW1 A;  3BLC A;  2XSG A;  3DYO A;  1N7P A;  3VD4 A;  3OBA A;  1F9G A;  1JYN A;  2WVX B;  1N7R A;  1JZ7 A;  1UG9 A;  1JYX A;  1MMU A;  2WVY A;  1PX4 A;  3I3E A;  3A24 A;  1YQ2 A;  1LXM A;  1F4A A;  3BGA A;  1C82 A;  3VD3 A;  3WVF A;  2JKE A;  2XHN A;  2X03 A;  2WW0 A;  1HN1 A;  1JYW A;  1NSR A;  2HTA A;  1SNZ A;  1NSX A;  2CIQ A;  3MV0 1;  1EGU A;  1X1I A;  3VDC A;  3T09 A;  1JOV A;  4MMH A;  1JZ4 A;  4BZE A;  4DUX A;  1ULV A;  3VD5 A;  1NSS A;  2WCO A;  1RW9 A;  4AQ0 A;  3BS6 A;  3T2O A;  2CIR A;  3IAQ A;  4TTG A;  1OJO A;  3T2P A;  2E22 A;  3T0B A;  1L7K A;  1NS8 A;  4DUW A;  3VD9 A;  1HMW A;  1J0N A;  1I8Q A;  3E1F 1;  1MMZ A;  2BRV X;  1MN0 A;  3MV1 1;  1CB8 A;  1HM2 A;  1NKG A;  3VD7 A;  3CZJ A;  4J5T A;  4OK2 A;  1TXK A;  4NEI A;  1JZ8 A;  1RWC A;  3DCD A;  3VDA A;  1JZ5 A;  1J0M A;  1LF6 A;  1K1X A;  1NSM A;  3T08 A;  1NS4 A;  4OK4 A;  1HM3 A;  2CIS A;  1N7O A;  2HTB A;  3VSM A;  1LF9 A;  4MMI A;  3OB8 A;  1NSV A;  4BZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...