1NSRA

Crystal structure of galactose mutarotase from lactococcus lactis mutant d243n complexed with glucose
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
339
structure length
339
Chain Sequence
b'SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGINHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 99
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsrA00
1ULVA 1NSMA 1W3YA 3MUY1 3NJXA 1NSZA 2JKEA 1LF6A 3DYOA 2BRPA 2HTBA 2WW1A 1X1JA 1SNZA 4TTGA 1JYVA 3I3EA 3T2OA 1HM3A 3VD3A 2D73A 1K1WA 1JYWA 1K1XA 1NS8A 1HN0A 1K1YA 3DCDA 3NJVA 1YQ2A 2ZQ0A 1YGAA 2XSGA 2WCOA 1NS7A 1MMXA 1L7JA 1LF9A 3VDBA 3I3BA 5A1AA 2HTAA 2XHNA 3OB8A 4BZFA 3NREA 2CIRA 2WVXA 2WVXB 3DYMA 3DYPA 2WW0A 4BZGA 4BZEA 1OJOA 1OJNA 4DUWA 1N7RA 1N7QA 3T2PA 2CISA 1HMUA 4AQ0A 1RWFA 1PX3A 3ECQA 3DECA 2BRVX 4RNLA 1OJPA 3A24A 1TXKA 1LXMA 2WW3A 3T2QA 3Q1NA 3VD4A 1JZ5A 1SO0A 5E1QA 3IAQA 2WDAA 1NSRA 1JYXA 3VDCA 1JZ3A 4BZHA 3J7HA 1CB8A 1RWCA 1C82A 1RWAA 1NSVA 1DP0A 1MN0A 1OJMA 1L7KA 1N7NA 3VD7A 3OS7A 3T0BA 1JOVA 1X1HA 1HMWA 1RW9A 3T09A 1JZ7A 1NS0A 3MWXA 3IAPA 2JKPA 1HN1A 3VD5A 1NSXA 3VD9A 1JYNA 1MMUA 3BGAA 2WW2A 3CZJA 1Z45A 2CIQA 3T0AA 1LOHA 1EGUA 2Q1FA 3E1F1 1F1SA 3K25A 1NS4A 1RWHA 1NSSA 3I3DA 3MUZ1 1J0NA 1X1IA 2BRWA 4DUVA 1NSUA 1N7PA 1F4HA 1N7OA 1MMZA 2E24A 2JKAA 2ZXQA 3VDAA 4DUXA 3OBAA 3WFAA 2X03A 3T0DA 1F9GA 3IMHA 2WZSA 1LURA 1JZ6A 2WVZA 1UG9A 3T08A 1HM2A 1LXKA 1J0MA 1MMYA 1RWGA 2WVYA 1NS2A 1JZ8A 1JZ4A 1JZ2A 1F4AA 3MV11 1I8QA 3SEPA 3MV01 1NKGA 1PX4A 2E22A
chains in the Genus database with same CATH superfamily
3RSYA 1ULVA 1NSMA 1RJOA 2F7RA 3WA2X 2JKEA 1LF6A 2HTBA 2BT3A 1DYUA 3T2OA 2F7OA 3VD3A 1W4NA 1K1WA 1JYWA 2OOVC 3KIIA 1YQ2A 3BLCA 2OOVA 2CQSA 3X3ZA 2FUQA 1R34A 5CA3A 1LF9A 1SPUA 2HTAA 2XHNA 2WGQA 4OK2A 3QFYA 2WW0A 3KN4A 3ACSA 3T2PA 3EJPA 2CG0A 3QFZA 3HIGA 4RNLA 1OJPA 2CFDA 5E1QA 2ALWA 3VSNA 3VDCA 1JYXA 4EV2A 3BUIA 3W7TA 2YFNA 3CZSA 3J7HA 3DDFA 1NSVA 1TQUA 1L7KA 3T0BA 4K3AA 1QX1A 2F7QA 1HMWA 1TQTA 2E2TA 1MMUA 4EV5A 3T0AA 1AVKA 3E1F1 4UFCA 4K35A 1NSSA 2PNCA 1SIIA 3TY1A 1W6GA 3BS6A 1J0NA 1X1IA 4DUVA 1O7DD 1NSUA 1N7OA 2JKAA 4OJZA 3OBAA 3T0DA 2WOFA 2ZL8A 3CZNA 3W7WA 1QAKA 3W7UA 1JZ6A 3T08A 4FNPA 1D6YA 1SIHA 2CFGA 2XN0A 1OACA 2CFLA 3WIRA 1NS2A 1JZ2A 3D4ZA 1F4AA 3ACTA 3MV11 1I8QA 1IQYA 3S4BA 3BVXA 3MUY1 3NJXA 1W6CA 1X1JA 1HM3A 3T0UA 1HN0A 3DCDA 3NJVA 3D50A 3PGBA 2XSGA 1MMXA 1L7JA 1WMNA 4FNUA 3VSMA 3LVTA 5A1AA 3OB8A 3MPHA 3NREA 2CIRA 1IVVA 4BZEA 1IVXA 1OJOA 4DUWA 1N7RA 1QWUA 2CISA 3BUQA 3BLBA 3N9HA 3S4AA 2EACA 3BUBA 2WW3A 3Q1NA 3DX3A 1SO0A 3IAQA 2F7PA 4BZHA 4KFEA 3E7JA 2WOHA 1RWCA 1HWWA 1N7NA 3VD7A 3X42A 1X1HA 3NBJA 2YFOA 1RW9A 1TQSA 3T09A 2WYIA 3HI7A 3QG0A 1JYNA 1IU7A 3E80A 1Z45A 1LOHA 3AMOA 3AMOB 3DDGA 1W2ZA 1NS4A 3EJTA 3MUZ1 1QWNA 2BRWA 1IQXA 2ZXQA 3W7XA 1F9GA 1TQWA 1UG9A 3EJQA 3WVFA 1LVNA 1MMYA 1AV4A 4FNSA 2E2UA 3AFLA 4MMIA 4FNRA 2F18A 1AVLA 4FNQA 1PX4A 1KSIA 2E22A 3CV5A 1HXKA 3EJSA 1PS3A 4TTGA 3X40A 3I3EA 3X3YA 2D73A 3S4DA 1K1XA 1NS8A 2CFKA 2ZQ0A 1YGAA 3MI6A 3LOYA 3I3BA 3D4YA 2WYHA 1QAFA 4BZFA 2EADA 3BUPA 2XN1A 4BZGA 3WA3A 3BVVA 3DX0A 3RRSA 1HMUA 2FUTA 4AQ0A 1PX3A 4KTRA 3DECA 2BRVX 3A24A 1TU5A 1TXKA 1LXMA 1V7XA 2OQEC 1NSRA 2OQEA 1C82A 1RWAA 3WIQA 2XN2A 4KTPA 4BTYA 1EKMA 1NS0A 3IAPA 2CG1A 3VD9A 3D52A 4KFDA 2F1AA 2WW2A 3CZJA 1R33A 3ALAA 5KBPA 3NBBA 2Q1FA 1F1SA 2CWVA 3K25A 1RWHA 3DX4A 2W0QA 1HTYA 1W5ZA 3DX2A 3A0OA 1F4HA 3VDAA 1MMZA 4DUXA 3WFAA 1H54A 2WZSA 1V7WA 4MMHA 3D3IA 3DX1A 5JMFA 1LXKA 3BVWA 2OW6A 4KFFA 1UI7A 3BUDA 2EAEA 1JZ8A 2C11A 1JZ4A 3MV01 1UI8A 3BVUA 1US1A 2OW7A 2CWUA 1W3YA 3QDEA 1NSZA 3DYOA 2BRPA 2WW1A 1SNZA 1JYVA 1JRQA 1K1YA 3X41A 2WO0A 2WCOA 1NS7A 1PU4A 2CFWA 3VDBA 4NEIA 3SX1A 3X3XA 2WVXA 1IVWA 3HIIA 2WVXB 3DYMA 3DYPA 2CWTA 3EJUA 3BVTA 1TQVA 1OJNA 1N7QA 3S4CA 1RWFA 3ECQA 3SXXA 4FNTA 3T2QA 3VD4A 1JZ5A 2YX9A 2WDAA 2EABA 1WMOA 1WMPA 1JZ3A 1QALA 1D6ZA 2Y73A 1CB8A 1DP0A 1MN0A 1OJMA 2D1WA 1IVUA 3OS7A 1JOVA 2C10A 1D6UA 1N9EA 2CQTA 5JMDA 1JZ7A 3D51A 3MWXA 3W7SA 2F1BA 2JKPA 1HN1A 3VD5A 1NSXA 3BGAA 2CIQA 2RDYA 1EGUA 3I3DA 5GW7A 1N7PA 2E24A 4BTWA 2X03A 3IMHA 1A2VA 2E2VA 1LURA 2WVZA 1HM2A 2FYVA 4BTXA 1J0MA 3K5TA 2Y74A 4J5TA 1V7VA 1W7CA 3AFJA 1RWGA 2WVYA 4FNVA 1RKYA 3SEPA 4OK4A 1NKGA 3EJRA
chains in the Genus database with same CATH topology
1ULVA 1NSMA 1W3YA 3MUY1 3NJXA 1NSZA 2JKEA 1LF6A 3DYOA 2BRPA 2HTBA 2WW1A 1X1JA 1SNZA 4TTGA 1JYVA 3I3EA 3T2OA 1HM3A 3VD3A 2D73A 1K1WA 1JYWA 1K1XA 1NS8A 1HN0A 1K1YA 3DCDA 3NJVA 1YQ2A 3BLCA 2ZQ0A 1YGAA 2XSGA 2WCOA 2FUQA 1NS7A 1MMXA 1L7JA 1LF9A 3VSMA 3I3BA 3VDBA 4NEIA 5A1AA 2HTAA 2XHNA 3OB8A 4OK2A 4BZFA 3NREA 2CIRA 2WVXA 2WVXB 3DYMA 3DYPA 2WW0A 4BZGA 4BZEA 1OJOA 1OJNA 4DUWA 1N7RA 1N7QA 3T2PA 2CISA 1HMUA 2FUTA 4AQ0A 1RWFA 1PX3A 3ECQA 3DECA 2BRVX 4RNLA 1OJPA 3A24A 1TXKA 1LXMA 2WW3A 3T2QA 3Q1NA 3VD4A 1JZ5A 1SO0A 5E1QA 3IAQA 2WDAA 1NSRA 1JYXA 3VSNA 3VDCA 1JZ3A 4BZHA 3E7JA 3J7HA 1CB8A 1RWCA 1C82A 1RWAA 1NSVA 1DP0A 1MN0A 1OJMA 1L7KA 1N7NA 3VD7A 3OS7A 3T0BA 1JOVA 1X1HA 5JMDA 1HMWA 1RW9A 3T09A 1JZ7A 1NS0A 3MWXA 3IAPA 2JKPA 1HN1A 3VD5A 1NSXA 3VD9A 1JYNA 3E80A 1MMUA 3BGAA 2WW2A 3CZJA 1Z45A 2CIQA 3T0AA 1LOHA 1EGUA 2Q1FA 3E1F1 1F1SA 3K25A 1NS4A 1RWHA 1NSSA 3I3DA 3TY1A 3MUZ1 3BS6A 1J0NA 1X1IA 2BRWA 4DUVA 1NSUA 1N7PA 1F4HA 1N7OA 1MMZA 2E24A 2JKAA 3A0OA 2ZXQA 4OJZA 3VDAA 4DUXA 3OBAA 3WFAA 2X03A 3T0DA 1F9GA 3IMHA 2WZSA 1LURA 1JZ6A 2WVZA 4MMHA 1UG9A 3T08A 3WVFA 1HM2A 5JMFA 1LXKA 1J0MA 1MMYA 4J5TA 3AFLA 4MMIA 1RWGA 2WVYA 1NS2A 4FNVA 1JZ8A 1JZ4A 1JZ2A 1F4AA 3MV11 1I8QA 3SEPA 3MV01 4OK4A 1NKGA 1PX4A 2E22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ULV A;  1NSM A;  1W3Y A;  3MUY 1;  3NJX A;  1NSZ A;  2JKE A;  1LF6 A;  3DYO A;  2BRP A;  2HTB A;  2WW1 A;  1X1J A;  1SNZ A;  4TTG A;  1JYV A;  3I3E A;  3T2O A;  1HM3 A;  3VD3 A;  2D73 A;  1K1W A;  1JYW A;  1K1X A;  1NS8 A;  1HN0 A;  1K1Y A;  3DCD A;  3NJV A;  1YQ2 A;  2ZQ0 A;  1YGA A;  2XSG A;  2WCO A;  1NS7 A;  1MMX A;  1L7J A;  1LF9 A;  3VDB A;  3I3B A;  5A1A A;  2HTA A;  2XHN A;  3OB8 A;  4BZF A;  3NRE A;  2CIR A;  2WVX A;  2WVX B;  3DYM A;  3DYP A;  2WW0 A;  4BZG A;  4BZE A;  1OJO A;  1OJN A;  4DUW A;  1N7R A;  1N7Q A;  3T2P A;  2CIS A;  1HMU A;  4AQ0 A;  1RWF A;  1PX3 A;  3ECQ A;  3DEC A;  2BRV X;  4RNL A;  1OJP A;  3A24 A;  1TXK A;  1LXM A;  2WW3 A;  3T2Q A;  3Q1N A;  3VD4 A;  1JZ5 A;  1SO0 A;  5E1Q A;  3IAQ A;  2WDA A;  1NSR A;  1JYX A;  3VDC A;  1JZ3 A;  4BZH A;  3J7H A;  1CB8 A;  1RWC A;  1C82 A;  1RWA A;  1NSV A;  1DP0 A;  1MN0 A;  1OJM A;  1L7K A;  1N7N A;  3VD7 A;  3OS7 A;  3T0B A;  1JOV A;  1X1H A;  1HMW A;  1RW9 A;  3T09 A;  1JZ7 A;  1NS0 A;  3MWX A;  3IAP A;  2JKP A;  1HN1 A;  3VD5 A;  1NSX A;  3VD9 A;  1JYN A;  1MMU A;  3BGA A;  2WW2 A;  3CZJ A;  1Z45 A;  2CIQ A;  3T0A A;  1LOH A;  1EGU A;  2Q1F A;  3E1F 1;  1F1S A;  3K25 A;  1NS4 A;  1RWH A;  1NSS A;  3I3D A;  3MUZ 1;  1J0N A;  1X1I A;  2BRW A;  4DUV A;  1NSU A;  1N7P A;  1F4H A;  1N7O A;  1MMZ A;  2E24 A;  2JKA A;  2ZXQ A;  3VDA A;  4DUX A;  3OBA A;  3WFA A;  2X03 A;  3T0D A;  1F9G A;  3IMH A;  2WZS A;  1LUR A;  1JZ6 A;  2WVZ A;  1UG9 A;  3T08 A;  1HM2 A;  1LXK A;  1J0M A;  1MMY A;  1RWG A;  2WVY A;  1NS2 A;  1JZ8 A;  1JZ4 A;  1JZ2 A;  1F4A A;  3MV1 1;  1I8Q A;  3SEP A;  3MV0 1;  1NKG A;  1PX4 A;  2E22 A; 
#chains in the Genus database with same CATH topology
 3RSY A;  1ULV A;  1NSM A;  1RJO A;  2F7R A;  3WA2 X;  2JKE A;  1LF6 A;  2HTB A;  2BT3 A;  1DYU A;  3T2O A;  2F7O A;  3VD3 A;  1W4N A;  1K1W A;  1JYW A;  2OOV C;  3KII A;  1YQ2 A;  3BLC A;  2OOV A;  2CQS A;  3X3Z A;  2FUQ A;  1R34 A;  5CA3 A;  1LF9 A;  1SPU A;  2HTA A;  2XHN A;  2WGQ A;  4OK2 A;  3QFY A;  2WW0 A;  3KN4 A;  3ACS A;  3T2P A;  3EJP A;  2CG0 A;  3QFZ A;  3HIG A;  4RNL A;  1OJP A;  2CFD A;  5E1Q A;  2ALW A;  3VSN A;  3VDC A;  1JYX A;  4EV2 A;  3BUI A;  3W7T A;  2YFN A;  3CZS A;  3J7H A;  3DDF A;  1NSV A;  1TQU A;  1L7K A;  3T0B A;  4K3A A;  1QX1 A;  2F7Q A;  1HMW A;  1TQT A;  2E2T A;  1MMU A;  4EV5 A;  3T0A A;  1AVK A;  3E1F 1;  4UFC A;  4K35 A;  1NSS A;  2PNC A;  1SII A;  3TY1 A;  1W6G A;  3BS6 A;  1J0N A;  1X1I A;  4DUV A;  1O7D D;  1NSU A;  1N7O A;  2JKA A;  4OJZ A;  3OBA A;  3T0D A;  2WOF A;  2ZL8 A;  3CZN A;  3W7W A;  1QAK A;  3W7U A;  1JZ6 A;  3T08 A;  4FNP A;  1D6Y A;  1SIH A;  2CFG A;  2XN0 A;  1OAC A;  2CFL A;  3WIR A;  1NS2 A;  1JZ2 A;  3D4Z A;  1F4A A;  3ACT A;  3MV1 1;  1I8Q A;  1IQY A;  3S4B A;  3BVX A;  3MUY 1;  3NJX A;  1W6C A;  1X1J A;  1HM3 A;  3T0U A;  1HN0 A;  3DCD A;  3NJV A;  3D50 A;  3PGB A;  2XSG A;  1MMX A;  1L7J A;  1WMN A;  4FNU A;  3VSM A;  3LVT A;  5A1A A;  3OB8 A;  3MPH A;  3NRE A;  2CIR A;  1IVV A;  4BZE A;  1IVX A;  1OJO A;  4DUW A;  1N7R A;  1QWU A;  2CIS A;  3BUQ A;  3BLB A;  3N9H A;  3S4A A;  2EAC A;  3BUB A;  2WW3 A;  3Q1N A;  3DX3 A;  1SO0 A;  3IAQ A;  2F7P A;  4BZH A;  4KFE A;  3E7J A;  2WOH A;  1RWC A;  1HWW A;  1N7N A;  3VD7 A;  3X42 A;  1X1H A;  3NBJ A;  2YFO A;  1RW9 A;  1TQS A;  3T09 A;  2WYI A;  3HI7 A;  3QG0 A;  1JYN A;  1IU7 A;  3E80 A;  1Z45 A;  1LOH A;  3AMO A;  3AMO B;  3DDG A;  1W2Z A;  1NS4 A;  3EJT A;  3MUZ 1;  1QWN A;  2BRW A;  1IQX A;  2ZXQ A;  3W7X A;  1F9G A;  1TQW A;  1UG9 A;  3EJQ A;  3WVF A;  1LVN A;  1MMY A;  1AV4 A;  4FNS A;  2E2U A;  3AFL A;  4MMI A;  4FNR A;  2F18 A;  1AVL A;  4FNQ A;  1PX4 A;  1KSI A;  2E22 A;  3CV5 A;  1HXK A;  3EJS A;  1PS3 A;  4TTG A;  3X40 A;  3I3E A;  3X3Y A;  2D73 A;  3S4D A;  1K1X A;  1NS8 A;  2CFK A;  2ZQ0 A;  1YGA A;  3MI6 A;  3LOY A;  3I3B A;  3D4Y A;  2WYH A;  1QAF A;  4BZF A;  2EAD A;  3BUP A;  2XN1 A;  4BZG A;  3WA3 A;  3BVV A;  3DX0 A;  3RRS A;  1HMU A;  2FUT A;  4AQ0 A;  1PX3 A;  4KTR A;  3DEC A;  2BRV X;  3A24 A;  1TU5 A;  1TXK A;  1LXM A;  1V7X A;  2OQE C;  1NSR A;  2OQE A;  1C82 A;  1RWA A;  3WIQ A;  2XN2 A;  4KTP A;  4BTY A;  1EKM A;  1NS0 A;  3IAP A;  2CG1 A;  3VD9 A;  3D52 A;  4KFD A;  2F1A A;  2WW2 A;  3CZJ A;  1R33 A;  3ALA A;  5KBP A;  3NBB A;  2Q1F A;  1F1S A;  2CWV A;  3K25 A;  1RWH A;  3DX4 A;  2W0Q A;  1HTY A;  1W5Z A;  3DX2 A;  3A0O A;  1F4H A;  3VDA A;  1MMZ A;  4DUX A;  3WFA A;  1H54 A;  2WZS A;  1V7W A;  4MMH A;  3D3I A;  3DX1 A;  5JMF A;  1LXK A;  3BVW A;  2OW6 A;  4KFF A;  1UI7 A;  3BUD A;  2EAE A;  1JZ8 A;  2C11 A;  1JZ4 A;  3MV0 1;  1UI8 A;  3BVU A;  1US1 A;  2OW7 A;  2CWU A;  1W3Y A;  3QDE A;  1NSZ A;  3DYO A;  2BRP A;  2WW1 A;  1SNZ A;  1JYV A;  1JRQ A;  1K1Y A;  3X41 A;  2WO0 A;  2WCO A;  1NS7 A;  1PU4 A;  2CFW A;  3VDB A;  4NEI A;  3SX1 A;  3X3X A;  2WVX A;  1IVW A;  3HII A;  2WVX B;  3DYM A;  3DYP A;  2CWT A;  3EJU A;  3BVT A;  1TQV A;  1OJN A;  1N7Q A;  3S4C A;  1RWF A;  3ECQ A;  3SXX A;  4FNT A;  3T2Q A;  3VD4 A;  1JZ5 A;  2YX9 A;  2WDA A;  2EAB A;  1WMO A;  1WMP A;  1JZ3 A;  1QAL A;  1D6Z A;  2Y73 A;  1CB8 A;  1DP0 A;  1MN0 A;  1OJM A;  2D1W A;  1IVU A;  3OS7 A;  1JOV A;  2C10 A;  1D6U A;  1N9E A;  2CQT A;  5JMD A;  1JZ7 A;  3D51 A;  3MWX A;  3W7S A;  2F1B A;  2JKP A;  1HN1 A;  3VD5 A;  1NSX A;  3BGA A;  2CIQ A;  2RDY A;  1EGU A;  3I3D A;  5GW7 A;  1N7P A;  2E24 A;  4BTW A;  2X03 A;  3IMH A;  1A2V A;  2E2V A;  1LUR A;  2WVZ A;  1HM2 A;  2FYV A;  4BTX A;  1J0M A;  3K5T A;  2Y74 A;  4J5T A;  1V7V A;  1W7C A;  3AFJ A;  1RWG A;  2WVY A;  4FNV A;  1RKY A;  3SEP A;  4OK4 A;  1NKG A;  3EJR A; 
#chains in the Genus database with same CATH homology
 1ULV A;  1NSM A;  1W3Y A;  3MUY 1;  3NJX A;  1NSZ A;  2JKE A;  1LF6 A;  3DYO A;  2BRP A;  2HTB A;  2WW1 A;  1X1J A;  1SNZ A;  4TTG A;  1JYV A;  3I3E A;  3T2O A;  1HM3 A;  3VD3 A;  2D73 A;  1K1W A;  1JYW A;  1K1X A;  1NS8 A;  1HN0 A;  1K1Y A;  3DCD A;  3NJV A;  1YQ2 A;  3BLC A;  2ZQ0 A;  1YGA A;  2XSG A;  2WCO A;  2FUQ A;  1NS7 A;  1MMX A;  1L7J A;  1LF9 A;  3VSM A;  3I3B A;  3VDB A;  4NEI A;  5A1A A;  2HTA A;  2XHN A;  3OB8 A;  4OK2 A;  4BZF A;  3NRE A;  2CIR A;  2WVX A;  2WVX B;  3DYM A;  3DYP A;  2WW0 A;  4BZG A;  4BZE A;  1OJO A;  1OJN A;  4DUW A;  1N7R A;  1N7Q A;  3T2P A;  2CIS A;  1HMU A;  2FUT A;  4AQ0 A;  1RWF A;  1PX3 A;  3ECQ A;  3DEC A;  2BRV X;  4RNL A;  1OJP A;  3A24 A;  1TXK A;  1LXM A;  2WW3 A;  3T2Q A;  3Q1N A;  3VD4 A;  1JZ5 A;  1SO0 A;  5E1Q A;  3IAQ A;  2WDA A;  1NSR A;  1JYX A;  3VSN A;  3VDC A;  1JZ3 A;  4BZH A;  3E7J A;  3J7H A;  1CB8 A;  1RWC A;  1C82 A;  1RWA A;  1NSV A;  1DP0 A;  1MN0 A;  1OJM A;  1L7K A;  1N7N A;  3VD7 A;  3OS7 A;  3T0B A;  1JOV A;  1X1H A;  5JMD A;  1HMW A;  1RW9 A;  3T09 A;  1JZ7 A;  1NS0 A;  3MWX A;  3IAP A;  2JKP A;  1HN1 A;  3VD5 A;  1NSX A;  3VD9 A;  1JYN A;  3E80 A;  1MMU A;  3BGA A;  2WW2 A;  3CZJ A;  1Z45 A;  2CIQ A;  3T0A A;  1LOH A;  1EGU A;  2Q1F A;  3E1F 1;  1F1S A;  3K25 A;  1NS4 A;  1RWH A;  1NSS A;  3I3D A;  3TY1 A;  3MUZ 1;  3BS6 A;  1J0N A;  1X1I A;  2BRW A;  4DUV A;  1NSU A;  1N7P A;  1F4H A;  1N7O A;  1MMZ A;  2E24 A;  2JKA A;  3A0O A;  2ZXQ A;  4OJZ A;  3VDA A;  4DUX A;  3OBA A;  3WFA A;  2X03 A;  3T0D A;  1F9G A;  3IMH A;  2WZS A;  1LUR A;  1JZ6 A;  2WVZ A;  4MMH A;  1UG9 A;  3T08 A;  3WVF A;  1HM2 A;  5JMF A;  1LXK A;  1J0M A;  1MMY A;  4J5T A;  3AFL A;  4MMI A;  1RWG A;  2WVY A;  1NS2 A;  4FNV A;  1JZ8 A;  1JZ4 A;  1JZ2 A;  1F4A A;  3MV1 1;  1I8Q A;  3SEP A;  3MV0 1;  4OK4 A;  1NKG A;  1PX4 A;  2E22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...