1NSRA

Crystal structure of galactose mutarotase from lactococcus lactis mutant d243n complexed with glucose
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGHVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGINHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
total genus 99
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsrA00
3OBAA 1N7OA 3BGAA 1LF6A 1L7JA 1NSXA 1RWAA 4BZHA 4TTGA 1MMZA 2WW0A 1NKGA 3NREA 1HM3A 2E22A 3I3DA 3NJVA 1RWCA 3E1F1 3VD5A 1YGAA 1HN1A 1NSSA 2WVZA 1NS7A 3Q1NA 1TXKA 2CIRA 1OJNA 1F4HA 2ZXQA 2JKPA 4BZGA 1JZ5A 2ZQ0A 2CIQA 1EGUA 1K1WA 3WFAA 3VD7A 1Z45A 1JYNA 2HTAA 3MUZ1 3T2OA 3DYMA 2WVYA 3T09A 1X1HA 3IAPA 1CB8A 1LXMA 2D73A 4BZEA 1N7RA 3VD3A 3IMHA 1F1SA 1NSMA 3T08A 2WW2A 2WZSA 3T0DA 1DP0A 1JOVA 1K1XA 1N7NA 1RW9A 2WCOA 3CZJA 3ECQA 3DECA 2HTBA 2WW1A 1J0MA 4AQ0A 1MMXA 1NSRA 1JZ6A 1JZ2A 1JYWA 1I8QA 1NSUA 2E24A 2XHNA 2WDAA 2BRVX 2X03A 3T0BA 1RWFA 3I3EA 3IAQA 3A24A 1J0NA 3VD4A 2WVXA 3MWXA 1UG9A 3T0AA 1L7KA 1LF9A 4RNLA 5E1QA 3VDBA 2WVXB 5A1AA 1JZ8A 1NSVA 1RWGA 1NS4A 3MV01 1HMUA 1W3YA 3VDAA 3DYPA 1F4AA 1PX3A 3MUY1 1LURA 1NS8A 1JZ3A 1X1IA 3VDCA 1JYXA 4BZFA 1HM2A 3K25A 1MN0A 2WW3A 3SEPA 1MMYA 1SO0A 1YQ2A 2BRWA 1LOHA 1RWHA 3J7HA 1MMUA 1K1YA 1X1JA 3T2PA 3MV11 4DUVA 2Q1FA 1JYVA 3OS7A 3OB8A 3DYOA 1C82A 1NS0A 1NS2A 1ULVA 1HMWA 3I3BA 3DCDA 1N7PA 1SNZA 1NSZA 2XSGA 1OJPA 2BRPA 1PX4A 3NJXA 4DUWA 1LXKA 3VD9A 1OJMA 1F9GA 1N7QA 2JKEA 1HN0A 2CISA 2JKAA 4DUXA 1JZ7A 1JZ4A 1OJOA 3T2QA
chains in the Genus database with same CATH superfamily
3MI6A 3QDEA 3T0UA 3BVUA 4TTGA 3S4CA 1NKGA 1V7WA 3X3XA 1TQTA 3E1F1 2WVZA 3Q1NA 1TXKA 2CIRA 3EJPA 1A2VA 2D1WA 2F1AA 1TQWA 2EADA 3D51A 3E80A 2HTAA 3BLBA 3BVTA 2F7PA 2E2VA 3DDFA 2D73A 3W7UA 1N7RA 4KTRA 2WYHA 1IVWA 3EJRA 2PNCA 1W6CA 2CWTA 1PS3A 3X3ZA 3DECA 4FNSA 2HTBA 2WW1A 1J0MA 3K5TA 1JZ6A 3WA3A 4FNRA 1TQUA 2XHNA 1EKMA 3S4AA 1W4NA 2E2UA 3WIRA 3PGBA 1DYUA 4OK2A 3IAQA 3VD4A 2CWUA 3MWXA 4KTPA 3T0AA 1L7KA 2C11A 3BUPA 1W3YA 3W7WA 3DYPA 1IQXA 1F4AA 3WIQA 2CFLA 2WO0A 5KBPA 3S4DA 3W7SA 1MMYA 2Y74A 1X1JA 1TQSA 4DUVA 2Q1FA 2FUQA 1JYVA 1TQVA 1NS0A 1ULVA 1NSZA 3NJXA 2CISA 4FNTA 3QFYA 4NEIA 1JZ7A 1OJOA 1W7CA 1RJOA 3W7XA 4EV5A 1O7DD 1N7OA 3BGAA 3EJQA 1LF6A 2F7RA 1RWAA 1JRQA 4OK4A 2WW0A 2OQEA 2E22A 1V7XA 2XN1A 1NSSA 1HTYA 1NS7A 1R33A 2EACA 1HXKA 1V7VA 3SX1A 1IVXA 1D6ZA 1F4HA 3SXXA 2ZXQA 2C10A 2F7QA 3EJUA 4BZGA 3VD7A 3BUDA 2CG1A 3T2OA 3MPHA 3IAPA 1F1SA 1NSMA 3AMOA 2Y73A 3T0DA 1DP0A 1JOVA 3D4ZA 2OOVA 1K1XA 4OJZA 1IQYA 2E2TA 2E24A 1LVNA 2XN0A 2X03A 3DX1A 3KIIA 3T0BA 3ALAA 3BUIA 5GW7A 3X42A 2WVXA 1UG9A 2ZL8A 3WA2X 5A1AA 1NSVA 1AV4A 3BVWA 1PX3A 3MUY1 1JYXA 3VSMA 3X3YA 4BZFA 1HM2A 3K25A 3WVFA 3D52A 3NBBA 3SEPA 4UFCA 3ACSA 1LOHA 3T2PA 1K1YA 1R34A 2CFWA 3RSYA 1UI8A 1C82A 5JMDA 1QAFA 1SPUA 2YFNA 3A0OA 3VD9A 3DX0A 1F9GA 1N7QA 2XN2A 2WGQA 2JKPA 1H54A 4K35A 3OBAA 1L7JA 1NSXA 3BUQA 4BZHA 1MMZA 1IVVA 3NREA 1HM3A 2CFKA 3I3DA 3AFLA 1RWCA 3NJVA 4KFEA 1YGAA 4FNQA 3VD5A 4KFDA 1SIIA 3S4BA 1IU7A 1KSIA 1OJNA 3VSNA 3N9HA 1JZ5A 1PU4A 1K1WA 1HWWA 3WFAA 4BTXA 1UI7A 1Z45A 1W2ZA 1QALA 3DYMA 2RDYA 3T09A 1X1HA 2F7OA 4BZEA 3VD3A 3IMHA 3T08A 3HI7A 2WZSA 3CV5A 3DDGA 4EV2A 1N7NA 1RW9A 3NBJA 1QWUA 1NSUA 2ALWA 1QWNA 2BRVX 1WMPA 3TY1A 1OACA 2EAEA 3A24A 1J0NA 3BLCA 4RNLA 5E1QA 3RRSA 2W0QA 2WVXB 1JZ8A 1HMUA 3X40A 3AFJA 3CZSA 3E7JA 1SIHA 1LURA 2CFGA 3VDCA 1D6UA 2WW3A 4BTWA 2BRWA 3BUBA 1RWHA 2OW7A 3MV11 5CA3A 3OB8A 3DYOA 3I3BA 3DCDA 1SNZA 2XSGA 1OJPA 2BRPA 1PX4A 2WOFA 4DUWA 2JKAA 1RKYA 3T2QA 3LVTA 1US1A 4BTYA 3D3IA 2CQSA 2BT3A 3EJSA 1QAKA 4MMIA 1AVLA 5JMFA 3DX2A 4MMHA 2YX9A 4FNVA 2CG0A 1HN1A 2CQTA 3D4YA 3HIIA 4FNUA 2ZQ0A 2CIQA 1EGUA 4J5TA 2FUTA 1JYNA 3MUZ1 2WVYA 2EABA 1CB8A 1LXMA 2OQEC 1WMOA 3BS6A 3KN4A 2F18A 2WW2A 1W5ZA 2WYIA 1IVUA 2CFDA 2WCOA 3QFZA 4FNPA 3CZJA 3ECQA 2CWVA 1QX1A 4AQ0A 1MMXA 1NSRA 3EJTA 1JZ2A 1JYWA 2OOVC 1I8QA 2WOHA 2WDAA 3DX3A 1RWFA 3I3EA 3HIGA 2YFOA 1LF9A 3VDBA 3LOYA 3AMOB 1TU5A 1D6YA 1RWGA 1NS4A 4K3AA 3MV01 3VDAA 1N9EA 1NS8A 4KFFA 1JZ3A 1X1IA 1MN0A 3W7TA 2F1BA 1SO0A 1W6GA 1WMNA 3DX4A 1YQ2A 3X41A 3J7HA 1MMUA 2FYVA 3OS7A 3QG0A 1AVKA 1NS2A 1HMWA 1N7PA 3CZNA 3BVVA 1LXKA 1OJMA 3BVXA 2JKEA 1HN0A 4DUXA 3ACTA 1JZ4A 2OW6A 3D50A
chains in the Genus database with same CATH topology
3OBAA 1N7OA 3BGAA 1LF6A 1L7JA 1NSXA 4MMIA 1RWAA 4OK4A 5JMFA 4BZHA 4TTGA 1MMZA 2WW0A 1NKGA 3NREA 1HM3A 4MMHA 2E22A 4FNVA 3I3DA 3AFLA 1RWCA 3E1F1 3NJVA 1YGAA 1HN1A 1NSSA 3VD5A 2WVZA 1NS7A 3Q1NA 1TXKA 2CIRA 1OJNA 3VSNA 1F4HA 2ZXQA 2JKPA 4BZGA 1JZ5A 2ZQ0A 2CIQA 1EGUA 1K1WA 3WFAA 4J5TA 3VD7A 1Z45A 3E80A 2FUTA 2HTAA 1JYNA 3MUZ1 3T2OA 3DYMA 2WVYA 3T09A 1X1HA 3IAPA 1CB8A 1LXMA 2D73A 4BZEA 1N7RA 3BS6A 3VD3A 3IMHA 1F1SA 1NSMA 3T08A 2WW2A 2WZSA 3T0DA 1DP0A 1JOVA 1K1XA 1N7NA 1RW9A 2WCOA 3CZJA 3ECQA 4OJZA 3DECA 2HTBA 2WW1A 1J0MA 4AQ0A 1MMXA 1NSRA 1JZ6A 1JZ2A 1JYWA 1I8QA 1NSUA 2E24A 2XHNA 2WDAA 2BRVX 2X03A 3T0BA 1RWFA 4OK2A 3I3EA 3TY1A 3IAQA 3A24A 1J0NA 3VD4A 2WVXA 3MWXA 3BLCA 1UG9A 3T0AA 1L7KA 1LF9A 4RNLA 5E1QA 3VDBA 2WVXB 5A1AA 1JZ8A 1NSVA 1RWGA 1NS4A 3MV01 1HMUA 1W3YA 3VDAA 3DYPA 3E7JA 1F4AA 1PX3A 3MUY1 1LURA 1NS8A 1JZ3A 1X1IA 3VDCA 1JYXA 3VSMA 4BZFA 1HM2A 3K25A 3WVFA 1MN0A 2WW3A 3SEPA 1MMYA 1SO0A 1YQ2A 2BRWA 1LOHA 1RWHA 3J7HA 1MMUA 1K1YA 1X1JA 3T2PA 3MV11 4DUVA 2Q1FA 2FUQA 1JYVA 3OS7A 3OB8A 3DYOA 1C82A 1NS0A 1NS2A 1ULVA 1HMWA 3I3BA 3DCDA 5JMDA 1N7PA 1SNZA 1NSZA 2XSGA 1OJPA 2BRPA 1PX4A 3NJXA 4DUWA 3A0OA 1LXKA 3VD9A 1OJMA 1F9GA 1N7QA 2JKEA 1HN0A 2CISA 2JKAA 4NEIA 4DUXA 1JZ7A 1JZ4A 1OJOA 3T2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OBA A;  1N7O A;  3BGA A;  1LF6 A;  1L7J A;  1NSX A;  1RWA A;  4BZH A;  4TTG A;  1MMZ A;  2WW0 A;  1NKG A;  3NRE A;  1HM3 A;  2E22 A;  3I3D A;  3NJV A;  1RWC A;  3E1F 1;  3VD5 A;  1YGA A;  1HN1 A;  1NSS A;  2WVZ A;  1NS7 A;  3Q1N A;  1TXK A;  2CIR A;  1OJN A;  1F4H A;  2ZXQ A;  2JKP A;  4BZG A;  1JZ5 A;  2ZQ0 A;  2CIQ A;  1EGU A;  1K1W A;  3WFA A;  3VD7 A;  1Z45 A;  1JYN A;  2HTA A;  3MUZ 1;  3T2O A;  3DYM A;  2WVY A;  3T09 A;  1X1H A;  3IAP A;  1CB8 A;  1LXM A;  2D73 A;  4BZE A;  1N7R A;  3VD3 A;  3IMH A;  1F1S A;  1NSM A;  3T08 A;  2WW2 A;  2WZS A;  3T0D A;  1DP0 A;  1JOV A;  1K1X A;  1N7N A;  1RW9 A;  2WCO A;  3CZJ A;  3ECQ A;  3DEC A;  2HTB A;  2WW1 A;  1J0M A;  4AQ0 A;  1MMX A;  1NSR A;  1JZ6 A;  1JZ2 A;  1JYW A;  1I8Q A;  1NSU A;  2E24 A;  2XHN A;  2WDA A;  2BRV X;  2X03 A;  3T0B A;  1RWF A;  3I3E A;  3IAQ A;  3A24 A;  1J0N A;  3VD4 A;  2WVX A;  3MWX A;  1UG9 A;  3T0A A;  1L7K A;  1LF9 A;  4RNL A;  5E1Q A;  3VDB A;  2WVX B;  5A1A A;  1JZ8 A;  1NSV A;  1RWG A;  1NS4 A;  3MV0 1;  1HMU A;  1W3Y A;  3VDA A;  3DYP A;  1F4A A;  1PX3 A;  3MUY 1;  1LUR A;  1NS8 A;  1JZ3 A;  1X1I A;  3VDC A;  1JYX A;  4BZF A;  1HM2 A;  3K25 A;  1MN0 A;  2WW3 A;  3SEP A;  1MMY A;  1SO0 A;  1YQ2 A;  2BRW A;  1LOH A;  1RWH A;  3J7H A;  1MMU A;  1K1Y A;  1X1J A;  3T2P A;  3MV1 1;  4DUV A;  2Q1F A;  1JYV A;  3OS7 A;  3OB8 A;  3DYO A;  1C82 A;  1NS0 A;  1NS2 A;  1ULV A;  1HMW A;  3I3B A;  3DCD A;  1N7P A;  1SNZ A;  1NSZ A;  2XSG A;  1OJP A;  2BRP A;  1PX4 A;  3NJX A;  4DUW A;  1LXK A;  3VD9 A;  1OJM A;  1F9G A;  1N7Q A;  2JKE A;  1HN0 A;  2CIS A;  2JKA A;  4DUX A;  1JZ7 A;  1JZ4 A;  1OJO A;  3T2Q A; 
#chains in the Genus database with same CATH topology
 3MI6 A;  3QDE A;  3T0U A;  3BVU A;  4TTG A;  3S4C A;  1NKG A;  1V7W A;  3X3X A;  1TQT A;  3E1F 1;  2WVZ A;  3Q1N A;  1TXK A;  2CIR A;  3EJP A;  1A2V A;  2D1W A;  2F1A A;  1TQW A;  2EAD A;  3D51 A;  3E80 A;  2HTA A;  3BLB A;  3BVT A;  2F7P A;  2E2V A;  3DDF A;  2D73 A;  3W7U A;  1N7R A;  4KTR A;  2WYH A;  1IVW A;  3EJR A;  2PNC A;  1W6C A;  2CWT A;  1PS3 A;  3X3Z A;  3DEC A;  4FNS A;  2HTB A;  2WW1 A;  1J0M A;  3K5T A;  1JZ6 A;  3WA3 A;  4FNR A;  1TQU A;  2XHN A;  1EKM A;  3S4A A;  1W4N A;  2E2U A;  3WIR A;  3PGB A;  1DYU A;  4OK2 A;  3IAQ A;  3VD4 A;  2CWU A;  3MWX A;  4KTP A;  3T0A A;  1L7K A;  2C11 A;  3BUP A;  1W3Y A;  3W7W A;  3DYP A;  1IQX A;  1F4A A;  3WIQ A;  2CFL A;  2WO0 A;  5KBP A;  3S4D A;  3W7S A;  1MMY A;  2Y74 A;  1X1J A;  1TQS A;  4DUV A;  2Q1F A;  2FUQ A;  1JYV A;  1TQV A;  1NS0 A;  1ULV A;  1NSZ A;  3NJX A;  2CIS A;  4FNT A;  3QFY A;  4NEI A;  1JZ7 A;  1OJO A;  1W7C A;  1RJO A;  3W7X A;  4EV5 A;  1O7D D;  1N7O A;  3BGA A;  3EJQ A;  1LF6 A;  2F7R A;  1RWA A;  1JRQ A;  4OK4 A;  2WW0 A;  2OQE A;  2E22 A;  1V7X A;  2XN1 A;  1NSS A;  1HTY A;  1NS7 A;  1R33 A;  2EAC A;  1HXK A;  1V7V A;  3SX1 A;  1IVX A;  1D6Z A;  1F4H A;  3SXX A;  2ZXQ A;  2C10 A;  2F7Q A;  3EJU A;  4BZG A;  3VD7 A;  3BUD A;  2CG1 A;  3T2O A;  3MPH A;  3IAP A;  1F1S A;  1NSM A;  3AMO A;  2Y73 A;  3T0D A;  1DP0 A;  1JOV A;  3D4Z A;  2OOV A;  1K1X A;  4OJZ A;  1IQY A;  2E2T A;  2E24 A;  1LVN A;  2XN0 A;  2X03 A;  3DX1 A;  3KII A;  3T0B A;  3ALA A;  3BUI A;  5GW7 A;  3X42 A;  2WVX A;  1UG9 A;  2ZL8 A;  3WA2 X;  5A1A A;  1NSV A;  1AV4 A;  3BVW A;  1PX3 A;  3MUY 1;  1JYX A;  3VSM A;  3X3Y A;  4BZF A;  1HM2 A;  3K25 A;  3WVF A;  3D52 A;  3NBB A;  3SEP A;  4UFC A;  3ACS A;  1LOH A;  3T2P A;  1K1Y A;  1R34 A;  2CFW A;  3RSY A;  1UI8 A;  1C82 A;  5JMD A;  1QAF A;  1SPU A;  2YFN A;  3A0O A;  3VD9 A;  3DX0 A;  1F9G A;  1N7Q A;  2XN2 A;  2WGQ A;  2JKP A;  1H54 A;  4K35 A;  3OBA A;  1L7J A;  1NSX A;  3BUQ A;  4BZH A;  1MMZ A;  1IVV A;  3NRE A;  1HM3 A;  2CFK A;  3I3D A;  3AFL A;  1RWC A;  3NJV A;  4KFE A;  1YGA A;  4FNQ A;  3VD5 A;  4KFD A;  1SII A;  3S4B A;  1IU7 A;  1KSI A;  1OJN A;  3VSN A;  3N9H A;  1JZ5 A;  1PU4 A;  1K1W A;  1HWW A;  3WFA A;  4BTX A;  1UI7 A;  1Z45 A;  1W2Z A;  1QAL A;  3DYM A;  2RDY A;  3T09 A;  1X1H A;  2F7O A;  4BZE A;  3VD3 A;  3IMH A;  3T08 A;  3HI7 A;  2WZS A;  3CV5 A;  3DDG A;  4EV2 A;  1N7N A;  1RW9 A;  3NBJ A;  1QWU A;  1NSU A;  2ALW A;  1QWN A;  2BRV X;  1WMP A;  3TY1 A;  1OAC A;  2EAE A;  3A24 A;  1J0N A;  3BLC A;  4RNL A;  5E1Q A;  3RRS A;  2W0Q A;  2WVX B;  1JZ8 A;  1HMU A;  3X40 A;  3AFJ A;  3CZS A;  3E7J A;  1SIH A;  1LUR A;  2CFG A;  3VDC A;  1D6U A;  2WW3 A;  4BTW A;  2BRW A;  3BUB A;  1RWH A;  2OW7 A;  3MV1 1;  5CA3 A;  3OB8 A;  3DYO A;  3I3B A;  3DCD A;  1SNZ A;  2XSG A;  1OJP A;  2BRP A;  1PX4 A;  2WOF A;  4DUW A;  2JKA A;  1RKY A;  3T2Q A;  3LVT A;  1US1 A;  4BTY A;  3D3I A;  2CQS A;  2BT3 A;  3EJS A;  1QAK A;  4MMI A;  1AVL A;  5JMF A;  3DX2 A;  4MMH A;  2YX9 A;  4FNV A;  2CG0 A;  1HN1 A;  2CQT A;  3D4Y A;  3HII A;  4FNU A;  2ZQ0 A;  2CIQ A;  1EGU A;  4J5T A;  2FUT A;  1JYN A;  3MUZ 1;  2WVY A;  2EAB A;  1CB8 A;  1LXM A;  2OQE C;  1WMO A;  3BS6 A;  3KN4 A;  2F18 A;  2WW2 A;  1W5Z A;  2WYI A;  1IVU A;  2CFD A;  2WCO A;  3QFZ A;  4FNP A;  3CZJ A;  3ECQ A;  2CWV A;  1QX1 A;  4AQ0 A;  1MMX A;  1NSR A;  3EJT A;  1JZ2 A;  1JYW A;  2OOV C;  1I8Q A;  2WOH A;  2WDA A;  3DX3 A;  1RWF A;  3I3E A;  3HIG A;  2YFO A;  1LF9 A;  3VDB A;  3LOY A;  3AMO B;  1TU5 A;  1D6Y A;  1RWG A;  1NS4 A;  4K3A A;  3MV0 1;  3VDA A;  1N9E A;  1NS8 A;  4KFF A;  1JZ3 A;  1X1I A;  1MN0 A;  3W7T A;  2F1B A;  1SO0 A;  1W6G A;  1WMN A;  3DX4 A;  1YQ2 A;  3X41 A;  3J7H A;  1MMU A;  2FYV A;  3OS7 A;  3QG0 A;  1AVK A;  1NS2 A;  1HMW A;  1N7P A;  3CZN A;  3BVV A;  1LXK A;  1OJM A;  3BVX A;  2JKE A;  1HN0 A;  4DUX A;  3ACT A;  1JZ4 A;  2OW6 A;  3D50 A; 
#chains in the Genus database with same CATH homology
 3OBA A;  1N7O A;  3BGA A;  1LF6 A;  1L7J A;  1NSX A;  4MMI A;  1RWA A;  4OK4 A;  5JMF A;  4BZH A;  4TTG A;  1MMZ A;  2WW0 A;  1NKG A;  3NRE A;  1HM3 A;  4MMH A;  2E22 A;  4FNV A;  3I3D A;  3AFL A;  1RWC A;  3E1F 1;  3NJV A;  1YGA A;  1HN1 A;  1NSS A;  3VD5 A;  2WVZ A;  1NS7 A;  3Q1N A;  1TXK A;  2CIR A;  1OJN A;  3VSN A;  1F4H A;  2ZXQ A;  2JKP A;  4BZG A;  1JZ5 A;  2ZQ0 A;  2CIQ A;  1EGU A;  1K1W A;  3WFA A;  4J5T A;  3VD7 A;  1Z45 A;  3E80 A;  2FUT A;  2HTA A;  1JYN A;  3MUZ 1;  3T2O A;  3DYM A;  2WVY A;  3T09 A;  1X1H A;  3IAP A;  1CB8 A;  1LXM A;  2D73 A;  4BZE A;  1N7R A;  3BS6 A;  3VD3 A;  3IMH A;  1F1S A;  1NSM A;  3T08 A;  2WW2 A;  2WZS A;  3T0D A;  1DP0 A;  1JOV A;  1K1X A;  1N7N A;  1RW9 A;  2WCO A;  3CZJ A;  3ECQ A;  4OJZ A;  3DEC A;  2HTB A;  2WW1 A;  1J0M A;  4AQ0 A;  1MMX A;  1NSR A;  1JZ6 A;  1JZ2 A;  1JYW A;  1I8Q A;  1NSU A;  2E24 A;  2XHN A;  2WDA A;  2BRV X;  2X03 A;  3T0B A;  1RWF A;  4OK2 A;  3I3E A;  3TY1 A;  3IAQ A;  3A24 A;  1J0N A;  3VD4 A;  2WVX A;  3MWX A;  3BLC A;  1UG9 A;  3T0A A;  1L7K A;  1LF9 A;  4RNL A;  5E1Q A;  3VDB A;  2WVX B;  5A1A A;  1JZ8 A;  1NSV A;  1RWG A;  1NS4 A;  3MV0 1;  1HMU A;  1W3Y A;  3VDA A;  3DYP A;  3E7J A;  1F4A A;  1PX3 A;  3MUY 1;  1LUR A;  1NS8 A;  1JZ3 A;  1X1I A;  3VDC A;  1JYX A;  3VSM A;  4BZF A;  1HM2 A;  3K25 A;  3WVF A;  1MN0 A;  2WW3 A;  3SEP A;  1MMY A;  1SO0 A;  1YQ2 A;  2BRW A;  1LOH A;  1RWH A;  3J7H A;  1MMU A;  1K1Y A;  1X1J A;  3T2P A;  3MV1 1;  4DUV A;  2Q1F A;  2FUQ A;  1JYV A;  3OS7 A;  3OB8 A;  3DYO A;  1C82 A;  1NS0 A;  1NS2 A;  1ULV A;  1HMW A;  3I3B A;  3DCD A;  5JMD A;  1N7P A;  1SNZ A;  1NSZ A;  2XSG A;  1OJP A;  2BRP A;  1PX4 A;  3NJX A;  4DUW A;  3A0O A;  1LXK A;  3VD9 A;  1OJM A;  1F9G A;  1N7Q A;  2JKE A;  1HN0 A;  2CIS A;  2JKA A;  4NEI A;  4DUX A;  1JZ7 A;  1JZ4 A;  1OJO A;  3T2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...