1NSXA

Crystal structure of galactose mutarotase from lactococcus lactis mutant h170n complexed with galactose
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGNVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
molecule keywords GALACTOSE MUTAROTASE
total genus 102
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsxA00
1SNZA 3T0DA 1NSUA 3DECA 2CISA 1HMWA 2WVZA 4DUWA 2CIQA 1HM2A 3I3EA 3VDAA 1OJNA 2XSGA 1RWGA 3T2QA 3NJXA 1MMUA 4AQ0A 1NS2A 3J7HA 4DUVA 1J0MA 1JZ2A 1NSVA 2D73A 1EGUA 2WW1A 1NSSA 2JKPA 1C82A 1LXMA 1X1JA 1LURA 4TTGA 3OBAA 3ECQA 3VDCA 4BZFA 1X1IA 1F1SA 1RWCA 2ZXQA 1F9GA 3T0AA 2WDAA 1SO0A 1JYXA 1NSXA 1J0NA 1RWHA 1K1YA 3CZJA 1LOHA 3T2OA 2BRVX 1NSZA 1YGAA 1K1WA 3IAQA 5E1QA 1Z45A 2HTAA 1LXKA 1RWFA 3SEPA 3T08A 1L7JA 1JZ3A 1X1HA 2E24A 3DYPA 3Q1NA 3VDBA 3IAPA 1CB8A 1JZ5A 1I8QA 2CIRA 1UG9A 2ZQ0A 2WW2A 3T0BA 1N7RA 1JZ4A 1JYNA 2BRPA 4RNLA 3VD7A 1NS0A 1N7QA 1F4HA 2BRWA 3VD5A 5A1AA 3A24A 1JZ6A 1PX4A 3MUZ1 1YQ2A 2WW3A 1JYVA 1MN0A 1TXKA 2XHNA 1NSRA 1HM3A 1LF6A 1OJOA 3I3BA 3OS7A 3NREA 3MV01 1N7OA 1HN0A 1NS4A 2E22A 1OJPA 4DUXA 3OB8A 1HN1A 4BZEA 1JOVA 1K1XA 2WVXA 3K25A 1NS8A 2WVXB 3MUY1 1NSMA 1LF9A 1HMUA 2WZSA 1N7NA 1ULVA 1OJMA 1RWAA 2JKAA 1N7PA 3DYMA 2Q1FA 3VD3A 1MMXA 1W3YA 2WCOA 3VD9A 4BZGA 1JZ8A 1RW9A 2WVYA 3T2PA 3VD4A 1NKGA 1MMZA 3DCDA 3MWXA 3IMHA 4BZHA 1JZ7A 3I3DA 3T09A 3NJVA 3MV11 1NS7A 1MMYA 2X03A 3WFAA 2JKEA 1DP0A 2HTBA 1JYWA 1F4AA 1L7KA 2WW0A 3E1F1 3BGAA 3DYOA 1PX3A
chains in the Genus database with same CATH superfamily
2ZL8A 3BVXA 2WVZA 2CIQA 3I3EA 4EV2A 1RWGA 2CFGA 3DDFA 3CV5A 4FNSA 2OQEC 3ALAA 3MPHA 3BVVA 2D73A 1EGUA 3VSNA 3W7XA 3EJQA 3OBAA 3DX3A 1EKMA 1X1IA 4KTRA 1RWCA 3LOYA 1F9GA 1NSXA 1WMNA 1K1YA 3CZJA 1LOHA 1D6ZA 3T2OA 2CFDA 1JRQA 3S4DA 3LVTA 3SXXA 1L7JA 3VDBA 4FNQA 2F1BA 3CZNA 1N7RA 1JZ4A 1KSIA 1JYNA 2XN1A 3T0UA 1TQSA 1N7QA 3NBJA 3VD5A 1JZ6A 1PX4A 3BUIA 1JYVA 1TQVA 2RDYA 4UFCA 3OS7A 3NREA 3MV01 3HIGA 3BUPA 1AVKA 3WVFA 3CZSA 1K1XA 1W5ZA 2YFOA 3BUBA 1OACA 1W6CA 3DYMA 3X41A 3T2PA 2WOFA 3VD4A 1IU7A 3VSMA 4BZHA 3BLCA 1JZ7A 1TU5A 1IVWA 3MV11 1NS7A 2HTBA 3AFJA 3E1F1 4BTXA 4BTYA 3ACTA 3BUQA 1QWNA 2CISA 3BVWA 2XSGA 3WA2X 2C11A 2CQTA 2WO0A 1J0MA 3D4ZA 1IVVA 3D51A 3X40A 2FYVA 3BUDA 1RKYA 2E2UA 1F1SA 1RJOA 3T0AA 2WDAA 1IVXA 4FNTA 2BT3A 1NSZA 2W0QA 3AMOA 1D6UA 1SIIA 1RWFA 1SIHA 3WA3A 3DYPA 3IAPA 3KIIA 3T0BA 2WW2A 4OJZA 1HXKA 1HWWA 2WYHA 1F4HA 5A1AA 3A24A 1YQ2A 2WW3A 3SX1A 1MN0A 3A0OA 1OJOA 3D50A 1IQXA 2E2VA 2E22A 1OJPA 2CWUA 3S4CA 4KFDA 4BZEA 2WVXA 3TY1A 3MUY1 1NSMA 2F1AA 1LF9A 5GW7A 3WIRA 1LVNA 3EJSA 2WZSA 1N7NA 3S4AA 1W6GA 3EJPA 4KTPA 2XN0A 2WGQA 1MMXA 3VD9A 1JZ8A 3W7SA 4FNUA 3DCDA 3IMHA 3DX4A 1QAFA 3NJVA 3W7UA 1MMYA 1DP0A 1TQWA 2F7QA 1A2VA 5CA3A 1DYUA 1F4AA 3X3YA 1IVUA 2WW0A 3ACSA 3BGAA 3DYOA 1PX3A 1SNZA 1HTYA 3DECA 4OK2A 2OOVA 1WMOA 4DUWA 3D4YA 1AV4A 1OJNA 1US1A 3T2QA 2CWVA 3NJXA 1MMUA 4AQ0A 1SPUA 3D3IA 1V7XA 1N9EA 2CG0A 2JKPA 1C82A 3EJUA 2D1WA 1LXMA 1X1JA 3ECQA 3VDCA 1IQYA 1TQUA 2CFKA 4OK4A 4EV5A 3DDGA 1JYXA 3NBBA 1QALA 2BRVX 1YGAA 3IAQA 5E1QA 1PU4A 4MMIA 3SEPA 1R33A 2E24A 1CB8A 1JZ5A 1O7DD 2EABA 2EACA 1I8QA 1UG9A 2ZQ0A 3PGBA 4NEIA 2BRPA 4RNLA 3VD7A 1NS0A 3BS6A 4FNPA 3MUZ1 3QG0A 3DX2A 2XHNA 1NSRA 2XN2A 1HM3A 3I3BA 1N7OA 5KBPA 3X3ZA 1NS4A 5JMFA 4DUXA 1HN1A 3EJRA 4FNRA 3X3XA 1V7VA 1UI8A 2WVXB 2OQEA 1HMUA 3K5TA 2YFNA 1ULVA 1QWUA 2EADA 1RWAA 2JKAA 1N7PA 3QFYA 2Q1FA 2Y73A 1W3YA 3RSYA 1PS3A 1RW9A 2WVYA 4K35A 2FUQA 3W7TA 1W2ZA 1UI7A 1W7CA 3BVUA 3T09A 1TQTA 3WFAA 3WIQA 4KFEA 1R34A 4J5TA 1LF6A 3T0DA 1NSUA 2CWTA 1HMWA 1HM2A 3VDAA 1V7WA 2F7PA 3RRSA 3W7WA 2CFWA 3QDEA 1NS2A 3J7HA 4DUVA 1JZ2A 1NSVA 2WW1A 1NSSA 2WOHA 2CG1A 2E2TA 1LURA 3HI7A 4TTGA 2YX9A 1QX1A 2ALWA 4BZFA 3DX1A 2ZXQA 2C10A 3QFZA 1SO0A 1J0NA 1RWHA 3AMOB 1K1WA 4FNVA 3X42A 1Z45A 2HTAA 2F7RA 1LXKA 3T08A 3E80A 2WYIA 3AFLA 1X1HA 1D6YA 1JZ3A 3Q1NA 1W4NA 2CIRA 3EJTA 2F7OA 2F18A 2BRWA 1TXKA 3HIIA 2Y74A 1HN0A 2PNCA 3E7JA 3OB8A 3S4BA 1JOVA 3K25A 1NS8A 3KN4A 3N9HA 3DX0A 2FUTA 1QAKA 1OJMA 4BTWA 2EAEA 3VD3A 2OW6A 1AVLA 2WCOA 4BZGA 2CFLA 4KFFA 1NKGA 1WMPA 1MMZA 3MWXA 1H54A 3I3DA 4K3AA 3BLBA 2X03A 2JKEA 2CQSA 3D52A 3BVTA 2OW7A 1JYWA 4MMHA 5JMDA 1L7KA 3MI6A 2OOVC
chains in the Genus database with same CATH topology
1SNZA 3T0DA 1NSUA 3DECA 4OK2A 2CISA 1HMWA 2WVZA 4DUWA 2CIQA 1HM2A 3I3EA 3VDAA 1OJNA 2XSGA 1RWGA 3T2QA 3NJXA 1MMUA 4AQ0A 1NS2A 3J7HA 4DUVA 1J0MA 1JZ2A 1NSVA 2D73A 1EGUA 2WW1A 1NSSA 2JKPA 1C82A 3VSNA 1LXMA 1X1JA 1LURA 4TTGA 3OBAA 3ECQA 3VDCA 4BZFA 1X1IA 1F1SA 4OK4A 1RWCA 2ZXQA 1F9GA 3T0AA 2WDAA 1SO0A 1JYXA 1NSXA 1J0NA 1RWHA 1K1YA 3CZJA 1LOHA 3T2OA 2BRVX 1NSZA 1YGAA 1K1WA 3IAQA 4FNVA 5E1QA 1Z45A 2HTAA 4MMIA 1LXKA 1RWFA 3SEPA 3E80A 1L7JA 3AFLA 1X1HA 3T08A 1JZ3A 2E24A 3DYPA 3Q1NA 3VDBA 3IAPA 1CB8A 1JZ5A 1I8QA 2CIRA 1UG9A 2ZQ0A 2WW2A 3T0BA 4OJZA 1N7RA 1JZ4A 4NEIA 1JYNA 2BRPA 4RNLA 3VD7A 1NS0A 3BS6A 1N7QA 1F4HA 2BRWA 3VD5A 5A1AA 3A24A 1JZ6A 1PX4A 3MUZ1 1YQ2A 2WW3A 1JYVA 1MN0A 1TXKA 2XHNA 3A0OA 1NSRA 1HM3A 1LF6A 1OJOA 3I3BA 3OS7A 3NREA 3MV01 1N7OA 1HN0A 1NS4A 2E22A 1OJPA 3E7JA 3WVFA 4DUXA 3OB8A 1HN1A 5JMFA 4BZEA 1JOVA 1K1XA 2WVXA 3K25A 1NS8A 2WVXB 3TY1A 3MUY1 1NSMA 1LF9A 1HMUA 2FUTA 2WZSA 1N7NA 1ULVA 1OJMA 1RWAA 2JKAA 1N7PA 3DYMA 2Q1FA 3VD3A 1MMXA 1W3YA 2WCOA 3VD9A 4BZGA 1JZ8A 1RW9A 2WVYA 3T2PA 3VD4A 1NKGA 1MMZA 3DCDA 3MWXA 3IMHA 3VSMA 4BZHA 2FUQA 3BLCA 1JZ7A 3I3DA 3T09A 3NJVA 3MV11 1NS7A 1MMYA 2X03A 3WFAA 2JKEA 1DP0A 2HTBA 1JYWA 1F4AA 4MMHA 5JMDA 1L7KA 2WW0A 3E1F1 3BGAA 4J5TA 3DYOA 1PX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNZ A;  3T0D A;  1NSU A;  3DEC A;  2CIS A;  1HMW A;  2WVZ A;  4DUW A;  2CIQ A;  1HM2 A;  3I3E A;  3VDA A;  1OJN A;  2XSG A;  1RWG A;  3T2Q A;  3NJX A;  1MMU A;  4AQ0 A;  1NS2 A;  3J7H A;  4DUV A;  1J0M A;  1JZ2 A;  1NSV A;  2D73 A;  1EGU A;  2WW1 A;  1NSS A;  2JKP A;  1C82 A;  1LXM A;  1X1J A;  1LUR A;  4TTG A;  3OBA A;  3ECQ A;  3VDC A;  4BZF A;  1X1I A;  1F1S A;  1RWC A;  2ZXQ A;  1F9G A;  3T0A A;  2WDA A;  1SO0 A;  1JYX A;  1NSX A;  1J0N A;  1RWH A;  1K1Y A;  3CZJ A;  1LOH A;  3T2O A;  2BRV X;  1NSZ A;  1YGA A;  1K1W A;  3IAQ A;  5E1Q A;  1Z45 A;  2HTA A;  1LXK A;  1RWF A;  3SEP A;  3T08 A;  1L7J A;  1JZ3 A;  1X1H A;  2E24 A;  3DYP A;  3Q1N A;  3VDB A;  3IAP A;  1CB8 A;  1JZ5 A;  1I8Q A;  2CIR A;  1UG9 A;  2ZQ0 A;  2WW2 A;  3T0B A;  1N7R A;  1JZ4 A;  1JYN A;  2BRP A;  4RNL A;  3VD7 A;  1NS0 A;  1N7Q A;  1F4H A;  2BRW A;  3VD5 A;  5A1A A;  3A24 A;  1JZ6 A;  1PX4 A;  3MUZ 1;  1YQ2 A;  2WW3 A;  1JYV A;  1MN0 A;  1TXK A;  2XHN A;  1NSR A;  1HM3 A;  1LF6 A;  1OJO A;  3I3B A;  3OS7 A;  3NRE A;  3MV0 1;  1N7O A;  1HN0 A;  1NS4 A;  2E22 A;  1OJP A;  4DUX A;  3OB8 A;  1HN1 A;  4BZE A;  1JOV A;  1K1X A;  2WVX A;  3K25 A;  1NS8 A;  2WVX B;  3MUY 1;  1NSM A;  1LF9 A;  1HMU A;  2WZS A;  1N7N A;  1ULV A;  1OJM A;  1RWA A;  2JKA A;  1N7P A;  3DYM A;  2Q1F A;  3VD3 A;  1MMX A;  1W3Y A;  2WCO A;  3VD9 A;  4BZG A;  1JZ8 A;  1RW9 A;  2WVY A;  3T2P A;  3VD4 A;  1NKG A;  1MMZ A;  3DCD A;  3MWX A;  3IMH A;  4BZH A;  1JZ7 A;  3I3D A;  3T09 A;  3NJV A;  3MV1 1;  1NS7 A;  1MMY A;  2X03 A;  3WFA A;  2JKE A;  1DP0 A;  2HTB A;  1JYW A;  1F4A A;  1L7K A;  2WW0 A;  3E1F 1;  3BGA A;  3DYO A;  1PX3 A; 
#chains in the Genus database with same CATH topology
 2ZL8 A;  3BVX A;  2WVZ A;  2CIQ A;  3I3E A;  4EV2 A;  1RWG A;  2CFG A;  3DDF A;  3CV5 A;  4FNS A;  2OQE C;  3ALA A;  3MPH A;  3BVV A;  2D73 A;  1EGU A;  3VSN A;  3W7X A;  3EJQ A;  3OBA A;  3DX3 A;  1EKM A;  1X1I A;  4KTR A;  1RWC A;  3LOY A;  1F9G A;  1NSX A;  1WMN A;  1K1Y A;  3CZJ A;  1LOH A;  1D6Z A;  3T2O A;  2CFD A;  1JRQ A;  3S4D A;  3LVT A;  3SXX A;  1L7J A;  3VDB A;  4FNQ A;  2F1B A;  3CZN A;  1N7R A;  1JZ4 A;  1KSI A;  1JYN A;  2XN1 A;  3T0U A;  1TQS A;  1N7Q A;  3NBJ A;  3VD5 A;  1JZ6 A;  1PX4 A;  3BUI A;  1JYV A;  1TQV A;  2RDY A;  4UFC A;  3OS7 A;  3NRE A;  3MV0 1;  3HIG A;  3BUP A;  1AVK A;  3WVF A;  3CZS A;  1K1X A;  1W5Z A;  2YFO A;  3BUB A;  1OAC A;  1W6C A;  3DYM A;  3X41 A;  3T2P A;  2WOF A;  3VD4 A;  1IU7 A;  3VSM A;  4BZH A;  3BLC A;  1JZ7 A;  1TU5 A;  1IVW A;  3MV1 1;  1NS7 A;  2HTB A;  3AFJ A;  3E1F 1;  4BTX A;  4BTY A;  3ACT A;  3BUQ A;  1QWN A;  2CIS A;  3BVW A;  2XSG A;  3WA2 X;  2C11 A;  2CQT A;  2WO0 A;  1J0M A;  3D4Z A;  1IVV A;  3D51 A;  3X40 A;  2FYV A;  3BUD A;  1RKY A;  2E2U A;  1F1S A;  1RJO A;  3T0A A;  2WDA A;  1IVX A;  4FNT A;  2BT3 A;  1NSZ A;  2W0Q A;  3AMO A;  1D6U A;  1SII A;  1RWF A;  1SIH A;  3WA3 A;  3DYP A;  3IAP A;  3KII A;  3T0B A;  2WW2 A;  4OJZ A;  1HXK A;  1HWW A;  2WYH A;  1F4H A;  5A1A A;  3A24 A;  1YQ2 A;  2WW3 A;  3SX1 A;  1MN0 A;  3A0O A;  1OJO A;  3D50 A;  1IQX A;  2E2V A;  2E22 A;  1OJP A;  2CWU A;  3S4C A;  4KFD A;  4BZE A;  2WVX A;  3TY1 A;  3MUY 1;  1NSM A;  2F1A A;  1LF9 A;  5GW7 A;  3WIR A;  1LVN A;  3EJS A;  2WZS A;  1N7N A;  3S4A A;  1W6G A;  3EJP A;  4KTP A;  2XN0 A;  2WGQ A;  1MMX A;  3VD9 A;  1JZ8 A;  3W7S A;  4FNU A;  3DCD A;  3IMH A;  3DX4 A;  1QAF A;  3NJV A;  3W7U A;  1MMY A;  1DP0 A;  1TQW A;  2F7Q A;  1A2V A;  5CA3 A;  1DYU A;  1F4A A;  3X3Y A;  1IVU A;  2WW0 A;  3ACS A;  3BGA A;  3DYO A;  1PX3 A;  1SNZ A;  1HTY A;  3DEC A;  4OK2 A;  2OOV A;  1WMO A;  4DUW A;  3D4Y A;  1AV4 A;  1OJN A;  1US1 A;  3T2Q A;  2CWV A;  3NJX A;  1MMU A;  4AQ0 A;  1SPU A;  3D3I A;  1V7X A;  1N9E A;  2CG0 A;  2JKP A;  1C82 A;  3EJU A;  2D1W A;  1LXM A;  1X1J A;  3ECQ A;  3VDC A;  1IQY A;  1TQU A;  2CFK A;  4OK4 A;  4EV5 A;  3DDG A;  1JYX A;  3NBB A;  1QAL A;  2BRV X;  1YGA A;  3IAQ A;  5E1Q A;  1PU4 A;  4MMI A;  3SEP A;  1R33 A;  2E24 A;  1CB8 A;  1JZ5 A;  1O7D D;  2EAB A;  2EAC A;  1I8Q A;  1UG9 A;  2ZQ0 A;  3PGB A;  4NEI A;  2BRP A;  4RNL A;  3VD7 A;  1NS0 A;  3BS6 A;  4FNP A;  3MUZ 1;  3QG0 A;  3DX2 A;  2XHN A;  1NSR A;  2XN2 A;  1HM3 A;  3I3B A;  1N7O A;  5KBP A;  3X3Z A;  1NS4 A;  5JMF A;  4DUX A;  1HN1 A;  3EJR A;  4FNR A;  3X3X A;  1V7V A;  1UI8 A;  2WVX B;  2OQE A;  1HMU A;  3K5T A;  2YFN A;  1ULV A;  1QWU A;  2EAD A;  1RWA A;  2JKA A;  1N7P A;  3QFY A;  2Q1F A;  2Y73 A;  1W3Y A;  3RSY A;  1PS3 A;  1RW9 A;  2WVY A;  4K35 A;  2FUQ A;  3W7T A;  1W2Z A;  1UI7 A;  1W7C A;  3BVU A;  3T09 A;  1TQT A;  3WFA A;  3WIQ A;  4KFE A;  1R34 A;  4J5T A;  1LF6 A;  3T0D A;  1NSU A;  2CWT A;  1HMW A;  1HM2 A;  3VDA A;  1V7W A;  2F7P A;  3RRS A;  3W7W A;  2CFW A;  3QDE A;  1NS2 A;  3J7H A;  4DUV A;  1JZ2 A;  1NSV A;  2WW1 A;  1NSS A;  2WOH A;  2CG1 A;  2E2T A;  1LUR A;  3HI7 A;  4TTG A;  2YX9 A;  1QX1 A;  2ALW A;  4BZF A;  3DX1 A;  2ZXQ A;  2C10 A;  3QFZ A;  1SO0 A;  1J0N A;  1RWH A;  3AMO B;  1K1W A;  4FNV A;  3X42 A;  1Z45 A;  2HTA A;  2F7R A;  1LXK A;  3T08 A;  3E80 A;  2WYI A;  3AFL A;  1X1H A;  1D6Y A;  1JZ3 A;  3Q1N A;  1W4N A;  2CIR A;  3EJT A;  2F7O A;  2F18 A;  2BRW A;  1TXK A;  3HII A;  2Y74 A;  1HN0 A;  2PNC A;  3E7J A;  3OB8 A;  3S4B A;  1JOV A;  3K25 A;  1NS8 A;  3KN4 A;  3N9H A;  3DX0 A;  2FUT A;  1QAK A;  1OJM A;  4BTW A;  2EAE A;  3VD3 A;  2OW6 A;  1AVL A;  2WCO A;  4BZG A;  2CFL A;  4KFF A;  1NKG A;  1WMP A;  1MMZ A;  3MWX A;  1H54 A;  3I3D A;  4K3A A;  3BLB A;  2X03 A;  2JKE A;  2CQS A;  3D52 A;  3BVT A;  2OW7 A;  1JYW A;  4MMH A;  5JMD A;  1L7K A;  3MI6 A;  2OOV C; 
#chains in the Genus database with same CATH homology
 1SNZ A;  3T0D A;  1NSU A;  3DEC A;  4OK2 A;  2CIS A;  1HMW A;  2WVZ A;  4DUW A;  2CIQ A;  1HM2 A;  3I3E A;  3VDA A;  1OJN A;  2XSG A;  1RWG A;  3T2Q A;  3NJX A;  1MMU A;  4AQ0 A;  1NS2 A;  3J7H A;  4DUV A;  1J0M A;  1JZ2 A;  1NSV A;  2D73 A;  1EGU A;  2WW1 A;  1NSS A;  2JKP A;  1C82 A;  3VSN A;  1LXM A;  1X1J A;  1LUR A;  4TTG A;  3OBA A;  3ECQ A;  3VDC A;  4BZF A;  1X1I A;  1F1S A;  4OK4 A;  1RWC A;  2ZXQ A;  1F9G A;  3T0A A;  2WDA A;  1SO0 A;  1JYX A;  1NSX A;  1J0N A;  1RWH A;  1K1Y A;  3CZJ A;  1LOH A;  3T2O A;  2BRV X;  1NSZ A;  1YGA A;  1K1W A;  3IAQ A;  4FNV A;  5E1Q A;  1Z45 A;  2HTA A;  4MMI A;  1LXK A;  1RWF A;  3SEP A;  3E80 A;  1L7J A;  3AFL A;  1X1H A;  3T08 A;  1JZ3 A;  2E24 A;  3DYP A;  3Q1N A;  3VDB A;  3IAP A;  1CB8 A;  1JZ5 A;  1I8Q A;  2CIR A;  1UG9 A;  2ZQ0 A;  2WW2 A;  3T0B A;  4OJZ A;  1N7R A;  1JZ4 A;  4NEI A;  1JYN A;  2BRP A;  4RNL A;  3VD7 A;  1NS0 A;  3BS6 A;  1N7Q A;  1F4H A;  2BRW A;  3VD5 A;  5A1A A;  3A24 A;  1JZ6 A;  1PX4 A;  3MUZ 1;  1YQ2 A;  2WW3 A;  1JYV A;  1MN0 A;  1TXK A;  2XHN A;  3A0O A;  1NSR A;  1HM3 A;  1LF6 A;  1OJO A;  3I3B A;  3OS7 A;  3NRE A;  3MV0 1;  1N7O A;  1HN0 A;  1NS4 A;  2E22 A;  1OJP A;  3E7J A;  3WVF A;  4DUX A;  3OB8 A;  1HN1 A;  5JMF A;  4BZE A;  1JOV A;  1K1X A;  2WVX A;  3K25 A;  1NS8 A;  2WVX B;  3TY1 A;  3MUY 1;  1NSM A;  1LF9 A;  1HMU A;  2FUT A;  2WZS A;  1N7N A;  1ULV A;  1OJM A;  1RWA A;  2JKA A;  1N7P A;  3DYM A;  2Q1F A;  3VD3 A;  1MMX A;  1W3Y A;  2WCO A;  3VD9 A;  4BZG A;  1JZ8 A;  1RW9 A;  2WVY A;  3T2P A;  3VD4 A;  1NKG A;  1MMZ A;  3DCD A;  3MWX A;  3IMH A;  3VSM A;  4BZH A;  2FUQ A;  3BLC A;  1JZ7 A;  3I3D A;  3T09 A;  3NJV A;  3MV1 1;  1NS7 A;  1MMY A;  2X03 A;  3WFA A;  2JKE A;  1DP0 A;  2HTB A;  1JYW A;  1F4A A;  4MMH A;  5JMD A;  1L7K A;  2WW0 A;  3E1F 1;  3BGA A;  4J5T A;  3DYO A;  1PX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...