1NSXA

Crystal structure of galactose mutarotase from lactococcus lactis mutant h170n complexed with galactose
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
339
structure length
339
Chain Sequence
SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGNVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 102
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsxA00
2XHNA 3SEPA 3MWXA 2WVXB 2HTBA 3NJVA 1TXKA 1HM2A 3E1F1 4BZGA 1NS2A 3K25A 3VD7A 1JOVA 1LURA 2E22A 3IAPA 4TTGA 3MV11 3NJXA 3OBAA 4AQ0A 3T0BA 1OJOA 3T08A 1RWCA 1N7RA 1N7QA 2E24A 1NSXA 2XSGA 1CB8A 3ECQA 1RWHA 1LXKA 1N7OA 1RW9A 3DYPA 1JYWA 1DP0A 1OJMA 1J0MA 3VDAA 3VD9A 1NSRA 3Q1NA 1UG9A 2WDAA 2WW2A 2JKAA 3I3EA 4BZFA 1NSZA 3MUZ1 2WZSA 3BGAA 1JZ7A 2WW3A 1NSSA 3T2QA 1YQ2A 2BRVX 1OJPA 1X1HA 2WW0A 2D73A 1N7PA 1NS8A 3J7HA 3MUY1 3T2OA 1Z45A 3VDCA 1SO0A 1W3YA 1F4AA 1F1SA 3VD3A 2ZXQA 1K1XA 2WVXA 1JZ2A 3I3BA 2CISA 2WVYA 3NREA 3VD4A 1RWFA 1HMWA 4RNLA 3WFAA 1MN0A 2BRWA 2WCOA 2ZQ0A 1F4HA 3DCDA 3T0DA 1NS4A 1JZ3A 1OJNA 3DYMA 3OB8A 4DUWA 1NKGA 1L7JA 1NS0A 1JZ4A 1MMUA 1LF9A 1JZ8A 2Q1FA 1L7KA 1C82A 5A1AA 4BZHA 3OS7A 1JYNA 1LF6A 3DYOA 1K1YA 1LXMA 1EGUA 1X1IA 3I3DA 3MV01 4DUXA 1HMUA 1JYVA 1PX4A 3DECA 1MMYA 3IMHA 4DUVA 1MMZA 4BZEA 2CIRA 3T2PA 1HN0A 2WW1A 3VD5A 1J0NA 1F9GA 1PX3A 3CZJA 1JZ5A 1X1JA 1HN1A 3IAQA 1YGAA 1N7NA 2BRPA 2CIQA 1SNZA 1JZ6A 5E1QA 1HM3A 1I8QA 1NSMA 1K1WA 1MMXA 1RWGA 3VDBA 2HTAA 1NS7A 3A24A 2X03A 1NSUA 1JYXA 1NSVA 1RWAA 1ULVA 2JKEA 2JKPA 2WVZA 3T09A 1LOHA 3T0AA
chains in the Genus database with same CATH superfamily
2XHNA 3DX0A 2CWUA 3MWXA 2WVXB 5KBPA 3DX1A 2RDYA 1LURA 1QAKA 3EJSA 3QFYA 3QFZA 2XN2A 4TTGA 3CZSA 3NJXA 3WA2X 4KFEA 1TQSA 3BUDA 4AQ0A 3T08A 2XSGA 2EACA 2WOFA 1RWHA 3WIQA 3DYPA 1QWUA 1OJMA 3D52A 3BLCA 3W7SA 1NSZA 3MUZ1 1JZ7A 2WW0A 1W4NA 1TQWA 1NS8A 2C11A 3N9HA 1W3YA 2WVXA 3W7XA 2WVYA 3NREA 1AVLA 3SX1A 3VD4A 2BRWA 3ACSA 1NS4A 2F7RA 3WA3A 1L7JA 4KFFA 1MMUA 3BUBA 1JZ8A 4KTRA 2EABA 1L7KA 3EJQA 1C82A 4BZHA 3OS7A 1JYNA 1W2ZA 3BVUA 1X1IA 3I3DA 2FUTA 4DUXA 1HMUA 3BUQA 3ACTA 3X42A 3S4CA 3DDGA 3VD5A 4OK2A 3MI6A 1HXKA 2F7PA 5E1QA 1TQTA 1V7XA 2OQEA 4UFCA 2W0QA 3VSMA 2EAEA 2YFOA 1NSUA 4OK4A 3W7TA 2CFLA 3D4YA 3DX4A 1RWAA 2WVZA 3X3ZA 4FNVA 1W6GA 1D6UA 3SEPA 1TXKA 3D4ZA 3E1F1 3K25A 1O7DD 3VD7A 3EJTA 2OQEC 2E22A 2WYHA 3IAPA 1R34A 1PS3A 1RWCA 3A0OA 1W7CA 1NSXA 1H54A 1JYWA 1DP0A 3VD9A 1J0MA 1UG9A 2WDAA 2WW2A 2XN0A 3QDEA 3I3EA 2D1WA 2WZSA 3BGAA 2CWTA 3T2QA 1YQ2A 3PGBA 2D73A 4MMHA 3S4DA 1D6ZA 3T2OA 1Z45A 3LOYA 2WOHA 2OOVA 3MPHA 1D6YA 1V7VA 4BTWA 2ZXQA 2ALWA 3I3BA 2CISA 1RWFA 4RNLA 3WFAA 2WCOA 4BTYA 3T0DA 4DUWA 1NS0A 1JZ4A 3E80A 3HIGA 5JMDA 2OOVC 1OACA 2Y74A 3AFLA 1RJOA 1W5ZA 2CQTA 1LF6A 1K1YA 1EGUA 2XN1A 4FNPA 1JYVA 1PX4A 1MMZA 4BZEA 1V7WA 3T2PA 1HN0A 1IVVA 1F9GA 2Y73A 1HN1A 1TQUA 3X3YA 1WMOA 1NSMA 2HTAA 1NS7A 3DDFA 2FYVA 2YFNA 3WIRA 3BVXA 2JKPA 1UI7A 3D51A 2OW7A 1WMPA 3T0AA 1TU5A 1IVWA 3NJVA 2CG1A 1HM2A 1PU4A 1RKYA 2ZL8A 1NS2A 3BVWA 3MV11 3OBAA 1OJOA 3BLBA 2WGQA 3T0UA 1DYUA 2CFWA 3EJRA 1N7RA 2CFGA 1AVKA 1IVXA 3CZNA 1WMNA 1N7OA 4FNQA 3VDAA 3WVFA 1NSRA 3BUPA 1N9EA 2CQSA 2JKAA 5CA3A 4BZFA 5JMFA 4NEIA 2WW3A 1NSSA 2BRVX 2F7QA 2E2VA 4EV5A 1N7PA 3DX2A 4FNTA 1QAFA 3MUY1 1QALA 4K3AA 3W7WA 1SIIA 3VDCA 1SO0A 1HTYA 3DX3A 1AV4A 4K35A 1F1SA 1K1XA 3QG0A 3KIIA 3KN4A 1JZ2A 3NBBA 3SXXA 2F7OA 2WYIA 2ZQ0A 1F4HA 2BT3A 1NKGA 1UI8A 2F1AA 3BVVA 2WO0A 3HIIA 3HI7A 5A1AA 3BVTA 3DYOA 3W7UA 3S4AA 2CFDA 2OW6A 2PNCA 3DECA 1MMYA 3IMHA 3AMOB 3TY1A 1TQVA 3D3IA 2WW1A 2CG0A 1J0NA 4FNSA 1X1JA 3X3XA 3IAQA 1SPUA 1SNZA 1K1WA 1MMXA 3D50A 3VDBA 3CV5A 2X03A 2YX9A 3EJUA 1IU7A 1NSVA 3X41A 1ULVA 2JKEA 3BUIA 3T09A 1HWWA 1LOHA 2HTBA 1US1A 4MMIA 3NBJA 4BZGA 1W6CA 3AFJA 1JOVA 3VSNA 1QWNA 3T0BA 1N7QA 2E24A 3ECQA 1CB8A 3AMOA 4FNUA 1LXKA 1RW9A 3K5TA 1IQYA 4J5TA 3RRSA 4OJZA 3Q1NA 3EJPA 4FNRA 3S4BA 1OJPA 1X1HA 4KFDA 3J7HA 4BTXA 4KTPA 1JRQA 1IQXA 1F4AA 3VD3A 3RSYA 3BS6A 1HMWA 5GW7A 1MN0A 2EADA 2E2TA 3DCDA 3E7JA 1JZ3A 1OJNA 1R33A 3DYMA 3OB8A 2FUQA 1LF9A 3X40A 2Q1FA 3LVTA 4EV2A 1LVNA 1KSIA 1EKMA 1QX1A 1LXMA 3MV01 1IVUA 4DUVA 2CFKA 2F1BA 2CIRA 1PX3A 3ALAA 3CZJA 1JZ5A 1YGAA 1N7NA 2BRPA 2CIQA 1JZ6A 1SIHA 2CWVA 1HM3A 1I8QA 1RWGA 2F18A 2C10A 3A24A 1JYXA 2E2UA 1A2VA
chains in the Genus database with same CATH topology
2XHNA 3SEPA 3MWXA 2WVXB 2HTBA 3NJVA 1TXKA 1HM2A 4MMIA 3E1F1 4BZGA 1NS2A 3K25A 3VD7A 1JOVA 1LURA 2E22A 3IAPA 3VSNA 4TTGA 3MV11 3NJXA 3OBAA 4AQ0A 3T0BA 1OJOA 3T08A 1RWCA 1N7RA 3A0OA 1N7QA 2E24A 1NSXA 2XSGA 1CB8A 3ECQA 1RWHA 1LXKA 1N7OA 1RW9A 3DYPA 4J5TA 1JYWA 1DP0A 1OJMA 1J0MA 4OJZA 3VDAA 1NSRA 3WVFA 3VD9A 3Q1NA 1UG9A 2WDAA 2WW2A 3BLCA 2JKAA 3I3EA 4BZFA 5JMFA 1NSZA 3MUZ1 2WZSA 3BGAA 4NEIA 1JZ7A 2WW3A 1NSSA 3T2QA 1YQ2A 2BRVX 1OJPA 1X1HA 2WW0A 2D73A 4MMHA 1N7PA 1NS8A 3J7HA 3MUY1 3T2OA 1Z45A 3VDCA 1SO0A 1W3YA 1F4AA 1F1SA 3VD3A 2ZXQA 1K1XA 2WVXA 1JZ2A 3I3BA 2CISA 2WVYA 3NREA 3VD4A 1RWFA 1HMWA 3BS6A 4RNLA 1MN0A 2BRWA 2WCOA 3WFAA 2ZQ0A 1F4HA 3DCDA 3T0DA 3E7JA 1NS4A 1JZ3A 1OJNA 3DYMA 3OB8A 4DUWA 1NKGA 2FUQA 1L7JA 1NS0A 1JZ4A 3E80A 1MMUA 1LF9A 5JMDA 1JZ8A 2Q1FA 1L7KA 1C82A 3AFLA 4BZHA 5A1AA 3OS7A 1JYNA 1LF6A 3DYOA 1K1YA 1LXMA 1EGUA 1X1IA 3I3DA 3MV01 2FUTA 4DUXA 1HMUA 1JYVA 1PX4A 3DECA 1MMYA 3IMHA 4DUVA 1MMZA 3TY1A 4BZEA 2CIRA 3T2PA 1HN0A 2WW1A 3VD5A 1J0NA 1F9GA 1PX3A 3CZJA 4OK2A 1JZ5A 1X1JA 1HN1A 3IAQA 1YGAA 1N7NA 2BRPA 2CIQA 1SNZA 1JZ6A 5E1QA 1HM3A 1I8QA 1NSMA 1K1WA 1MMXA 1RWGA 3VDBA 2HTAA 3VSMA 1NS7A 3A24A 2X03A 1NSUA 4OK4A 1JYXA 1NSVA 1RWAA 1ULVA 2JKEA 2JKPA 2WVZA 3T09A 4FNVA 1LOHA 3T0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XHN A;  3SEP A;  3MWX A;  2WVX B;  2HTB A;  3NJV A;  1TXK A;  1HM2 A;  3E1F 1;  4BZG A;  1NS2 A;  3K25 A;  3VD7 A;  1JOV A;  1LUR A;  2E22 A;  3IAP A;  4TTG A;  3MV1 1;  3NJX A;  3OBA A;  4AQ0 A;  3T0B A;  1OJO A;  3T08 A;  1RWC A;  1N7R A;  1N7Q A;  2E24 A;  1NSX A;  2XSG A;  1CB8 A;  3ECQ A;  1RWH A;  1LXK A;  1N7O A;  1RW9 A;  3DYP A;  1JYW A;  1DP0 A;  1OJM A;  1J0M A;  3VDA A;  3VD9 A;  1NSR A;  3Q1N A;  1UG9 A;  2WDA A;  2WW2 A;  2JKA A;  3I3E A;  4BZF A;  1NSZ A;  3MUZ 1;  2WZS A;  3BGA A;  1JZ7 A;  2WW3 A;  1NSS A;  3T2Q A;  1YQ2 A;  2BRV X;  1OJP A;  1X1H A;  2WW0 A;  2D73 A;  1N7P A;  1NS8 A;  3J7H A;  3MUY 1;  3T2O A;  1Z45 A;  3VDC A;  1SO0 A;  1W3Y A;  1F4A A;  1F1S A;  3VD3 A;  2ZXQ A;  1K1X A;  2WVX A;  1JZ2 A;  3I3B A;  2CIS A;  2WVY A;  3NRE A;  3VD4 A;  1RWF A;  1HMW A;  4RNL A;  3WFA A;  1MN0 A;  2BRW A;  2WCO A;  2ZQ0 A;  1F4H A;  3DCD A;  3T0D A;  1NS4 A;  1JZ3 A;  1OJN A;  3DYM A;  3OB8 A;  4DUW A;  1NKG A;  1L7J A;  1NS0 A;  1JZ4 A;  1MMU A;  1LF9 A;  1JZ8 A;  2Q1F A;  1L7K A;  1C82 A;  5A1A A;  4BZH A;  3OS7 A;  1JYN A;  1LF6 A;  3DYO A;  1K1Y A;  1LXM A;  1EGU A;  1X1I A;  3I3D A;  3MV0 1;  4DUX A;  1HMU A;  1JYV A;  1PX4 A;  3DEC A;  1MMY A;  3IMH A;  4DUV A;  1MMZ A;  4BZE A;  2CIR A;  3T2P A;  1HN0 A;  2WW1 A;  3VD5 A;  1J0N A;  1F9G A;  1PX3 A;  3CZJ A;  1JZ5 A;  1X1J A;  1HN1 A;  3IAQ A;  1YGA A;  1N7N A;  2BRP A;  2CIQ A;  1SNZ A;  1JZ6 A;  5E1Q A;  1HM3 A;  1I8Q A;  1NSM A;  1K1W A;  1MMX A;  1RWG A;  3VDB A;  2HTA A;  1NS7 A;  3A24 A;  2X03 A;  1NSU A;  1JYX A;  1NSV A;  1RWA A;  1ULV A;  2JKE A;  2JKP A;  2WVZ A;  3T09 A;  1LOH A;  3T0A A; 
#chains in the Genus database with same CATH topology
 2XHN A;  3DX0 A;  2CWU A;  3MWX A;  2WVX B;  5KBP A;  3DX1 A;  2RDY A;  1LUR A;  1QAK A;  3EJS A;  3QFY A;  3QFZ A;  2XN2 A;  4TTG A;  3CZS A;  3NJX A;  3WA2 X;  4KFE A;  1TQS A;  3BUD A;  4AQ0 A;  3T08 A;  2XSG A;  2EAC A;  2WOF A;  1RWH A;  3WIQ A;  3DYP A;  1QWU A;  1OJM A;  3D52 A;  3BLC A;  3W7S A;  1NSZ A;  3MUZ 1;  1JZ7 A;  2WW0 A;  1W4N A;  1TQW A;  1NS8 A;  2C11 A;  3N9H A;  1W3Y A;  2WVX A;  3W7X A;  2WVY A;  3NRE A;  1AVL A;  3SX1 A;  3VD4 A;  2BRW A;  3ACS A;  1NS4 A;  2F7R A;  3WA3 A;  1L7J A;  4KFF A;  1MMU A;  3BUB A;  1JZ8 A;  4KTR A;  2EAB A;  1L7K A;  3EJQ A;  1C82 A;  4BZH A;  3OS7 A;  1JYN A;  1W2Z A;  3BVU A;  1X1I A;  3I3D A;  2FUT A;  4DUX A;  1HMU A;  3BUQ A;  3ACT A;  3X42 A;  3S4C A;  3DDG A;  3VD5 A;  4OK2 A;  3MI6 A;  1HXK A;  2F7P A;  5E1Q A;  1TQT A;  1V7X A;  2OQE A;  4UFC A;  2W0Q A;  3VSM A;  2EAE A;  2YFO A;  1NSU A;  4OK4 A;  3W7T A;  2CFL A;  3D4Y A;  3DX4 A;  1RWA A;  2WVZ A;  3X3Z A;  4FNV A;  1W6G A;  1D6U A;  3SEP A;  1TXK A;  3D4Z A;  3E1F 1;  3K25 A;  1O7D D;  3VD7 A;  3EJT A;  2OQE C;  2E22 A;  2WYH A;  3IAP A;  1R34 A;  1PS3 A;  1RWC A;  3A0O A;  1W7C A;  1NSX A;  1H54 A;  1JYW A;  1DP0 A;  3VD9 A;  1J0M A;  1UG9 A;  2WDA A;  2WW2 A;  2XN0 A;  3QDE A;  3I3E A;  2D1W A;  2WZS A;  3BGA A;  2CWT A;  3T2Q A;  1YQ2 A;  3PGB A;  2D73 A;  4MMH A;  3S4D A;  1D6Z A;  3T2O A;  1Z45 A;  3LOY A;  2WOH A;  2OOV A;  3MPH A;  1D6Y A;  1V7V A;  4BTW A;  2ZXQ A;  2ALW A;  3I3B A;  2CIS A;  1RWF A;  4RNL A;  3WFA A;  2WCO A;  4BTY A;  3T0D A;  4DUW A;  1NS0 A;  1JZ4 A;  3E80 A;  3HIG A;  5JMD A;  2OOV C;  1OAC A;  2Y74 A;  3AFL A;  1RJO A;  1W5Z A;  2CQT A;  1LF6 A;  1K1Y A;  1EGU A;  2XN1 A;  4FNP A;  1JYV A;  1PX4 A;  1MMZ A;  4BZE A;  1V7W A;  3T2P A;  1HN0 A;  1IVV A;  1F9G A;  2Y73 A;  1HN1 A;  1TQU A;  3X3Y A;  1WMO A;  1NSM A;  2HTA A;  1NS7 A;  3DDF A;  2FYV A;  2YFN A;  3WIR A;  3BVX A;  2JKP A;  1UI7 A;  3D51 A;  2OW7 A;  1WMP A;  3T0A A;  1TU5 A;  1IVW A;  3NJV A;  2CG1 A;  1HM2 A;  1PU4 A;  1RKY A;  2ZL8 A;  1NS2 A;  3BVW A;  3MV1 1;  3OBA A;  1OJO A;  3BLB A;  2WGQ A;  3T0U A;  1DYU A;  2CFW A;  3EJR A;  1N7R A;  2CFG A;  1AVK A;  1IVX A;  3CZN A;  1WMN A;  1N7O A;  4FNQ A;  3VDA A;  3WVF A;  1NSR A;  3BUP A;  1N9E A;  2CQS A;  2JKA A;  5CA3 A;  4BZF A;  5JMF A;  4NEI A;  2WW3 A;  1NSS A;  2BRV X;  2F7Q A;  2E2V A;  4EV5 A;  1N7P A;  3DX2 A;  4FNT A;  1QAF A;  3MUY 1;  1QAL A;  4K3A A;  3W7W A;  1SII A;  3VDC A;  1SO0 A;  1HTY A;  3DX3 A;  1AV4 A;  4K35 A;  1F1S A;  1K1X A;  3QG0 A;  3KII A;  3KN4 A;  1JZ2 A;  3NBB A;  3SXX A;  2F7O A;  2WYI A;  2ZQ0 A;  1F4H A;  2BT3 A;  1NKG A;  1UI8 A;  2F1A A;  3BVV A;  2WO0 A;  3HII A;  3HI7 A;  5A1A A;  3BVT A;  3DYO A;  3W7U A;  3S4A A;  2CFD A;  2OW6 A;  2PNC A;  3DEC A;  1MMY A;  3IMH A;  3AMO B;  3TY1 A;  1TQV A;  3D3I A;  2WW1 A;  2CG0 A;  1J0N A;  4FNS A;  1X1J A;  3X3X A;  3IAQ A;  1SPU A;  1SNZ A;  1K1W A;  1MMX A;  3D50 A;  3VDB A;  3CV5 A;  2X03 A;  2YX9 A;  3EJU A;  1IU7 A;  1NSV A;  3X41 A;  1ULV A;  2JKE A;  3BUI A;  3T09 A;  1HWW A;  1LOH A;  2HTB A;  1US1 A;  4MMI A;  3NBJ A;  4BZG A;  1W6C A;  3AFJ A;  1JOV A;  3VSN A;  1QWN A;  3T0B A;  1N7Q A;  2E24 A;  3ECQ A;  1CB8 A;  3AMO A;  4FNU A;  1LXK A;  1RW9 A;  3K5T A;  1IQY A;  4J5T A;  3RRS A;  4OJZ A;  3Q1N A;  3EJP A;  4FNR A;  3S4B A;  1OJP A;  1X1H A;  4KFD A;  3J7H A;  4BTX A;  4KTP A;  1JRQ A;  1IQX A;  1F4A A;  3VD3 A;  3RSY A;  3BS6 A;  1HMW A;  5GW7 A;  1MN0 A;  2EAD A;  2E2T A;  3DCD A;  3E7J A;  1JZ3 A;  1OJN A;  1R33 A;  3DYM A;  3OB8 A;  2FUQ A;  1LF9 A;  3X40 A;  2Q1F A;  3LVT A;  4EV2 A;  1LVN A;  1KSI A;  1EKM A;  1QX1 A;  1LXM A;  3MV0 1;  1IVU A;  4DUV A;  2CFK A;  2F1B A;  2CIR A;  1PX3 A;  3ALA A;  3CZJ A;  1JZ5 A;  1YGA A;  1N7N A;  2BRP A;  2CIQ A;  1JZ6 A;  1SIH A;  2CWV A;  1HM3 A;  1I8Q A;  1RWG A;  2F18 A;  2C10 A;  3A24 A;  1JYX A;  2E2U A;  1A2V A; 
#chains in the Genus database with same CATH homology
 2XHN A;  3SEP A;  3MWX A;  2WVX B;  2HTB A;  3NJV A;  1TXK A;  1HM2 A;  4MMI A;  3E1F 1;  4BZG A;  1NS2 A;  3K25 A;  3VD7 A;  1JOV A;  1LUR A;  2E22 A;  3IAP A;  3VSN A;  4TTG A;  3MV1 1;  3NJX A;  3OBA A;  4AQ0 A;  3T0B A;  1OJO A;  3T08 A;  1RWC A;  1N7R A;  3A0O A;  1N7Q A;  2E24 A;  1NSX A;  2XSG A;  1CB8 A;  3ECQ A;  1RWH A;  1LXK A;  1N7O A;  1RW9 A;  3DYP A;  4J5T A;  1JYW A;  1DP0 A;  1OJM A;  1J0M A;  4OJZ A;  3VDA A;  1NSR A;  3WVF A;  3VD9 A;  3Q1N A;  1UG9 A;  2WDA A;  2WW2 A;  3BLC A;  2JKA A;  3I3E A;  4BZF A;  5JMF A;  1NSZ A;  3MUZ 1;  2WZS A;  3BGA A;  4NEI A;  1JZ7 A;  2WW3 A;  1NSS A;  3T2Q A;  1YQ2 A;  2BRV X;  1OJP A;  1X1H A;  2WW0 A;  2D73 A;  4MMH A;  1N7P A;  1NS8 A;  3J7H A;  3MUY 1;  3T2O A;  1Z45 A;  3VDC A;  1SO0 A;  1W3Y A;  1F4A A;  1F1S A;  3VD3 A;  2ZXQ A;  1K1X A;  2WVX A;  1JZ2 A;  3I3B A;  2CIS A;  2WVY A;  3NRE A;  3VD4 A;  1RWF A;  1HMW A;  3BS6 A;  4RNL A;  1MN0 A;  2BRW A;  2WCO A;  3WFA A;  2ZQ0 A;  1F4H A;  3DCD A;  3T0D A;  3E7J A;  1NS4 A;  1JZ3 A;  1OJN A;  3DYM A;  3OB8 A;  4DUW A;  1NKG A;  2FUQ A;  1L7J A;  1NS0 A;  1JZ4 A;  3E80 A;  1MMU A;  1LF9 A;  5JMD A;  1JZ8 A;  2Q1F A;  1L7K A;  1C82 A;  3AFL A;  4BZH A;  5A1A A;  3OS7 A;  1JYN A;  1LF6 A;  3DYO A;  1K1Y A;  1LXM A;  1EGU A;  1X1I A;  3I3D A;  3MV0 1;  2FUT A;  4DUX A;  1HMU A;  1JYV A;  1PX4 A;  3DEC A;  1MMY A;  3IMH A;  4DUV A;  1MMZ A;  3TY1 A;  4BZE A;  2CIR A;  3T2P A;  1HN0 A;  2WW1 A;  3VD5 A;  1J0N A;  1F9G A;  1PX3 A;  3CZJ A;  4OK2 A;  1JZ5 A;  1X1J A;  1HN1 A;  3IAQ A;  1YGA A;  1N7N A;  2BRP A;  2CIQ A;  1SNZ A;  1JZ6 A;  5E1Q A;  1HM3 A;  1I8Q A;  1NSM A;  1K1W A;  1MMX A;  1RWG A;  3VDB A;  2HTA A;  3VSM A;  1NS7 A;  3A24 A;  2X03 A;  1NSU A;  4OK4 A;  1JYX A;  1NSV A;  1RWA A;  1ULV A;  2JKE A;  2JKP A;  2WVZ A;  3T09 A;  4FNV A;  1LOH A;  3T0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...