1NSXA

Crystal structure of galactose mutarotase from lactococcus lactis mutant h170n complexed with galactose
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
339
structure length
339
Chain Sequence
b'SIKIRDFGLGSDLISLTNKAGVTISFTNLGARIVDWQKDGKHLILGFDSAKEYLEKDAYPGATVGPTAGRIKDGLVKISGKDYILNQNEGPQTLHGGEESIHTKLWTYEVTDLGAEVQVKFSLVSNDGTNGYPGKIEMSVTHSFDDDNKWKIHYEAISDKDTVFNPTGNVYFNLNGDASESVENHGLRLAASRFVPLKDQTEIVRGDIVDIKNTDLDFRQEKQLSNAFNSNMEQVQLVKGIDHPFLLDQLGLDKEQARLTLDDTSISVFTDQPSIVIFTANFGDLGTLYHEKKQVHHGGITFECQVSPGSEQIPELGDISLKAGEKYQATTIYSLHTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALACTOSE MUTAROTASE
publication title The Catalytic Mechanism of Galactose Mutarotase
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Isomerase
total genus 102
structure length 339
sequence length 339
chains with identical sequence B
ec nomenclature ec 5.1.3.3: Aldose 1-epimerase.
pdb deposition date 2003-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01263 Aldose_epim Aldose 1-epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1nsxA00
1NSVA 2BRVX 3I3BA 1NS7A 1ULVA 1NS2A 1JZ3A 2WW0A 1X1IA 3T08A 1DP0A 3VD3A 3VDAA 1MMUA 3Q1NA 5A1AA 1LXKA 1J0NA 3IAQA 2WW3A 4BZEA 2Q1FA 1JZ2A 4RNLA 1K1XA 2JKAA 3I3EA 1F4AA 2JKEA 1Z45A 1LF9A 1JZ8A 1NKGA 3DECA 1RWCA 1EGUA 3OS7A 5E1QA 1NSZA 1YGAA 3MV01 3DYOA 3T2OA 3OB8A 3VDCA 3NJXA 3T2QA 3J7HA 3K25A 3A24A 3T0DA 1NSMA 1OJPA 3E1F1 1LXMA 3T0AA 3VD4A 2E24A 1JZ4A 3MWXA 3I3DA 4DUWA 2WCOA 3IAPA 1N7NA 1HN1A 2WVXB 3MV11 3NREA 1JYNA 1HMUA 1HM2A 1NSSA 2ZQ0A 4TTGA 1HM3A 1YQ2A 1F9GA 1JZ5A 1JYXA 1L7KA 1CB8A 3VD5A 1X1JA 1MN0A 1SO0A 1OJNA 3VD7A 2JKPA 3MUY1 2XHNA 4BZFA 2HTAA 1MMXA 3IMHA 4AQ0A 1OJOA 3CZJA 1UG9A 1K1YA 2BRPA 1RWAA 2WVYA 3T2PA 3NJVA 1I8QA 2WVZA 3DYMA 1N7RA 1N7PA 1PX3A 1F1SA 1RWHA 2CIQA 2CIRA 4BZGA 1N7OA 1RWGA 2HTBA 1RW9A 1C82A 1JZ6A 3ECQA 1MMYA 2X03A 4DUVA 3DCDA 1MMZA 1NS0A 1PX4A 1NSUA 1F4HA 2CISA 3BGAA 1NS4A 1JYVA 2WDAA 1LF6A 1L7JA 3VD9A 1NSXA 1JZ7A 1JOVA 3DYPA 1TXKA 3T09A 4BZHA 3OBAA 1J0MA 4DUXA 3MUZ1 1LURA 2XSGA 1OJMA 3T0BA 1HMWA 2BRWA 3VDBA 1LOHA 2E22A 1RWFA 2WW2A 1HN0A 1N7QA 2ZXQA 3SEPA 1NSRA 2WVXA 1SNZA 2WW1A 1JYWA 1K1WA 2D73A 2WZSA 1W3YA 1NS8A 1X1HA 3WFAA
chains in the Genus database with same CATH superfamily
1QAFA 3K5TA 3QG0A 3RRSA 1OACA 2C11A 3VD3A 1J0NA 3LOYA 2RDYA 1F4AA 3MI6A 1D6YA 3DECA 3KIIA 3DDGA 3OB8A 1W6CA 1V7VA 3K25A 3T0DA 3E1F1 1LXMA 1SIIA 2E24A 1JZ4A 2WCOA 3EJSA 1JYXA 3VD5A 2F7PA 4FNTA 3VD7A 3MUY1 3BS6A 2HTAA 2CFWA 4AQ0A 3D51A 4BTWA 2CFLA 3AMOB 2WVYA 3NJVA 4FNUA 1RWHA 3ACSA 2XN1A 4MMHA 3EJPA 4MMIA 3ECQA 4DUVA 1NSUA 1TQWA 3BUQA 2F1AA 3EJRA 2OQEA 1LF6A 2WGQA 3W7WA 3DX2A 3OBAA 2E2UA 4EV5A 2ZL8A 3NBBA 4K35A 1LVNA 1LOHA 3DX0A 4FNQA 1RWFA 2WW2A 1N7QA 2ZXQA 3SEPA 1NSRA 1SNZA 3D4YA 1UI8A 3T0UA 3BVVA 4OJZA 1QX1A 3S4CA 2BRVX 1ULVA 3W7UA 3BVXA 3VDAA 1MMUA 3Q1NA 5CA3A 5A1AA 1LXKA 2ALWA 2Q1FA 1JZ2A 1JZ8A 1Z45A 1NKGA 3WIRA 5E1QA 3D52A 2WO0A 1YGAA 3MV01 3DYOA 3VSMA 1NSMA 1O7DD 1OJPA 3ACTA 3DDFA 3T0AA 3DX4A 1IVVA 2F7OA 3I3DA 3IAPA 1N7NA 2OOVA 3QFYA 1JYNA 1NSSA 3X3YA 3EJQA 2ZQ0A 4TTGA 1YQ2A 1F9GA 1IVXA 2WOFA 3BVWA 1MN0A 1OJNA 2WYHA 2XHNA 1QWUA 3HIGA 4BZFA 3IMHA 1OJOA 3CZJA 1UG9A 2BRPA 1RWAA 1TQSA 1TQUA 1SIHA 2CG0A 2WVZA 1N7PA 3WIQA 4BZGA 1N7OA 1RWGA 1W5ZA 3X3ZA 1RW9A 2YX9A 1PU4A 4KFFA 1NS0A 1PS3A 3RSYA 3BGAA 1NS4A 3QDEA 3T09A 1TXKA 3MPHA 4NEIA 2CFDA 3S4BA 1W6GA 3TY1A 2FYVA 1HMWA 4OK2A 2BRWA 3VDBA 2E2TA 3W7SA 1HN0A 1WMNA 3X41A 2F1BA 3CZNA 2D73A 1W3YA 3BUIA 1TQVA 1IVUA 2Y74A 1NSVA 3I3BA 3LVTA 1NS2A 1QALA 3HI7A 2WW0A 3T08A 1DP0A 4BZEA 3NBJA 2W0QA 2JKAA 1AV4A 2JKEA 1LF9A 3WA2X 3OS7A 3BLBA 4FNVA 1NSZA 3VDCA 3NJXA 4KFEA 3T2QA 3J7HA 3BLCA 3WVFA 1IQYA 3VD4A 3CZSA 3S4AA 3SXXA 4DUWA 4KFDA 1HN1A 3MV11 2FUTA 2XN0A 1HM2A 3BUPA 1HM3A 1V7WA 1L7KA 1CB8A 3AFLA 1X1JA 1SO0A 3CV5A 4FNRA 3X40A 2YFNA 1MMXA 4BTYA 3N9HA 3DX3A 3D50A 1WMPA 1D6ZA 3E7JA 4FNPA 1N7RA 2CQSA 1WMOA 2CIRA 2OOVC 3S4DA 3AFJA 2CWTA 5GW7A 1W7CA 1RKYA 1A2VA 1JZ6A 2X03A 1MMYA 4KTRA 1MMZA 3PGBA 2F18A 1IU7A 1PX4A 1TQTA 1EKMA 2CQTA 4UFCA 3EJTA 1UI7A 1JYVA 2WDAA 3VD9A 1JZ7A 1JOVA 1DYUA 4BZHA 3W7XA 2CFKA 2CG1A 2XSGA 1AVLA 1LURA 1KSIA 3T0BA 1QWNA 3DX1A 2E22A 3BVTA 1HXKA 2PNCA 1K1WA 1NS8A 4KTPA 4FNSA 3WFAA 2C10A 3BUDA 3X42A 3HIIA 1NS7A 1JZ3A 3VSNA 5JMDA 1X1IA 1IQXA 1TU5A 3IAQA 2WW3A 2EAEA 4RNLA 1K1XA 3I3EA 2FUQA 4J5TA 4EV2A 1RWCA 1EGUA 3D4ZA 3T2OA 5KBPA 3A24A 2OW6A 4K3AA 3W7TA 1D6UA 1HTYA 5JMFA 2OQEC 2CFGA 3MWXA 3ALAA 2WVXB 2D1WA 3D3IA 3NREA 2F7QA 3SX1A 1HMUA 1N9EA 1H54A 1R34A 1JZ5A 3BVUA 2F7RA 2JKPA 4OK4A 2YFOA 2Y73A 3QFZA 2OW7A 3A0OA 1K1YA 1HWWA 3X3XA 3T2PA 1I8QA 3DYMA 1PX3A 1F1SA 1SPUA 2CIQA 1R33A 1US1A 2EADA 2WOHA 2HTBA 1C82A 3KN4A 1AVKA 3DCDA 1F4HA 2CISA 2XN2A 2BT3A 1QAKA 3BUBA 1V7XA 1L7JA 2EACA 1NSXA 3DYPA 2CWUA 1J0MA 4DUXA 3EJUA 3MUZ1 1OJMA 1JRQA 4BTXA 3AMOA 1IVWA 1W2ZA 1W4NA 2E2VA 3WA3A 2WVXA 2WW1A 1JYWA 2EABA 2WYIA 2WZSA 1X1HA 3E80A 2CWVA 1RJOA
chains in the Genus database with same CATH topology
4OJZA 1NSVA 2BRVX 3I3BA 1NS7A 1ULVA 1NS2A 1JZ3A 3VSNA 5JMDA 2WW0A 1X1IA 3T08A 1DP0A 3VD3A 3VDAA 1MMUA 3Q1NA 5A1AA 1LXKA 1J0NA 3IAQA 2WW3A 4BZEA 2Q1FA 1JZ2A 4RNLA 1K1XA 2JKAA 3I3EA 1F4AA 2FUQA 1Z45A 1LF9A 2JKEA 1NKGA 4J5TA 3DECA 1JZ8A 1RWCA 1EGUA 3OS7A 5E1QA 4FNVA 1NSZA 1YGAA 3MV01 3DYOA 3T2OA 3VSMA 3OB8A 3VDCA 3NJXA 3T2QA 3J7HA 3BLCA 3A24A 3K25A 3T0DA 1NSMA 1OJPA 3E1F1 1LXMA 3T0AA 3WVFA 3VD4A 2E24A 5JMFA 1JZ4A 3MWXA 3I3DA 4DUWA 2WCOA 3IAPA 1N7NA 1HN1A 2WVXB 3MV11 2FUTA 3NREA 1JYNA 1HMUA 1HM2A 1NSSA 2ZQ0A 4TTGA 1HM3A 1YQ2A 1F9GA 1JZ5A 1JYXA 1L7KA 1CB8A 3VD5A 3AFLA 1X1JA 1MN0A 1SO0A 1OJNA 3VD7A 2JKPA 4OK4A 3MUY1 2XHNA 3BS6A 4BZFA 2HTAA 1MMXA 3A0OA 3IMHA 4AQ0A 1OJOA 3CZJA 1UG9A 1K1YA 2BRPA 1RWAA 2WVYA 3T2PA 3E7JA 3NJVA 1I8QA 2WVZA 3DYMA 1N7RA 1N7PA 1PX3A 1F1SA 1RWHA 2CIQA 2CIRA 4BZGA 4MMHA 1N7OA 1RWGA 2HTBA 4MMIA 1RW9A 1C82A 1JZ6A 3ECQA 1MMYA 2X03A 4DUVA 3DCDA 1MMZA 1NS0A 1PX4A 1NSUA 1F4HA 2CISA 3BGAA 1NS4A 1JYVA 2WDAA 1LF6A 1L7JA 3VD9A 1NSXA 1JZ7A 1JOVA 3DYPA 1TXKA 4NEIA 3T09A 4BZHA 3OBAA 1J0MA 4DUXA 3MUZ1 1LURA 2XSGA 1OJMA 3T0BA 1HMWA 4OK2A 2BRWA 3TY1A 3VDBA 1LOHA 2E22A 1RWFA 2WW2A 1HN0A 1N7QA 2ZXQA 3SEPA 1NSRA 2WVXA 1SNZA 2WW1A 1JYWA 1K1WA 2D73A 2WZSA 1W3YA 1NS8A 1X1HA 3E80A 3WFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSV A;  2BRV X;  3I3B A;  1NS7 A;  1ULV A;  1NS2 A;  1JZ3 A;  2WW0 A;  1X1I A;  3T08 A;  1DP0 A;  3VD3 A;  3VDA A;  1MMU A;  3Q1N A;  5A1A A;  1LXK A;  1J0N A;  3IAQ A;  2WW3 A;  4BZE A;  2Q1F A;  1JZ2 A;  4RNL A;  1K1X A;  2JKA A;  3I3E A;  1F4A A;  2JKE A;  1Z45 A;  1LF9 A;  1JZ8 A;  1NKG A;  3DEC A;  1RWC A;  1EGU A;  3OS7 A;  5E1Q A;  1NSZ A;  1YGA A;  3MV0 1;  3DYO A;  3T2O A;  3OB8 A;  3VDC A;  3NJX A;  3T2Q A;  3J7H A;  3K25 A;  3A24 A;  3T0D A;  1NSM A;  1OJP A;  3E1F 1;  1LXM A;  3T0A A;  3VD4 A;  2E24 A;  1JZ4 A;  3MWX A;  3I3D A;  4DUW A;  2WCO A;  3IAP A;  1N7N A;  1HN1 A;  2WVX B;  3MV1 1;  3NRE A;  1JYN A;  1HMU A;  1HM2 A;  1NSS A;  2ZQ0 A;  4TTG A;  1HM3 A;  1YQ2 A;  1F9G A;  1JZ5 A;  1JYX A;  1L7K A;  1CB8 A;  3VD5 A;  1X1J A;  1MN0 A;  1SO0 A;  1OJN A;  3VD7 A;  2JKP A;  3MUY 1;  2XHN A;  4BZF A;  2HTA A;  1MMX A;  3IMH A;  4AQ0 A;  1OJO A;  3CZJ A;  1UG9 A;  1K1Y A;  2BRP A;  1RWA A;  2WVY A;  3T2P A;  3NJV A;  1I8Q A;  2WVZ A;  3DYM A;  1N7R A;  1N7P A;  1PX3 A;  1F1S A;  1RWH A;  2CIQ A;  2CIR A;  4BZG A;  1N7O A;  1RWG A;  2HTB A;  1RW9 A;  1C82 A;  1JZ6 A;  3ECQ A;  1MMY A;  2X03 A;  4DUV A;  3DCD A;  1MMZ A;  1NS0 A;  1PX4 A;  1NSU A;  1F4H A;  2CIS A;  3BGA A;  1NS4 A;  1JYV A;  2WDA A;  1LF6 A;  1L7J A;  3VD9 A;  1NSX A;  1JZ7 A;  1JOV A;  3DYP A;  1TXK A;  3T09 A;  4BZH A;  3OBA A;  1J0M A;  4DUX A;  3MUZ 1;  1LUR A;  2XSG A;  1OJM A;  3T0B A;  1HMW A;  2BRW A;  3VDB A;  1LOH A;  2E22 A;  1RWF A;  2WW2 A;  1HN0 A;  1N7Q A;  2ZXQ A;  3SEP A;  1NSR A;  2WVX A;  1SNZ A;  2WW1 A;  1JYW A;  1K1W A;  2D73 A;  2WZS A;  1W3Y A;  1NS8 A;  1X1H A;  3WFA A; 
#chains in the Genus database with same CATH topology
 1QAF A;  3K5T A;  3QG0 A;  3RRS A;  1OAC A;  2C11 A;  3VD3 A;  1J0N A;  3LOY A;  2RDY A;  1F4A A;  3MI6 A;  1D6Y A;  3DEC A;  3KII A;  3DDG A;  3OB8 A;  1W6C A;  1V7V A;  3K25 A;  3T0D A;  3E1F 1;  1LXM A;  1SII A;  2E24 A;  1JZ4 A;  2WCO A;  3EJS A;  1JYX A;  3VD5 A;  2F7P A;  4FNT A;  3VD7 A;  3MUY 1;  3BS6 A;  2HTA A;  2CFW A;  4AQ0 A;  3D51 A;  4BTW A;  2CFL A;  3AMO B;  2WVY A;  3NJV A;  4FNU A;  1RWH A;  3ACS A;  2XN1 A;  4MMH A;  3EJP A;  4MMI A;  3ECQ A;  4DUV A;  1NSU A;  1TQW A;  3BUQ A;  2F1A A;  3EJR A;  2OQE A;  1LF6 A;  2WGQ A;  3W7W A;  3DX2 A;  3OBA A;  2E2U A;  4EV5 A;  2ZL8 A;  3NBB A;  4K35 A;  1LVN A;  1LOH A;  3DX0 A;  4FNQ A;  1RWF A;  2WW2 A;  1N7Q A;  2ZXQ A;  3SEP A;  1NSR A;  1SNZ A;  3D4Y A;  1UI8 A;  3T0U A;  3BVV A;  4OJZ A;  1QX1 A;  3S4C A;  2BRV X;  1ULV A;  3W7U A;  3BVX A;  3VDA A;  1MMU A;  3Q1N A;  5CA3 A;  5A1A A;  1LXK A;  2ALW A;  2Q1F A;  1JZ2 A;  1JZ8 A;  1Z45 A;  1NKG A;  3WIR A;  5E1Q A;  3D52 A;  2WO0 A;  1YGA A;  3MV0 1;  3DYO A;  3VSM A;  1NSM A;  1O7D D;  1OJP A;  3ACT A;  3DDF A;  3T0A A;  3DX4 A;  1IVV A;  2F7O A;  3I3D A;  3IAP A;  1N7N A;  2OOV A;  3QFY A;  1JYN A;  1NSS A;  3X3Y A;  3EJQ A;  2ZQ0 A;  4TTG A;  1YQ2 A;  1F9G A;  1IVX A;  2WOF A;  3BVW A;  1MN0 A;  1OJN A;  2WYH A;  2XHN A;  1QWU A;  3HIG A;  4BZF A;  3IMH A;  1OJO A;  3CZJ A;  1UG9 A;  2BRP A;  1RWA A;  1TQS A;  1TQU A;  1SIH A;  2CG0 A;  2WVZ A;  1N7P A;  3WIQ A;  4BZG A;  1N7O A;  1RWG A;  1W5Z A;  3X3Z A;  1RW9 A;  2YX9 A;  1PU4 A;  4KFF A;  1NS0 A;  1PS3 A;  3RSY A;  3BGA A;  1NS4 A;  3QDE A;  3T09 A;  1TXK A;  3MPH A;  4NEI A;  2CFD A;  3S4B A;  1W6G A;  3TY1 A;  2FYV A;  1HMW A;  4OK2 A;  2BRW A;  3VDB A;  2E2T A;  3W7S A;  1HN0 A;  1WMN A;  3X41 A;  2F1B A;  3CZN A;  2D73 A;  1W3Y A;  3BUI A;  1TQV A;  1IVU A;  2Y74 A;  1NSV A;  3I3B A;  3LVT A;  1NS2 A;  1QAL A;  3HI7 A;  2WW0 A;  3T08 A;  1DP0 A;  4BZE A;  3NBJ A;  2W0Q A;  2JKA A;  1AV4 A;  2JKE A;  1LF9 A;  3WA2 X;  3OS7 A;  3BLB A;  4FNV A;  1NSZ A;  3VDC A;  3NJX A;  4KFE A;  3T2Q A;  3J7H A;  3BLC A;  3WVF A;  1IQY A;  3VD4 A;  3CZS A;  3S4A A;  3SXX A;  4DUW A;  4KFD A;  1HN1 A;  3MV1 1;  2FUT A;  2XN0 A;  1HM2 A;  3BUP A;  1HM3 A;  1V7W A;  1L7K A;  1CB8 A;  3AFL A;  1X1J A;  1SO0 A;  3CV5 A;  4FNR A;  3X40 A;  2YFN A;  1MMX A;  4BTY A;  3N9H A;  3DX3 A;  3D50 A;  1WMP A;  1D6Z A;  3E7J A;  4FNP A;  1N7R A;  2CQS A;  1WMO A;  2CIR A;  2OOV C;  3S4D A;  3AFJ A;  2CWT A;  5GW7 A;  1W7C A;  1RKY A;  1A2V A;  1JZ6 A;  2X03 A;  1MMY A;  4KTR A;  1MMZ A;  3PGB A;  2F18 A;  1IU7 A;  1PX4 A;  1TQT A;  1EKM A;  2CQT A;  4UFC A;  3EJT A;  1UI7 A;  1JYV A;  2WDA A;  3VD9 A;  1JZ7 A;  1JOV A;  1DYU A;  4BZH A;  3W7X A;  2CFK A;  2CG1 A;  2XSG A;  1AVL A;  1LUR A;  1KSI A;  3T0B A;  1QWN A;  3DX1 A;  2E22 A;  3BVT A;  1HXK A;  2PNC A;  1K1W A;  1NS8 A;  4KTP A;  4FNS A;  3WFA A;  2C10 A;  3BUD A;  3X42 A;  3HII A;  1NS7 A;  1JZ3 A;  3VSN A;  5JMD A;  1X1I A;  1IQX A;  1TU5 A;  3IAQ A;  2WW3 A;  2EAE A;  4RNL A;  1K1X A;  3I3E A;  2FUQ A;  4J5T A;  4EV2 A;  1RWC A;  1EGU A;  3D4Z A;  3T2O A;  5KBP A;  3A24 A;  2OW6 A;  4K3A A;  3W7T A;  1D6U A;  1HTY A;  5JMF A;  2OQE C;  2CFG A;  3MWX A;  3ALA A;  2WVX B;  2D1W A;  3D3I A;  3NRE A;  2F7Q A;  3SX1 A;  1HMU A;  1N9E A;  1H54 A;  1R34 A;  1JZ5 A;  3BVU A;  2F7R A;  2JKP A;  4OK4 A;  2YFO A;  2Y73 A;  3QFZ A;  2OW7 A;  3A0O A;  1K1Y A;  1HWW A;  3X3X A;  3T2P A;  1I8Q A;  3DYM A;  1PX3 A;  1F1S A;  1SPU A;  2CIQ A;  1R33 A;  1US1 A;  2EAD A;  2WOH A;  2HTB A;  1C82 A;  3KN4 A;  1AVK A;  3DCD A;  1F4H A;  2CIS A;  2XN2 A;  2BT3 A;  1QAK A;  3BUB A;  1V7X A;  1L7J A;  2EAC A;  1NSX A;  3DYP A;  2CWU A;  1J0M A;  4DUX A;  3EJU A;  3MUZ 1;  1OJM A;  1JRQ A;  4BTX A;  3AMO A;  1IVW A;  1W2Z A;  1W4N A;  2E2V A;  3WA3 A;  2WVX A;  2WW1 A;  1JYW A;  2EAB A;  2WYI A;  2WZS A;  1X1H A;  3E80 A;  2CWV A;  1RJO A; 
#chains in the Genus database with same CATH homology
 4OJZ A;  1NSV A;  2BRV X;  3I3B A;  1NS7 A;  1ULV A;  1NS2 A;  1JZ3 A;  3VSN A;  5JMD A;  2WW0 A;  1X1I A;  3T08 A;  1DP0 A;  3VD3 A;  3VDA A;  1MMU A;  3Q1N A;  5A1A A;  1LXK A;  1J0N A;  3IAQ A;  2WW3 A;  4BZE A;  2Q1F A;  1JZ2 A;  4RNL A;  1K1X A;  2JKA A;  3I3E A;  1F4A A;  2FUQ A;  1Z45 A;  1LF9 A;  2JKE A;  1NKG A;  4J5T A;  3DEC A;  1JZ8 A;  1RWC A;  1EGU A;  3OS7 A;  5E1Q A;  4FNV A;  1NSZ A;  1YGA A;  3MV0 1;  3DYO A;  3T2O A;  3VSM A;  3OB8 A;  3VDC A;  3NJX A;  3T2Q A;  3J7H A;  3BLC A;  3A24 A;  3K25 A;  3T0D A;  1NSM A;  1OJP A;  3E1F 1;  1LXM A;  3T0A A;  3WVF A;  3VD4 A;  2E24 A;  5JMF A;  1JZ4 A;  3MWX A;  3I3D A;  4DUW A;  2WCO A;  3IAP A;  1N7N A;  1HN1 A;  2WVX B;  3MV1 1;  2FUT A;  3NRE A;  1JYN A;  1HMU A;  1HM2 A;  1NSS A;  2ZQ0 A;  4TTG A;  1HM3 A;  1YQ2 A;  1F9G A;  1JZ5 A;  1JYX A;  1L7K A;  1CB8 A;  3VD5 A;  3AFL A;  1X1J A;  1MN0 A;  1SO0 A;  1OJN A;  3VD7 A;  2JKP A;  4OK4 A;  3MUY 1;  2XHN A;  3BS6 A;  4BZF A;  2HTA A;  1MMX A;  3A0O A;  3IMH A;  4AQ0 A;  1OJO A;  3CZJ A;  1UG9 A;  1K1Y A;  2BRP A;  1RWA A;  2WVY A;  3T2P A;  3E7J A;  3NJV A;  1I8Q A;  2WVZ A;  3DYM A;  1N7R A;  1N7P A;  1PX3 A;  1F1S A;  1RWH A;  2CIQ A;  2CIR A;  4BZG A;  4MMH A;  1N7O A;  1RWG A;  2HTB A;  4MMI A;  1RW9 A;  1C82 A;  1JZ6 A;  3ECQ A;  1MMY A;  2X03 A;  4DUV A;  3DCD A;  1MMZ A;  1NS0 A;  1PX4 A;  1NSU A;  1F4H A;  2CIS A;  3BGA A;  1NS4 A;  1JYV A;  2WDA A;  1LF6 A;  1L7J A;  3VD9 A;  1NSX A;  1JZ7 A;  1JOV A;  3DYP A;  1TXK A;  4NEI A;  3T09 A;  4BZH A;  3OBA A;  1J0M A;  4DUX A;  3MUZ 1;  1LUR A;  2XSG A;  1OJM A;  3T0B A;  1HMW A;  4OK2 A;  2BRW A;  3TY1 A;  3VDB A;  1LOH A;  2E22 A;  1RWF A;  2WW2 A;  1HN0 A;  1N7Q A;  2ZXQ A;  3SEP A;  1NSR A;  2WVX A;  1SNZ A;  2WW1 A;  1JYW A;  1K1W A;  2D73 A;  2WZS A;  1W3Y A;  1NS8 A;  1X1H A;  3E80 A;  3WFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...