1NTKJ

Crystal structure of mitochondrial cytochrome bc1 in complex with antimycin a1
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
60
structure length
60
Chain Sequence
APTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 17
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1ntkJ00
3CWBJ 3L71J 1BCCJ 1KB9I 3L72J 3TGUJ 1KYOI 2IBZI 4D6TJ 3L70J 2FYUJ 3H1JJ 1P84I 3BCCJ 1BE3J 3L74J 3H1IJ 1NTKJ 3L73J 1SQPJ 1BGYJ 1SQXJ 1EZVI 1NU1J 3L75J 1NTMJ 1SQVJ 3H1KJ 1NTZJ 1SQQJ 3H1HJ 3CX5I 3CXHI 1SQBJ 3H1LJ 2BCCJ 4U3FJ 1L0NJ 1PP9J 1L0LJ 5KLVJ 4PD4I
chains in the Genus database with same CATH superfamily
1HUCA 4RJTA 4K35A 3CCRP 1BCCD 3L71E 3V2RA 5TISH 2WPVB 2Z5IA 5APYA 2DW3A 3H6PA 3Q3DA 2W6JH 3EFGA 1KILC 4OGQD 1FU1A 3B5NA 3H1KE 2N1TB 1LWUC 2W6BA 1N2DC 5BU8B 1SFCB 3CWBE 3FXEA 1SP4A 3HUSB 4EOTA 1EZVI 3V6IA 2O01J 2W90A 1NTMD 3O6QB 1NKZB 2E75B 2FBWC 3L74G 4W7ZA 4R4MA 4H13D 2OTLP 3PRJA 1VQOP 1PGPA 2IBZE 1OWAA 1PZQA 1L0LE 2N1TD 2B88A 1SFCD 3SFEC 2Y9ZA 3P32A 3RGUA 1Z56A 3U1AA 2RMZA 5KTBA 3VOPA 5BVZA 2KZJA 3SSUA 2C0XA 3OJAB 1K05A 3A0HH 4UB8H 3UIAA 1KFMA 1Q90D 2A06G 1HJ0A 3VMXA 2FXOA 1K73Q 1FZCA 2QJPB 3CXHI 3I55P 5APWA 1BGYG 2N1TA 2ITAA 2D2CC 5AVSB 2Q9IA 1R5LA 1SFCA 2Y9YA 2QE7H 3S9OA 3S4RA 2B87A 4ZMDA 1RF0A 3HUSA 1IK9A 1RQVA 2R44A 1DD4A 5APXA 1VL2A 1SQXK 1W2EA 2W27A 1URQB 1ZOYC 3BATA 3VP9A 1R8EA 4IFDK 2RN0A 1ZXGA 4Y99C 5AVUB 1IK7A 1YQ3C 3L4FA 1YIJP 1PL5A 2NPSC 3GF7A 3H32A 3RK2B 1MKMA 2YO3A 3O8ZA 4LC1A 1GMJA 1VQNP 1NTZK 1KQFB 1ZRTD 3PHLA 1YHQP 1URQD 4WVZA 1A02J 3B71A 1LNQA 3PP5A 3QH9A 1NU1G 2BCCE 1KB9I 2Q7CA 2Z5HA 1G1IA 3RK2D 3P8MC 1DH3A 1FDMA 1S9KD 3PTZA 3WMM0 2RH0A 3H1LJ 3HE5B 1RF1A 3L75G 4WY4C 3WUVA 1NTZG 1RQUA 4U3FE 2IZ1A 1AFOA 3N4XA 4NPEA 1GD2E 1URQA 2AEMA 3AE2C 1JY3O 4H0LB 2AXTH 3L74J 1X8YA 5KJ7C 5CBOA 3V2NA 3A0HE 1UIIA 4UB8E 1GDTA 1JEKA 3RL0B 1U57A 3L71D 4GKGA 2R5BA 1NTMK 4I1LA 1VQ5P 1BCCG 1NTKD 2R5DA 2XNXA 1EDJA 1FZFA 4H0LD 3H1KD 3H1HJ 3AE9C 1SQXE 1OZHA 3AE4C 1KV4A 3G6EP 3ITKA 3CWBD 3RL0D 1LTIC 3SWKA 2K9JA 5APSA 3SWFA 4UB6H 2E74D 3BCCE 5CCHD 4AYCA 1WRGA 3HD7B 4GIFA 3CI9A 3V4WA 1LTJA 4W7YA 1USDA 1Y8AA 3A2AA 2IBZD 1L0LD 3HE5A 3MUDA 1NTMG 4XA4A 1BDDA 1HH0A 3AE8C 1GTWA 5AVTB 4DT0A 2WWWA 1N7SC 2OYHB 4JQ0D 1NAFA 2ZT9C 2B89A 1J1DB 1ZMEC 1FE6A 1SQQJ 1PPJE 3KYQA 1JOCA 2KS1B 5KLIC 5CCHA 3H1JE 1JTHB 2Q6QA 4DZOA 3AEDC 1OMIA 2YKOA 3BRVB 1OXZA 1Q81Q 1JNMA 4EDFA 1VF5C 1HGZA 4ASVA 1SQBG 2IDBA 1S1CX 1LT9C 2V7QJ 3G9RA 3L70E 2XDJA 4GT1A 1EXJA 1NU1J 3FWNA 1BDCA 1Q82Q 4YPCA 1Y9BA 2NRGA 5B66H 3CCVP 3GMAA 2AXTE 3WUTA 1KYOI 3L72E 2JO1A 4D6TE 2WSFH 3M0DC 3MHVA 1YITP 1JM0A 1AVOA 4BRYA 1SQVE 2PFXA 1BSHA 1QVFO 1T2KC 4PV1C 1X0TA 3PLNA 1NYHA 1VQ9P 2P67A 1GL2C 1GU5A 3Q5RA 1JTHA 1J1EC 1KC8Q 3FGAD 1L4AB 2Z4EA 2WQYC 1WMKA 2BCCD 1QVGO 2JR8A 2WSCJ 2A45H 1BCCJ 1HF9A 3TNUA 4OGQC 1NGMB 5AVRB 2E76D 2KUBA 2OYIA 3HTKA 3L36A 5AVVB 5M1BA 3I5CA 3CCQP 1AVYA 3M9QA 4WBAA 4U3FD 2QJKB 1NTKK 1P84D 1UIXA 3MGNA 1LJ2A 2IPPA 4PD4H 1M1JB 4JYBA 2N1TC 4GDOA 1SFCC 1PP9J 1PGOA 1QL1A 1EDLA 2XU6A 1XTGB 1NVOA 1PV3A 2QJYB 1YTZI 3HUSC 2O01N 1HBWA 3L71G 1L0LK 3NXSA 1VQLP 2E75C 3B5NB 2IX7C 2YXRB 2GUVA 3JSVC 3H1KG 2G3AA 3KDPB 3TGUJ 4RO0A 4ZKPA 2L91A 5B66E 1KILE 2Y0DA 3CWBG 1OIPA 1JUNA 1KTMA 1EDIA 1SQBJ 1YQ4C 1LGHB 4DJGA 2KYVA 3RK3E 2M5AA 1KZUB 2IBZG 1L0LG 3CD6P 3IF4A 2QJPC 3M9BA 1YTZT 1IFPA 1M1JA 3OA7A 1PPJD 3H1IE 5KKZB 3G71P 2E5YA 2GA1A 2FFDA 5AW9B 3P8CE 2ZAEB 3AE5C 3H1JD 3JC22 1FZBA 3ABVC 2KXPB 1FZCB 4H13B 1NTKE 2KNCA 5AW7B 1RHZB 3VN0A 1URQC 1IFNA 1M57D 1H0TA 1RH5B 3L70D 2B87B 1QL2A 3WU2H 3AEFC 2WPQA 2KLVA 1HWTC 3RK2C 1S5LH 2K1AA 4PD4E 3W68A 1ZN5A 1RE4A 3IFMA 1YYCA 3L72D 4K3AA 2WPSA 4EIJA 4D6TD 4XFJA 2MKVA 4AUWA 2XKMA 1AQ5A 1IFMA 2K3RA 1SQVD 3BASA 1P84H 1GU4A 3H32B 5APTA 1L0ND 5AW0B 3KZIE 2WVRA 4I7ZC 4L75A 4OH8B 5C39A 1KYOH 3A0BH 1VQKP 3QWOC 5GTHH 2FYZA 4NPFX 1N86A 4BWNA 2BCCG 2P2UA 4H0LC 2KSEA 1Q7YQ 3AEAC 3R4YA 2K88A 2YO2A 1KMIZ 1IO4A 3K5BA 3RL0C 1RF1B 1NO4A 3WUUA 4C46A 4GOFA 1KQGB 3H1LE 2HODA 2V7QH 5CCHC 2WSEH 5DJUB 1MFTA 2RKLA 2YMKA 2WSSH 2FYUD 2JDIH 2HR3A 2XZRA 3EFFK 3CX5I 3CCJP 1FZAA 1EC5A 1ZLLA 5KAFH 3V5BA 1VQPP 5APQA 2YXQB 4H44D 4PJ0H 3HD7C 3GW6A 3OW2O 5K5GB 3RK3B 1RY3A 1AQTA 2POHA 3VYIA 3MD0A 3H1HE 1SQXG 4W80A 3WU2E 3OAKA 1KILD 2KZIA 2K9JB 2OYHC 1S5LE 1OVUA 1Q2NA 1R5SA 4I7ZB 2QA4P 3GF3A 3CXHD 1J1DC 1D7MA 3M91A 1LTJB 3LW5H 3BCCG 2P1JA 5AVXB 1NKNA 3RK3D 4IL6E 2GUSA 2YKQA 3GHGB 3SWYA 2HG5D 2IBZI 1CW5A 1P84E 3II6A 1KQLA 1USEA 3H1ID 4LLHA 1DEEG 4N6JA 1WT6A 1SQQE 2R3CA 1KILA 1SLQA 3P8CD 1PPJG 1KYOE 3A0BE 4L74A 1LWUA 2IFNA 5GTHE 1VQ4P 2PAJA 2E74B 5KLVK 3GLMA 2HYNA 3H1JG 1XTCC 2IZ0A 2NZ2A 3T97B 2H8PD 1SQVK 3D70A 1AV1A 1SS1A 3GG2A 2JP3A 3Q5SA 1L0NK 1BGYJ 3L70G 3VMAA 4LGDE 4PD4D 1HGVA 3D6YA 2I1KA 3GHGA 3G3ZA 5KAFE 1DX7A 2PGDA 5CJ4A 2O3JA 3L72G 1QX8A 2E43A 1LT1A 1L4AC 4D6TG 2L5GB 4BRYB 3L73E 1FJPA 4PJ0E 2M3BA 1JB0J 1SQPK 1SQVG 1KORA 3CCEP 2Q1KA 3U59A 2OGUA 1IFDA 1IC2A 2IFMA 1ZR2A 1BE3E 2OTJP 1JCCA 2QJKC 2FYUK 3Q2YA 2H88C 2ZJSE 5L8RJ 3TNUB 2FKWB 3T97A 2OYIB 1M1JC 3VP8A 3PJSK 5AW3B 3HTKB 3V4QA 1SQXJ 1M56D 3N7NA 3B8EB 3TK1A 3H1LD 1FJKA 2QJYC 4HYTB 1NHLA 2NPSA 2KLUA 2Y0CA 3CXHH 5KLVE 1OW7A 3BCCJ 1HVVA 4EI2A 2O01H 3B5NC 2KOGA 4DOJA 3L75J 4CPGA 1N73B 2CPSA 5CCGD 1NTZJ 1K9MQ 3CC2P 2YMYA 1KD1Q 4O9BA 5KJ7D 2E76B 3F89A 1PP9E 1VQ6P 1L0NE 2KP8A 2GM4A 1YI2P 2FY8A 2VRSA 1MUUA 3L35A 1FC2C 2FYNB 1JCDA 2O1KA 1DD3A 3AECC 3H1HD 1BSNA 1K04A 1PFIA 2A06D 2ZXXA 1N7LA 2KK7A 3TGUE 2M3EA 5CCGA 5KKZC 1T3UA 3B4SA 3MIWA 1SQPE 1T6AA 1ZP0C 5KJ7A 1OFCX 1U7JA 1FOSF 2M5AB 1LTGC 1QGKB 1U7MA 2ZYDA 2ZVNB 1FZCC 2JWAA 3C9IA 1EZVE 1KB9H 4H13C 2FYUE 2J58A 2O1JA 2YIUB 2W6AA 1NTMJ 2JJLA 1LTTC 2IYOA 1N73A 1SQQD 1ZV8A 2FXMA 4TT3H 1KYOD 2FFDB 3H1IG 3BVHA 5CBNA 2ZT9D 4C7NA 3L72J 1IJDB 1VQ8P 1S5LX 4U7JA 4D6TJ 1RF0C 1FS0E 5APVA 3KZIH 1AA0A 1EDKA 4M3LA 1EXIA 4I2LC 2KNCB 2A45G 1LP1B 2IYPA 3CC4P 3C1LA 1NTKG 3IAOA 5AW5B 1H0TB 1NJIQ 2WITA 4WWIA 5AW8B 2KB7P 1NU1D 1VF5D 3LIDA 3TSIA 3CXHE 1X22A 3NMDA 4IFFA 1YJ9P 3I56P 2AEJA 3CC7P 3S1KA 3D71A 3MZWB 1JY2N 1JO5A 3L73D 2Q3IA 3KPEA 2Y0EA 2LKMA 4QMAA 2LXCB 4L73A 1IZNB 3CMEP 1T2KD 1BE3D 3KXDA 3ZDMA 1RF1C 1NOHA 1SVFA 1LP1A 1N8RQ 2XNDH 1GL2D 1E5WA 2W8ZA 1T8ZA 1FAVA 1FDOA 2QSIA 2ZVOB 4ZKUA 3USSA 3H25A 4N3YB 3M0DA 5KAIH 1JY3P 3IN6A 1KB9E 2HODB 3AE1C 5KLVD 1PGJA 1VDFA 5APUA 3H1LG 1MV8A 3FXDA 3CCSP 4NPDA 3RK3C 4IL6H 1K8AQ 3AEGC 1EQ7A 3P7KA 2WT7A 2WSFJ 1GL2A 4KHXA 1QLED 1PP9D 3SFDC 1OX3A 4IFMA 2R32A 3C8VA 2AXCA 2SPZA 1S4XA 1CI6A 1A02F 2H7HA 3RBXA 3H1IJ 1LTJC 3CLQA 2N9YB 3MUDC 5AW4B 3E1RA 3GHGC 3BRTB 2E75D 4C7RA 3L71J 2C0WA 3E1IA 3TF5A 3TGUD 3H1HG 4YTPC 1Y47A 1SQQK 2BEZF 2Q3EA 2AEFA 1CZQA 1NTKJ 1SQPD 3H1KJ 3VTPC 3PH0A 5CHXA 1SQBD 4H44B 3U1CA 2E42A 3CWBJ 2E74C 2WMMA 2M8RA 2QM8A 5AW1B 1OW6A 4AQRD 4U3FG 1EZVD 3MTUE 2P7JA 2JWDA 1YJWP 2H89C 1KN7A 3L74E 4HKZH 2K37A 3O6QA 1KILB 1L0LJ 1NU1K 1LWUB 1SQQG 4HH2A 2QEXP 1HTLC 2CPBA 2N9BA 1GK6A 1M90Q 1Q86Q 2FXPA 2R3SA 1M8OB 5GTIH 5TJHA 2YKPA 3V2QA 2A45I 5TISE 3V2PA 1NH4A 4XE5B 5B5EH 3RBZA 3M9HA 1FBMA 2WPRA 2ZFCA 5KAIE 2A06E 1GK4A 3AEEC 2WSCH 1KQSO 1BGYE 4KT0J 1RE3A 4PD4I 2PRRA 4B86A 2G8YA 2QIWA 5DJTB 2JKVA 2XV5A 1H88A 1X79B 3NTNA 3Q1MA 3E7KA 1IFIA 2PP6A 3HE4B 2Q5UA 4IOIH 4GODA 2WTYA 4EYYQ 3L73G 3AE6C 2OYIC 5CCGC 2CK3H 2P58A 2D2CB 2C9NY 3RL0g 4JF7A 2MJZA 3CX5D 5AW6B 1AJYA 2YNYA 3AEBC 1LTAC 1BE3G 1KFNA 4MN4C 3VMZA 3A5TA 4JYCA 1JMMA 2W83C 4GOEA 1W5CE 1JY3N 5H2FH 3CCUP 1OVVA 1FZGA 4Z1MH 4RKUJ 1N73C 4Y99B 5CMZA 2D2CD 1QEXA 1VPCA 3AE7C 1S72P 1KB9D 1NU1E 2BCCJ 2E76C 5EFWB 3CMAP 2NPSB 1M7LA 2KSJA 4R4LA 1W2BO 1GW4A 4L76A 5KLVG 2FYNC 5AVWB 2WZ7A 1MFZA 3HE4A 3L75E 3KHUA 3R2PA 1NTZE 4U3FJ 5GTIE 3EQ2A 1E79H 4YXWH 4RESB 2OARA 3CPWO 1PP9G 2NPSD 1JY2P 1L0NG 1SQBK 5B5EE 2HPCB 3IR9A 3F5HA 1NWQA 3G4SP 2QG4A 5AW2B 3CCMP 3M06A 4HB1A 1PIXA 3HD7D 4Y28J 1GZLA 4N78E 3JCUH 4OVNF 1M1KQ 4WY4B 2J59M 1BCCE 2OYOA 3NFQA 2YIUC 2BEQD 2OTKE 3TGUG 2QRXA 2FFDC 3L37A 1VQ7P 5AVQB 1SQPG 1DEBA 3AE3C 1TU3F 1P84I 2WSEJ 1VQMP 5CJ0A 4WY4D 1X9VA 1JMBA 3L74D 3CCLP 4JBZA 1YJNP 1EZVG 2FYUG 3HD7A 1NTME 1HJBA 4C7NB 4KJMA 1L2PA 2KI7B 3A7OA 1S2EA 3CL3D 3L73J 5H2FE 1OW8A 2OYHA 2HPCA 1DIPA 4DCKA 5E79H 1H89A 1LTBC 1RE4C 4ZNCA 1T3JA 1PGQA 1IFJA 2OQQA 1G2CB 3VMYA 3CX5H 3HRNA 1G1JA 3H1JJ 4WY4A 2KS1A 1BE3J 1ZW0A 1BGYD 2J5UA 1N7SB 2ZT9B 2LXBA 3EWKA 4BXLA 2UWJE 4UB6E 4JPZB 3LW5J 1SQBE 1CSBA 3KQGA 3L70J 3A3YB 4YXDC 2KIKA 5KLIB 3MP7B 2ZYAA 1LTSC 1N7SD 5KLVJ 4HJGH 2I8DA 3TDKA 1L4AD 1FDIA 1FOSE 3D6ZA 3TYYA 1OVRA 2K9YA 2V4HA 1VF5B 2ZYGA 3JCUE 2HLOA 1LT9B 1GW3A 1MZ9A 1SQVJ 4I6MC 2BASA 4IL6X 1FZEA 1L0NJ 3M0AA 1G2CA 2B9BA 4OWFA 1YBKA 2P10A 1ZRTE 1ZR4A 5BU5A 2HFED 3LIEA 1SQXD 4A7PA 1JY2O 1N7SA 1L4AA 2LR2A 2ZXEB 2I1JA 4PV1B 1H8AA 3BCCD 2JEEA 1SQPJ 2WT7B 3L75D 1GL2B 1NAYA 1S9KE 1NTZD 2H43A 3Q5PA 4TLFA 3B5ND 3FX0A 1J1EB 1J2JB 4ASWA 2E5TA 5E79E 1S3JA 2C9LY 2FYUJ 1CI6B 2QVAA 4OGQB 4WB4A 5AVZB 5AVYB 4PV1D 1RE3C 3FWLA 4H44C 3CX5E 1LT9A 3W67A 2M0BA 4N78D 2QM7A
chains in the Genus database with same CATH topology
3CWBJ 3L71J 1BCCJ 1KB9I 3L72J 3TGUJ 1KYOI 2IBZI 4D6TJ 3L70J 2FYUJ 3H1JJ 1P84I 3BCCJ 1BE3J 3L74J 3H1IJ 1NTKJ 3L73J 1SQPJ 1BGYJ 1SQXJ 1EZVI 1NU1J 3L75J 1NTMJ 1SQVJ 3H1KJ 1NTZJ 1SQQJ 3H1HJ 3CX5I 3CXHI 1SQBJ 3H1LJ 2BCCJ 4U3FJ 1L0NJ 1PP9J 1L0LJ 5KLVJ 4PD4I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWB J;  3L71 J;  1BCC J;  1KB9 I;  3L72 J;  3TGU J;  1KYO I;  2IBZ I;  4D6T J;  3L70 J;  2FYU J;  3H1J J;  1P84 I;  3BCC J;  1BE3 J;  3L74 J;  3H1I J;  1NTK J;  3L73 J;  1SQP J;  1BGY J;  1SQX J;  1EZV I;  1NU1 J;  3L75 J;  1NTM J;  1SQV J;  3H1K J;  1NTZ J;  1SQQ J;  3H1H J;  3CX5 I;  3CXH I;  1SQB J;  3H1L J;  2BCC J;  4U3F J;  1L0N J;  1PP9 J;  1L0L J;  5KLV J;  4PD4 I; 
#chains in the Genus database with same CATH topology
 1HUC A;  4RJT A;  4K35 A;  3CCR P;  1BCC D;  3L71 E;  3V2R A;  5TIS H;  2WPV B;  2Z5I A;  5APY A;  2DW3 A;  3H6P A;  3Q3D A;  2W6J H;  3EFG A;  1KIL C;  4OGQ D;  1FU1 A;  3B5N A;  3H1K E;  2N1T B;  1LWU C;  2W6B A;  1N2D C;  5BU8 B;  1SFC B;  3CWB E;  3FXE A;  1SP4 A;  3HUS B;  4EOT A;  1EZV I;  3V6I A;  2O01 J;  2W90 A;  1NTM D;  3O6Q B;  1NKZ B;  2E75 B;  2FBW C;  3L74 G;  4W7Z A;  4R4M A;  4H13 D;  2OTL P;  3PRJ A;  1VQO P;  1PGP A;  2IBZ E;  1OWA A;  1PZQ A;  1L0L E;  2N1T D;  2B88 A;  1SFC D;  3SFE C;  2Y9Z A;  3P32 A;  3RGU A;  1Z56 A;  3U1A A;  2RMZ A;  5KTB A;  3VOP A;  5BVZ A;  2KZJ A;  3SSU A;  2C0X A;  3OJA B;  1K05 A;  3A0H H;  4UB8 H;  3UIA A;  1KFM A;  1Q90 D;  2A06 G;  1HJ0 A;  3VMX A;  2FXO A;  1K73 Q;  1FZC A;  2QJP B;  3CXH I;  3I55 P;  5APW A;  1BGY G;  2N1T A;  2ITA A;  2D2C C;  5AVS B;  2Q9I A;  1R5L A;  1SFC A;  2Y9Y A;  2QE7 H;  3S9O A;  3S4R A;  2B87 A;  4ZMD A;  1RF0 A;  3HUS A;  1IK9 A;  1RQV A;  2R44 A;  1DD4 A;  5APX A;  1VL2 A;  1SQX K;  1W2E A;  2W27 A;  1URQ B;  1ZOY C;  3BAT A;  3VP9 A;  1R8E A;  4IFD K;  2RN0 A;  1ZXG A;  4Y99 C;  5AVU B;  1IK7 A;  1YQ3 C;  3L4F A;  1YIJ P;  1PL5 A;  2NPS C;  3GF7 A;  3H32 A;  3RK2 B;  1MKM A;  2YO3 A;  3O8Z A;  4LC1 A;  1GMJ A;  1VQN P;  1NTZ K;  1KQF B;  1ZRT D;  3PHL A;  1YHQ P;  1URQ D;  4WVZ A;  1A02 J;  3B71 A;  1LNQ A;  3PP5 A;  3QH9 A;  1NU1 G;  2BCC E;  1KB9 I;  2Q7C A;  2Z5H A;  1G1I A;  3RK2 D;  3P8M C;  1DH3 A;  1FDM A;  1S9K D;  3PTZ A;  3WMM 0;  2RH0 A;  3H1L J;  3HE5 B;  1RF1 A;  3L75 G;  4WY4 C;  3WUV A;  1NTZ G;  1RQU A;  4U3F E;  2IZ1 A;  1AFO A;  3N4X A;  4NPE A;  1GD2 E;  1URQ A;  2AEM A;  3AE2 C;  1JY3 O;  4H0L B;  2AXT H;  3L74 J;  1X8Y A;  5KJ7 C;  5CBO A;  3V2N A;  3A0H E;  1UII A;  4UB8 E;  1GDT A;  1JEK A;  3RL0 B;  1U57 A;  3L71 D;  4GKG A;  2R5B A;  1NTM K;  4I1L A;  1VQ5 P;  1BCC G;  1NTK D;  2R5D A;  2XNX A;  1EDJ A;  1FZF A;  4H0L D;  3H1K D;  3H1H J;  3AE9 C;  1SQX E;  1OZH A;  3AE4 C;  1KV4 A;  3G6E P;  3ITK A;  3CWB D;  3RL0 D;  1LTI C;  3SWK A;  2K9J A;  5APS A;  3SWF A;  4UB6 H;  2E74 D;  3BCC E;  5CCH D;  4AYC A;  1WRG A;  3HD7 B;  4GIF A;  3CI9 A;  3V4W A;  1LTJ A;  4W7Y A;  1USD A;  1Y8A A;  3A2A A;  2IBZ D;  1L0L D;  3HE5 A;  3MUD A;  1NTM G;  4XA4 A;  1BDD A;  1HH0 A;  3AE8 C;  1GTW A;  5AVT B;  4DT0 A;  2WWW A;  1N7S C;  2OYH B;  4JQ0 D;  1NAF A;  2ZT9 C;  2B89 A;  1J1D B;  1ZME C;  1FE6 A;  1SQQ J;  1PPJ E;  3KYQ A;  1JOC A;  2KS1 B;  5KLI C;  5CCH A;  3H1J E;  1JTH B;  2Q6Q A;  4DZO A;  3AED C;  1OMI A;  2YKO A;  3BRV B;  1OXZ A;  1Q81 Q;  1JNM A;  4EDF A;  1VF5 C;  1HGZ A;  4ASV A;  1SQB G;  2IDB A;  1S1C X;  1LT9 C;  2V7Q J;  3G9R A;  3L70 E;  2XDJ A;  4GT1 A;  1EXJ A;  1NU1 J;  3FWN A;  1BDC A;  1Q82 Q;  4YPC A;  1Y9B A;  2NRG A;  5B66 H;  3CCV P;  3GMA A;  2AXT E;  3WUT A;  1KYO I;  3L72 E;  2JO1 A;  4D6T E;  2WSF H;  3M0D C;  3MHV A;  1YIT P;  1JM0 A;  1AVO A;  4BRY A;  1SQV E;  2PFX A;  1BSH A;  1QVF O;  1T2K C;  4PV1 C;  1X0T A;  3PLN A;  1NYH A;  1VQ9 P;  2P67 A;  1GL2 C;  1GU5 A;  3Q5R A;  1JTH A;  1J1E C;  1KC8 Q;  3FGA D;  1L4A B;  2Z4E A;  2WQY C;  1WMK A;  2BCC D;  1QVG O;  2JR8 A;  2WSC J;  2A45 H;  1BCC J;  1HF9 A;  3TNU A;  4OGQ C;  1NGM B;  5AVR B;  2E76 D;  2KUB A;  2OYI A;  3HTK A;  3L36 A;  5AVV B;  5M1B A;  3I5C A;  3CCQ P;  1AVY A;  3M9Q A;  4WBA A;  4U3F D;  2QJK B;  1NTK K;  1P84 D;  1UIX A;  3MGN A;  1LJ2 A;  2IPP A;  4PD4 H;  1M1J B;  4JYB A;  2N1T C;  4GDO A;  1SFC C;  1PP9 J;  1PGO A;  1QL1 A;  1EDL A;  2XU6 A;  1XTG B;  1NVO A;  1PV3 A;  2QJY B;  1YTZ I;  3HUS C;  2O01 N;  1HBW A;  3L71 G;  1L0L K;  3NXS A;  1VQL P;  2E75 C;  3B5N B;  2IX7 C;  2YXR B;  2GUV A;  3JSV C;  3H1K G;  2G3A A;  3KDP B;  3TGU J;  4RO0 A;  4ZKP A;  2L91 A;  5B66 E;  1KIL E;  2Y0D A;  3CWB G;  1OIP A;  1JUN A;  1KTM A;  1EDI A;  1SQB J;  1YQ4 C;  1LGH B;  4DJG A;  2KYV A;  3RK3 E;  2M5A A;  1KZU B;  2IBZ G;  1L0L G;  3CD6 P;  3IF4 A;  2QJP C;  3M9B A;  1YTZ T;  1IFP A;  1M1J A;  3OA7 A;  1PPJ D;  3H1I E;  5KKZ B;  3G71 P;  2E5Y A;  2GA1 A;  2FFD A;  5AW9 B;  3P8C E;  2ZAE B;  3AE5 C;  3H1J D;  3JC2 2;  1FZB A;  3ABV C;  2KXP B;  1FZC B;  4H13 B;  1NTK E;  2KNC A;  5AW7 B;  1RHZ B;  3VN0 A;  1URQ C;  1IFN A;  1M57 D;  1H0T A;  1RH5 B;  3L70 D;  2B87 B;  1QL2 A;  3WU2 H;  3AEF C;  2WPQ A;  2KLV A;  1HWT C;  3RK2 C;  1S5L H;  2K1A A;  4PD4 E;  3W68 A;  1ZN5 A;  1RE4 A;  3IFM A;  1YYC A;  3L72 D;  4K3A A;  2WPS A;  4EIJ A;  4D6T D;  4XFJ A;  2MKV A;  4AUW A;  2XKM A;  1AQ5 A;  1IFM A;  2K3R A;  1SQV D;  3BAS A;  1P84 H;  1GU4 A;  3H32 B;  5APT A;  1L0N D;  5AW0 B;  3KZI E;  2WVR A;  4I7Z C;  4L75 A;  4OH8 B;  5C39 A;  1KYO H;  3A0B H;  1VQK P;  3QWO C;  5GTH H;  2FYZ A;  4NPF X;  1N86 A;  4BWN A;  2BCC G;  2P2U A;  4H0L C;  2KSE A;  1Q7Y Q;  3AEA C;  3R4Y A;  2K88 A;  2YO2 A;  1KMI Z;  1IO4 A;  3K5B A;  3RL0 C;  1RF1 B;  1NO4 A;  3WUU A;  4C46 A;  4GOF A;  1KQG B;  3H1L E;  2HOD A;  2V7Q H;  5CCH C;  2WSE H;  5DJU B;  1MFT A;  2RKL A;  2YMK A;  2WSS H;  2FYU D;  2JDI H;  2HR3 A;  2XZR A;  3EFF K;  3CX5 I;  3CCJ P;  1FZA A;  1EC5 A;  1ZLL A;  5KAF H;  3V5B A;  1VQP P;  5APQ A;  2YXQ B;  4H44 D;  4PJ0 H;  3HD7 C;  3GW6 A;  3OW2 O;  5K5G B;  3RK3 B;  1RY3 A;  1AQT A;  2POH A;  3VYI A;  3MD0 A;  3H1H E;  1SQX G;  4W80 A;  3WU2 E;  3OAK A;  1KIL D;  2KZI A;  2K9J B;  2OYH C;  1S5L E;  1OVU A;  1Q2N A;  1R5S A;  4I7Z B;  2QA4 P;  3GF3 A;  3CXH D;  1J1D C;  1D7M A;  3M91 A;  1LTJ B;  3LW5 H;  3BCC G;  2P1J A;  5AVX B;  1NKN A;  3RK3 D;  4IL6 E;  2GUS A;  2YKQ A;  3GHG B;  3SWY A;  2HG5 D;  2IBZ I;  1CW5 A;  1P84 E;  3II6 A;  1KQL A;  1USE A;  3H1I D;  4LLH A;  1DEE G;  4N6J A;  1WT6 A;  1SQQ E;  2R3C A;  1KIL A;  1SLQ A;  3P8C D;  1PPJ G;  1KYO E;  3A0B E;  4L74 A;  1LWU A;  2IFN A;  5GTH E;  1VQ4 P;  2PAJ A;  2E74 B;  5KLV K;  3GLM A;  2HYN A;  3H1J G;  1XTC C;  2IZ0 A;  2NZ2 A;  3T97 B;  2H8P D;  1SQV K;  3D70 A;  1AV1 A;  1SS1 A;  3GG2 A;  2JP3 A;  3Q5S A;  1L0N K;  1BGY J;  3L70 G;  3VMA A;  4LGD E;  4PD4 D;  1HGV A;  3D6Y A;  2I1K A;  3GHG A;  3G3Z A;  5KAF E;  1DX7 A;  2PGD A;  5CJ4 A;  2O3J A;  3L72 G;  1QX8 A;  2E43 A;  1LT1 A;  1L4A C;  4D6T G;  2L5G B;  4BRY B;  3L73 E;  1FJP A;  4PJ0 E;  2M3B A;  1JB0 J;  1SQP K;  1SQV G;  1KOR A;  3CCE P;  2Q1K A;  3U59 A;  2OGU A;  1IFD A;  1IC2 A;  2IFM A;  1ZR2 A;  1BE3 E;  2OTJ P;  1JCC A;  2QJK C;  2FYU K;  3Q2Y A;  2H88 C;  2ZJS E;  5L8R J;  3TNU B;  2FKW B;  3T97 A;  2OYI B;  1M1J C;  3VP8 A;  3PJS K;  5AW3 B;  3HTK B;  3V4Q A;  1SQX J;  1M56 D;  3N7N A;  3B8E B;  3TK1 A;  3H1L D;  1FJK A;  2QJY C;  4HYT B;  1NHL A;  2NPS A;  2KLU A;  2Y0C A;  3CXH H;  5KLV E;  1OW7 A;  3BCC J;  1HVV A;  4EI2 A;  2O01 H;  3B5N C;  2KOG A;  4DOJ A;  3L75 J;  4CPG A;  1N73 B;  2CPS A;  5CCG D;  1NTZ J;  1K9M Q;  3CC2 P;  2YMY A;  1KD1 Q;  4O9B A;  5KJ7 D;  2E76 B;  3F89 A;  1PP9 E;  1VQ6 P;  1L0N E;  2KP8 A;  2GM4 A;  1YI2 P;  2FY8 A;  2VRS A;  1MUU A;  3L35 A;  1FC2 C;  2FYN B;  1JCD A;  2O1K A;  1DD3 A;  3AEC C;  3H1H D;  1BSN A;  1K04 A;  1PFI A;  2A06 D;  2ZXX A;  1N7L A;  2KK7 A;  3TGU E;  2M3E A;  5CCG A;  5KKZ C;  1T3U A;  3B4S A;  3MIW A;  1SQP E;  1T6A A;  1ZP0 C;  5KJ7 A;  1OFC X;  1U7J A;  1FOS F;  2M5A B;  1LTG C;  1QGK B;  1U7M A;  2ZYD A;  2ZVN B;  1FZC C;  2JWA A;  3C9I A;  1EZV E;  1KB9 H;  4H13 C;  2FYU E;  2J58 A;  2O1J A;  2YIU B;  2W6A A;  1NTM J;  2JJL A;  1LTT C;  2IYO A;  1N73 A;  1SQQ D;  1ZV8 A;  2FXM A;  4TT3 H;  1KYO D;  2FFD B;  3H1I G;  3BVH A;  5CBN A;  2ZT9 D;  4C7N A;  3L72 J;  1IJD B;  1VQ8 P;  1S5L X;  4U7J A;  4D6T J;  1RF0 C;  1FS0 E;  5APV A;  3KZI H;  1AA0 A;  1EDK A;  4M3L A;  1EXI A;  4I2L C;  2KNC B;  2A45 G;  1LP1 B;  2IYP A;  3CC4 P;  3C1L A;  1NTK G;  3IAO A;  5AW5 B;  1H0T B;  1NJI Q;  2WIT A;  4WWI A;  5AW8 B;  2KB7 P;  1NU1 D;  1VF5 D;  3LID A;  3TSI A;  3CXH E;  1X22 A;  3NMD A;  4IFF A;  1YJ9 P;  3I56 P;  2AEJ A;  3CC7 P;  3S1K A;  3D71 A;  3MZW B;  1JY2 N;  1JO5 A;  3L73 D;  2Q3I A;  3KPE A;  2Y0E A;  2LKM A;  4QMA A;  2LXC B;  4L73 A;  1IZN B;  3CME P;  1T2K D;  1BE3 D;  3KXD A;  3ZDM A;  1RF1 C;  1NOH A;  1SVF A;  1LP1 A;  1N8R Q;  2XND H;  1GL2 D;  1E5W A;  2W8Z A;  1T8Z A;  1FAV A;  1FDO A;  2QSI A;  2ZVO B;  4ZKU A;  3USS A;  3H25 A;  4N3Y B;  3M0D A;  5KAI H;  1JY3 P;  3IN6 A;  1KB9 E;  2HOD B;  3AE1 C;  5KLV D;  1PGJ A;  1VDF A;  5APU A;  3H1L G;  1MV8 A;  3FXD A;  3CCS P;  4NPD A;  3RK3 C;  4IL6 H;  1K8A Q;  3AEG C;  1EQ7 A;  3P7K A;  2WT7 A;  2WSF J;  1GL2 A;  4KHX A;  1QLE D;  1PP9 D;  3SFD C;  1OX3 A;  4IFM A;  2R32 A;  3C8V A;  2AXC A;  2SPZ A;  1S4X A;  1CI6 A;  1A02 F;  2H7H A;  3RBX A;  3H1I J;  1LTJ C;  3CLQ A;  2N9Y B;  3MUD C;  5AW4 B;  3E1R A;  3GHG C;  3BRT B;  2E75 D;  4C7R A;  3L71 J;  2C0W A;  3E1I A;  3TF5 A;  3TGU D;  3H1H G;  4YTP C;  1Y47 A;  1SQQ K;  2BEZ F;  2Q3E A;  2AEF A;  1CZQ A;  1NTK J;  1SQP D;  3H1K J;  3VTP C;  3PH0 A;  5CHX A;  1SQB D;  4H44 B;  3U1C A;  2E42 A;  3CWB J;  2E74 C;  2WMM A;  2M8R A;  2QM8 A;  5AW1 B;  1OW6 A;  4AQR D;  4U3F G;  1EZV D;  3MTU E;  2P7J A;  2JWD A;  1YJW P;  2H89 C;  1KN7 A;  3L74 E;  4HKZ H;  2K37 A;  3O6Q A;  1KIL B;  1L0L J;  1NU1 K;  1LWU B;  1SQQ G;  4HH2 A;  2QEX P;  1HTL C;  2CPB A;  2N9B A;  1GK6 A;  1M90 Q;  1Q86 Q;  2FXP A;  2R3S A;  1M8O B;  5GTI H;  5TJH A;  2YKP A;  3V2Q A;  2A45 I;  5TIS E;  3V2P A;  1NH4 A;  4XE5 B;  5B5E H;  3RBZ A;  3M9H A;  1FBM A;  2WPR A;  2ZFC A;  5KAI E;  2A06 E;  1GK4 A;  3AEE C;  2WSC H;  1KQS O;  1BGY E;  4KT0 J;  1RE3 A;  4PD4 I;  2PRR A;  4B86 A;  2G8Y A;  2QIW A;  5DJT B;  2JKV A;  2XV5 A;  1H88 A;  1X79 B;  3NTN A;  3Q1M A;  3E7K A;  1IFI A;  2PP6 A;  3HE4 B;  2Q5U A;  4IOI H;  4GOD A;  2WTY A;  4EYY Q;  3L73 G;  3AE6 C;  2OYI C;  5CCG C;  2CK3 H;  2P58 A;  2D2C B;  2C9N Y;  3RL0 g;  4JF7 A;  2MJZ A;  3CX5 D;  5AW6 B;  1AJY A;  2YNY A;  3AEB C;  1LTA C;  1BE3 G;  1KFN A;  4MN4 C;  3VMZ A;  3A5T A;  4JYC A;  1JMM A;  2W83 C;  4GOE A;  1W5C E;  1JY3 N;  5H2F H;  3CCU P;  1OVV A;  1FZG A;  4Z1M H;  4RKU J;  1N73 C;  4Y99 B;  5CMZ A;  2D2C D;  1QEX A;  1VPC A;  3AE7 C;  1S72 P;  1KB9 D;  1NU1 E;  2BCC J;  2E76 C;  5EFW B;  3CMA P;  2NPS B;  1M7L A;  2KSJ A;  4R4L A;  1W2B O;  1GW4 A;  4L76 A;  5KLV G;  2FYN C;  5AVW B;  2WZ7 A;  1MFZ A;  3HE4 A;  3L75 E;  3KHU A;  3R2P A;  1NTZ E;  4U3F J;  5GTI E;  3EQ2 A;  1E79 H;  4YXW H;  4RES B;  2OAR A;  3CPW O;  1PP9 G;  2NPS D;  1JY2 P;  1L0N G;  1SQB K;  5B5E E;  2HPC B;  3IR9 A;  3F5H A;  1NWQ A;  3G4S P;  2QG4 A;  5AW2 B;  3CCM P;  3M06 A;  4HB1 A;  1PIX A;  3HD7 D;  4Y28 J;  1GZL A;  4N78 E;  3JCU H;  4OVN F;  1M1K Q;  4WY4 B;  2J59 M;  1BCC E;  2OYO A;  3NFQ A;  2YIU C;  2BEQ D;  2OTK E;  3TGU G;  2QRX A;  2FFD C;  3L37 A;  1VQ7 P;  5AVQ B;  1SQP G;  1DEB A;  3AE3 C;  1TU3 F;  1P84 I;  2WSE J;  1VQM P;  5CJ0 A;  4WY4 D;  1X9V A;  1JMB A;  3L74 D;  3CCL P;  4JBZ A;  1YJN P;  1EZV G;  2FYU G;  3HD7 A;  1NTM E;  1HJB A;  4C7N B;  4KJM A;  1L2P A;  2KI7 B;  3A7O A;  1S2E A;  3CL3 D;  3L73 J;  5H2F E;  1OW8 A;  2OYH A;  2HPC A;  1DIP A;  4DCK A;  5E79 H;  1H89 A;  1LTB C;  1RE4 C;  4ZNC A;  1T3J A;  1PGQ A;  1IFJ A;  2OQQ A;  1G2C B;  3VMY A;  3CX5 H;  3HRN A;  1G1J A;  3H1J J;  4WY4 A;  2KS1 A;  1BE3 J;  1ZW0 A;  1BGY D;  2J5U A;  1N7S B;  2ZT9 B;  2LXB A;  3EWK A;  4BXL A;  2UWJ E;  4UB6 E;  4JPZ B;  3LW5 J;  1SQB E;  1CSB A;  3KQG A;  3L70 J;  3A3Y B;  4YXD C;  2KIK A;  5KLI B;  3MP7 B;  2ZYA A;  1LTS C;  1N7S D;  5KLV J;  4HJG H;  2I8D A;  3TDK A;  1L4A D;  1FDI A;  1FOS E;  3D6Z A;  3TYY A;  1OVR A;  2K9Y A;  2V4H A;  1VF5 B;  2ZYG A;  3JCU E;  2HLO A;  1LT9 B;  1GW3 A;  1MZ9 A;  1SQV J;  4I6M C;  2BAS A;  4IL6 X;  1FZE A;  1L0N J;  3M0A A;  1G2C A;  2B9B A;  4OWF A;  1YBK A;  2P10 A;  1ZRT E;  1ZR4 A;  5BU5 A;  2HFE D;  3LIE A;  1SQX D;  4A7P A;  1JY2 O;  1N7S A;  1L4A A;  2LR2 A;  2ZXE B;  2I1J A;  4PV1 B;  1H8A A;  3BCC D;  2JEE A;  1SQP J;  2WT7 B;  3L75 D;  1GL2 B;  1NAY A;  1S9K E;  1NTZ D;  2H43 A;  3Q5P A;  4TLF A;  3B5N D;  3FX0 A;  1J1E B;  1J2J B;  4ASW A;  2E5T A;  5E79 E;  1S3J A;  2C9L Y;  2FYU J;  1CI6 B;  2QVA A;  4OGQ B;  4WB4 A;  5AVZ B;  5AVY B;  4PV1 D;  1RE3 C;  3FWL A;  4H44 C;  3CX5 E;  1LT9 A;  3W67 A;  2M0B A;  4N78 D;  2QM7 A; 
#chains in the Genus database with same CATH homology
 3CWB J;  3L71 J;  1BCC J;  1KB9 I;  3L72 J;  3TGU J;  1KYO I;  2IBZ I;  4D6T J;  3L70 J;  2FYU J;  3H1J J;  1P84 I;  3BCC J;  1BE3 J;  3L74 J;  3H1I J;  1NTK J;  3L73 J;  1SQP J;  1BGY J;  1SQX J;  1EZV I;  1NU1 J;  3L75 J;  1NTM J;  1SQV J;  3H1K J;  1NTZ J;  1SQQ J;  3H1H J;  3CX5 I;  3CXH I;  1SQB J;  3H1L J;  2BCC J;  4U3F J;  1L0N J;  1PP9 J;  1L0L J;  5KLV J;  4PD4 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...