1NTME

Crystal structure of mitochondrial cytochrome bc1 complex at 2.4 angstrom
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 49
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ntmE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ntmE02
4H44D 4PD4E 4HM6A 1KB9E 3GCEA 2GBWA 3D89A 1NTKE 2GBXA 1UUVA 2NUKA 3L75E 2QJKC 3VMGD 3BCCE 2YVJB 4OGQD 4AIVA 2E4QA 3H1HE 3CXHE 2NUMA 3L71E 4QUQA 1L0NE 1VM9A 3H1KE 5CXMA 2A06E 1EG9A 3H1JE 4NB9D 5BOKA 3N0QA 3C0DA 4QUPA 2B1XA 1ULJA 3VMID 2NVFA 1KYOE 4PV1D 2QJYC 1SJGA 2FYUE 2YFIA 4NBCD 1O7HA 1PPJE 1NDOA 3EN1A 1RFSA 2E75D 4EMJB 2B24A 4QURA 2HMOA 1SQQE 4NBED 1O7GA 2E74D 5AEWA 3GKEA 3GOBA 2BMRA 3L72E 3VMHD 3VCPA 2I7FA 2BCCE 4HM8A 1PP9E 5KKZC 3L70E 4NBAD 4HM4A 5KLVE 2DE5D 1SQVE 2IBZE 1JM1A 2HMMA 1NU1E 1O7NA 3TGUE 2DE6D 2JO6A 4NBHD 4QCKA 2HMJA 4AAYB 1EZVE 4NBBD 1BCCE 2FYNC 2XR8A 3GTEA 4NBFD 3AZCA 4HM7A 3H1LE 4H13D 2QPZA 4HM2A 1SQPE 1G8JB 3CWBE 5HL4A 1P84E 2HMKA 1NTME 1BE3E 4QDFA 2HMLA 3GTSA 1WQLA 3L73E 2NVEA 2QJPC 1Q90C 1UUWA 5KLIC 1SQBE 4HM5A 3VCAA 4HM0A 3GZYA 4QDCA 1L0LE 3H1IE 2XSOA 2NVGA 1NTZE 2Q3WA 4HM1A 4NBGD 3EQQA 1ULIA 4D6TE 1SQXE 2BMQA 4U3FE 3L74E 2NWFA 2CKFA 1ZRTE 3GL2A 4NBDD 4P1BH 1RIEA 3GL0A 4HJLA 4P1CH 4H0LD 1FQTA 2XSHA 2D2CD 2E76D 3FOUA 1G8KB 5AEUA 1VCKA 2YIUC 4QDDA 4QDFB 2YFJA 3DQYA 2BMOA 1O7MA 1O7WA 3CX5E 4NB8D 3GZXA 2YFLA 1NYKA 2HMNA 2XRXA 2E4PA 2ZYLA 4HKVA 3GB4A 1VF5D 2DE7D 1BGYE 4HM3A 2JZAA 2ZT9D 1O7PA
chains in the Genus database with same CATH superfamily
2BCCJ 1FZBA 1HH0A 2P7JA 3H1HG 2E76B 1L0NK 3B5NC 1HGZA 3VMGD 1W2BO 3H1JG 3N7NA 1BDDA 1BSHA 2Q3IA 1NU1G 4WVZA 4L76A 1LNQA 1BCCD 3HE5B 2M8RA 3GHGC 1E79H 1NGMB 3CWBJ 3Q2YA 1SQQK 3B5ND 2PRRA 1ULJA 3CCEP 2R5BA 1FC2C 1FS0E 5AVRB 4EI2A 1OVUA 3PRJA 3LW5H 3SFDC 3VN0A 1GU4A 1HUCA 4XE5B 4HKZH 2BMRA 3GF3A 5BU5A 3E1RA 1KFNA 2I7FA 1KQSO 4L75A 1RQVA 2K1AA 4H13C 1J1EB 1JY3P 2HODA 1FAVA 1CW5A 2IBZE 3TGUE 4QCKA 2JEEA 1NTMK 2E74B 3GTEA 1M1KQ 4H13D 4HM2A 1SQPE 3I56P 1P84E 1BE3E 3M0AA 5APSA 2XNDH 3PTZA 2G3AA 4BRYB 5KJ7A 3VOPA 3L73E 1VDFA 4Y28J 2XDJA 1SQXK 3MHVA 3L75D 2KXPB 2HPCB 1N7LA 2OYIC 1ULIA 3H1HD 1JTHB 1NVOA 3H1JD 2W6JH 3FOUA 2XSHA 1QVGO 1NU1D 2AEFA 1PGPA 3AE3C 4NPEA 4JYCA 2E4PA 1YIJP 1BGYE 2KS1A 2I1KA 4A7PA 2FYZA 1M1JC 3CCVP 3AE5C 3MZWB 3G4SP 3GLMA 2PGDA 1FOSE 5TJHA 2YVJB 3L71E 3Q5PA 4K35A 3CXHH 3EFFK 5CBOA 2YIUB 3RK2C 3N0QA 2QIWA 1MUUA 4I7ZB 3D70A 1PL5A 3H32B 3MTUE 1HWTC 2IYPA 2Q3EA 1GW3A 1O7GA 3RK2D 3H1IJ 5K5GB 4BWNA 1SQVG 4PV1C 3V6IA 3V5BA 3B5NB 2O01H 4O9BA 4Z1MH 1X22A 2WWWA 1JM1A 1IFIA 3GHGB 1WRGA 1VQLP 2WSEH 4LGDE 1FDIA 2KLVA 2ZJSE 1L0LK 1T2KC 1IC2A 1RE3C 4W7ZA 1WQLA 1N8RQ 1SQBE 3IF4A 2OTKE 3BCCJ 3N4XA 2WT7B 2Q3WA 1ZR4A 1KQGB 1T2KD 4H13B 3G9RA 3D6YA 2RMZA 2JJLA 1SP4A 4N6JA 2YFJA 1YYCA 1EDLA 5CCHC 3CCRP 1DD4A 1G1IA 1KILE 1GTWA 2H43A 2DE7D 3G71P 2NRGA 1YITP 1CI6A 4HM6A 2OTJP 3VMZA 2IBZI 3JCUE 2OYIB 5CCHD 4WY4C 5BVZA 2IX7C 3D89A 1NHLA 1SQVD 1N7SA 1M56D 1P84I 1BCCJ 2NUMA 1L0NE 4WY4D 1JY2P 1X0TA 1YQ4C 2LXBA 1JCCA 1S5LH 3AE7C 3EN1A 2E75D 1JY3N 1SQQE 1QX8A 3L35A 1M1JB 3P8CE 3HE4A 4JYBA 1FU1A 5AW4B 3PH0A 4EYYQ 3PP5A 4DCKA 1LWUA 3AEEC 2JWDA 2IFMA 1LJ2A 2HMMA 5AVXB 3S9OA 3RK2B 2JP3A 1LTGC 3Q5RA 3AE1C 3H1LE 2HMKA 1NTME 1YJ9P 3KZIH 4QDFA 2O1JA 1NTZK 1YQ3C 3WUTA 4HM5A 1NTKD 3L75J 3IN6A 3H1HJ 3T97A 2ZVNB 1SQXE 3H1KD 4U3FE 2FY8A 3H1JJ 2B87A 3B71A 2WSCJ 2O1KA 1JCDA 3VP9A 2FYUD 1O7WA 2GUSA 3CX5E 3HD7C 1RE4C 1LP1B 1S9KE 1VQ5P 2OYOA 4PD4E 2JKVA 1EDKA 1AA0A 3HRNA 3TSIA 5KLVD 1GW4A 2KSEA 5GTHE 2FXMA 2IBZG 2O3JA 3TGUG 1VM9A 3M0DC 4ZMDA 2JWAA 1SQPG 3A0BE 4DJGA 1YTZT 1BE3G 2KIKA 1M90Q 2WSCH 3TK1A 3CCMP 3L73G 4PD4H 1HJBA 3SWFA 1RHZB 4WY4B 3VMHD 4D6TD 4ZKUA 4R4LA 1XTCC 1HGVA 1AJYA 1FZCB 2E75B 5B5EE 2HMJA 4AAYB 4UB8H 2LKMA 1JMBA 1OX3A 2IPPA 3PJSK 2HLOA 1BGYG 5M1BA 3VP8A 2WMMA 2MJZA 3GTSA 2KB7P 2QJPC 2WSFJ 1UUWA 1L0LE 2WPVB 2ZAEB 1SFCC 1Q7YQ 3RK3E 1QEXA 5B5EH 3L71G 4NPFX 2WPQA 3GL0A 1SFCD 3G6EP 1PZQA 3HE5A 1YBKA 1SQPD 3WU2E 2UWJE 3KPEA 1P84D 5GTIE 1BE3D 1KQLA 1H0TB 3L72D 2DW3A 3U1CA 1JY2N 3LIEA 2GBWA 2GBXA 4PJ0H 2QJKC 5APUA 1SQVJ 2WSFH 3L37A 3U1AA 4QUQA 2A06E 1OVVA 3D6ZA 1IFMA 2KLUA 1KYOE 5GTIH 4GKGA 2FXOA 1LTTC 1JEKA 1R5SA 4IL6X 2H7HA 1PP9G 1SQBG 1N2DC 3L70G 2G8YA 4RO0A 3L36A 4BRYA 2QA4P 3L74D 1VQOP 2HPCA 1A02J 3BRVB 4LLHA 2DE6D 5APVA 1E5WA 1JTHA 4EIJA 2C0WA 1KYOH 4HJGH 2K37A 3HUSC 2OARA 5H2FE 3MP7B 1NYHA 2NVEA 2L91A 1NTKJ 3GZYA 3WMM0 4H0LC 1NTZE 4NBGD 4IL6E 1KILA 3L4FA 3H1KJ 1L0NG 1LTBC 2AEMA 1KB9I 4H0LD 2FYUJ 4NB8D 1FJPA 4JF7A 1SQQG 2W6BA 1MKMA 3GB4A 2Z5HA 2P2UA 2JZAA 2QJPB 5AW0B 3H32A 3TYYA 3GMAA 2HR3A 1TU3F 1JMMA 1PP9D 1SFCB 3L70D 5CJ4A 5KLVJ 1J2JB 2Z4EA 3V2PA 1GL2D 4DOJA 4U7JA 3B5NA 3CC4P 4GOEA 2IYOA 1VQ7P 1CZQA 2M3BA 3H1LG 4WB4A 3R4YA 3C0DA 4HB1A 1UIXA 1NTMG 3GHGA 1AVYA 2B24A 1J1DC 5CHXA 2Q7CA 3GOBA 5CCGC 1L4AC 3VCPA 3VMAA 2J58A 4LC1A 4D6TJ 2BCCE 2QJKB 2PFXA 1SQXG 4U3FG 2WTYA 1LGHB 5APWA 5AW2B 2WT7A 5AVSB 3FX0A 5CCGD 1L4AD 1O7NA 3KHUA 2FXPA 1EZVE 3RL0C 3CWBE 3A2AA 5HL4A 4C7NB 1RF1C 3MGNA 2N9YB 2YO2A 4HYTB 1GU5A 1X9VA 3AE9C 4UB6H 3RL0D 2KZIA 2P1JA 2OYIA 4I1LA 1ZRTE 2E43A 4NBDD 5C39A 1IZNB 3P8MC 1JM0A 3H1LD 1KN7A 2YXQB 3HUSB 2XRXA 2QE7H 1LTJC 5APTA 3L72J 1NAFA 3FXEA 4H0LB 1JY2O 1CSBA 1M1JA 2Y0EA 3CXHE 4C7RA 1SQXD 1EDJA 1RF0C 5KTBA 2V4HA 1NDOA 2VRSA 4NBED 1GL2B 3CC7P 3O6QB 1L0LG 2B88A 3BVHA 3R2PA 2A45H 3L74J 2Y0DA 3C8VA 1U7JA 1EC5A 2GM4A 3RL0g 4HM7A 4JBZA 3MUDC 1J1DB 1X8YA 1URQC 1KB9D 2E5YA 5KLIC 1L4AB 1AV1A 4W7YA 1RE3A 1FZAA 1OW7A 3H1IE 1H89A 3H6PA 4HM1A 3V4QA 1URQD 1S5LX 2KUBA 3G3ZA 2BMQA 4I2LC 2A06G 3RL0B 5AVWB 1RF1B 3CMEP 1T3UA 3IFMA 1SLQA 2ZFCA 4HKVA 3M06A 4TT3H 3HTKB 2WITA 5CCHA 3CCJP 1PP9J 1FBMA 1WT6A 2KK7A 3L70J 2NUKA 3BCCE 3II6A 4WY4A 4N78E 1Q2NA 1PIXA 1SVFA 1IK7A 2YKPA 5CBNA 3IAOA 1S5LE 3VMID 3C9IA 4DT0A 5KAFH 1PPJE 4C46A 1H88A 1FZGA 1IFNA 1RFSA 1LTJB 4RJTA 3V2NA 4ASWA 2YO3A 1VQ4P 2Y9YA 3GKEA 4CPGA 1NTZG 1AQTA 1PGQA 1SQVK 1WMKA 2GA1A 4IFDK 1FZCC 2E75C 4ZKPA 3C1LA 2HODB 4B86A 2NPSA 1XTGB 1ZP0C 1Z56A 4GOFA 1NH4A 1W5CE 1BCCE 3AZCA 3BRTB 1VQ8P 2WQYC 3KZIE 1IFJA 2I1JA 3I55P 1OVRA 2WSSH 1FZEA 3CXHI 1H0TA 2JR8A 5B66H 1QL1A 1S72P 3PHLA 5CMZA 4RESB 2KOGA 2O01N 5AEUA 1KTMA 4WWIA 3CD6P 2AXTE 3USSA 1LT9C 2IDBA 3V4WA 1N73C 1URQB 2KS1B 1NTKK 3HD7A 5KLIB 1RE4A 4JPZB 2N1TC 2BCCG 2GUVA 3W68A 5AW7B 1UUVA 3L75E 1Y8AA 1NU1J 3H1HE 2I8DA 5BU8B 2N1TD 2FYUK 1EG9A 1FDMA 1LTIC 2AXTH 3H1JE 2W8ZA 1OW8A 1AVOA 3M0DA 1Y9BA 1O7HA 1HBWA 1T6AA 1PGOA 2AXCA 3NXSA 3PLNA 4GIFA 2Q6QA 2YMKA 3BATA 5KLVK 3NFQA 1YJWP 1DEBA 2XU6A 3B8EB 1GDTA 3A0HH 4UB8E 1KQFB 4NBBD 4NBFD 5DJTB 1LT1A 1JOCA 3RBZA 4R4MA 2XNXA 3VMXA 1FE6A 3P7KA 1N86A 2KI7B 4EDFA 2NVGA 3RBXA 1KD1Q 2ZYDA 1NO4A 5AW6B 1KZUB 1SFCA 5AVZB 1PV3A 2CKFA 2P67A 4P1BH 2KNCA 1OMIA 5AW3B 1VQNP 3EQ2A 1Q81Q 4DZOA 4H44C 3AE6C 1JB0J 3M91A 1NYKA 1LTSC 1ZMEC 2K9YA 3SWKA 3TNUB 4H44D 3QWOC 1HJ0A 1AQ5A 4PJ0E 3JSVC 2WZ7A 3CCQP 2IBZD 3TGUD 3GG2A 2WPRA 2P10A 1ZRTD 2C9NY 1PGJA 2WPSA 1EQ7A 1Q86Q 3KXDA 2YFIA 1LT9B 1N73B 1FZFA 3L73D 2HYNA 1PFIA 1KV4A 3A3YB 4EOTA 3SSUA 1W2EA 4C7NA 2N1TB 1SS1A 3H1IG 1VQKP 5CJ0A 3VYIA 1U57A 3CL3D 1S1CX 5DJUB 3A5TA 1K9MQ 1KORA 1GMJA 2J5UA 1K04A 1SQVE 1FJKA 1T8ZA 2HG5D 3AEDC 3KDPB 1JY3O 3UIAA 1BGYD 2W6AA 2OYHC 4IFFA 1HVVA 4MN4C 3HUSA 1M8OB 4HM0A 3CX5I 2D2CC 3BCCG 2OTLP 3T97B 2B9BA 1YHQP 1LTAC 3L71D 3F89A 2B87B 3A7OA 4PD4I 1JNMA 2D2CD 3M9QA 1VCKA 2BMOA 1PPJG 3GZXA 1FDOA 1NKZB 2ZYLA 2IZ0A 3NMDA 3AEBC 5AVYB 2K3RA 3KYQA 1YI2P 4OGQC 4W80A 2YXRB 1NTKE 3O6QA 1K73Q 4OGQD 1GK4A 4RKUJ 2H8PD 2K9JB 1BCCG 3H1KE 3CC2P 1DH3A 4H44B 5BOKA 3F5HA 1GL2C 4YPCA 2QJYC 2FYUE 2R3SA 4NBCD 2MKVA 4EMJB 3AECC 3W67A 1SQBD 3IR9A 1VPCA 3K5BA 1IFDA 2YKOA 5KKZC 1IFPA 5CCGA 1L4AA 1KILC 5KLVE 5TISH 1ZXGA 2DE5D 3GW6A 2W83C 4WBAA 2FYNC 1DEEG 1KILD 2Z5IA 3GF7A 3S1KA 4UB6E 3AEAC 3AE2C 3AE4C 1RF1A 5APXA 2WVRA 1M7LA 3L75G 3HTKA 3AEFC 2NZ2A 4Y99C 4D6TE 1L0ND 2BEQD 4OH8B 3TDKA 1VF5C 2FFDC 5APYA 2JO1A 4QDDA 4OWFA 1SQQD 3D71A 2H89C 2OYHB 1ZLLA 2Y9ZA 1VF5D 2ITAA 3AEGC 1VQMP 3P8CD 1AFOA 3CCUP 3CPWO 1LTJA 2D2CB 4KHXA 2M0BA 1KYOI 3EFGA 2QG4A 5AVQB 3TGUJ 1S3JA 1KFMA 2Q1KA 3JC22 2C0XA 1GK6A 4ZNCA 2J59M 1SQPJ 4NB9D 1NTMD 1BE3J 2IZ1A 1SJGA 3L73J 1RF0A 4XFJA 4OGQB 2R5DA 3L72E 1NU1K 4HM8A 4U3FD 2QSIA 2M3EA 4ASVA 3BASA 4YXWH 3V2QA 3CX5D 2ZYAA 2E5TA 2QJYB 1BGYJ 5KJ7C 5AVTB 2M5AB 1S9KD 3AE8C 1P84H 1G2CB 1R5LA 4PD4D 3MUDA 1KC8Q 1OIPA 5APQA 1BSNA 1EDIA 1URQA 3FXDA 5KJ7D 2XSOA 2O01J 5KKZB 1KILB 3L71J 3SFEC 2Y0CA 3L74E 1RIEA 2FYNB 2OGUA 2ZT9C 1G8KB 2WSEJ 3ZDMA 2FKWB 1ZR2A 2FBWC 3OAKA 3WUVA 1MFTA 1LP1A 4HM3A 2ZT9D 1O7PA 1OZHA 2YKQA 3KQGA 4Y99B 5KAIE 1ZOYC 4L74A 2E4QA 1VF5B 2FFDB 3CLQA 2B89A 2OQQA 5KAFE 2CK3H 5L8RJ 3RK3C 5AVVB 3OJAB 4PV1D 3H25A 4QURA 3RGUA 1SQBJ 2H88C 1L0LD 1EZVI 2SPZA 2K88A 3RK3D 3EWKA 4KJMA 4XA4A 5KAIH 2RKLA 4GT1A 1PP9E 4GDOA 3L70E 4NBAD 3Q5SA 2BEZF 1FZCA 1IK9A 1RY3A 2ZXXA 2XR8A 2QVAA 1A02F 1Y47A 2R32A 1G8JB 3Q3DA 3SWYA 4L73A 1L2PA 1MFZA 4HH2A 2PAJA 1YTZI 1MZ9A 3FGAD 4QDCA 1NTKG 4IFMA 3TNUA 5B66E 1QLED 2QEXP 1L0NJ 1T3JA 1OW6A 2A06D 1IJDB 2NWFA 3H1KG 1KYOD 1OFCX 1O7MA 2FYUG 1SQQJ 2BASA 2A45I 2IFNA 1K8AQ 2RH0A 1LT9A 3U59A 1N73A 1JO5A 1S2EA 2W27A 1N7SC 3JCUH 1ZN5A 2Q9IA 2N1TA 5KLVG 5AW1B 1DD3A 2NPSC 1QGKB 2C9LY 1RQUA 1N7SD 2KYVA 2ZT9B 3H1LJ 2QRXA 1NJIQ 1HF9A 1NTMJ 2NVFA 3MIWA 2NPSD 2KP8A 4BXLA 1EXJA 2L5GB 1R8EA 1NTZD 1Q82Q 1LWUC 2LXCB 1IO4A 4K3AA 1SQXJ 4U3FJ 4D6TG 1EZVG 2CPSA 4PV1B 4HM4A 3V2RA 1ZV8A 3A0HE 4JQ0D 3CWBG 2YMYA 2QM7A 1NU1E 2JO6A 4NBHD 3RK3B 2QPZA 5AW5B 1M57D 1U7MA 3TF5A 5AW9B 4M3LA 2HMLA 1Q90C 3VCAA 2XZRA 2KZJA 3HD7D 3Q1MA 3CCLP 1Q90D 4HJLA 1FQTA 2K9JA 1GZLA 2E42A 3CX5H 2HMNA 3OW2O 2W90A 1VQPP 4YTPC 4YXDC 2A45G 2BCCD 1KB9E 3I5CA 3L72G 1USEA 1VL2A 1RH5B 4NPDA 3LIDA 5GTHH 1EZVD 1OWAA 5CXMA 4OVNF 3FWLA 3CWBD 5AVUB 5EFWB 4QUPA 2B1XA 1DX7A 1K05A 3VMYA 3A0BH 1CI6B 1MV8A 2P58A 2HMOA 1KB9H 1L0LJ 2CPBA 3VTPC 1N7SB 4I6MC 3O8ZA 1HTLC 3L74G 2N9BA 3P32A 1H8AA 2NPSB 1NWQA 1SQPK 1VQ6P 1FOSF 2YNYA 2ZVOB 3ABVC 3M9HA 3HE4B 1BDCA 1X79B 3OA7A 5E79E 2R3CA 1LWUB 2KSJA 4AYCA 2OYHA 2E76C 1D7MA 3CXHD 2ZXEB 3B4SA 3GL2A 2POHA 3CCSP 4P1CH 2E76D 1G1JA 4QDFB 3DQYA 3ITKA 2RN0A 2V7QJ 1USDA 5E79H 3WU2H 3HD7B 2HFED 1YJNP 1S4XA 3GCEA 1NKNA 1ZW0A 1UIIA 3FWNA 1J1EC 4AIVA 1NAYA 3E1IA 4TLFA 2XV5A 4GODA 3CMAP 2E74C 2R44A 2QM8A 4N3YB 1GL2A 2JDIH 2E74D 3H1ID 2LR2A 3E7KA 4AQRD 1NTZJ 5AEWA 4AUWA 2M5AA 2AEJA 2V7QH 1G2CA 3NTNA 4QMAA 2PP6A 2ZYGA 3MD0A 1KMIZ 5TISE 3S4RA 3QH9A 1GD2E 1EXIA 1JUNA 1SQBK 1NOHA 5H2FH 5AW8B 1DIPA 3BCCD 3WUUA 3EQQA 4N78D 3M9BA 4IL6H 2KNCB 2Q5UA 3CI9A 2XKMA 4KT0J 4IOIH 2YIUC 3LW5J 1PPJD 4I7ZC 2FFDA 1VQ9P 2YFLA 1OXZA 1QVFO 1QL2A
chains in the Genus database with same CATH topology
4H44D 4PD4E 4HM6A 1KB9E 3GCEA 2GBWA 3D89A 1NTKE 2GBXA 1UUVA 2NUKA 3L75E 2QJKC 3VMGD 3BCCE 2YVJB 4OGQD 4AIVA 2E4QA 3H1HE 3CXHE 2NUMA 3L71E 4QUQA 1L0NE 1VM9A 3H1KE 5CXMA 2A06E 1EG9A 3H1JE 4NB9D 5BOKA 3N0QA 3C0DA 4QUPA 2B1XA 1ULJA 3VMID 2NVFA 1KYOE 4PV1D 2QJYC 1SJGA 2FYUE 2YFIA 4NBCD 1O7HA 1PPJE 1NDOA 3EN1A 1RFSA 2E75D 4EMJB 2B24A 4QURA 2HMOA 1SQQE 4NBED 1O7GA 2E74D 5AEWA 3GKEA 3GOBA 2BMRA 3L72E 3VMHD 3VCPA 2I7FA 2BCCE 4HM8A 1PP9E 5KKZC 3L70E 4NBAD 4HM4A 5KLVE 2DE5D 1SQVE 2IBZE 1JM1A 2HMMA 1NU1E 1O7NA 3TGUE 2DE6D 2JO6A 4NBHD 4QCKA 2HMJA 4AAYB 1EZVE 4NBBD 1BCCE 2FYNC 2XR8A 3GTEA 4NBFD 3AZCA 4HM7A 3H1LE 4H13D 2QPZA 4HM2A 1SQPE 1G8JB 3CWBE 5HL4A 1P84E 2HMKA 1NTME 1BE3E 4QDFA 2HMLA 3GTSA 1WQLA 3L73E 2NVEA 2QJPC 1Q90C 1UUWA 5KLIC 1SQBE 4HM5A 3VCAA 4HM0A 3GZYA 4QDCA 1L0LE 3H1IE 2XSOA 2NVGA 1NTZE 2Q3WA 4HM1A 4NBGD 3EQQA 1ULIA 4D6TE 1SQXE 2BMQA 4U3FE 3L74E 2NWFA 2CKFA 1ZRTE 3GL2A 4NBDD 4P1BH 1RIEA 3GL0A 4HJLA 4P1CH 4H0LD 1FQTA 2XSHA 2D2CD 2E76D 3FOUA 1G8KB 5AEUA 1VCKA 2YIUC 4QDDA 4QDFB 2YFJA 3DQYA 2BMOA 1O7MA 1O7WA 3CX5E 4NB8D 3GZXA 2YFLA 1NYKA 2HMNA 2XRXA 2E4PA 2ZYLA 4HKVA 3GB4A 1VF5D 2DE7D 1BGYE 4HM3A 2JZAA 2ZT9D 1O7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H44 D;  4PD4 E;  4HM6 A;  1KB9 E;  3GCE A;  2GBW A;  3D89 A;  1NTK E;  2GBX A;  1UUV A;  2NUK A;  3L75 E;  2QJK C;  3VMG D;  3BCC E;  2YVJ B;  4OGQ D;  4AIV A;  2E4Q A;  3H1H E;  3CXH E;  2NUM A;  3L71 E;  4QUQ A;  1L0N E;  1VM9 A;  3H1K E;  5CXM A;  2A06 E;  1EG9 A;  3H1J E;  4NB9 D;  5BOK A;  3N0Q A;  3C0D A;  4QUP A;  2B1X A;  1ULJ A;  3VMI D;  2NVF A;  1KYO E;  4PV1 D;  2QJY C;  1SJG A;  2FYU E;  2YFI A;  4NBC D;  1O7H A;  1PPJ E;  1NDO A;  3EN1 A;  1RFS A;  2E75 D;  4EMJ B;  2B24 A;  4QUR A;  2HMO A;  1SQQ E;  4NBE D;  1O7G A;  2E74 D;  5AEW A;  3GKE A;  3GOB A;  2BMR A;  3L72 E;  3VMH D;  3VCP A;  2I7F A;  2BCC E;  4HM8 A;  1PP9 E;  5KKZ C;  3L70 E;  4NBA D;  4HM4 A;  5KLV E;  2DE5 D;  1SQV E;  2IBZ E;  1JM1 A;  2HMM A;  1NU1 E;  1O7N A;  3TGU E;  2DE6 D;  2JO6 A;  4NBH D;  4QCK A;  2HMJ A;  4AAY B;  1EZV E;  4NBB D;  1BCC E;  2FYN C;  2XR8 A;  3GTE A;  4NBF D;  3AZC A;  4HM7 A;  3H1L E;  4H13 D;  2QPZ A;  4HM2 A;  1SQP E;  1G8J B;  3CWB E;  5HL4 A;  1P84 E;  2HMK A;  1NTM E;  1BE3 E;  4QDF A;  2HML A;  3GTS A;  1WQL A;  3L73 E;  2NVE A;  2QJP C;  1Q90 C;  1UUW A;  5KLI C;  1SQB E;  4HM5 A;  3VCA A;  4HM0 A;  3GZY A;  4QDC A;  1L0L E;  3H1I E;  2XSO A;  2NVG A;  1NTZ E;  2Q3W A;  4HM1 A;  4NBG D;  3EQQ A;  1ULI A;  4D6T E;  1SQX E;  2BMQ A;  4U3F E;  3L74 E;  2NWF A;  2CKF A;  1ZRT E;  3GL2 A;  4NBD D;  4P1B H;  1RIE A;  3GL0 A;  4HJL A;  4P1C H;  4H0L D;  1FQT A;  2XSH A;  2D2C D;  2E76 D;  3FOU A;  1G8K B;  5AEU A;  1VCK A;  2YIU C;  4QDD A;  4QDF B;  2YFJ A;  3DQY A;  2BMO A;  1O7M A;  1O7W A;  3CX5 E;  4NB8 D;  3GZX A;  2YFL A;  1NYK A;  2HMN A;  2XRX A;  2E4P A;  2ZYL A;  4HKV A;  3GB4 A;  1VF5 D;  2DE7 D;  1BGY E;  4HM3 A;  2JZA A;  2ZT9 D;  1O7P A; 
#chains in the Genus database with same CATH topology
 2BCC J;  1FZB A;  1HH0 A;  2P7J A;  3H1H G;  2E76 B;  1L0N K;  3B5N C;  1HGZ A;  3VMG D;  1W2B O;  3H1J G;  3N7N A;  1BDD A;  1BSH A;  2Q3I A;  1NU1 G;  4WVZ A;  4L76 A;  1LNQ A;  1BCC D;  3HE5 B;  2M8R A;  3GHG C;  1E79 H;  1NGM B;  3CWB J;  3Q2Y A;  1SQQ K;  3B5N D;  2PRR A;  1ULJ A;  3CCE P;  2R5B A;  1FC2 C;  1FS0 E;  5AVR B;  4EI2 A;  1OVU A;  3PRJ A;  3LW5 H;  3SFD C;  3VN0 A;  1GU4 A;  1HUC A;  4XE5 B;  4HKZ H;  2BMR A;  3GF3 A;  5BU5 A;  3E1R A;  1KFN A;  2I7F A;  1KQS O;  4L75 A;  1RQV A;  2K1A A;  4H13 C;  1J1E B;  1JY3 P;  2HOD A;  1FAV A;  1CW5 A;  2IBZ E;  3TGU E;  4QCK A;  2JEE A;  1NTM K;  2E74 B;  3GTE A;  1M1K Q;  4H13 D;  4HM2 A;  1SQP E;  3I56 P;  1P84 E;  1BE3 E;  3M0A A;  5APS A;  2XND H;  3PTZ A;  2G3A A;  4BRY B;  5KJ7 A;  3VOP A;  3L73 E;  1VDF A;  4Y28 J;  2XDJ A;  1SQX K;  3MHV A;  3L75 D;  2KXP B;  2HPC B;  1N7L A;  2OYI C;  1ULI A;  3H1H D;  1JTH B;  1NVO A;  3H1J D;  2W6J H;  3FOU A;  2XSH A;  1QVG O;  1NU1 D;  2AEF A;  1PGP A;  3AE3 C;  4NPE A;  4JYC A;  2E4P A;  1YIJ P;  1BGY E;  2KS1 A;  2I1K A;  4A7P A;  2FYZ A;  1M1J C;  3CCV P;  3AE5 C;  3MZW B;  3G4S P;  3GLM A;  2PGD A;  1FOS E;  5TJH A;  2YVJ B;  3L71 E;  3Q5P A;  4K35 A;  3CXH H;  3EFF K;  5CBO A;  2YIU B;  3RK2 C;  3N0Q A;  2QIW A;  1MUU A;  4I7Z B;  3D70 A;  1PL5 A;  3H32 B;  3MTU E;  1HWT C;  2IYP A;  2Q3E A;  1GW3 A;  1O7G A;  3RK2 D;  3H1I J;  5K5G B;  4BWN A;  1SQV G;  4PV1 C;  3V6I A;  3V5B A;  3B5N B;  2O01 H;  4O9B A;  4Z1M H;  1X22 A;  2WWW A;  1JM1 A;  1IFI A;  3GHG B;  1WRG A;  1VQL P;  2WSE H;  4LGD E;  1FDI A;  2KLV A;  2ZJS E;  1L0L K;  1T2K C;  1IC2 A;  1RE3 C;  4W7Z A;  1WQL A;  1N8R Q;  1SQB E;  3IF4 A;  2OTK E;  3BCC J;  3N4X A;  2WT7 B;  2Q3W A;  1ZR4 A;  1KQG B;  1T2K D;  4H13 B;  3G9R A;  3D6Y A;  2RMZ A;  2JJL A;  1SP4 A;  4N6J A;  2YFJ A;  1YYC A;  1EDL A;  5CCH C;  3CCR P;  1DD4 A;  1G1I A;  1KIL E;  1GTW A;  2H43 A;  2DE7 D;  3G71 P;  2NRG A;  1YIT P;  1CI6 A;  4HM6 A;  2OTJ P;  3VMZ A;  2IBZ I;  3JCU E;  2OYI B;  5CCH D;  4WY4 C;  5BVZ A;  2IX7 C;  3D89 A;  1NHL A;  1SQV D;  1N7S A;  1M56 D;  1P84 I;  1BCC J;  2NUM A;  1L0N E;  4WY4 D;  1JY2 P;  1X0T A;  1YQ4 C;  2LXB A;  1JCC A;  1S5L H;  3AE7 C;  3EN1 A;  2E75 D;  1JY3 N;  1SQQ E;  1QX8 A;  3L35 A;  1M1J B;  3P8C E;  3HE4 A;  4JYB A;  1FU1 A;  5AW4 B;  3PH0 A;  4EYY Q;  3PP5 A;  4DCK A;  1LWU A;  3AEE C;  2JWD A;  2IFM A;  1LJ2 A;  2HMM A;  5AVX B;  3S9O A;  3RK2 B;  2JP3 A;  1LTG C;  3Q5R A;  3AE1 C;  3H1L E;  2HMK A;  1NTM E;  1YJ9 P;  3KZI H;  4QDF A;  2O1J A;  1NTZ K;  1YQ3 C;  3WUT A;  4HM5 A;  1NTK D;  3L75 J;  3IN6 A;  3H1H J;  3T97 A;  2ZVN B;  1SQX E;  3H1K D;  4U3F E;  2FY8 A;  3H1J J;  2B87 A;  3B71 A;  2WSC J;  2O1K A;  1JCD A;  3VP9 A;  2FYU D;  1O7W A;  2GUS A;  3CX5 E;  3HD7 C;  1RE4 C;  1LP1 B;  1S9K E;  1VQ5 P;  2OYO A;  4PD4 E;  2JKV A;  1EDK A;  1AA0 A;  3HRN A;  3TSI A;  5KLV D;  1GW4 A;  2KSE A;  5GTH E;  2FXM A;  2IBZ G;  2O3J A;  3TGU G;  1VM9 A;  3M0D C;  4ZMD A;  2JWA A;  1SQP G;  3A0B E;  4DJG A;  1YTZ T;  1BE3 G;  2KIK A;  1M90 Q;  2WSC H;  3TK1 A;  3CCM P;  3L73 G;  4PD4 H;  1HJB A;  3SWF A;  1RHZ B;  4WY4 B;  3VMH D;  4D6T D;  4ZKU A;  4R4L A;  1XTC C;  1HGV A;  1AJY A;  1FZC B;  2E75 B;  5B5E E;  2HMJ A;  4AAY B;  4UB8 H;  2LKM A;  1JMB A;  1OX3 A;  2IPP A;  3PJS K;  2HLO A;  1BGY G;  5M1B A;  3VP8 A;  2WMM A;  2MJZ A;  3GTS A;  2KB7 P;  2QJP C;  2WSF J;  1UUW A;  1L0L E;  2WPV B;  2ZAE B;  1SFC C;  1Q7Y Q;  3RK3 E;  1QEX A;  5B5E H;  3L71 G;  4NPF X;  2WPQ A;  3GL0 A;  1SFC D;  3G6E P;  1PZQ A;  3HE5 A;  1YBK A;  1SQP D;  3WU2 E;  2UWJ E;  3KPE A;  1P84 D;  5GTI E;  1BE3 D;  1KQL A;  1H0T B;  3L72 D;  2DW3 A;  3U1C A;  1JY2 N;  3LIE A;  2GBW A;  2GBX A;  4PJ0 H;  2QJK C;  5APU A;  1SQV J;  2WSF H;  3L37 A;  3U1A A;  4QUQ A;  2A06 E;  1OVV A;  3D6Z A;  1IFM A;  2KLU A;  1KYO E;  5GTI H;  4GKG A;  2FXO A;  1LTT C;  1JEK A;  1R5S A;  4IL6 X;  2H7H A;  1PP9 G;  1SQB G;  1N2D C;  3L70 G;  2G8Y A;  4RO0 A;  3L36 A;  4BRY A;  2QA4 P;  3L74 D;  1VQO P;  2HPC A;  1A02 J;  3BRV B;  4LLH A;  2DE6 D;  5APV A;  1E5W A;  1JTH A;  4EIJ A;  2C0W A;  1KYO H;  4HJG H;  2K37 A;  3HUS C;  2OAR A;  5H2F E;  3MP7 B;  1NYH A;  2NVE A;  2L91 A;  1NTK J;  3GZY A;  3WMM 0;  4H0L C;  1NTZ E;  4NBG D;  4IL6 E;  1KIL A;  3L4F A;  3H1K J;  1L0N G;  1LTB C;  2AEM A;  1KB9 I;  4H0L D;  2FYU J;  4NB8 D;  1FJP A;  4JF7 A;  1SQQ G;  2W6B A;  1MKM A;  3GB4 A;  2Z5H A;  2P2U A;  2JZA A;  2QJP B;  5AW0 B;  3H32 A;  3TYY A;  3GMA A;  2HR3 A;  1TU3 F;  1JMM A;  1PP9 D;  1SFC B;  3L70 D;  5CJ4 A;  5KLV J;  1J2J B;  2Z4E A;  3V2P A;  1GL2 D;  4DOJ A;  4U7J A;  3B5N A;  3CC4 P;  4GOE A;  2IYO A;  1VQ7 P;  1CZQ A;  2M3B A;  3H1L G;  4WB4 A;  3R4Y A;  3C0D A;  4HB1 A;  1UIX A;  1NTM G;  3GHG A;  1AVY A;  2B24 A;  1J1D C;  5CHX A;  2Q7C A;  3GOB A;  5CCG C;  1L4A C;  3VCP A;  3VMA A;  2J58 A;  4LC1 A;  4D6T J;  2BCC E;  2QJK B;  2PFX A;  1SQX G;  4U3F G;  2WTY A;  1LGH B;  5APW A;  5AW2 B;  2WT7 A;  5AVS B;  3FX0 A;  5CCG D;  1L4A D;  1O7N A;  3KHU A;  2FXP A;  1EZV E;  3RL0 C;  3CWB E;  3A2A A;  5HL4 A;  4C7N B;  1RF1 C;  3MGN A;  2N9Y B;  2YO2 A;  4HYT B;  1GU5 A;  1X9V A;  3AE9 C;  4UB6 H;  3RL0 D;  2KZI A;  2P1J A;  2OYI A;  4I1L A;  1ZRT E;  2E43 A;  4NBD D;  5C39 A;  1IZN B;  3P8M C;  1JM0 A;  3H1L D;  1KN7 A;  2YXQ B;  3HUS B;  2XRX A;  2QE7 H;  1LTJ C;  5APT A;  3L72 J;  1NAF A;  3FXE A;  4H0L B;  1JY2 O;  1CSB A;  1M1J A;  2Y0E A;  3CXH E;  4C7R A;  1SQX D;  1EDJ A;  1RF0 C;  5KTB A;  2V4H A;  1NDO A;  2VRS A;  4NBE D;  1GL2 B;  3CC7 P;  3O6Q B;  1L0L G;  2B88 A;  3BVH A;  3R2P A;  2A45 H;  3L74 J;  2Y0D A;  3C8V A;  1U7J A;  1EC5 A;  2GM4 A;  3RL0 g;  4HM7 A;  4JBZ A;  3MUD C;  1J1D B;  1X8Y A;  1URQ C;  1KB9 D;  2E5Y A;  5KLI C;  1L4A B;  1AV1 A;  4W7Y A;  1RE3 A;  1FZA A;  1OW7 A;  3H1I E;  1H89 A;  3H6P A;  4HM1 A;  3V4Q A;  1URQ D;  1S5L X;  2KUB A;  3G3Z A;  2BMQ A;  4I2L C;  2A06 G;  3RL0 B;  5AVW B;  1RF1 B;  3CME P;  1T3U A;  3IFM A;  1SLQ A;  2ZFC A;  4HKV A;  3M06 A;  4TT3 H;  3HTK B;  2WIT A;  5CCH A;  3CCJ P;  1PP9 J;  1FBM A;  1WT6 A;  2KK7 A;  3L70 J;  2NUK A;  3BCC E;  3II6 A;  4WY4 A;  4N78 E;  1Q2N A;  1PIX A;  1SVF A;  1IK7 A;  2YKP A;  5CBN A;  3IAO A;  1S5L E;  3VMI D;  3C9I A;  4DT0 A;  5KAF H;  1PPJ E;  4C46 A;  1H88 A;  1FZG A;  1IFN A;  1RFS A;  1LTJ B;  4RJT A;  3V2N A;  4ASW A;  2YO3 A;  1VQ4 P;  2Y9Y A;  3GKE A;  4CPG A;  1NTZ G;  1AQT A;  1PGQ A;  1SQV K;  1WMK A;  2GA1 A;  4IFD K;  1FZC C;  2E75 C;  4ZKP A;  3C1L A;  2HOD B;  4B86 A;  2NPS A;  1XTG B;  1ZP0 C;  1Z56 A;  4GOF A;  1NH4 A;  1W5C E;  1BCC E;  3AZC A;  3BRT B;  1VQ8 P;  2WQY C;  3KZI E;  1IFJ A;  2I1J A;  3I55 P;  1OVR A;  2WSS H;  1FZE A;  3CXH I;  1H0T A;  2JR8 A;  5B66 H;  1QL1 A;  1S72 P;  3PHL A;  5CMZ A;  4RES B;  2KOG A;  2O01 N;  5AEU A;  1KTM A;  4WWI A;  3CD6 P;  2AXT E;  3USS A;  1LT9 C;  2IDB A;  3V4W A;  1N73 C;  1URQ B;  2KS1 B;  1NTK K;  3HD7 A;  5KLI B;  1RE4 A;  4JPZ B;  2N1T C;  2BCC G;  2GUV A;  3W68 A;  5AW7 B;  1UUV A;  3L75 E;  1Y8A A;  1NU1 J;  3H1H E;  2I8D A;  5BU8 B;  2N1T D;  2FYU K;  1EG9 A;  1FDM A;  1LTI C;  2AXT H;  3H1J E;  2W8Z A;  1OW8 A;  1AVO A;  3M0D A;  1Y9B A;  1O7H A;  1HBW A;  1T6A A;  1PGO A;  2AXC A;  3NXS A;  3PLN A;  4GIF A;  2Q6Q A;  2YMK A;  3BAT A;  5KLV K;  3NFQ A;  1YJW P;  1DEB A;  2XU6 A;  3B8E B;  1GDT A;  3A0H H;  4UB8 E;  1KQF B;  4NBB D;  4NBF D;  5DJT B;  1LT1 A;  1JOC A;  3RBZ A;  4R4M A;  2XNX A;  3VMX A;  1FE6 A;  3P7K A;  1N86 A;  2KI7 B;  4EDF A;  2NVG A;  3RBX A;  1KD1 Q;  2ZYD A;  1NO4 A;  5AW6 B;  1KZU B;  1SFC A;  5AVZ B;  1PV3 A;  2CKF A;  2P67 A;  4P1B H;  2KNC A;  1OMI A;  5AW3 B;  1VQN P;  3EQ2 A;  1Q81 Q;  4DZO A;  4H44 C;  3AE6 C;  1JB0 J;  3M91 A;  1NYK A;  1LTS C;  1ZME C;  2K9Y A;  3SWK A;  3TNU B;  4H44 D;  3QWO C;  1HJ0 A;  1AQ5 A;  4PJ0 E;  3JSV C;  2WZ7 A;  3CCQ P;  2IBZ D;  3TGU D;  3GG2 A;  2WPR A;  2P10 A;  1ZRT D;  2C9N Y;  1PGJ A;  2WPS A;  1EQ7 A;  1Q86 Q;  3KXD A;  2YFI A;  1LT9 B;  1N73 B;  1FZF A;  3L73 D;  2HYN A;  1PFI A;  1KV4 A;  3A3Y B;  4EOT A;  3SSU A;  1W2E A;  4C7N A;  2N1T B;  1SS1 A;  3H1I G;  1VQK P;  5CJ0 A;  3VYI A;  1U57 A;  3CL3 D;  1S1C X;  5DJU B;  3A5T A;  1K9M Q;  1KOR A;  1GMJ A;  2J5U A;  1K04 A;  1SQV E;  1FJK A;  1T8Z A;  2HG5 D;  3AED C;  3KDP B;  1JY3 O;  3UIA A;  1BGY D;  2W6A A;  2OYH C;  4IFF A;  1HVV A;  4MN4 C;  3HUS A;  1M8O B;  4HM0 A;  3CX5 I;  2D2C C;  3BCC G;  2OTL P;  3T97 B;  2B9B A;  1YHQ P;  1LTA C;  3L71 D;  3F89 A;  2B87 B;  3A7O A;  4PD4 I;  1JNM A;  2D2C D;  3M9Q A;  1VCK A;  2BMO A;  1PPJ G;  3GZX A;  1FDO A;  1NKZ B;  2ZYL A;  2IZ0 A;  3NMD A;  3AEB C;  5AVY B;  2K3R A;  3KYQ A;  1YI2 P;  4OGQ C;  4W80 A;  2YXR B;  1NTK E;  3O6Q A;  1K73 Q;  4OGQ D;  1GK4 A;  4RKU J;  2H8P D;  2K9J B;  1BCC G;  3H1K E;  3CC2 P;  1DH3 A;  4H44 B;  5BOK A;  3F5H A;  1GL2 C;  4YPC A;  2QJY C;  2FYU E;  2R3S A;  4NBC D;  2MKV A;  4EMJ B;  3AEC C;  3W67 A;  1SQB D;  3IR9 A;  1VPC A;  3K5B A;  1IFD A;  2YKO A;  5KKZ C;  1IFP A;  5CCG A;  1L4A A;  1KIL C;  5KLV E;  5TIS H;  1ZXG A;  2DE5 D;  3GW6 A;  2W83 C;  4WBA A;  2FYN C;  1DEE G;  1KIL D;  2Z5I A;  3GF7 A;  3S1K A;  4UB6 E;  3AEA C;  3AE2 C;  3AE4 C;  1RF1 A;  5APX A;  2WVR A;  1M7L A;  3L75 G;  3HTK A;  3AEF C;  2NZ2 A;  4Y99 C;  4D6T E;  1L0N D;  2BEQ D;  4OH8 B;  3TDK A;  1VF5 C;  2FFD C;  5APY A;  2JO1 A;  4QDD A;  4OWF A;  1SQQ D;  3D71 A;  2H89 C;  2OYH B;  1ZLL A;  2Y9Z A;  1VF5 D;  2ITA A;  3AEG C;  1VQM P;  3P8C D;  1AFO A;  3CCU P;  3CPW O;  1LTJ A;  2D2C B;  4KHX A;  2M0B A;  1KYO I;  3EFG A;  2QG4 A;  5AVQ B;  3TGU J;  1S3J A;  1KFM A;  2Q1K A;  3JC2 2;  2C0X A;  1GK6 A;  4ZNC A;  2J59 M;  1SQP J;  4NB9 D;  1NTM D;  1BE3 J;  2IZ1 A;  1SJG A;  3L73 J;  1RF0 A;  4XFJ A;  4OGQ B;  2R5D A;  3L72 E;  1NU1 K;  4HM8 A;  4U3F D;  2QSI A;  2M3E A;  4ASV A;  3BAS A;  4YXW H;  3V2Q A;  3CX5 D;  2ZYA A;  2E5T A;  2QJY B;  1BGY J;  5KJ7 C;  5AVT B;  2M5A B;  1S9K D;  3AE8 C;  1P84 H;  1G2C B;  1R5L A;  4PD4 D;  3MUD A;  1KC8 Q;  1OIP A;  5APQ A;  1BSN A;  1EDI A;  1URQ A;  3FXD A;  5KJ7 D;  2XSO A;  2O01 J;  5KKZ B;  1KIL B;  3L71 J;  3SFE C;  2Y0C A;  3L74 E;  1RIE A;  2FYN B;  2OGU A;  2ZT9 C;  1G8K B;  2WSE J;  3ZDM A;  2FKW B;  1ZR2 A;  2FBW C;  3OAK A;  3WUV A;  1MFT A;  1LP1 A;  4HM3 A;  2ZT9 D;  1O7P A;  1OZH A;  2YKQ A;  3KQG A;  4Y99 B;  5KAI E;  1ZOY C;  4L74 A;  2E4Q A;  1VF5 B;  2FFD B;  3CLQ A;  2B89 A;  2OQQ A;  5KAF E;  2CK3 H;  5L8R J;  3RK3 C;  5AVV B;  3OJA B;  4PV1 D;  3H25 A;  4QUR A;  3RGU A;  1SQB J;  2H88 C;  1L0L D;  1EZV I;  2SPZ A;  2K88 A;  3RK3 D;  3EWK A;  4KJM A;  4XA4 A;  5KAI H;  2RKL A;  4GT1 A;  1PP9 E;  4GDO A;  3L70 E;  4NBA D;  3Q5S A;  2BEZ F;  1FZC A;  1IK9 A;  1RY3 A;  2ZXX A;  2XR8 A;  2QVA A;  1A02 F;  1Y47 A;  2R32 A;  1G8J B;  3Q3D A;  3SWY A;  4L73 A;  1L2P A;  1MFZ A;  4HH2 A;  2PAJ A;  1YTZ I;  1MZ9 A;  3FGA D;  4QDC A;  1NTK G;  4IFM A;  3TNU A;  5B66 E;  1QLE D;  2QEX P;  1L0N J;  1T3J A;  1OW6 A;  2A06 D;  1IJD B;  2NWF A;  3H1K G;  1KYO D;  1OFC X;  1O7M A;  2FYU G;  1SQQ J;  2BAS A;  2A45 I;  2IFN A;  1K8A Q;  2RH0 A;  1LT9 A;  3U59 A;  1N73 A;  1JO5 A;  1S2E A;  2W27 A;  1N7S C;  3JCU H;  1ZN5 A;  2Q9I A;  2N1T A;  5KLV G;  5AW1 B;  1DD3 A;  2NPS C;  1QGK B;  2C9L Y;  1RQU A;  1N7S D;  2KYV A;  2ZT9 B;  3H1L J;  2QRX A;  1NJI Q;  1HF9 A;  1NTM J;  2NVF A;  3MIW A;  2NPS D;  2KP8 A;  4BXL A;  1EXJ A;  2L5G B;  1R8E A;  1NTZ D;  1Q82 Q;  1LWU C;  2LXC B;  1IO4 A;  4K3A A;  1SQX J;  4U3F J;  4D6T G;  1EZV G;  2CPS A;  4PV1 B;  4HM4 A;  3V2R A;  1ZV8 A;  3A0H E;  4JQ0 D;  3CWB G;  2YMY A;  2QM7 A;  1NU1 E;  2JO6 A;  4NBH D;  3RK3 B;  2QPZ A;  5AW5 B;  1M57 D;  1U7M A;  3TF5 A;  5AW9 B;  4M3L A;  2HML A;  1Q90 C;  3VCA A;  2XZR A;  2KZJ A;  3HD7 D;  3Q1M A;  3CCL P;  1Q90 D;  4HJL A;  1FQT A;  2K9J A;  1GZL A;  2E42 A;  3CX5 H;  2HMN A;  3OW2 O;  2W90 A;  1VQP P;  4YTP C;  4YXD C;  2A45 G;  2BCC D;  1KB9 E;  3I5C A;  3L72 G;  1USE A;  1VL2 A;  1RH5 B;  4NPD A;  3LID A;  5GTH H;  1EZV D;  1OWA A;  5CXM A;  4OVN F;  3FWL A;  3CWB D;  5AVU B;  5EFW B;  4QUP A;  2B1X A;  1DX7 A;  1K05 A;  3VMY A;  3A0B H;  1CI6 B;  1MV8 A;  2P58 A;  2HMO A;  1KB9 H;  1L0L J;  2CPB A;  3VTP C;  1N7S B;  4I6M C;  3O8Z A;  1HTL C;  3L74 G;  2N9B A;  3P32 A;  1H8A A;  2NPS B;  1NWQ A;  1SQP K;  1VQ6 P;  1FOS F;  2YNY A;  2ZVO B;  3ABV C;  3M9H A;  3HE4 B;  1BDC A;  1X79 B;  3OA7 A;  5E79 E;  2R3C A;  1LWU B;  2KSJ A;  4AYC A;  2OYH A;  2E76 C;  1D7M A;  3CXH D;  2ZXE B;  3B4S A;  3GL2 A;  2POH A;  3CCS P;  4P1C H;  2E76 D;  1G1J A;  4QDF B;  3DQY A;  3ITK A;  2RN0 A;  2V7Q J;  1USD A;  5E79 H;  3WU2 H;  3HD7 B;  2HFE D;  1YJN P;  1S4X A;  3GCE A;  1NKN A;  1ZW0 A;  1UII A;  3FWN A;  1J1E C;  4AIV A;  1NAY A;  3E1I A;  4TLF A;  2XV5 A;  4GOD A;  3CMA P;  2E74 C;  2R44 A;  2QM8 A;  4N3Y B;  1GL2 A;  2JDI H;  2E74 D;  3H1I D;  2LR2 A;  3E7K A;  4AQR D;  1NTZ J;  5AEW A;  4AUW A;  2M5A A;  2AEJ A;  2V7Q H;  1G2C A;  3NTN A;  4QMA A;  2PP6 A;  2ZYG A;  3MD0 A;  1KMI Z;  5TIS E;  3S4R A;  3QH9 A;  1GD2 E;  1EXI A;  1JUN A;  1SQB K;  1NOH A;  5H2F H;  5AW8 B;  1DIP A;  3BCC D;  3WUU A;  3EQQ A;  4N78 D;  3M9B A;  4IL6 H;  2KNC B;  2Q5U A;  3CI9 A;  2XKM A;  4KT0 J;  4IOI H;  2YIU C;  3LW5 J;  1PPJ D;  4I7Z C;  2FFD A;  1VQ9 P;  2YFL A;  1OXZ A;  1QVF O;  1QL2 A; 
#chains in the Genus database with same CATH homology
 4H44 D;  4PD4 E;  4HM6 A;  1KB9 E;  3GCE A;  2GBW A;  3D89 A;  1NTK E;  2GBX A;  1UUV A;  2NUK A;  3L75 E;  2QJK C;  3VMG D;  3BCC E;  2YVJ B;  4OGQ D;  4AIV A;  2E4Q A;  3H1H E;  3CXH E;  2NUM A;  3L71 E;  4QUQ A;  1L0N E;  1VM9 A;  3H1K E;  5CXM A;  2A06 E;  1EG9 A;  3H1J E;  4NB9 D;  5BOK A;  3N0Q A;  3C0D A;  4QUP A;  2B1X A;  1ULJ A;  3VMI D;  2NVF A;  1KYO E;  4PV1 D;  2QJY C;  1SJG A;  2FYU E;  2YFI A;  4NBC D;  1O7H A;  1PPJ E;  1NDO A;  3EN1 A;  1RFS A;  2E75 D;  4EMJ B;  2B24 A;  4QUR A;  2HMO A;  1SQQ E;  4NBE D;  1O7G A;  2E74 D;  5AEW A;  3GKE A;  3GOB A;  2BMR A;  3L72 E;  3VMH D;  3VCP A;  2I7F A;  2BCC E;  4HM8 A;  1PP9 E;  5KKZ C;  3L70 E;  4NBA D;  4HM4 A;  5KLV E;  2DE5 D;  1SQV E;  2IBZ E;  1JM1 A;  2HMM A;  1NU1 E;  1O7N A;  3TGU E;  2DE6 D;  2JO6 A;  4NBH D;  4QCK A;  2HMJ A;  4AAY B;  1EZV E;  4NBB D;  1BCC E;  2FYN C;  2XR8 A;  3GTE A;  4NBF D;  3AZC A;  4HM7 A;  3H1L E;  4H13 D;  2QPZ A;  4HM2 A;  1SQP E;  1G8J B;  3CWB E;  5HL4 A;  1P84 E;  2HMK A;  1NTM E;  1BE3 E;  4QDF A;  2HML A;  3GTS A;  1WQL A;  3L73 E;  2NVE A;  2QJP C;  1Q90 C;  1UUW A;  5KLI C;  1SQB E;  4HM5 A;  3VCA A;  4HM0 A;  3GZY A;  4QDC A;  1L0L E;  3H1I E;  2XSO A;  2NVG A;  1NTZ E;  2Q3W A;  4HM1 A;  4NBG D;  3EQQ A;  1ULI A;  4D6T E;  1SQX E;  2BMQ A;  4U3F E;  3L74 E;  2NWF A;  2CKF A;  1ZRT E;  3GL2 A;  4NBD D;  4P1B H;  1RIE A;  3GL0 A;  4HJL A;  4P1C H;  4H0L D;  1FQT A;  2XSH A;  2D2C D;  2E76 D;  3FOU A;  1G8K B;  5AEU A;  1VCK A;  2YIU C;  4QDD A;  4QDF B;  2YFJ A;  3DQY A;  2BMO A;  1O7M A;  1O7W A;  3CX5 E;  4NB8 D;  3GZX A;  2YFL A;  1NYK A;  2HMN A;  2XRX A;  2E4P A;  2ZYL A;  4HKV A;  3GB4 A;  1VF5 D;  2DE7 D;  1BGY E;  4HM3 A;  2JZA A;  2ZT9 D;  1O7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...