1NTME

Crystal structure of mitochondrial cytochrome bc1 complex at 2.4 angstrom
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
molecule tags Oxidoreductase
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
total genus 49
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ntmE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ntmE02
4U3FE 4PV1D 4QDCA 1G8KB 3GZYA 4P1CH 3VCAA 3H1KE 1NU1E 1O7NA 3EQQA 1NDOA 4QDDA 1PP9E 2GBXA 1O7GA 4H0LD 4HKVA 3GKEA 5KLVE 1EZVE 2YFJA 2DE7D 1BCCE 1SJGA 1Q90C 2E4PA 3GTSA 4HM7A 4HM4A 2XSHA 2NVFA 3H1LE 5KKZC 4QDFA 5CXMA 4H13D 3VMHD 2ZYLA 2QJPC 1O7WA 2QPZA 2HMOA 3L73E 3H1HE 5BOKA 4NBAD 2NVGA 3CWBE 1FQTA 2YFLA 4D6TE 1L0LE 3GCEA 1SQVE 1NTZE 2BCCE 3GL2A 4QDFB 2QJYC 3L72E 1SQQE 1O7MA 1ULJA 2ZT9D 2BMOA 1JM1A 2HMLA 3GB4A 3GZXA 4HM3A 3CXHE 1RFSA 3GTEA 4NBGD 3FOUA 1P84E 4QURA 2I7FA 1WQLA 2XSOA 4NB9D 3L75E 4NBDD 4AAYB 4NB8D 1NYKA 1L0NE 1VF5D 4HM0A 2E75D 1BE3E 4P1BH 1ULIA 2CKFA 2E76D 4AIVA 3EN1A 1KYOE 3VMID 2B1XA 2NUMA 4NBHD 2NVEA 3VMGD 5AEWA 1SQBE 2HMMA 2B24A 1EG9A 3TGUE 3GL0A 3N0QA 4NBED 3D89A 1ZRTE 3H1JE 3L70E 2IBZE 2YIUC 3C0DA 2DE6D 4NBBD 1NTKE 1NTME 2HMJA 3GOBA 4H44D 5AEUA 3AZCA 4QCKA 1BGYE 4EMJB 2GBWA 3L71E 1SQPE 2E74D 2E4QA 5KLIC 2FYUE 4QUPA 2D2CD 4PD4E 1VM9A 2XR8A 4HJLA 4OGQD 2BMRA 2DE5D 1O7HA 2YVJB 4NBFD 2YFIA 4QUQA 1SQXE 1UUVA 3VCPA 4HM6A 1G8JB 2BMQA 3H1IE 4HM2A 2A06E 3CX5E 2HMNA 1VCKA 4HM5A 2FYNC 2XRXA 4HM1A 4NBCD 3DQYA 3L74E 1O7PA 2NUKA 3BCCE 2JO6A 1UUWA 2QJKC 1PPJE 2Q3WA 2NWFA 2JZAA 4HM8A 2HMKA 5HL4A 1KB9E 1RIEA
chains in the Genus database with same CATH superfamily
3PHLA 4LGDE 1NDOA 4N6JA 2YXQB 4TLFA 3CWBJ 3MUDC 4O9BA 4AQRD 3C1LA 3HD7C 2FFDA 1CI6A 3FWLA 1YBKA 5AVQB 3L72J 3VN0A 1BSNA 1HF9A 2WITA 1O7WA 1LTJC 3L72D 3HE4B 1RE4A 5KTBA 1U7JA 1L0LE 1KB9I 5AVSB 4YTPC 3GL2A 1EXJA 1PV3A 3CWBD 2W8ZA 3II6A 1AVOA 3H1HJ 1EZVI 2D2CB 4I1LA 2ZFCA 3VP9A 2AEFA 3PJSK 3TDKA 1KYOD 1RQVA 3V2NA 1KTMA 1P84D 3AEDC 1LWUA 3RK3C 1YI2P 1JUNA 3KZIH 2AEJA 2C0XA 3CCQP 2AXTH 3BCCG 2JKVA 3IF4A 3V5BA 3PTZA 2E76B 2YIUC 1USEA 2HMJA 4QCKA 1RHZB 3L71E 2WPSA 1SQXD 2OYHC 4D6TG 3T97B 2FYUE 3OW2O 2KB7P 1CW5A 4I7ZB 1PPJG 3SWKA 3LW5H 2R3CA 1VQ5P 3HTKA 1LP1B 2CPBA 2WVRA 3DQYA 2QEXP 1UUWA 4I7ZC 3TF5A 3Q1MA 5K5GB 3OA7A 4ASWA 2OTKE 1RE3C 2YKPA 1LTJA 1E79H 3VP8A 4R4MA 1NTZJ 1M8OB 1ZLLA 3Q5SA 2XSHA 1PZQA 2ZYGA 1SQVD 3USSA 1R8EA 3CC4P 2A45H 4H0LC 2PRRA 3GHGC 1YYCA 1OZHA 3ZDMA 2B87A 1JY2P 1SQQE 2IZ1A 1DX7A 2B88A 4GIFA 2DW3A 3GMAA 1J1EC 1T6AA 1WQLA 1T3JA 1Q2NA 1NYKA 3V4WA 1HWTC 3KHUA 3E7KA 3VMXA 1GZLA 1S4XA 1NHLA 1M7LA 1KB9H 4HKZH 2XZRA 2Z5IA 1NTMD 3AEFC 3HTKB 4GKGA 2E75C 2AXCA 1HH0A 1QL2A 3C0DA 1FAVA 4EI2A 1RE3A 3KQGA 3L72G 5BU8B 1YJWP 1SQBD 1BGYE 5GTHE 5KLVK 3MGNA 1SQPK 2E74D 3L70D 1QGKB 1ZMEC 5AW9B 3CWBG 4RKUJ 3A3YB 3N7NA 4NBFD 1BDCA 2O01H 2WT7A 3L70J 1HJBA 4HM6A 4DZOA 1YQ4C 1G8JB 1NTKJ 1HGVA 2H8PD 4HM1A 1SQPJ 2A06G 1BCCJ 2AXTE 1MKMA 1MFZA 3A0HH 3W68A 2KSEA 3ABVC 1NKZB 3H6PA 3A2AA 3B71A 2WSSH 1IK9A 1FZAA 1Z56A 1NOHA 1OWAA 1OIPA 2R5BA 2W6JH 4D6TD 1L0LD 1N73C 4L74A 2BCCG 3G6EP 3L35A 3GCEA 3L75J 1Y9BA 3V6IA 2FYUK 3IAOA 4BRYA 1NYHA 1N73B 2WPRA 1S9KE 3RGUA 1O7MA 1K8AQ 3AE9C 1LGHB 3SWYA 5APYA 3H1LG 4OGQB 4WB4A 1IJDB 1S9KD 2OYOA 4N78D 2K9JB 1PP9G 3T97A 4AAYB 1L0NE 1L4AC 2E75D 2FXOA 1L0NG 2B1XA 2KUBA 2FBWC 5AW0B 4NBED 2PP6A 3D89A 3VMZA 1X22A 3H1IJ 2N9BA 3QH9A 5B5EE 1X9VA 1FS0E 1VQ7P 3BCCJ 1LTSC 1PL5A 2YNYA 4ZKPA 1LT9C 5BVZA 4PD4E 1KILD 3GW6A 4JPZB 2XDJA 2IYPA 1AA0A 2Z5HA 2KLVA 3L74E 2GUSA 2IFMA 1LTAC 1VQLP 4U3FE 1U7MA 3BCCD 5KAIE 3GZYA 1SQXJ 3HE5A 3LIDA 1DEEG 3MP7B 1EDLA 3HE5B 5CHXA 5KLVE 4EYYQ 4HM4A 3L73D 3V2RA 2NVFA 1SQBG 4QDFA 5AW8B 1VQPP 1JY3O 2HMOA 4WY4B 3A5TA 1URQA 1VPCA 1SQVE 3PLNA 4UB6H 1GU4A 4UB8E 1IC2A 1S5LE 1OVVA 1SQVK 1NAFA 4DT0A 1M1JC 1KV4A 1SQXG 2XSOA 3NTNA 2WTYA 3WUUA 1P84I 1AV1A 3B5NC 5B66H 4L76A 1LT9A 3BASA 2MKVA 2FXMA 3GLMA 1DEBA 4I6MC 4C46A 3M9QA 4UB6E 1L2PA 4AUWA 1NTZK 4UB8H 1VQKP 3FXEA 1JY3P 5KAFH 5CCHC 1JY2O 3VCPA 5DJUB 4K35A 3CX5E 4ZKUA 5KJ7D 1VDFA 1KILC 3FGAD 1URQB 5KLVG 2G3AA 1GW3A 5APSA 2Q3IA 2WSFH 1ZR2A 2KS1A 1KQSO 5AVVB 1KB9D 2OGUA 2FYZA 1K9MQ 1URQC 2WSCJ 3GTSA 1SJGA 4HM7A 3H1HD 4KT0J 5M1BA 1N7SB 1Q82Q 1FBMA 4D6TE 3WU2E 3L71G 2BCCE 4C7RA 2KIKA 1J2JB 5APTA 2OYIA 1JY3N 3RL0D 2BCCD 1OFCX 2KP8A 2V7QJ 5E79E 2XNXA 2I7FA 2Q1KA 1SVFA 1NTZG 2ZT9C 2KLUA 1NH4A 1N73A 1BE3E 2K88A 2V4HA 3MTUE 4AIVA 4JBZA 4L75A 2A45I 2NVEA 4EDFA 5AEWA 2CPSA 2HMMA 1PGPA 3A7OA 3VYIA 5CBNA 1R5LA 1SQQK 1HBWA 1QVGO 2Q3EA 2QRXA 3TGUD 4OWFA 3RBXA 2IZ0A 2B87B 3FWNA 1HJ0A 5TISH 5AW4B 2G8YA 2YVJB 1SS1A 5E79H 3HD7B 1T2KC 2D2CC 2WPQA 2H89C 4NPEA 2HMKA 3BVHA 1EDIA 2M5AB 1G8KB 3AE5C 4W80A 3CXHH 5CJ4A 3AE1C 3VMYA 2KNCB 3EFFK 5CXMA 2QIWA 3LW5J 3H1KJ 2KZIA 3HD7D 2FY8A 2PAJA 1QX8A 1H0TB 1GU5A 2ITAA 2SPZA 5KLIB 2E76C 2POHA 1OXZA 2H43A 2N1TD 4W7ZA 3CCMP 2QM8A 1SFCA 4IL6X 2QSIA 1RF0A 3H1JD 1RQUA 4NBHD 1RF1B 3VMGD 1U57A 1JY2N 1BGYD 1N86A 1SLQA 2R5DA 1KC8Q 2JWAA 2H88C 1JNMA 3UIAA 2CK3H 2KNCA 2XNDH 3VTPC 2XR8A 2DE5D 4NPDA 2P1JA 4XFJA 5L8RJ 3D71A 2QJKC 3IN6A 1KMIZ 3Q3DA 1S1CX 2OARA 2LR2A 3VMAA 3OJAB 4HJGH 1NU1E 5TJHA 1ZOYC 3CPWO 4Y99C 1O7GA 1KILA 2E75B 4JF7A 2YFJA 1G2CB 5KJ7A 3B5NB 3NMDA 2HPCB 1IFDA 3L37A 3RK2D 1AFOA 1BCCD 5KKZB 4NBAD 3CWBE 5APWA 5B5EH 3P7KA 4H13C 1N7SA 2RKLA 4WWIA 1DD3A 1QLED 3L72E 3A0BH 2WSCH 5AVZB 5AW2B 2KSJA 2LKMA 1K73Q 4HM3A 1VQ4P 1RFSA 2QJYB 1P84E 2WWWA 1E5WA 1J1DB 4NB8D 2K9YA 2P7JA 1KFMA 3BRVB 1LNQA 1NVOA 3GF7A 5CCGA 5KAIH 1NTKK 4YXDC 3I55P 3TGUE 3KYQA 4NBBD 2KXPB 4PD4D 3CC7P 1LTTC 1X0TA 4GOEA 1HUCA 1VM9A 1QVFO 2WSEH 3ITKA 3RL0B 4AYCA 1UUVA 1PPJD 5C39A 1IFNA 4WY4A 2BMQA 3AECC 2HMNA 2Q9IA 1JTHB 3L71J 3H1KD 3H1ID 2A06D 1TU3F 3HUSA 3CD6P 1G1JA 3L74D 3VCAA 3L4FA 2MJZA 2YKQA 3N4XA 2JO1A 4A7PA 1PP9E 2L91A 5TISE 1OW8A 2OTJP 3H1LE 3O6QB 1OW6A 3AEAC 1NTZD 3IR9A 1BSHA 1D7MA 1URQD 1LT9B 5CJ0A 1FQTA 4DOJA 2YFLA 1EDJA 1NTZE 3I5CA 1DD4A 4QDFB 2KOGA 1M1KQ 5GTHH 1VL2A 2JWDA 2E43A 1GL2A 3A0HE 5CCGC 4NBGD 1GL2B 4PJ0E 1YTZT 3CMEP 2XV5A 3C8VA 4NBDD 5AW1B 3G3ZA 2QVAA 3FX0A 3NFQA 1N2DC 4JYCA 1FZGA 3MZWB 2OQQA 3O8ZA 3CMAP 4YXWH 5APVA 3F5HA 2J5UA 3GL0A 1BCCG 1AVYA 5CCHA 3M9HA 3Q2YA 1NTME 1XTGB 3PRJA 2ZYAA 4WY4C 3SWFA 2K37A 2NZ2A 1DIPA 2YMYA 1P84H 2BMRA 4I2LC 1O7HA 1BGYG 3HUSB 2HR3A 1RF0C 1YQ3C 2Q3WA 1FDOA 3R4YA 2XKMA 3EQQA 1NAYA 3O6QA 1VQNP 4XE5B 1BCCE 2J58A 3AEBC 4BXLA 4BRYB 2ZYLA 1K05A 1EZVD 1RY3A 5KAFE 4RO0A 1X79B 1SQBK 2I1KA 3MIWA 4GT1A 3MD0A 5AW6B 4Y28J 3U59A 1M90Q 3AE2C 3BATA 2NRGA 3S9OA 4GODA 2Q5UA 1JCCA 3H1IG 1JM1A 1KILB 2OYHA 2P2UA 3M9BA 2M8RA 3L75E 4HM0A 1SQVG 1N7SD 2J59M 1H89A 1ULIA 2CKFA 5EFWB 3NXSA 3L75D 2XU6A 2OTLP 1S72P 2QJPB 1L0ND 4IFMA 2RH0A 2FKWB 1IO4A 2E74C 2M0BA 2ZYDA 2H7HA 1EG9A 3N0QA 1N7SC 2WT7B 2FYUD 3B5ND 1L0NJ 1MUUA 3CCVP 2HPCA 3CCEP 2E4QA 3CCSP 2O1JA 1NTMK 4OGQD 2W90A 2E5YA 1UIXA 4QUQA 1HVVA 1OW7A 2IYOA 3H1IE 1GL2D 3JCUH 1FZFA 3BCCE 4ZNCA 1PIXA 2JR8A 2IBZI 3RL0g 3G4SP 5HL4A 5KLVD 3L73J 4GDOA 1KORA 1R5SA 5GTIE 1BDDA 4U3FD 3E1IA 2ZJSE 5APQA 3EWKA 3L74J 1JO5A 1L4AB 5AW3B 1K04A 4U3FJ 3B8EB 1SP4A 1JEKA 1WMKA 2ZT9B 1H8AA 1FZEA 1SQPG 4OVNF 2RN0A 1FZCC 1Y8AA 3CXHI 1L4AA 3F89A 5APXA 2LXCB 4WBAA 1GTWA 1JOCA 1EC5A 1SQBJ 2GM4A 2GUVA 3WMM0 1N7LA 1SQVJ 2HYNA 2Z4EA 1S2EA 3H32B 3EN1A 2WMMA 2QE7H 3GHGA 3M0DC 3H1JE 3CL3D 2YMKA 3L36A 1NU1G 2OYIB 2FYNB 1GL2C 2C9NY 2YFIA 1OVRA 4N3YB 1UIIA 2FYNC 1Q86Q 4C7NA 1LWUB 4WVZA 3WU2H 1LP1A 2FFDB 1IK7A 1FDMA 1KB9E 1Q90D 1FZBA 1T2KD 4QDCA 1IFJA 4QDDA 3RK2C 1NGMB 1L0LJ 1FJPA 1EZVE 2E4PA 5AW7B 3AEEC 1FZCA 3QWOC 2WQYC 3H1HE 2M5AA 4U7JA 2K3RA 2QG4A 2Y9ZA 3M0DA 3HRNA 2W27A 4L73A 4LC1A 4PD4H 2IBZG 2I1JA 3LIEA 2ZVOB 2KYVA 3R2PA 3RK3D 3FOUA 3JSVC 3KDPB 3AE6C 3S4RA 4R4LA 4D6TJ 2PFXA 5AVYB 3P8CD 2BCCJ 1M56D 5H2FE 4P1BH 2E76D 3VMID 2FYUJ 4K3AA 2IFNA 2WSFJ 3L71D 1ZRTE 4BWNA 2IBZE 4HH2A 3TNUB 2UWJE 3CCRP 3AZCA 1CI6B 1OMIA 3CC2P 2W83C 2D2CD 1L0LK 1GK4A 2KS1B 2P58A 1USDA 3AEGC 4Y99B 3V2PA 2N1TB 1GW4A 2P10A 1JMBA 4HM2A 2QM7A 1EZVG 1RE4C 3M06A 3W67A 2C9LY 3I56P 3U1AA 1XTCC 1LTBC 4HM8A 1ZXGA 4XA4A 3H1LD 2HFED 1YJ9P 4HKVA 3GKEA 4ZMDA 2ZXXA 1PP9D 1SQQJ 1EDKA 2QJPC 2QPZA 4LLHA 1SQQD 3RL0C 1SFCD 4IFFA 2NPSC 1FOSE 1FOSF 3GZXA 3L70G 1KQLA 5AVRB 4IOIH 1HTLC 3CCUP 2M3EA 1JM0A 1BGYJ 2YKOA 2WPVB 3OAKA 1JTHA 1CSBA 4WY4D 2O01J 3IFMA 2JEEA 4HB1A 1VF5C 1A02J 4IL6H 1VQOP 2K9JA 3AE4C 3L70E 3B4SA 2R32A 1NTKE 4TT3H 4H44D 5AEUA 1SQPE 4Z1MH 3K5BA 2WZ7A 4HJLA 1M1JA 2Y0CA 1S5LH 4U3FG 4HYTB 4PV1C 2JJLA 2R3SA 2YIUB 1QEXA 1O7PA 5CMZA 2A45G 1IFMA 3GF3A 2NWFA 1G2CA 1RIEA 4GOFA 2OYIC 1JB0J 1YJNP 1W2EA 4KJMA 3RK3B 1WT6A 1VQ8P 1NU1D 1OX3A 3H25A 2NPSA 2WSEJ 1FC2C 2NPSD 3FXDA 1KYOH 2BASA 4OH8B 1WRGA 2I8DA 3Q5PA 2NVGA 1M57D 3PP5A 2FFDC 3D70A 3CXHD 2M3BA 2HLOA 3HUSC 2O3JA 1NTKG 1ULJA 1S5LX 2BMOA 3E1RA 1GD2E 1IZNB 1T8ZA 1CZQA 1VF5D 3GHGB 3U1CA 1RF1A 2HODA 1AQTA 2IBZD 2QJKB 4IFDK 3G9RA 1VQ6P 3S1KA 1JCDA 1BE3D 2B24A 5GTIH 4DJGA 2RMZA 2YO3A 1Q7YQ 3EQ2A 3B5NA 3SFDC 5AW5B 1G1IA 1JMMA 2ZVNB 1L0NK 1YTZI 4W7YA 1NO4A 1PGQA 3TGUJ 1NWQA 1FDIA 1SQXK 1SQXE 3WUVA 3CCLP 1KYOI 1KQFB 3H1JG 2A06E 1KN7A 1KD1Q 1ZV8A 5KLVJ 2L5GB 1A02F 1YHQP 2GA1A 4C7NB 2JZAA 4IL6E 1YIJP 4PV1D 1VQ9P 1FU1A 1O7NA 2GBXA 2E74B 1NKNA 1J1DC 4JQ0D 5KKZC 1SFCC 1MV8A 1FJKA 1PP9J 2Y9YA 3MHVA 3EFGA 3RBZA 1SFCB 3H1LJ 2QJYC 3KPEA 2QA4P 1L4AD 2C0WA 5CBOA 3GB4A 3GTEA 1SQQG 4QURA 3V4QA 1IFIA 1ZR4A 3CI9A 3M91A 1H0TA 3WUTA 3KXDA 2NUMA 3CX5I 1AJYA 4RJTA 1VF5B 1NJIQ 1LTGC 3BRTB 4OGQC 3AE7C 1LJ2A 4B86A 2P67A 4PD4I 3VOPA 1ZP0C 2ZAEB 2GBWA 3H32A 2W6AA 1LT1A 1NTKD 5KJ7C 3H1HG 1N8RQ 4CPGA 1NTMJ 2N9YB 4HM5A 2XRXA 2KI7B 4NBCD 5AVUB 2NPSB 2IDBA 2KZJA 3P32A 3HD7A 2KK7A 1PGOA 2VRSA 4PJ0H 4P1CH 2K1AA 3V2QA 2ZXEB 1BE3G 3CLQA 3D6ZA 3L73G 4H0LD 5H2FH 2DE7D 5AVXB 1Q90C 5B66E 3TSIA 1LTJB 2JDIH 4PV1B 1Y47A 3CX5H 2IX7C 3KZIE 3H1KG 3M0AA 1ZW0A 3JCUE 3L74G 1BE3J 3TYYA 1EXIA 1H88A 1VQMP 2B9BA 1KQGB 2HMLA 1LWUC 3TGUG 3TK1A 3Q5RA 3CXHE 1RH5B 4H44B 1ZN5A 2OYHB 2PGDA 1GMJA 2JP3A 2R44A 1YITP 2IPPA 3RK3E 2HG5D 4N78E 1ZRTD 1KYOE 2Y0DA 1FE6A 4H44C 5AVTB 3P8CE 3L75G 4H0LB 1GK6A 2BEQD 3G71P 4DCKA 1RF1C 2DE6D 1M1JB 1KILE 4EMJB 2HODB 5DJTB 3AE3C 3D6YA 5KLIC 2YXRB 4QUPA 3JC22 2O1KA 5BU5A 3RK2B 1NU1K 3PH0A 2LXBA 2NUKA 2FXPA 2Q7CA 1PPJE 3HE4A 1IFPA 2FYUG 3H1KE 3SFEC 4EIJA 2BEZF 1X8YA 4M3LA 1MFTA 2E5TA 1T3UA 3VMHD 2O01N 4H13D 4MN4C 1PGJA 3L73E 3CCJP 3P8MC 1EQ7A 5BOKA 3MUDA 5APUA 4ASVA 2Y0EA 4RESB 5CCGD 1DH3A 1Q81Q 2N1TC 1KFNA 2ZT9D 1NTMG 1MZ9A 4QMAA 1J1EB 4EOTA 4NB9D 1L0LG 1KZUB 1OVUA 1W5CE 1QL1A 4KHXA 5AVWB 4JYBA 1S3JA 1SQBE 4YPCA 1SQPD 2E42A 4H13B 5CCHD 3GOBA 3A0BE 1PFIA 4NPFX 2W6BA 3AE8C 3TNUA 1GDTA 1W2BO 3H1JJ 3SSUA 1NU1J 1VCKA 1LTIC 1HGZA 2B89A 3GG2A 2Q6QA 2YO2A 2JO6A 1FZCB 1AQ5A 2V7QH 3C9IA 2AEMA 3CX5D 2N1TA
chains in the Genus database with same CATH topology
4U3FE 4PV1D 4QDCA 1G8KB 3GZYA 4P1CH 3VCAA 3H1KE 1NU1E 1O7NA 3EQQA 1NDOA 4QDDA 1PP9E 2GBXA 1O7GA 4H0LD 4HKVA 3GKEA 5KLVE 1EZVE 2YFJA 2DE7D 1BCCE 1SJGA 1Q90C 2E4PA 3GTSA 4HM7A 4HM4A 2XSHA 2NVFA 3H1LE 5KKZC 4QDFA 5CXMA 4H13D 3VMHD 2ZYLA 2QJPC 1O7WA 2QPZA 2HMOA 3L73E 3H1HE 5BOKA 4NBAD 2NVGA 3CWBE 1FQTA 2YFLA 4D6TE 1L0LE 3GCEA 1SQVE 1NTZE 2BCCE 3GL2A 4QDFB 2QJYC 3L72E 1SQQE 1O7MA 1ULJA 2ZT9D 2BMOA 1JM1A 2HMLA 3GB4A 3GZXA 4HM3A 3CXHE 1RFSA 3GTEA 4NBGD 3FOUA 1P84E 4QURA 2I7FA 1WQLA 2XSOA 4NB9D 3L75E 4NBDD 4AAYB 4NB8D 1NYKA 1L0NE 1VF5D 4HM0A 2E75D 1BE3E 4P1BH 1ULIA 2CKFA 2E76D 4AIVA 3EN1A 1KYOE 3VMID 2B1XA 2NUMA 4NBHD 2NVEA 3VMGD 5AEWA 1SQBE 2HMMA 2B24A 1EG9A 3TGUE 3GL0A 3N0QA 4NBED 3D89A 1ZRTE 3H1JE 3L70E 2IBZE 2YIUC 3C0DA 2DE6D 4NBBD 1NTKE 1NTME 2HMJA 3GOBA 4H44D 5AEUA 3AZCA 4QCKA 1BGYE 4EMJB 2GBWA 3L71E 1SQPE 2E74D 2E4QA 5KLIC 2FYUE 4QUPA 2D2CD 4PD4E 1VM9A 2XR8A 4HJLA 4OGQD 2BMRA 2DE5D 1O7HA 2YVJB 4NBFD 2YFIA 4QUQA 1SQXE 1UUVA 3VCPA 4HM6A 1G8JB 2BMQA 3H1IE 4HM2A 2A06E 3CX5E 2HMNA 1VCKA 4HM5A 2FYNC 2XRXA 4HM1A 4NBCD 3DQYA 3L74E 1O7PA 2NUKA 3BCCE 2JO6A 1UUWA 2QJKC 1PPJE 2Q3WA 2NWFA 2JZAA 4HM8A 2HMKA 5HL4A 1KB9E 1RIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U3F E;  4PV1 D;  4QDC A;  1G8K B;  3GZY A;  4P1C H;  3VCA A;  3H1K E;  1NU1 E;  1O7N A;  3EQQ A;  1NDO A;  4QDD A;  1PP9 E;  2GBX A;  1O7G A;  4H0L D;  4HKV A;  3GKE A;  5KLV E;  1EZV E;  2YFJ A;  2DE7 D;  1BCC E;  1SJG A;  1Q90 C;  2E4P A;  3GTS A;  4HM7 A;  4HM4 A;  2XSH A;  2NVF A;  3H1L E;  5KKZ C;  4QDF A;  5CXM A;  4H13 D;  3VMH D;  2ZYL A;  2QJP C;  1O7W A;  2QPZ A;  2HMO A;  3L73 E;  3H1H E;  5BOK A;  4NBA D;  2NVG A;  3CWB E;  1FQT A;  2YFL A;  4D6T E;  1L0L E;  3GCE A;  1SQV E;  1NTZ E;  2BCC E;  3GL2 A;  4QDF B;  2QJY C;  3L72 E;  1SQQ E;  1O7M A;  1ULJ A;  2ZT9 D;  2BMO A;  1JM1 A;  2HML A;  3GB4 A;  3GZX A;  4HM3 A;  3CXH E;  1RFS A;  3GTE A;  4NBG D;  3FOU A;  1P84 E;  4QUR A;  2I7F A;  1WQL A;  2XSO A;  4NB9 D;  3L75 E;  4NBD D;  4AAY B;  4NB8 D;  1NYK A;  1L0N E;  1VF5 D;  4HM0 A;  2E75 D;  1BE3 E;  4P1B H;  1ULI A;  2CKF A;  2E76 D;  4AIV A;  3EN1 A;  1KYO E;  3VMI D;  2B1X A;  2NUM A;  4NBH D;  2NVE A;  3VMG D;  5AEW A;  1SQB E;  2HMM A;  2B24 A;  1EG9 A;  3TGU E;  3GL0 A;  3N0Q A;  4NBE D;  3D89 A;  1ZRT E;  3H1J E;  3L70 E;  2IBZ E;  2YIU C;  3C0D A;  2DE6 D;  4NBB D;  1NTK E;  1NTM E;  2HMJ A;  3GOB A;  4H44 D;  5AEU A;  3AZC A;  4QCK A;  1BGY E;  4EMJ B;  2GBW A;  3L71 E;  1SQP E;  2E74 D;  2E4Q A;  5KLI C;  2FYU E;  4QUP A;  2D2C D;  4PD4 E;  1VM9 A;  2XR8 A;  4HJL A;  4OGQ D;  2BMR A;  2DE5 D;  1O7H A;  2YVJ B;  4NBF D;  2YFI A;  4QUQ A;  1SQX E;  1UUV A;  3VCP A;  4HM6 A;  1G8J B;  2BMQ A;  3H1I E;  4HM2 A;  2A06 E;  3CX5 E;  2HMN A;  1VCK A;  4HM5 A;  2FYN C;  2XRX A;  4HM1 A;  4NBC D;  3DQY A;  3L74 E;  1O7P A;  2NUK A;  3BCC E;  2JO6 A;  1UUW A;  2QJK C;  1PPJ E;  2Q3W A;  2NWF A;  2JZA A;  4HM8 A;  2HMK A;  5HL4 A;  1KB9 E;  1RIE A; 
#chains in the Genus database with same CATH topology
 3PHL A;  4LGD E;  1NDO A;  4N6J A;  2YXQ B;  4TLF A;  3CWB J;  3MUD C;  4O9B A;  4AQR D;  3C1L A;  3HD7 C;  2FFD A;  1CI6 A;  3FWL A;  1YBK A;  5AVQ B;  3L72 J;  3VN0 A;  1BSN A;  1HF9 A;  2WIT A;  1O7W A;  1LTJ C;  3L72 D;  3HE4 B;  1RE4 A;  5KTB A;  1U7J A;  1L0L E;  1KB9 I;  5AVS B;  4YTP C;  3GL2 A;  1EXJ A;  1PV3 A;  3CWB D;  2W8Z A;  3II6 A;  1AVO A;  3H1H J;  1EZV I;  2D2C B;  4I1L A;  2ZFC A;  3VP9 A;  2AEF A;  3PJS K;  3TDK A;  1KYO D;  1RQV A;  3V2N A;  1KTM A;  1P84 D;  3AED C;  1LWU A;  3RK3 C;  1YI2 P;  1JUN A;  3KZI H;  2AEJ A;  2C0X A;  3CCQ P;  2AXT H;  3BCC G;  2JKV A;  3IF4 A;  3V5B A;  3PTZ A;  2E76 B;  2YIU C;  1USE A;  2HMJ A;  4QCK A;  1RHZ B;  3L71 E;  2WPS A;  1SQX D;  2OYH C;  4D6T G;  3T97 B;  2FYU E;  3OW2 O;  2KB7 P;  1CW5 A;  4I7Z B;  1PPJ G;  3SWK A;  3LW5 H;  2R3C A;  1VQ5 P;  3HTK A;  1LP1 B;  2CPB A;  2WVR A;  3DQY A;  2QEX P;  1UUW A;  4I7Z C;  3TF5 A;  3Q1M A;  5K5G B;  3OA7 A;  4ASW A;  2OTK E;  1RE3 C;  2YKP A;  1LTJ A;  1E79 H;  3VP8 A;  4R4M A;  1NTZ J;  1M8O B;  1ZLL A;  3Q5S A;  2XSH A;  1PZQ A;  2ZYG A;  1SQV D;  3USS A;  1R8E A;  3CC4 P;  2A45 H;  4H0L C;  2PRR A;  3GHG C;  1YYC A;  1OZH A;  3ZDM A;  2B87 A;  1JY2 P;  1SQQ E;  2IZ1 A;  1DX7 A;  2B88 A;  4GIF A;  2DW3 A;  3GMA A;  1J1E C;  1T6A A;  1WQL A;  1T3J A;  1Q2N A;  1NYK A;  3V4W A;  1HWT C;  3KHU A;  3E7K A;  3VMX A;  1GZL A;  1S4X A;  1NHL A;  1M7L A;  1KB9 H;  4HKZ H;  2XZR A;  2Z5I A;  1NTM D;  3AEF C;  3HTK B;  4GKG A;  2E75 C;  2AXC A;  1HH0 A;  1QL2 A;  3C0D A;  1FAV A;  4EI2 A;  1RE3 A;  3KQG A;  3L72 G;  5BU8 B;  1YJW P;  1SQB D;  1BGY E;  5GTH E;  5KLV K;  3MGN A;  1SQP K;  2E74 D;  3L70 D;  1QGK B;  1ZME C;  5AW9 B;  3CWB G;  4RKU J;  3A3Y B;  3N7N A;  4NBF D;  1BDC A;  2O01 H;  2WT7 A;  3L70 J;  1HJB A;  4HM6 A;  4DZO A;  1YQ4 C;  1G8J B;  1NTK J;  1HGV A;  2H8P D;  4HM1 A;  1SQP J;  2A06 G;  1BCC J;  2AXT E;  1MKM A;  1MFZ A;  3A0H H;  3W68 A;  2KSE A;  3ABV C;  1NKZ B;  3H6P A;  3A2A A;  3B71 A;  2WSS H;  1IK9 A;  1FZA A;  1Z56 A;  1NOH A;  1OWA A;  1OIP A;  2R5B A;  2W6J H;  4D6T D;  1L0L D;  1N73 C;  4L74 A;  2BCC G;  3G6E P;  3L35 A;  3GCE A;  3L75 J;  1Y9B A;  3V6I A;  2FYU K;  3IAO A;  4BRY A;  1NYH A;  1N73 B;  2WPR A;  1S9K E;  3RGU A;  1O7M A;  1K8A Q;  3AE9 C;  1LGH B;  3SWY A;  5APY A;  3H1L G;  4OGQ B;  4WB4 A;  1IJD B;  1S9K D;  2OYO A;  4N78 D;  2K9J B;  1PP9 G;  3T97 A;  4AAY B;  1L0N E;  1L4A C;  2E75 D;  2FXO A;  1L0N G;  2B1X A;  2KUB A;  2FBW C;  5AW0 B;  4NBE D;  2PP6 A;  3D89 A;  3VMZ A;  1X22 A;  3H1I J;  2N9B A;  3QH9 A;  5B5E E;  1X9V A;  1FS0 E;  1VQ7 P;  3BCC J;  1LTS C;  1PL5 A;  2YNY A;  4ZKP A;  1LT9 C;  5BVZ A;  4PD4 E;  1KIL D;  3GW6 A;  4JPZ B;  2XDJ A;  2IYP A;  1AA0 A;  2Z5H A;  2KLV A;  3L74 E;  2GUS A;  2IFM A;  1LTA C;  1VQL P;  4U3F E;  1U7M A;  3BCC D;  5KAI E;  3GZY A;  1SQX J;  3HE5 A;  3LID A;  1DEE G;  3MP7 B;  1EDL A;  3HE5 B;  5CHX A;  5KLV E;  4EYY Q;  4HM4 A;  3L73 D;  3V2R A;  2NVF A;  1SQB G;  4QDF A;  5AW8 B;  1VQP P;  1JY3 O;  2HMO A;  4WY4 B;  3A5T A;  1URQ A;  1VPC A;  1SQV E;  3PLN A;  4UB6 H;  1GU4 A;  4UB8 E;  1IC2 A;  1S5L E;  1OVV A;  1SQV K;  1NAF A;  4DT0 A;  1M1J C;  1KV4 A;  1SQX G;  2XSO A;  3NTN A;  2WTY A;  3WUU A;  1P84 I;  1AV1 A;  3B5N C;  5B66 H;  4L76 A;  1LT9 A;  3BAS A;  2MKV A;  2FXM A;  3GLM A;  1DEB A;  4I6M C;  4C46 A;  3M9Q A;  4UB6 E;  1L2P A;  4AUW A;  1NTZ K;  4UB8 H;  1VQK P;  3FXE A;  1JY3 P;  5KAF H;  5CCH C;  1JY2 O;  3VCP A;  5DJU B;  4K35 A;  3CX5 E;  4ZKU A;  5KJ7 D;  1VDF A;  1KIL C;  3FGA D;  1URQ B;  5KLV G;  2G3A A;  1GW3 A;  5APS A;  2Q3I A;  2WSF H;  1ZR2 A;  2KS1 A;  1KQS O;  5AVV B;  1KB9 D;  2OGU A;  2FYZ A;  1K9M Q;  1URQ C;  2WSC J;  3GTS A;  1SJG A;  4HM7 A;  3H1H D;  4KT0 J;  5M1B A;  1N7S B;  1Q82 Q;  1FBM A;  4D6T E;  3WU2 E;  3L71 G;  2BCC E;  4C7R A;  2KIK A;  1J2J B;  5APT A;  2OYI A;  1JY3 N;  3RL0 D;  2BCC D;  1OFC X;  2KP8 A;  2V7Q J;  5E79 E;  2XNX A;  2I7F A;  2Q1K A;  1SVF A;  1NTZ G;  2ZT9 C;  2KLU A;  1NH4 A;  1N73 A;  1BE3 E;  2K88 A;  2V4H A;  3MTU E;  4AIV A;  4JBZ A;  4L75 A;  2A45 I;  2NVE A;  4EDF A;  5AEW A;  2CPS A;  2HMM A;  1PGP A;  3A7O A;  3VYI A;  5CBN A;  1R5L A;  1SQQ K;  1HBW A;  1QVG O;  2Q3E A;  2QRX A;  3TGU D;  4OWF A;  3RBX A;  2IZ0 A;  2B87 B;  3FWN A;  1HJ0 A;  5TIS H;  5AW4 B;  2G8Y A;  2YVJ B;  1SS1 A;  5E79 H;  3HD7 B;  1T2K C;  2D2C C;  2WPQ A;  2H89 C;  4NPE A;  2HMK A;  3BVH A;  1EDI A;  2M5A B;  1G8K B;  3AE5 C;  4W80 A;  3CXH H;  5CJ4 A;  3AE1 C;  3VMY A;  2KNC B;  3EFF K;  5CXM A;  2QIW A;  3LW5 J;  3H1K J;  2KZI A;  3HD7 D;  2FY8 A;  2PAJ A;  1QX8 A;  1H0T B;  1GU5 A;  2ITA A;  2SPZ A;  5KLI B;  2E76 C;  2POH A;  1OXZ A;  2H43 A;  2N1T D;  4W7Z A;  3CCM P;  2QM8 A;  1SFC A;  4IL6 X;  2QSI A;  1RF0 A;  3H1J D;  1RQU A;  4NBH D;  1RF1 B;  3VMG D;  1U57 A;  1JY2 N;  1BGY D;  1N86 A;  1SLQ A;  2R5D A;  1KC8 Q;  2JWA A;  2H88 C;  1JNM A;  3UIA A;  2CK3 H;  2KNC A;  2XND H;  3VTP C;  2XR8 A;  2DE5 D;  4NPD A;  2P1J A;  4XFJ A;  5L8R J;  3D71 A;  2QJK C;  3IN6 A;  1KMI Z;  3Q3D A;  1S1C X;  2OAR A;  2LR2 A;  3VMA A;  3OJA B;  4HJG H;  1NU1 E;  5TJH A;  1ZOY C;  3CPW O;  4Y99 C;  1O7G A;  1KIL A;  2E75 B;  4JF7 A;  2YFJ A;  1G2C B;  5KJ7 A;  3B5N B;  3NMD A;  2HPC B;  1IFD A;  3L37 A;  3RK2 D;  1AFO A;  1BCC D;  5KKZ B;  4NBA D;  3CWB E;  5APW A;  5B5E H;  3P7K A;  4H13 C;  1N7S A;  2RKL A;  4WWI A;  1DD3 A;  1QLE D;  3L72 E;  3A0B H;  2WSC H;  5AVZ B;  5AW2 B;  2KSJ A;  2LKM A;  1K73 Q;  4HM3 A;  1VQ4 P;  1RFS A;  2QJY B;  1P84 E;  2WWW A;  1E5W A;  1J1D B;  4NB8 D;  2K9Y A;  2P7J A;  1KFM A;  3BRV B;  1LNQ A;  1NVO A;  3GF7 A;  5CCG A;  5KAI H;  1NTK K;  4YXD C;  3I55 P;  3TGU E;  3KYQ A;  4NBB D;  2KXP B;  4PD4 D;  3CC7 P;  1LTT C;  1X0T A;  4GOE A;  1HUC A;  1VM9 A;  1QVF O;  2WSE H;  3ITK A;  3RL0 B;  4AYC A;  1UUV A;  1PPJ D;  5C39 A;  1IFN A;  4WY4 A;  2BMQ A;  3AEC C;  2HMN A;  2Q9I A;  1JTH B;  3L71 J;  3H1K D;  3H1I D;  2A06 D;  1TU3 F;  3HUS A;  3CD6 P;  1G1J A;  3L74 D;  3VCA A;  3L4F A;  2MJZ A;  2YKQ A;  3N4X A;  2JO1 A;  4A7P A;  1PP9 E;  2L91 A;  5TIS E;  1OW8 A;  2OTJ P;  3H1L E;  3O6Q B;  1OW6 A;  3AEA C;  1NTZ D;  3IR9 A;  1BSH A;  1D7M A;  1URQ D;  1LT9 B;  5CJ0 A;  1FQT A;  4DOJ A;  2YFL A;  1EDJ A;  1NTZ E;  3I5C A;  1DD4 A;  4QDF B;  2KOG A;  1M1K Q;  5GTH H;  1VL2 A;  2JWD A;  2E43 A;  1GL2 A;  3A0H E;  5CCG C;  4NBG D;  1GL2 B;  4PJ0 E;  1YTZ T;  3CME P;  2XV5 A;  3C8V A;  4NBD D;  5AW1 B;  3G3Z A;  2QVA A;  3FX0 A;  3NFQ A;  1N2D C;  4JYC A;  1FZG A;  3MZW B;  2OQQ A;  3O8Z A;  3CMA P;  4YXW H;  5APV A;  3F5H A;  2J5U A;  3GL0 A;  1BCC G;  1AVY A;  5CCH A;  3M9H A;  3Q2Y A;  1NTM E;  1XTG B;  3PRJ A;  2ZYA A;  4WY4 C;  3SWF A;  2K37 A;  2NZ2 A;  1DIP A;  2YMY A;  1P84 H;  2BMR A;  4I2L C;  1O7H A;  1BGY G;  3HUS B;  2HR3 A;  1RF0 C;  1YQ3 C;  2Q3W A;  1FDO A;  3R4Y A;  2XKM A;  3EQQ A;  1NAY A;  3O6Q A;  1VQN P;  4XE5 B;  1BCC E;  2J58 A;  3AEB C;  4BXL A;  4BRY B;  2ZYL A;  1K05 A;  1EZV D;  1RY3 A;  5KAF E;  4RO0 A;  1X79 B;  1SQB K;  2I1K A;  3MIW A;  4GT1 A;  3MD0 A;  5AW6 B;  4Y28 J;  3U59 A;  1M90 Q;  3AE2 C;  3BAT A;  2NRG A;  3S9O A;  4GOD A;  2Q5U A;  1JCC A;  3H1I G;  1JM1 A;  1KIL B;  2OYH A;  2P2U A;  3M9B A;  2M8R A;  3L75 E;  4HM0 A;  1SQV G;  1N7S D;  2J59 M;  1H89 A;  1ULI A;  2CKF A;  5EFW B;  3NXS A;  3L75 D;  2XU6 A;  2OTL P;  1S72 P;  2QJP B;  1L0N D;  4IFM A;  2RH0 A;  2FKW B;  1IO4 A;  2E74 C;  2M0B A;  2ZYD A;  2H7H A;  1EG9 A;  3N0Q A;  1N7S C;  2WT7 B;  2FYU D;  3B5N D;  1L0N J;  1MUU A;  3CCV P;  2HPC A;  3CCE P;  2E4Q A;  3CCS P;  2O1J A;  1NTM K;  4OGQ D;  2W90 A;  2E5Y A;  1UIX A;  4QUQ A;  1HVV A;  1OW7 A;  2IYO A;  3H1I E;  1GL2 D;  3JCU H;  1FZF A;  3BCC E;  4ZNC A;  1PIX A;  2JR8 A;  2IBZ I;  3RL0 g;  3G4S P;  5HL4 A;  5KLV D;  3L73 J;  4GDO A;  1KOR A;  1R5S A;  5GTI E;  1BDD A;  4U3F D;  3E1I A;  2ZJS E;  5APQ A;  3EWK A;  3L74 J;  1JO5 A;  1L4A B;  5AW3 B;  1K04 A;  4U3F J;  3B8E B;  1SP4 A;  1JEK A;  1WMK A;  2ZT9 B;  1H8A A;  1FZE A;  1SQP G;  4OVN F;  2RN0 A;  1FZC C;  1Y8A A;  3CXH I;  1L4A A;  3F89 A;  5APX A;  2LXC B;  4WBA A;  1GTW A;  1JOC A;  1EC5 A;  1SQB J;  2GM4 A;  2GUV A;  3WMM 0;  1N7L A;  1SQV J;  2HYN A;  2Z4E A;  1S2E A;  3H32 B;  3EN1 A;  2WMM A;  2QE7 H;  3GHG A;  3M0D C;  3H1J E;  3CL3 D;  2YMK A;  3L36 A;  1NU1 G;  2OYI B;  2FYN B;  1GL2 C;  2C9N Y;  2YFI A;  1OVR A;  4N3Y B;  1UII A;  2FYN C;  1Q86 Q;  4C7N A;  1LWU B;  4WVZ A;  3WU2 H;  1LP1 A;  2FFD B;  1IK7 A;  1FDM A;  1KB9 E;  1Q90 D;  1FZB A;  1T2K D;  4QDC A;  1IFJ A;  4QDD A;  3RK2 C;  1NGM B;  1L0L J;  1FJP A;  1EZV E;  2E4P A;  5AW7 B;  3AEE C;  1FZC A;  3QWO C;  2WQY C;  3H1H E;  2M5A A;  4U7J A;  2K3R A;  2QG4 A;  2Y9Z A;  3M0D A;  3HRN A;  2W27 A;  4L73 A;  4LC1 A;  4PD4 H;  2IBZ G;  2I1J A;  3LIE A;  2ZVO B;  2KYV A;  3R2P A;  3RK3 D;  3FOU A;  3JSV C;  3KDP B;  3AE6 C;  3S4R A;  4R4L A;  4D6T J;  2PFX A;  5AVY B;  3P8C D;  2BCC J;  1M56 D;  5H2F E;  4P1B H;  2E76 D;  3VMI D;  2FYU J;  4K3A A;  2IFN A;  2WSF J;  3L71 D;  1ZRT E;  4BWN A;  2IBZ E;  4HH2 A;  3TNU B;  2UWJ E;  3CCR P;  3AZC A;  1CI6 B;  1OMI A;  3CC2 P;  2W83 C;  2D2C D;  1L0L K;  1GK4 A;  2KS1 B;  2P58 A;  1USD A;  3AEG C;  4Y99 B;  3V2P A;  2N1T B;  1GW4 A;  2P10 A;  1JMB A;  4HM2 A;  2QM7 A;  1EZV G;  1RE4 C;  3M06 A;  3W67 A;  2C9L Y;  3I56 P;  3U1A A;  1XTC C;  1LTB C;  4HM8 A;  1ZXG A;  4XA4 A;  3H1L D;  2HFE D;  1YJ9 P;  4HKV A;  3GKE A;  4ZMD A;  2ZXX A;  1PP9 D;  1SQQ J;  1EDK A;  2QJP C;  2QPZ A;  4LLH A;  1SQQ D;  3RL0 C;  1SFC D;  4IFF A;  2NPS C;  1FOS E;  1FOS F;  3GZX A;  3L70 G;  1KQL A;  5AVR B;  4IOI H;  1HTL C;  3CCU P;  2M3E A;  1JM0 A;  1BGY J;  2YKO A;  2WPV B;  3OAK A;  1JTH A;  1CSB A;  4WY4 D;  2O01 J;  3IFM A;  2JEE A;  4HB1 A;  1VF5 C;  1A02 J;  4IL6 H;  1VQO P;  2K9J A;  3AE4 C;  3L70 E;  3B4S A;  2R32 A;  1NTK E;  4TT3 H;  4H44 D;  5AEU A;  1SQP E;  4Z1M H;  3K5B A;  2WZ7 A;  4HJL A;  1M1J A;  2Y0C A;  1S5L H;  4U3F G;  4HYT B;  4PV1 C;  2JJL A;  2R3S A;  2YIU B;  1QEX A;  1O7P A;  5CMZ A;  2A45 G;  1IFM A;  3GF3 A;  2NWF A;  1G2C A;  1RIE A;  4GOF A;  2OYI C;  1JB0 J;  1YJN P;  1W2E A;  4KJM A;  3RK3 B;  1WT6 A;  1VQ8 P;  1NU1 D;  1OX3 A;  3H25 A;  2NPS A;  2WSE J;  1FC2 C;  2NPS D;  3FXD A;  1KYO H;  2BAS A;  4OH8 B;  1WRG A;  2I8D A;  3Q5P A;  2NVG A;  1M57 D;  3PP5 A;  2FFD C;  3D70 A;  3CXH D;  2M3B A;  2HLO A;  3HUS C;  2O3J A;  1NTK G;  1ULJ A;  1S5L X;  2BMO A;  3E1R A;  1GD2 E;  1IZN B;  1T8Z A;  1CZQ A;  1VF5 D;  3GHG B;  3U1C A;  1RF1 A;  2HOD A;  1AQT A;  2IBZ D;  2QJK B;  4IFD K;  3G9R A;  1VQ6 P;  3S1K A;  1JCD A;  1BE3 D;  2B24 A;  5GTI H;  4DJG A;  2RMZ A;  2YO3 A;  1Q7Y Q;  3EQ2 A;  3B5N A;  3SFD C;  5AW5 B;  1G1I A;  1JMM A;  2ZVN B;  1L0N K;  1YTZ I;  4W7Y A;  1NO4 A;  1PGQ A;  3TGU J;  1NWQ A;  1FDI A;  1SQX K;  1SQX E;  3WUV A;  3CCL P;  1KYO I;  1KQF B;  3H1J G;  2A06 E;  1KN7 A;  1KD1 Q;  1ZV8 A;  5KLV J;  2L5G B;  1A02 F;  1YHQ P;  2GA1 A;  4C7N B;  2JZA A;  4IL6 E;  1YIJ P;  4PV1 D;  1VQ9 P;  1FU1 A;  1O7N A;  2GBX A;  2E74 B;  1NKN A;  1J1D C;  4JQ0 D;  5KKZ C;  1SFC C;  1MV8 A;  1FJK A;  1PP9 J;  2Y9Y A;  3MHV A;  3EFG A;  3RBZ A;  1SFC B;  3H1L J;  2QJY C;  3KPE A;  2QA4 P;  1L4A D;  2C0W A;  5CBO A;  3GB4 A;  3GTE A;  1SQQ G;  4QUR A;  3V4Q A;  1IFI A;  1ZR4 A;  3CI9 A;  3M91 A;  1H0T A;  3WUT A;  3KXD A;  2NUM A;  3CX5 I;  1AJY A;  4RJT A;  1VF5 B;  1NJI Q;  1LTG C;  3BRT B;  4OGQ C;  3AE7 C;  1LJ2 A;  4B86 A;  2P67 A;  4PD4 I;  3VOP A;  1ZP0 C;  2ZAE B;  2GBW A;  3H32 A;  2W6A A;  1LT1 A;  1NTK D;  5KJ7 C;  3H1H G;  1N8R Q;  4CPG A;  1NTM J;  2N9Y B;  4HM5 A;  2XRX A;  2KI7 B;  4NBC D;  5AVU B;  2NPS B;  2IDB A;  2KZJ A;  3P32 A;  3HD7 A;  2KK7 A;  1PGO A;  2VRS A;  4PJ0 H;  4P1C H;  2K1A A;  3V2Q A;  2ZXE B;  1BE3 G;  3CLQ A;  3D6Z A;  3L73 G;  4H0L D;  5H2F H;  2DE7 D;  5AVX B;  1Q90 C;  5B66 E;  3TSI A;  1LTJ B;  2JDI H;  4PV1 B;  1Y47 A;  3CX5 H;  2IX7 C;  3KZI E;  3H1K G;  3M0A A;  1ZW0 A;  3JCU E;  3L74 G;  1BE3 J;  3TYY A;  1EXI A;  1H88 A;  1VQM P;  2B9B A;  1KQG B;  2HML A;  1LWU C;  3TGU G;  3TK1 A;  3Q5R A;  3CXH E;  1RH5 B;  4H44 B;  1ZN5 A;  2OYH B;  2PGD A;  1GMJ A;  2JP3 A;  2R44 A;  1YIT P;  2IPP A;  3RK3 E;  2HG5 D;  4N78 E;  1ZRT D;  1KYO E;  2Y0D A;  1FE6 A;  4H44 C;  5AVT B;  3P8C E;  3L75 G;  4H0L B;  1GK6 A;  2BEQ D;  3G71 P;  4DCK A;  1RF1 C;  2DE6 D;  1M1J B;  1KIL E;  4EMJ B;  2HOD B;  5DJT B;  3AE3 C;  3D6Y A;  5KLI C;  2YXR B;  4QUP A;  3JC2 2;  2O1K A;  5BU5 A;  3RK2 B;  1NU1 K;  3PH0 A;  2LXB A;  2NUK A;  2FXP A;  2Q7C A;  1PPJ E;  3HE4 A;  1IFP A;  2FYU G;  3H1K E;  3SFE C;  4EIJ A;  2BEZ F;  1X8Y A;  4M3L A;  1MFT A;  2E5T A;  1T3U A;  3VMH D;  2O01 N;  4H13 D;  4MN4 C;  1PGJ A;  3L73 E;  3CCJ P;  3P8M C;  1EQ7 A;  5BOK A;  3MUD A;  5APU A;  4ASV A;  2Y0E A;  4RES B;  5CCG D;  1DH3 A;  1Q81 Q;  2N1T C;  1KFN A;  2ZT9 D;  1NTM G;  1MZ9 A;  4QMA A;  1J1E B;  4EOT A;  4NB9 D;  1L0L G;  1KZU B;  1OVU A;  1W5C E;  1QL1 A;  4KHX A;  5AVW B;  4JYB A;  1S3J A;  1SQB E;  4YPC A;  1SQP D;  2E42 A;  4H13 B;  5CCH D;  3GOB A;  3A0B E;  1PFI A;  4NPF X;  2W6B A;  3AE8 C;  3TNU A;  1GDT A;  1W2B O;  3H1J J;  3SSU A;  1NU1 J;  1VCK A;  1LTI C;  1HGZ A;  2B89 A;  3GG2 A;  2Q6Q A;  2YO2 A;  2JO6 A;  1FZC B;  1AQ5 A;  2V7Q H;  3C9I A;  2AEM A;  3CX5 D;  2N1T A; 
#chains in the Genus database with same CATH homology
 4U3F E;  4PV1 D;  4QDC A;  1G8K B;  3GZY A;  4P1C H;  3VCA A;  3H1K E;  1NU1 E;  1O7N A;  3EQQ A;  1NDO A;  4QDD A;  1PP9 E;  2GBX A;  1O7G A;  4H0L D;  4HKV A;  3GKE A;  5KLV E;  1EZV E;  2YFJ A;  2DE7 D;  1BCC E;  1SJG A;  1Q90 C;  2E4P A;  3GTS A;  4HM7 A;  4HM4 A;  2XSH A;  2NVF A;  3H1L E;  5KKZ C;  4QDF A;  5CXM A;  4H13 D;  3VMH D;  2ZYL A;  2QJP C;  1O7W A;  2QPZ A;  2HMO A;  3L73 E;  3H1H E;  5BOK A;  4NBA D;  2NVG A;  3CWB E;  1FQT A;  2YFL A;  4D6T E;  1L0L E;  3GCE A;  1SQV E;  1NTZ E;  2BCC E;  3GL2 A;  4QDF B;  2QJY C;  3L72 E;  1SQQ E;  1O7M A;  1ULJ A;  2ZT9 D;  2BMO A;  1JM1 A;  2HML A;  3GB4 A;  3GZX A;  4HM3 A;  3CXH E;  1RFS A;  3GTE A;  4NBG D;  3FOU A;  1P84 E;  4QUR A;  2I7F A;  1WQL A;  2XSO A;  4NB9 D;  3L75 E;  4NBD D;  4AAY B;  4NB8 D;  1NYK A;  1L0N E;  1VF5 D;  4HM0 A;  2E75 D;  1BE3 E;  4P1B H;  1ULI A;  2CKF A;  2E76 D;  4AIV A;  3EN1 A;  1KYO E;  3VMI D;  2B1X A;  2NUM A;  4NBH D;  2NVE A;  3VMG D;  5AEW A;  1SQB E;  2HMM A;  2B24 A;  1EG9 A;  3TGU E;  3GL0 A;  3N0Q A;  4NBE D;  3D89 A;  1ZRT E;  3H1J E;  3L70 E;  2IBZ E;  2YIU C;  3C0D A;  2DE6 D;  4NBB D;  1NTK E;  1NTM E;  2HMJ A;  3GOB A;  4H44 D;  5AEU A;  3AZC A;  4QCK A;  1BGY E;  4EMJ B;  2GBW A;  3L71 E;  1SQP E;  2E74 D;  2E4Q A;  5KLI C;  2FYU E;  4QUP A;  2D2C D;  4PD4 E;  1VM9 A;  2XR8 A;  4HJL A;  4OGQ D;  2BMR A;  2DE5 D;  1O7H A;  2YVJ B;  4NBF D;  2YFI A;  4QUQ A;  1SQX E;  1UUV A;  3VCP A;  4HM6 A;  1G8J B;  2BMQ A;  3H1I E;  4HM2 A;  2A06 E;  3CX5 E;  2HMN A;  1VCK A;  4HM5 A;  2FYN C;  2XRX A;  4HM1 A;  4NBC D;  3DQY A;  3L74 E;  1O7P A;  2NUK A;  3BCC E;  2JO6 A;  1UUW A;  2QJK C;  1PPJ E;  2Q3W A;  2NWF A;  2JZA A;  4HM8 A;  2HMK A;  5HL4 A;  1KB9 E;  1RIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...