1NTME

Crystal structure of mitochondrial cytochrome bc1 complex at 2.4 angstrom
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 49
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ntmE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ntmE02
2DE5D 3D89A 3GB4A 2HMKA 2CKFA 3GTSA 4H44D 4HM2A 1G8JB 1O7PA 5HL4A 1SQBE 4PV1D 1BGYE 1L0NE 3H1LE 2B1XA 3L71E 5KKZC 3L74E 1WQLA 2BCCE 4NB8D 2DE7D 3L70E 2YFIA 1KYOE 2NWFA 2ZT9D 3C0DA 4HM8A 3EN1A 1UUWA 2HMOA 3L75E 2QPZA 3TGUE 3GL2A 1SQXE 2Q3WA 2BMQA 1NTZE 2ZYLA 1ULIA 2HMMA 1O7NA 1BE3E 2E4PA 3GCEA 4OGQD 1JM1A 3EQQA 2E74D 2QJPC 4P1CH 1EZVE 2HMJA 2YFJA 2QJYC 4HM7A 4QDFA 3VCPA 1VCKA 3AZCA 4NBHD 3CX5E 4QUQA 1SQQE 1G8KB 3H1JE 3CXHE 4H13D 4NBAD 2BMOA 2NVFA 2NUMA 1NTKE 2D2CD 2E75D 4QURA 4HM0A 3VMID 3DQYA 2GBXA 2FYNC 2YIUC 4HM6A 4NBGD 1VM9A 5AEWA 2NVEA 1L0LE 4HJLA 1NDOA 2HMLA 4HKVA 4NBDD 3L72E 3L73E 3GTEA 4QUPA 3FOUA 2XRXA 2DE6D 2FYUE 4HM5A 4AIVA 1VF5D 4HM1A 2E4QA 4NBCD 4EMJB 5CXMA 2YVJB 2QJKC 1O7WA 3N0QA 5BOKA 5KLIC 4D6TE 1PPJE 1BCCE 1O7MA 4PD4E 4U3FE 4NBBD 1NTME 4P1BH 3VMHD 2I7FA 1UUVA 3GZYA 3VMGD 4NBED 4QDFB 2IBZE 3BCCE 1RFSA 4HM4A 4QCKA 1ZRTE 2XR8A 2XSHA 4HM3A 2NVGA 1SQPE 1O7HA 1Q90C 5AEUA 4AAYB 3H1IE 4NBFD 2E76D 2JO6A 1EG9A 3GZXA 1O7GA 1SJGA 3GL0A 2HMNA 4QDCA 2YFLA 1KB9E 1RIEA 3GKEA 1ULJA 3VCAA 2NUKA 1FQTA 5KLVE 3GOBA 4H0LD 2B24A 2A06E 2BMRA 1NYKA 1P84E 2JZAA 3CWBE 2XSOA 1NU1E 3H1HE 2GBWA 1PP9E 4NB9D 4QDDA 1SQVE 3H1KE
chains in the Genus database with same CATH superfamily
2DE5D 5KAIE 1AV1A 3CC2P 2W6JH 3VTPC 2HG5D 3TYYA 2WPSA 3C0DA 2KIKA 1PGOA 1QVFO 1KQSO 1L2PA 3LW5H 1DX7A 5E79H 5KLVG 4GT1A 3AE2C 1BE3E 4WWIA 2XV5A 1SQVK 3AE5C 4EYYQ 5L8RJ 1Q86Q 1NTZJ 4NBAD 3SFEC 3HTKB 2OGUA 1P84D 5KJ7C 1QLED 2D2CC 1J2JB 1OZHA 1ZMEC 1LT1A 1O7WA 5BU8B 1NOHA 1NGMB 1ZV8A 1W2BO 2Y9ZA 2OYHC 1WT6A 1SVFA 3E7KA 5GTIE 1LTJB 1BSHA 3BVHA 1HJBA 1BDDA 3Q5SA 1O7HA 3CC4P 4IFMA 2AEMA 3QWOC 4JYCA 1N2DC 1SFCD 4QMAA 4JF7A 3RL0g 4HJGH 3VP9A 1PP9G 1YYCA 2WITA 4L73A 2FYUG 1JY2P 3TGUJ 1VQPP 2ZT9C 2AXTE 3EFFK 2RMZA 2FBWC 3P7KA 4R4MA 3MD0A 2CKFA 1OMIA 3Q5RA 4PV1D 2FYNB 2M5AA 2R3CA 3S1KA 4HH2A 2WMMA 3RK2B 4NPEA 1U7MA 4HYTB 3KPEA 5TISE 3D71A 1NKZB 3UIAA 2HMMA 1JM1A 2QJPC 4HM7A 1MKMA 3OJAB 1AQ5A 2RKLA 4NBHD 3USSA 2FKWB 5AVXB 1LGHB 4BRYA 3VP8A 5GTIH 2P2UA 1ZLLA 2E75D 2KXPB 4R4LA 2ZYGA 1SQBG 4KJMA 4EOTA 2HMLA 4QUPA 3VOPA 3N4XA 2XRXA 3QH9A 2NPSA 3B5ND 2IBZD 4HM5A 3A3YB 2E4QA 4NBCD 1YBKA 3Q1MA 3H1ID 5DJUB 1AQTA 3T97B 1N73A 1T3JA 4EDFA 4Y99B 2L91A 3VMGD 3R2PA 3AE4C 3RK3C 2PP6A 1EQ7A 1ZN5A 2BASA 1NJIQ 3CCSP 1VQ8P 5GTHH 1YI2P 4WVZA 3GL0A 1PL5A 3AE3C 3GHGB 3NFQA 1S1CX 2XDJA 1W5CE 2XKMA 3BATA 3C8VA 4I2LC 1M57D 2YXRB 1GW3A 3H1JG 5AVTB 2WSSH 1LT9C 3JC22 4C46A 2YO2A 1G2CB 1M56D 5B66E 1KQFB 3HE4A 3L71E 1SFCB 1MFTA 3M9HA 3H32B 1VQLP 1RE4A 1URQC 2ZYDA 2BCCG 3H1HD 3CWBG 2YFJA 2QIWA 3IN6A 1OW6A 1Q81Q 3S4RA 5CCHA 3WU2E 2O1KA 2RN0A 1RE3C 3U1AA 3H6PA 4U7JA 3DQYA 3H1LD 1VM9A 3OW2O 5AEWA 4IOIH 2ZXXA 4ZMDA 2DE6D 2JWAA 2IDBA 1RE4C 5BOKA 2WVRA 1KFNA 1RF0A 1KB9H 3B8EB 2YO3A 3T97A 1FDMA 1KILC 1CSBA 2I7FA 1HGZA 5APWA 4QDFB 2JR8A 2V7QJ 1R5SA 3TGUD 1VF5C 1KD1Q 1VF5B 3R4YA 2A45H 2H43A 1VQMP 1J1EB 1KB9I 1PPJD 1S5LE 1Y9BA 1NTZK 2XU6A 1LTSC 1FDOA 1X22A 1DIPA 1KYOH 1HGVA 1KILD 3D89A 1IFNA 4UB8E 3E1IA 2A06G 3H1HJ 2LKMA 4YXDC 1O7PA 1LTJC 1L0NE 2B1XA 1DEEG 1PP9J 1LNQA 4W7ZA 1PGPA 2ZVOB 2Q6QA 1KN7A 4PD4D 1SQQJ 1NTKD 4D6TG 5EFWB 4PV1C 2POHA 1SQXE 1IFPA 3CX5H 1S9KD 3JCUE 4JBZA 2FXMA 2SPZA 3KZIE 2KZIA 1SQPG 2Q9IA 2QJPB 1ZP0C 4H0LC 3C1LA 3ABVC 1L0LE 2W83C 3GTEA 5CHXA 3HE4B 2OYHA 1OW7A 1SQXJ 2FY8A 2JWDA 5CBOA 1OWAA 1PPJE 1KYOD 4WY4B 2WQYC 5M1BA 2E5TA 2E42A 3KYQA 5CJ0A 1SFCC 1NKNA 2WPVB 1UUVA 2AXCA 2P10A 4HM4A 1W2EA 3AE8C 3BASA 1JEKA 1P84I 1PIXA 4DOJA 3GW6A 1UIXA 4KHXA 1FZCB 1FC2C 2OTLP 1LJ2A 4LLHA 1GL2D 4PV1B 1OIPA 2FYUK 1M90Q 1HBWA 1ZW0A 1SP4A 2JZAA 3II6A 3SFDC 1NU1E 2ITAA 2N1TB 5CCHC 4ZKUA 5KLVJ 5KLIB 1N73C 2IBZI 1LWUB 3L73G 3L70E 1WMKA 3L74D 2HMOA 3M06A 4D6TJ 1VDFA 2QA4P 2C9LY 1JY2O 3L71J 5B66H 1O7NA 1K04A 2E75C 2HMJA 1URQB 3V4WA 4B86A 3A7OA 3H1JE 4H13D 1FZCA 3L75D 1FU1A 1SQBK 3HD7D 4HM0A 4ASWA 1KORA 3D6ZA 2KK7A 3CCUP 3L74G 1CZQA 1CI6B 3CCMP 1EDLA 2DW3A 4HM1A 1SFCA 3L72D 3SWFA 4EMJB 1K8AQ 1JMBA 3L75J 1O7MA 4DT0A 3CCRP 1NTME 1LWUA 2PRRA 1GD2E 3BRTB 2Q7CA 5APTA 3H32A 4HM3A 2AEFA 5BVZA 3RK3B 3KHUA 3P8MC 1HWTC 3L35A 1Y47A 1LP1B 1VQ9P 4H44B 2W90A 1H0TA 3AEFC 1SQVE 5APUA 1SQQK 3AE7C 1L4AD 2HMKA 1N7SD 1VQOP 4HM2A 2V7QH 1SQPD 2D2CB 3LIEA 3BCCG 1S9KE 1BGYE 1U57A 2KLVA 3VMXA 3NMDA 2FFDB 4NB8D 3Q5PA 5CCGC 3EN1A 3L75E 2JDIH 3G9RA 2OARA 1KV4A 3B4SA 1QEXA 2K9JA 4BRYB 2JEEA 1JY3O 3RK2D 3CXHE 1IK7A 3SWYA 1SQQD 3BRVB 3FXEA 5AW9B 1JNMA 4HKVA 5AVVB 4NBDD 2OYIB 1LTTC 1BDCA 1KTMA 3G71P 1EXIA 2R5DA 3PRJA 5CCGA 4AQRD 2B9BA 3V6IA 1S4XA 5KLIC 4D6TE 1T2KD 2ZYAA 1OFCX 2KP8A 2M8RA 1YTZT 2GUSA 1SQVD 4ZKPA 3NXSA 1YQ3C 2NVGA 1SQPE 2B87A 3A0BH 2E76D 4KT0J 1VQKP 1OVVA 1HJ0A 3L70J 5AW7B 4QDCA 2IBZG 1RIEA 3KXDA 3VCAA 1FQTA 3HD7C 3H1KJ 3H1IG 3PH0A 3WUVA 1NVOA 2YKOA 2AXTH 1FZCC 2Q5UA 1M1KQ 2BCCE 3CCQP 2P58A 3O6QB 1EDKA 2O01J 1YITP 2OYOA 1ULIA 1Z56A 4I7ZC 4QDFA 1VCKA 1LTIC 2HR3A 3HUSA 1ZR2A 4OVNF 5APSA 1BE3G 2JP3A 2WSEH 3CC7P 1T8ZA 3L73E 2KZJA 2J58A 4Z1MH 1IO4A 1FZFA 2WPRA 3CWBJ 3H1HG 2WSCH 1USEA 3GG2A 4WY4A 3VMHD 1BCCD 1ZOYC 4HKZH 4GIFA 4QCKA 2OQQA 1NTKG 3L4FA 1Q90C 3FXDA 1RF1B 5AW6B 5GTHE 1YJ9P 2QSIA 2A06E 3L73J 3PJSK 5KAFE 1L0NG 1G1JA 2WZ7A 1Q82Q 1PP9E 2Y0DA 1PV3A 4NB9D 2ZJSE 1OXZA 2OYIC 3GTSA 2M5AB 2N9BA 1X79B 1SQXG 3L37A 4H0LB 3D70A 1FJKA 2HPCB 1EXJA 1RY3A 3AE6C 3TSIA 2E74D 4NPDA 4QUQA 2FXOA 1NTZD 1H89A 1NU1J 5AVYB 4UB6H 1SQVG 4H44C 1FZAA 3M0DA 4JPZB 2PGDA 1H0TB 3KQGA 5CCGD 4NBGD 1J1EC 2W8ZA 3ITKA 1YJWP 1NH4A 1FBMA 4DCKA 3AE1C 2YNYA 1FZBA 3HRNA 2YXQB 2G3AA 5KJ7A 3H1JD 2Z4EA 2GUVA 5H2FH 4U3FD 1Y8AA 1E5WA 4NBED 1RHZB 4I6MC 5DJTB 2WTYA 1FZEA 4PJ0H 1JMMA 2XSHA 3NTNA 3VN0A 2ZT9B 3MIWA 4AAYB 3GZXA 1MZ9A 1E79H 4K3AA 3M0AA 1IZNB 1ULJA 5AW3B 5KLVE 1JCCA 1IFIA 1N86A 2WSEJ 2ZAEB 3I55P 2GBWA 1KC8Q 1J1DC 2LXCB 3L72J 1GMJA 5AVRB 4N78E 1LTAC 2IFMA 1IFMA 4HB1A 2XZRA 1XTCC 3PP5A 3U1CA 2QE7H 2QJYB 1UUWA 1WRGA 4TT3H 2YIUB 2P7JA 3CX5E 3AEEC 1PGJA 2V4HA 1LTGC 2O01N 1RF1A 3M9BA 2KS1B 2WSFH 3LW5J 3LIDA 3Q3DA 3L72E 4GDOA 3TK1A 2FYUE 2QG4A 1VF5D 1ZR4A 1NTMD 3V2QA 1QX8A 4RO0A 3KDPB 5AW5B 4PD4E 1SQPJ 2QVAA 1DEBA 2AEJA 3RK3E 2Y9YA 2C0WA 2J59M 3AECC 3HUSC 2A45I 2BEQD 4OGQB 4ZNCA 3AEGC 1NTMJ 1PZQA 2BCCJ 4GKGA 3H1JJ 1U7JA 5KJ7D 3RGUA 1K9MQ 1M1JA 3CL3D 4UB8H 1HTLC 1LT9B 2IZ0A 4OH8B 3GKEA 2GM4A 2H8PD 2OTJP 1JTHA 1LP1A 1HVVA 4JQ0D 3FX0A 3H1KE 1KMIZ 2FYZA 3A0HH 1KQLA 5CCHD 5KKZC 2W27A 5KAFH 1K73Q 5AW8B 1M1JC 2QPZA 3TGUE 1GL2A 3GMAA 1N73B 2GA1A 3JSVC 1JM0A 4C7RA 1NAFA 2YKQA 1OVUA 2YMKA 5AVWB 2B89A 1PP9D 1NU1G 1NTMK 1VQ7P 1QL2A 2I8DA 2A06D 4I7ZB 2Z5IA 4QURA 1ZRTD 3CXHI 3G4SP 2E74C 1IFDA 2FYNC 4WB4A 3IR9A 4BXLA 1RF0C 4D6TD 4AIVA 2M0BA 1KILE 1GL2C 1RQVA 3EWKA 4W80A 1S72P 1KZUB 4PD4I 2H7HA 3HE5B 1NTKK 2KSEA 1RFSA 2YMYA 1S5LX 2WPQA 2LXBA 3VMAA 3GF7A 1L0LD 1SQBD 1JB0J 1IK9A 1X8YA 3O6QA 2JO6A 4WY4C 3CMEP 4N3YB 4YXWH 3SSUA 3TGUG 3PTZA 2IZ1A 1HF9A 1N7SB 2Z5HA 2UWJE 2W6BA 2B24A 2M3EA 1USDA 5AVZB 5APQA 3WUUA 5BU5A 2XNXA 1L0ND 1QL1A 3SWKA 4AYCA 5HL4A 3N7NA 2KNCA 3CI9A 2DE7D 3OAKA 1GL2B 1EDIA 3RL0D 2Q3WA 2IYOA 2WT7A 3BCCJ 4P1CH 4JYBA 3VCPA 3L70G 1EZVE 2QJYC 3AZCA 1GDTA 2G8YA 2BMOA 3PLNA 2Y0EA 3CXHH 1DD4A 3L73D 1QGKB 2NVEA 1PPJG 1NDOA 1FAVA 2E5YA 4N78D 2ZFCA 5CXMA 2Q3IA 1VQNP 2HPCA 4WBAA 5H2FE 4IL6E 3JCUH 1URQD 1QVGO 1H88A 3HE5A 1JCDA 4NPFX 1KB9D 2P1JA 1BE3J 1NYHA 2O01H 3O8ZA 3CWBD 5AEUA 1YJNP 3L36A 1N7SC 3MP7B 1BGYJ 3G6EP 1VL2A 1EZVI 2FYUJ 3L72G 3Q2YA 4H13C 5APXA 2E76C 4XA4A 3B5NB 3CMAP 3AE9C 5KAIH 2HYNA 1A02F 3VMYA 1JOCA 1L4AA 3GHGC 3AEAC 3F5HA 4EIJA 1KFMA 2CPSA 2B88A 2NPSB 3RBXA 1L0LK 3TNUB 5AVSB 2ZT9D 1YTZI 4RKUJ 3CCLP 3H1IJ 2KI7B 1FOSE 1BGYG 1NTZE 2R44A 4OGQD 5CBNA 4WY4D 2WWWA 3CX5I 1G8KB 1NHLA 4DZOA 1JO5A 2I1JA 4A7PA 2NVFA 2NUMA 2D2CD 2KUBA 1CW5A 3A5TA 3F89A 3H1KD 4HJLA 1T2KC 4XFJA 1MUUA 1SS1A 3AEBC 4GODA 3FOUA 1NTMG 3B5NA 1FE6A 2KOGA 1FZGA 1L0LJ 2I1KA 2E74B 2N1TC 5K5GB 1K05A 4I1LA 2WT7B 2W6AA 1EC5A 1YIJP 1ZRTE 5B5EH 3FGAD 1N8RQ 3HUSB 3WU2H 3L71D 2C0XA 1P84H 2HMNA 2YFLA 2HODA 2O3JA 4IFDK 2JJLA 3GOBA 5C39A 1DD3A 4C7NB 3H1HE 1XTGB 1VQ5P 1GTWA 1VQ6P 3EFGA 4IL6H 2ZVNB 3HD7B 3L75G 1G8JB 2R5BA 1SQBE 4LC1A 3TNUA 3L74E 4L75A 2QEXP 3GL2A 3GF3A 1NU1K 3GCEA 4C7NA 3S9OA 2KLUA 4DJGA 1SQQG 3OA7A 1NAYA 4ASVA 1BSNA 2RH0A 5AVUB 2BCCD 1MV8A 3RK3D 2E75B 1VQ4P 2JO1A 1G2CA 1EZVG 2NPSC 3TF5A 2IBZE 3BCCE 1LTJA 3E1RA 3H1LG 3CPWO 3CCEP 3MTUE 2Q3EA 3H1IE 4PJ0E 1SLQA 2B87B 3KZIH 3HTKA 1SJGA 1KB9E 1T3UA 4H0LD 1G1IA 2J5UA 3CWBE 1AVOA 2OYHB 2PFXA 1FJPA 4MN4C 1UIIA 2Y0CA 4IFFA 4QDDA 4Y99C 2E43A 3M0DC 4RESB 1GU4A 1KILA 1JY3P 3V2NA 2Q1KA 1AA0A 3A0BE 3P32A 3RL0B 1AJYA 2K3RA 2YFIA 1KYOE 2BMQA 2ZYLA 2K9JB 2E4PA 5AW2B 3V4QA 1L0LG 1SQQE 5KLVD 1KQGB 1DH3A 4N6JA 3I5CA 3BCCD 4OGQC 3CXHD 5AW0B 1X0TA 1OW8A 1KILB 3C9IA 1R8EA 3AEDC 1RF1C 3D6YA 1IFJA 2A45G 2LR2A 2YVJB 3FWLA 3CCJP 1JY2N 1RH5B 2P67A 3EQ2A 1NTZG 2VRSA 1NU1D 4AUWA 2KYVA 4IL6X 3GZYA 1BCCG 2CK3H 1FDIA 1GU5A 5AW1B 1Q2NA 4NBFD 1EG9A 3L70D 1R5LA 2OTKE 2K37A 3MUDC 3P8CE 4UB6E 2BMRA 1NYKA 2XSOA 4K35A 1ZXGA 2CPBA 2MKVA 2FYUD 2MJZA 1HUCA 4U3FG 4GOFA 3H1LJ 1P84E 2N1TA 3GB4A 2KS1A 1YQ4C 4YPCA 1S2EA 3V5BA 1SQPK 3B71A 3MZWB 1PGQA 1BE3D 4RJTA 1WQLA 1M7LA 1SQXD 1BGYD 2NWFA 2KNCB 4HM8A 1M8OB 2WSCJ 3RBZA 3CLQA 3M9QA 1A02J 4LGDE 3GLMA 3L71G 4CPGA 3EQQA 1BCCJ 1X9VA 1FS0E 1FOSF 3PHLA 1Q90D 2YKPA 3TDKA 3I56P 1OX3A 2HLOA 1SQVJ 2NZ2A 4OWFA 2BEZF 1NTKE 1HH0A 2K88A 3FWNA 1L0NK 1M1JB 2KSJA 2YIUC 2GBXA 2N9YB 3VMZA 1JY3N 2QRXA 2QJKB 1NTKJ 3G3ZA 1CI6A 1OVRA 1SQXK 2QJKC 2PAJA 3N0QA 3MHVA 4H13B 1GK6A 1KYOI 1JUNA 1BCCE 1GW4A 2C9NY 4U3FE 2H89C 3CX5D 3V2RA 4NBBD 2JKVA 3B5NC 1NWQA 3IFMA 5B5EE 5APVA 2L5GB 3U59A 2QM7A 1J1DB 3MGNA 3P8CD 2XR8A 2M3BA 1PFIA 5AVQB 4EI2A 3IAOA 4M3LA 1L0NJ 3W68A 1IC2A 5E79E 1Q7YQ 2FXPA 4BWNA 5CMZA 1LT9A 3A0HE 2NUKA 2NPSD 2IFNA 2XNDH 2N1TD 1RQUA 1JTHB 5TISH 1L4AB 3V2PA 2IYPA 3MUDA 3HD7A 4H44D 2ZXEB 2K1AA 1VPCA 3H1LE 1EZVD 5CJ4A 2HFED 3H1KG 1N7LA 4PD4H 1SQBJ 4Y28J 3ZDMA 4L76A 2O1JA 5TJHA 3CD6P 1URQA 1GK4A 2K9YA 4L74A 1NO4A 3RL0C 1T6AA 2WSFJ 1LTBC 2NRGA 3VMID 2R32A 3M91A 4HM6A 5APYA 1MFZA 4YTPC 1TU3F 3L74J 1D7MA 1YHQP 2KB7P 1LWUC 1RE3A 5AW4B 3H25A 1GZLA 2FFDA 3RK2C 5KLVK 2E76B 3VYIA 2QM8A 3IF4A 5KTBA 3K5BA 4W7YA 2IPPA 3CCVP 1AVYA 4P1BH 4XE5B 4GOEA 1IJDB 3W67A 1EDJA 4TLFA 3WMM0 1O7GA 3A2AA 1H8AA 1L4AC 3GHGA 2OYIA 2H88C 2HODB 4O9BA 2FFDC 2IX7C 1N7SA 1S3JA 2R3SA 5KKZB 3WUTA 1S5LH 4U3FJ 1AFOA
chains in the Genus database with same CATH topology
2DE5D 3D89A 3GB4A 2HMKA 2CKFA 3GTSA 4H44D 4HM2A 1G8JB 1O7PA 5HL4A 1SQBE 4PV1D 1BGYE 1L0NE 3H1LE 2B1XA 3L71E 5KKZC 3L74E 1WQLA 2BCCE 4NB8D 2DE7D 3L70E 2YFIA 1KYOE 2NWFA 2ZT9D 3C0DA 4HM8A 3EN1A 1UUWA 2HMOA 3L75E 2QPZA 3TGUE 3GL2A 1SQXE 2Q3WA 2BMQA 1NTZE 2ZYLA 1ULIA 2HMMA 1O7NA 1BE3E 2E4PA 3GCEA 4OGQD 1JM1A 3EQQA 2E74D 2QJPC 4P1CH 1EZVE 2HMJA 2YFJA 2QJYC 4HM7A 4QDFA 3VCPA 1VCKA 3AZCA 4NBHD 3CX5E 4QUQA 1SQQE 1G8KB 3H1JE 3CXHE 4H13D 4NBAD 2BMOA 2NVFA 2NUMA 1NTKE 2D2CD 2E75D 4QURA 4HM0A 3VMID 3DQYA 2GBXA 2FYNC 2YIUC 4HM6A 4NBGD 1VM9A 5AEWA 2NVEA 1L0LE 4HJLA 1NDOA 2HMLA 4HKVA 4NBDD 3L72E 3L73E 3GTEA 4QUPA 3FOUA 2XRXA 2DE6D 2FYUE 4HM5A 4AIVA 1VF5D 4HM1A 2E4QA 4NBCD 4EMJB 5CXMA 2YVJB 2QJKC 1O7WA 3N0QA 5BOKA 5KLIC 4D6TE 1PPJE 1BCCE 1O7MA 4PD4E 4U3FE 4NBBD 1NTME 4P1BH 3VMHD 2I7FA 1UUVA 3GZYA 3VMGD 4NBED 4QDFB 2IBZE 3BCCE 1RFSA 4HM4A 4QCKA 1ZRTE 2XR8A 2XSHA 4HM3A 2NVGA 1SQPE 1O7HA 1Q90C 5AEUA 4AAYB 3H1IE 4NBFD 2E76D 2JO6A 1EG9A 3GZXA 1O7GA 1SJGA 3GL0A 2HMNA 4QDCA 2YFLA 1KB9E 1RIEA 3GKEA 1ULJA 3VCAA 2NUKA 1FQTA 5KLVE 3GOBA 4H0LD 2B24A 2A06E 2BMRA 1NYKA 1P84E 2JZAA 3CWBE 2XSOA 1NU1E 3H1HE 2GBWA 1PP9E 4NB9D 4QDDA 1SQVE 3H1KE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DE5 D;  3D89 A;  3GB4 A;  2HMK A;  2CKF A;  3GTS A;  4H44 D;  4HM2 A;  1G8J B;  1O7P A;  5HL4 A;  1SQB E;  4PV1 D;  1BGY E;  1L0N E;  3H1L E;  2B1X A;  3L71 E;  5KKZ C;  3L74 E;  1WQL A;  2BCC E;  4NB8 D;  2DE7 D;  3L70 E;  2YFI A;  1KYO E;  2NWF A;  2ZT9 D;  3C0D A;  4HM8 A;  3EN1 A;  1UUW A;  2HMO A;  3L75 E;  2QPZ A;  3TGU E;  3GL2 A;  1SQX E;  2Q3W A;  2BMQ A;  1NTZ E;  2ZYL A;  1ULI A;  2HMM A;  1O7N A;  1BE3 E;  2E4P A;  3GCE A;  4OGQ D;  1JM1 A;  3EQQ A;  2E74 D;  2QJP C;  4P1C H;  1EZV E;  2HMJ A;  2YFJ A;  2QJY C;  4HM7 A;  4QDF A;  3VCP A;  1VCK A;  3AZC A;  4NBH D;  3CX5 E;  4QUQ A;  1SQQ E;  1G8K B;  3H1J E;  3CXH E;  4H13 D;  4NBA D;  2BMO A;  2NVF A;  2NUM A;  1NTK E;  2D2C D;  2E75 D;  4QUR A;  4HM0 A;  3VMI D;  3DQY A;  2GBX A;  2FYN C;  2YIU C;  4HM6 A;  4NBG D;  1VM9 A;  5AEW A;  2NVE A;  1L0L E;  4HJL A;  1NDO A;  2HML A;  4HKV A;  4NBD D;  3L72 E;  3L73 E;  3GTE A;  4QUP A;  3FOU A;  2XRX A;  2DE6 D;  2FYU E;  4HM5 A;  4AIV A;  1VF5 D;  4HM1 A;  2E4Q A;  4NBC D;  4EMJ B;  5CXM A;  2YVJ B;  2QJK C;  1O7W A;  3N0Q A;  5BOK A;  5KLI C;  4D6T E;  1PPJ E;  1BCC E;  1O7M A;  4PD4 E;  4U3F E;  4NBB D;  1NTM E;  4P1B H;  3VMH D;  2I7F A;  1UUV A;  3GZY A;  3VMG D;  4NBE D;  4QDF B;  2IBZ E;  3BCC E;  1RFS A;  4HM4 A;  4QCK A;  1ZRT E;  2XR8 A;  2XSH A;  4HM3 A;  2NVG A;  1SQP E;  1O7H A;  1Q90 C;  5AEU A;  4AAY B;  3H1I E;  4NBF D;  2E76 D;  2JO6 A;  1EG9 A;  3GZX A;  1O7G A;  1SJG A;  3GL0 A;  2HMN A;  4QDC A;  2YFL A;  1KB9 E;  1RIE A;  3GKE A;  1ULJ A;  3VCA A;  2NUK A;  1FQT A;  5KLV E;  3GOB A;  4H0L D;  2B24 A;  2A06 E;  2BMR A;  1NYK A;  1P84 E;  2JZA A;  3CWB E;  2XSO A;  1NU1 E;  3H1H E;  2GBW A;  1PP9 E;  4NB9 D;  4QDD A;  1SQV E;  3H1K E; 
#chains in the Genus database with same CATH topology
 2DE5 D;  5KAI E;  1AV1 A;  3CC2 P;  2W6J H;  3VTP C;  2HG5 D;  3TYY A;  2WPS A;  3C0D A;  2KIK A;  1PGO A;  1QVF O;  1KQS O;  1L2P A;  3LW5 H;  1DX7 A;  5E79 H;  5KLV G;  4GT1 A;  3AE2 C;  1BE3 E;  4WWI A;  2XV5 A;  1SQV K;  3AE5 C;  4EYY Q;  5L8R J;  1Q86 Q;  1NTZ J;  4NBA D;  3SFE C;  3HTK B;  2OGU A;  1P84 D;  5KJ7 C;  1QLE D;  2D2C C;  1J2J B;  1OZH A;  1ZME C;  1LT1 A;  1O7W A;  5BU8 B;  1NOH A;  1NGM B;  1ZV8 A;  1W2B O;  2Y9Z A;  2OYH C;  1WT6 A;  1SVF A;  3E7K A;  5GTI E;  1LTJ B;  1BSH A;  3BVH A;  1HJB A;  1BDD A;  3Q5S A;  1O7H A;  3CC4 P;  4IFM A;  2AEM A;  3QWO C;  4JYC A;  1N2D C;  1SFC D;  4QMA A;  4JF7 A;  3RL0 g;  4HJG H;  3VP9 A;  1PP9 G;  1YYC A;  2WIT A;  4L73 A;  2FYU G;  1JY2 P;  3TGU J;  1VQP P;  2ZT9 C;  2AXT E;  3EFF K;  2RMZ A;  2FBW C;  3P7K A;  4R4M A;  3MD0 A;  2CKF A;  1OMI A;  3Q5R A;  4PV1 D;  2FYN B;  2M5A A;  2R3C A;  3S1K A;  4HH2 A;  2WMM A;  3RK2 B;  4NPE A;  1U7M A;  4HYT B;  3KPE A;  5TIS E;  3D71 A;  1NKZ B;  3UIA A;  2HMM A;  1JM1 A;  2QJP C;  4HM7 A;  1MKM A;  3OJA B;  1AQ5 A;  2RKL A;  4NBH D;  3USS A;  2FKW B;  5AVX B;  1LGH B;  4BRY A;  3VP8 A;  5GTI H;  2P2U A;  1ZLL A;  2E75 D;  2KXP B;  4R4L A;  2ZYG A;  1SQB G;  4KJM A;  4EOT A;  2HML A;  4QUP A;  3VOP A;  3N4X A;  2XRX A;  3QH9 A;  2NPS A;  3B5N D;  2IBZ D;  4HM5 A;  3A3Y B;  2E4Q A;  4NBC D;  1YBK A;  3Q1M A;  3H1I D;  5DJU B;  1AQT A;  3T97 B;  1N73 A;  1T3J A;  4EDF A;  4Y99 B;  2L91 A;  3VMG D;  3R2P A;  3AE4 C;  3RK3 C;  2PP6 A;  1EQ7 A;  1ZN5 A;  2BAS A;  1NJI Q;  3CCS P;  1VQ8 P;  5GTH H;  1YI2 P;  4WVZ A;  3GL0 A;  1PL5 A;  3AE3 C;  3GHG B;  3NFQ A;  1S1C X;  2XDJ A;  1W5C E;  2XKM A;  3BAT A;  3C8V A;  4I2L C;  1M57 D;  2YXR B;  1GW3 A;  3H1J G;  5AVT B;  2WSS H;  1LT9 C;  3JC2 2;  4C46 A;  2YO2 A;  1G2C B;  1M56 D;  5B66 E;  1KQF B;  3HE4 A;  3L71 E;  1SFC B;  1MFT A;  3M9H A;  3H32 B;  1VQL P;  1RE4 A;  1URQ C;  2ZYD A;  2BCC G;  3H1H D;  3CWB G;  2YFJ A;  2QIW A;  3IN6 A;  1OW6 A;  1Q81 Q;  3S4R A;  5CCH A;  3WU2 E;  2O1K A;  2RN0 A;  1RE3 C;  3U1A A;  3H6P A;  4U7J A;  3DQY A;  3H1L D;  1VM9 A;  3OW2 O;  5AEW A;  4IOI H;  2ZXX A;  4ZMD A;  2DE6 D;  2JWA A;  2IDB A;  1RE4 C;  5BOK A;  2WVR A;  1KFN A;  1RF0 A;  1KB9 H;  3B8E B;  2YO3 A;  3T97 A;  1FDM A;  1KIL C;  1CSB A;  2I7F A;  1HGZ A;  5APW A;  4QDF B;  2JR8 A;  2V7Q J;  1R5S A;  3TGU D;  1VF5 C;  1KD1 Q;  1VF5 B;  3R4Y A;  2A45 H;  2H43 A;  1VQM P;  1J1E B;  1KB9 I;  1PPJ D;  1S5L E;  1Y9B A;  1NTZ K;  2XU6 A;  1LTS C;  1FDO A;  1X22 A;  1DIP A;  1KYO H;  1HGV A;  1KIL D;  3D89 A;  1IFN A;  4UB8 E;  3E1I A;  2A06 G;  3H1H J;  2LKM A;  4YXD C;  1O7P A;  1LTJ C;  1L0N E;  2B1X A;  1DEE G;  1PP9 J;  1LNQ A;  4W7Z A;  1PGP A;  2ZVO B;  2Q6Q A;  1KN7 A;  4PD4 D;  1SQQ J;  1NTK D;  4D6T G;  5EFW B;  4PV1 C;  2POH A;  1SQX E;  1IFP A;  3CX5 H;  1S9K D;  3JCU E;  4JBZ A;  2FXM A;  2SPZ A;  3KZI E;  2KZI A;  1SQP G;  2Q9I A;  2QJP B;  1ZP0 C;  4H0L C;  3C1L A;  3ABV C;  1L0L E;  2W83 C;  3GTE A;  5CHX A;  3HE4 B;  2OYH A;  1OW7 A;  1SQX J;  2FY8 A;  2JWD A;  5CBO A;  1OWA A;  1PPJ E;  1KYO D;  4WY4 B;  2WQY C;  5M1B A;  2E5T A;  2E42 A;  3KYQ A;  5CJ0 A;  1SFC C;  1NKN A;  2WPV B;  1UUV A;  2AXC A;  2P10 A;  4HM4 A;  1W2E A;  3AE8 C;  3BAS A;  1JEK A;  1P84 I;  1PIX A;  4DOJ A;  3GW6 A;  1UIX A;  4KHX A;  1FZC B;  1FC2 C;  2OTL P;  1LJ2 A;  4LLH A;  1GL2 D;  4PV1 B;  1OIP A;  2FYU K;  1M90 Q;  1HBW A;  1ZW0 A;  1SP4 A;  2JZA A;  3II6 A;  3SFD C;  1NU1 E;  2ITA A;  2N1T B;  5CCH C;  4ZKU A;  5KLV J;  5KLI B;  1N73 C;  2IBZ I;  1LWU B;  3L73 G;  3L70 E;  1WMK A;  3L74 D;  2HMO A;  3M06 A;  4D6T J;  1VDF A;  2QA4 P;  2C9L Y;  1JY2 O;  3L71 J;  5B66 H;  1O7N A;  1K04 A;  2E75 C;  2HMJ A;  1URQ B;  3V4W A;  4B86 A;  3A7O A;  3H1J E;  4H13 D;  1FZC A;  3L75 D;  1FU1 A;  1SQB K;  3HD7 D;  4HM0 A;  4ASW A;  1KOR A;  3D6Z A;  2KK7 A;  3CCU P;  3L74 G;  1CZQ A;  1CI6 B;  3CCM P;  1EDL A;  2DW3 A;  4HM1 A;  1SFC A;  3L72 D;  3SWF A;  4EMJ B;  1K8A Q;  1JMB A;  3L75 J;  1O7M A;  4DT0 A;  3CCR P;  1NTM E;  1LWU A;  2PRR A;  1GD2 E;  3BRT B;  2Q7C A;  5APT A;  3H32 A;  4HM3 A;  2AEF A;  5BVZ A;  3RK3 B;  3KHU A;  3P8M C;  1HWT C;  3L35 A;  1Y47 A;  1LP1 B;  1VQ9 P;  4H44 B;  2W90 A;  1H0T A;  3AEF C;  1SQV E;  5APU A;  1SQQ K;  3AE7 C;  1L4A D;  2HMK A;  1N7S D;  1VQO P;  4HM2 A;  2V7Q H;  1SQP D;  2D2C B;  3LIE A;  3BCC G;  1S9K E;  1BGY E;  1U57 A;  2KLV A;  3VMX A;  3NMD A;  2FFD B;  4NB8 D;  3Q5P A;  5CCG C;  3EN1 A;  3L75 E;  2JDI H;  3G9R A;  2OAR A;  1KV4 A;  3B4S A;  1QEX A;  2K9J A;  4BRY B;  2JEE A;  1JY3 O;  3RK2 D;  3CXH E;  1IK7 A;  3SWY A;  1SQQ D;  3BRV B;  3FXE A;  5AW9 B;  1JNM A;  4HKV A;  5AVV B;  4NBD D;  2OYI B;  1LTT C;  1BDC A;  1KTM A;  3G71 P;  1EXI A;  2R5D A;  3PRJ A;  5CCG A;  4AQR D;  2B9B A;  3V6I A;  1S4X A;  5KLI C;  4D6T E;  1T2K D;  2ZYA A;  1OFC X;  2KP8 A;  2M8R A;  1YTZ T;  2GUS A;  1SQV D;  4ZKP A;  3NXS A;  1YQ3 C;  2NVG A;  1SQP E;  2B87 A;  3A0B H;  2E76 D;  4KT0 J;  1VQK P;  1OVV A;  1HJ0 A;  3L70 J;  5AW7 B;  4QDC A;  2IBZ G;  1RIE A;  3KXD A;  3VCA A;  1FQT A;  3HD7 C;  3H1K J;  3H1I G;  3PH0 A;  3WUV A;  1NVO A;  2YKO A;  2AXT H;  1FZC C;  2Q5U A;  1M1K Q;  2BCC E;  3CCQ P;  2P58 A;  3O6Q B;  1EDK A;  2O01 J;  1YIT P;  2OYO A;  1ULI A;  1Z56 A;  4I7Z C;  4QDF A;  1VCK A;  1LTI C;  2HR3 A;  3HUS A;  1ZR2 A;  4OVN F;  5APS A;  1BE3 G;  2JP3 A;  2WSE H;  3CC7 P;  1T8Z A;  3L73 E;  2KZJ A;  2J58 A;  4Z1M H;  1IO4 A;  1FZF A;  2WPR A;  3CWB J;  3H1H G;  2WSC H;  1USE A;  3GG2 A;  4WY4 A;  3VMH D;  1BCC D;  1ZOY C;  4HKZ H;  4GIF A;  4QCK A;  2OQQ A;  1NTK G;  3L4F A;  1Q90 C;  3FXD A;  1RF1 B;  5AW6 B;  5GTH E;  1YJ9 P;  2QSI A;  2A06 E;  3L73 J;  3PJS K;  5KAF E;  1L0N G;  1G1J A;  2WZ7 A;  1Q82 Q;  1PP9 E;  2Y0D A;  1PV3 A;  4NB9 D;  2ZJS E;  1OXZ A;  2OYI C;  3GTS A;  2M5A B;  2N9B A;  1X79 B;  1SQX G;  3L37 A;  4H0L B;  3D70 A;  1FJK A;  2HPC B;  1EXJ A;  1RY3 A;  3AE6 C;  3TSI A;  2E74 D;  4NPD A;  4QUQ A;  2FXO A;  1NTZ D;  1H89 A;  1NU1 J;  5AVY B;  4UB6 H;  1SQV G;  4H44 C;  1FZA A;  3M0D A;  4JPZ B;  2PGD A;  1H0T B;  3KQG A;  5CCG D;  4NBG D;  1J1E C;  2W8Z A;  3ITK A;  1YJW P;  1NH4 A;  1FBM A;  4DCK A;  3AE1 C;  2YNY A;  1FZB A;  3HRN A;  2YXQ B;  2G3A A;  5KJ7 A;  3H1J D;  2Z4E A;  2GUV A;  5H2F H;  4U3F D;  1Y8A A;  1E5W A;  4NBE D;  1RHZ B;  4I6M C;  5DJT B;  2WTY A;  1FZE A;  4PJ0 H;  1JMM A;  2XSH A;  3NTN A;  3VN0 A;  2ZT9 B;  3MIW A;  4AAY B;  3GZX A;  1MZ9 A;  1E79 H;  4K3A A;  3M0A A;  1IZN B;  1ULJ A;  5AW3 B;  5KLV E;  1JCC A;  1IFI A;  1N86 A;  2WSE J;  2ZAE B;  3I55 P;  2GBW A;  1KC8 Q;  1J1D C;  2LXC B;  3L72 J;  1GMJ A;  5AVR B;  4N78 E;  1LTA C;  2IFM A;  1IFM A;  4HB1 A;  2XZR A;  1XTC C;  3PP5 A;  3U1C A;  2QE7 H;  2QJY B;  1UUW A;  1WRG A;  4TT3 H;  2YIU B;  2P7J A;  3CX5 E;  3AEE C;  1PGJ A;  2V4H A;  1LTG C;  2O01 N;  1RF1 A;  3M9B A;  2KS1 B;  2WSF H;  3LW5 J;  3LID A;  3Q3D A;  3L72 E;  4GDO A;  3TK1 A;  2FYU E;  2QG4 A;  1VF5 D;  1ZR4 A;  1NTM D;  3V2Q A;  1QX8 A;  4RO0 A;  3KDP B;  5AW5 B;  4PD4 E;  1SQP J;  2QVA A;  1DEB A;  2AEJ A;  3RK3 E;  2Y9Y A;  2C0W A;  2J59 M;  3AEC C;  3HUS C;  2A45 I;  2BEQ D;  4OGQ B;  4ZNC A;  3AEG C;  1NTM J;  1PZQ A;  2BCC J;  4GKG A;  3H1J J;  1U7J A;  5KJ7 D;  3RGU A;  1K9M Q;  1M1J A;  3CL3 D;  4UB8 H;  1HTL C;  1LT9 B;  2IZ0 A;  4OH8 B;  3GKE A;  2GM4 A;  2H8P D;  2OTJ P;  1JTH A;  1LP1 A;  1HVV A;  4JQ0 D;  3FX0 A;  3H1K E;  1KMI Z;  2FYZ A;  3A0H H;  1KQL A;  5CCH D;  5KKZ C;  2W27 A;  5KAF H;  1K73 Q;  5AW8 B;  1M1J C;  2QPZ A;  3TGU E;  1GL2 A;  3GMA A;  1N73 B;  2GA1 A;  3JSV C;  1JM0 A;  4C7R A;  1NAF A;  2YKQ A;  1OVU A;  2YMK A;  5AVW B;  2B89 A;  1PP9 D;  1NU1 G;  1NTM K;  1VQ7 P;  1QL2 A;  2I8D A;  2A06 D;  4I7Z B;  2Z5I A;  4QUR A;  1ZRT D;  3CXH I;  3G4S P;  2E74 C;  1IFD A;  2FYN C;  4WB4 A;  3IR9 A;  4BXL A;  1RF0 C;  4D6T D;  4AIV A;  2M0B A;  1KIL E;  1GL2 C;  1RQV A;  3EWK A;  4W80 A;  1S72 P;  1KZU B;  4PD4 I;  2H7H A;  3HE5 B;  1NTK K;  2KSE A;  1RFS A;  2YMY A;  1S5L X;  2WPQ A;  2LXB A;  3VMA A;  3GF7 A;  1L0L D;  1SQB D;  1JB0 J;  1IK9 A;  1X8Y A;  3O6Q A;  2JO6 A;  4WY4 C;  3CME P;  4N3Y B;  4YXW H;  3SSU A;  3TGU G;  3PTZ A;  2IZ1 A;  1HF9 A;  1N7S B;  2Z5H A;  2UWJ E;  2W6B A;  2B24 A;  2M3E A;  1USD A;  5AVZ B;  5APQ A;  3WUU A;  5BU5 A;  2XNX A;  1L0N D;  1QL1 A;  3SWK A;  4AYC A;  5HL4 A;  3N7N A;  2KNC A;  3CI9 A;  2DE7 D;  3OAK A;  1GL2 B;  1EDI A;  3RL0 D;  2Q3W A;  2IYO A;  2WT7 A;  3BCC J;  4P1C H;  4JYB A;  3VCP A;  3L70 G;  1EZV E;  2QJY C;  3AZC A;  1GDT A;  2G8Y A;  2BMO A;  3PLN A;  2Y0E A;  3CXH H;  1DD4 A;  3L73 D;  1QGK B;  2NVE A;  1PPJ G;  1NDO A;  1FAV A;  2E5Y A;  4N78 D;  2ZFC A;  5CXM A;  2Q3I A;  1VQN P;  2HPC A;  4WBA A;  5H2F E;  4IL6 E;  3JCU H;  1URQ D;  1QVG O;  1H88 A;  3HE5 A;  1JCD A;  4NPF X;  1KB9 D;  2P1J A;  1BE3 J;  1NYH A;  2O01 H;  3O8Z A;  3CWB D;  5AEU A;  1YJN P;  3L36 A;  1N7S C;  3MP7 B;  1BGY J;  3G6E P;  1VL2 A;  1EZV I;  2FYU J;  3L72 G;  3Q2Y A;  4H13 C;  5APX A;  2E76 C;  4XA4 A;  3B5N B;  3CMA P;  3AE9 C;  5KAI H;  2HYN A;  1A02 F;  3VMY A;  1JOC A;  1L4A A;  3GHG C;  3AEA C;  3F5H A;  4EIJ A;  1KFM A;  2CPS A;  2B88 A;  2NPS B;  3RBX A;  1L0L K;  3TNU B;  5AVS B;  2ZT9 D;  1YTZ I;  4RKU J;  3CCL P;  3H1I J;  2KI7 B;  1FOS E;  1BGY G;  1NTZ E;  2R44 A;  4OGQ D;  5CBN A;  4WY4 D;  2WWW A;  3CX5 I;  1G8K B;  1NHL A;  4DZO A;  1JO5 A;  2I1J A;  4A7P A;  2NVF A;  2NUM A;  2D2C D;  2KUB A;  1CW5 A;  3A5T A;  3F89 A;  3H1K D;  4HJL A;  1T2K C;  4XFJ A;  1MUU A;  1SS1 A;  3AEB C;  4GOD A;  3FOU A;  1NTM G;  3B5N A;  1FE6 A;  2KOG A;  1FZG A;  1L0L J;  2I1K A;  2E74 B;  2N1T C;  5K5G B;  1K05 A;  4I1L A;  2WT7 B;  2W6A A;  1EC5 A;  1YIJ P;  1ZRT E;  5B5E H;  3FGA D;  1N8R Q;  3HUS B;  3WU2 H;  3L71 D;  2C0X A;  1P84 H;  2HMN A;  2YFL A;  2HOD A;  2O3J A;  4IFD K;  2JJL A;  3GOB A;  5C39 A;  1DD3 A;  4C7N B;  3H1H E;  1XTG B;  1VQ5 P;  1GTW A;  1VQ6 P;  3EFG A;  4IL6 H;  2ZVN B;  3HD7 B;  3L75 G;  1G8J B;  2R5B A;  1SQB E;  4LC1 A;  3TNU A;  3L74 E;  4L75 A;  2QEX P;  3GL2 A;  3GF3 A;  1NU1 K;  3GCE A;  4C7N A;  3S9O A;  2KLU A;  4DJG A;  1SQQ G;  3OA7 A;  1NAY A;  4ASV A;  1BSN A;  2RH0 A;  5AVU B;  2BCC D;  1MV8 A;  3RK3 D;  2E75 B;  1VQ4 P;  2JO1 A;  1G2C A;  1EZV G;  2NPS C;  3TF5 A;  2IBZ E;  3BCC E;  1LTJ A;  3E1R A;  3H1L G;  3CPW O;  3CCE P;  3MTU E;  2Q3E A;  3H1I E;  4PJ0 E;  1SLQ A;  2B87 B;  3KZI H;  3HTK A;  1SJG A;  1KB9 E;  1T3U A;  4H0L D;  1G1I A;  2J5U A;  3CWB E;  1AVO A;  2OYH B;  2PFX A;  1FJP A;  4MN4 C;  1UII A;  2Y0C A;  4IFF A;  4QDD A;  4Y99 C;  2E43 A;  3M0D C;  4RES B;  1GU4 A;  1KIL A;  1JY3 P;  3V2N A;  2Q1K A;  1AA0 A;  3A0B E;  3P32 A;  3RL0 B;  1AJY A;  2K3R A;  2YFI A;  1KYO E;  2BMQ A;  2ZYL A;  2K9J B;  2E4P A;  5AW2 B;  3V4Q A;  1L0L G;  1SQQ E;  5KLV D;  1KQG B;  1DH3 A;  4N6J A;  3I5C A;  3BCC D;  4OGQ C;  3CXH D;  5AW0 B;  1X0T A;  1OW8 A;  1KIL B;  3C9I A;  1R8E A;  3AED C;  1RF1 C;  3D6Y A;  1IFJ A;  2A45 G;  2LR2 A;  2YVJ B;  3FWL A;  3CCJ P;  1JY2 N;  1RH5 B;  2P67 A;  3EQ2 A;  1NTZ G;  2VRS A;  1NU1 D;  4AUW A;  2KYV A;  4IL6 X;  3GZY A;  1BCC G;  2CK3 H;  1FDI A;  1GU5 A;  5AW1 B;  1Q2N A;  4NBF D;  1EG9 A;  3L70 D;  1R5L A;  2OTK E;  2K37 A;  3MUD C;  3P8C E;  4UB6 E;  2BMR A;  1NYK A;  2XSO A;  4K35 A;  1ZXG A;  2CPB A;  2MKV A;  2FYU D;  2MJZ A;  1HUC A;  4U3F G;  4GOF A;  3H1L J;  1P84 E;  2N1T A;  3GB4 A;  2KS1 A;  1YQ4 C;  4YPC A;  1S2E A;  3V5B A;  1SQP K;  3B71 A;  3MZW B;  1PGQ A;  1BE3 D;  4RJT A;  1WQL A;  1M7L A;  1SQX D;  1BGY D;  2NWF A;  2KNC B;  4HM8 A;  1M8O B;  2WSC J;  3RBZ A;  3CLQ A;  3M9Q A;  1A02 J;  4LGD E;  3GLM A;  3L71 G;  4CPG A;  3EQQ A;  1BCC J;  1X9V A;  1FS0 E;  1FOS F;  3PHL A;  1Q90 D;  2YKP A;  3TDK A;  3I56 P;  1OX3 A;  2HLO A;  1SQV J;  2NZ2 A;  4OWF A;  2BEZ F;  1NTK E;  1HH0 A;  2K88 A;  3FWN A;  1L0N K;  1M1J B;  2KSJ A;  2YIU C;  2GBX A;  2N9Y B;  3VMZ A;  1JY3 N;  2QRX A;  2QJK B;  1NTK J;  3G3Z A;  1CI6 A;  1OVR A;  1SQX K;  2QJK C;  2PAJ A;  3N0Q A;  3MHV A;  4H13 B;  1GK6 A;  1KYO I;  1JUN A;  1BCC E;  1GW4 A;  2C9N Y;  4U3F E;  2H89 C;  3CX5 D;  3V2R A;  4NBB D;  2JKV A;  3B5N C;  1NWQ A;  3IFM A;  5B5E E;  5APV A;  2L5G B;  3U59 A;  2QM7 A;  1J1D B;  3MGN A;  3P8C D;  2XR8 A;  2M3B A;  1PFI A;  5AVQ B;  4EI2 A;  3IAO A;  4M3L A;  1L0N J;  3W68 A;  1IC2 A;  5E79 E;  1Q7Y Q;  2FXP A;  4BWN A;  5CMZ A;  1LT9 A;  3A0H E;  2NUK A;  2NPS D;  2IFN A;  2XND H;  2N1T D;  1RQU A;  1JTH B;  5TIS H;  1L4A B;  3V2P A;  2IYP A;  3MUD A;  3HD7 A;  4H44 D;  2ZXE B;  2K1A A;  1VPC A;  3H1L E;  1EZV D;  5CJ4 A;  2HFE D;  3H1K G;  1N7L A;  4PD4 H;  1SQB J;  4Y28 J;  3ZDM A;  4L76 A;  2O1J A;  5TJH A;  3CD6 P;  1URQ A;  1GK4 A;  2K9Y A;  4L74 A;  1NO4 A;  3RL0 C;  1T6A A;  2WSF J;  1LTB C;  2NRG A;  3VMI D;  2R32 A;  3M91 A;  4HM6 A;  5APY A;  1MFZ A;  4YTP C;  1TU3 F;  3L74 J;  1D7M A;  1YHQ P;  2KB7 P;  1LWU C;  1RE3 A;  5AW4 B;  3H25 A;  1GZL A;  2FFD A;  3RK2 C;  5KLV K;  2E76 B;  3VYI A;  2QM8 A;  3IF4 A;  5KTB A;  3K5B A;  4W7Y A;  2IPP A;  3CCV P;  1AVY A;  4P1B H;  4XE5 B;  4GOE A;  1IJD B;  3W67 A;  1EDJ A;  4TLF A;  3WMM 0;  1O7G A;  3A2A A;  1H8A A;  1L4A C;  3GHG A;  2OYI A;  2H88 C;  2HOD B;  4O9B A;  2FFD C;  2IX7 C;  1N7S A;  1S3J A;  2R3S A;  5KKZ B;  3WUT A;  1S5L H;  4U3F J;  1AFO A; 
#chains in the Genus database with same CATH homology
 2DE5 D;  3D89 A;  3GB4 A;  2HMK A;  2CKF A;  3GTS A;  4H44 D;  4HM2 A;  1G8J B;  1O7P A;  5HL4 A;  1SQB E;  4PV1 D;  1BGY E;  1L0N E;  3H1L E;  2B1X A;  3L71 E;  5KKZ C;  3L74 E;  1WQL A;  2BCC E;  4NB8 D;  2DE7 D;  3L70 E;  2YFI A;  1KYO E;  2NWF A;  2ZT9 D;  3C0D A;  4HM8 A;  3EN1 A;  1UUW A;  2HMO A;  3L75 E;  2QPZ A;  3TGU E;  3GL2 A;  1SQX E;  2Q3W A;  2BMQ A;  1NTZ E;  2ZYL A;  1ULI A;  2HMM A;  1O7N A;  1BE3 E;  2E4P A;  3GCE A;  4OGQ D;  1JM1 A;  3EQQ A;  2E74 D;  2QJP C;  4P1C H;  1EZV E;  2HMJ A;  2YFJ A;  2QJY C;  4HM7 A;  4QDF A;  3VCP A;  1VCK A;  3AZC A;  4NBH D;  3CX5 E;  4QUQ A;  1SQQ E;  1G8K B;  3H1J E;  3CXH E;  4H13 D;  4NBA D;  2BMO A;  2NVF A;  2NUM A;  1NTK E;  2D2C D;  2E75 D;  4QUR A;  4HM0 A;  3VMI D;  3DQY A;  2GBX A;  2FYN C;  2YIU C;  4HM6 A;  4NBG D;  1VM9 A;  5AEW A;  2NVE A;  1L0L E;  4HJL A;  1NDO A;  2HML A;  4HKV A;  4NBD D;  3L72 E;  3L73 E;  3GTE A;  4QUP A;  3FOU A;  2XRX A;  2DE6 D;  2FYU E;  4HM5 A;  4AIV A;  1VF5 D;  4HM1 A;  2E4Q A;  4NBC D;  4EMJ B;  5CXM A;  2YVJ B;  2QJK C;  1O7W A;  3N0Q A;  5BOK A;  5KLI C;  4D6T E;  1PPJ E;  1BCC E;  1O7M A;  4PD4 E;  4U3F E;  4NBB D;  1NTM E;  4P1B H;  3VMH D;  2I7F A;  1UUV A;  3GZY A;  3VMG D;  4NBE D;  4QDF B;  2IBZ E;  3BCC E;  1RFS A;  4HM4 A;  4QCK A;  1ZRT E;  2XR8 A;  2XSH A;  4HM3 A;  2NVG A;  1SQP E;  1O7H A;  1Q90 C;  5AEU A;  4AAY B;  3H1I E;  4NBF D;  2E76 D;  2JO6 A;  1EG9 A;  3GZX A;  1O7G A;  1SJG A;  3GL0 A;  2HMN A;  4QDC A;  2YFL A;  1KB9 E;  1RIE A;  3GKE A;  1ULJ A;  3VCA A;  2NUK A;  1FQT A;  5KLV E;  3GOB A;  4H0L D;  2B24 A;  2A06 E;  2BMR A;  1NYK A;  1P84 E;  2JZA A;  3CWB E;  2XSO A;  1NU1 E;  3H1H E;  2GBW A;  1PP9 E;  4NB9 D;  4QDD A;  1SQV E;  3H1K E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...