1NTME

Crystal structure of mitochondrial cytochrome bc1 complex at 2.4 angstrom
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 49
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1ntmE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 1ntmE02
3CX5E 4H0LD 2BMRA 1L0NE 1ULIA 4NBAD 3H1KE 2Q3WA 3GTEA 4D6TE 4NBFD 1G8KB 2NVEA 3L71E 4H13D 4HM2A 3DQYA 3H1LE 4QDDA 4NB8D 4HM4A 3AZCA 4HM8A 5KKZC 2JZAA 3C0DA 1PP9E 2DE6D 4NBCD 5KLIC 4QDCA 1BCCE 3GTSA 2FYNC 3GCEA 4HM7A 1FQTA 5KLVE 3N0QA 4PV1D 2CKFA 4HKVA 1G8JB 3H1IE 2B24A 2E4PA 3GL2A 5AEUA 1O7HA 2NVGA 2I7FA 2HMJA 3L70E 1UUVA 4QURA 2E76D 4QCKA 3GOBA 2HMMA 1KB9E 4NBED 4AAYB 5BOKA 2ZT9D 1SQXE 4HM6A 2DE5D 4QUPA 4HM5A 3L73E 4HJLA 2FYUE 2HMKA 3GZYA 5CXMA 2NUMA 1SQVE 3EQQA 4HM0A 4H44D 3CWBE 3GKEA 1EG9A 2HMLA 3VMGD 1KYOE 2BMQA 4QDFA 3EN1A 1NTKE 3VMHD 1ZRTE 2YVJB 4NB9D 4HM3A 3CXHE 1NU1E 3VCPA 3GZXA 4P1CH 3FOUA 2BCCE 3L72E 2E74D 2B1XA 2XR8A 2QJPC 3L75E 1RIEA 1SQQE 3BCCE 3L74E 1PPJE 2GBXA 3GL0A 3TGUE 4AIVA 1BE3E 2ZYLA 2BMOA 1O7PA 1SQBE 1EZVE 3H1HE 4U3FE 1L0LE 4P1BH 2E4QA 1O7GA 4QDFB 1SJGA 1NYKA 2E75D 1O7NA 2NVFA 1NDOA 1Q90C 2NUKA 2XRXA 4NBGD 4NBBD 4NBDD 1NTME 2QPZA 1O7MA 2XSOA 2JO6A 3GB4A 1WQLA 1O7WA 2D2CD 1P84E 1RFSA 5HL4A 1NTZE 1VCKA 1ULJA 2YFJA 2QJYC 5AEWA 2XSHA 2IBZE 2HMNA 3D89A 2DE7D 2QJKC 4NBHD 3VCAA 1VM9A 2A06E 1SQPE 2GBWA 4PD4E 3H1JE 3VMID 1VF5D 2YFLA 1UUWA 4OGQD 4HM1A 1JM1A 4QUQA 2HMOA 4EMJB 1BGYE 2YIUC 2YFIA 2NWFA
chains in the Genus database with same CATH superfamily
1U7MA 3A0BH 3L74G 2JWAA 4NPEA 4NBFD 3M9BA 1EZVG 2OYHC 1KQSO 2WVRA 3DQYA 4QDDA 3AE9C 4UB8E 1ZMEC 1S9KE 1Q7YQ 4OGQC 1PV3A 4DZOA 4HKVA 2L5GB 3B5ND 1DEBA 1KN7A 2WT7B 2QEXP 3BRVB 3L75G 1SQVJ 2P2UA 1LP1A 1FDMA 1M1JC 1OW8A 4HM6A 1MFTA 2HMKA 3KDPB 1SQVE 1LTAC 2E42A 2GUVA 1R5LA 2FFDB 2QG4A 3HRNA 1EDKA 2YVJB 1L0LJ 2AXTE 4GOEA 2N9YB 3TF5A 1NTMJ 3H1JG 1NKNA 2Q6QA 1O7PA 3MP7B 3CCMP 1L0LE 4C46A 3AEGC 5CCHC 1BGYD 4ASWA 1IFMA 1NYKA 2MKVA 2VRSA 1NTME 2A45I 1O7WA 1P84E 1QEXA 3HD7D 1PP9G 1RHZB 4LGDE 1VM9A 4UB8H 1TU3F 4PD4E 1NTKG 3RGUA 2KI7B 4PV1B 4Y99B 1GK6A 1LTIC 3RK3D 2HMOA 3EFFK 2FFDC 3O6QB 1KILD 1IFPA 5KTBA 1BE3G 1KB9D 2POHA 4D6TD 1H89A 1A02F 1X22A 2OYHA 3GG2A 4U3FG 5B66E 3H1IJ 2CPBA 2R44A 1ZV8A 3WMM0 1VQLP 3VP9A 3A0HE 1FE6A 3H1IE 1UIIA 2FYUJ 2B88A 1O7HA 3L70D 2AXTH 4DCKA 1N2DC 3TGUD 5BOKA 1PZQA 2ZXXA 4O9BA 4QUPA 2ZYDA 2WMMA 4IFMA 3H1HD 2FYUE 3CCEP 2GUSA 4H44D 1JTHB 5CCGA 1GL2C 4PV1C 1SQQJ 4Y99C 4N3YB 2K1AA 4DOJA 3TSIA 1P84H 4WVZA 2LXBA 3AEDC 3M0AA 1SQQE 3EFGA 1ZN5A 3E1RA 4LC1A 4PD4H 1R5SA 3TYYA 5CCHA 1VL2A 2R3CA 2B9BA 2J58A 1NDOA 2KYVA 2QPZA 1USDA 5AVTB 3L71G 5HL4A 4WB4A 2IBZD 1XTCC 5AEWA 5B66H 4HYTB 3VMYA 1QL2A 4RJTA 5DJUB 1VQ4P 5KLVD 2YKPA 1YTZT 3PTZA 3G9RA 1T8ZA 3A0HH 3B5NB 1JY2O 1JM0A 3WUUA 1SQXK 2YMKA 1HUCA 1PPJG 1AQ5A 1ULIA 3HUSB 5CJ4A 3CCRP 2XV5A 2W8ZA 1FOSE 1S9KD 1FDIA 2LXCB 4NBCD 1RF0C 3AEEC 1NGMB 3EQ2A 5K5GB 2YO2A 5AVUB 1A02J 1LT1A 1NU1D 1FZGA 2I7FA 4GOFA 3CC7P 5CHXA 1EZVI 1DD3A 3HE5B 4NPFX 5KLIB 3GHGB 1Q86Q 2CPSA 4HM0A 4JYCA 5TISE 4WBAA 1G1IA 3B5NC 1NTZD 3GLMA 3MZWB 3HD7B 2NPSD 2E74D 3HUSC 1LTTC 2WZ7A 3OW2O 5APUA 1GZLA 1WT6A 3D71A 3RK3B 2HLOA 1LTBC 1KILB 2W90A 2Z4EA 1FJPA 2B87A 3CL3D 2N1TB 2OTJP 1VCKA 3CCSP 1EQ7A 2WITA 1JY3N 4KJMA 2QM7A 1YI2P 3GHGC 1FAVA 2PFXA 1OFCX 4YPCA 5AW2B 3NXSA 3CC2P 2P58A 3HD7C 2QJPB 2Y9ZA 1VQ8P 5KLVK 1WRGA 1IC2A 4H44B 5TISH 3I56P 1KYOD 1MKMA 3RK3C 1L4AD 3S1KA 2E4PA 1KILC 2NVGA 1HF9A 3TNUA 2JEEA 3L75D 1SQBG 2ZYGA 2KUBA 3KHUA 3G3ZA 3L37A 2V4HA 2KNCB 1VQPP 3VOPA 1RF1C 2OARA 2C0WA 3AE5C 2KOGA 3PP5A 2PGDA 1URQD 1IJDB 3H1LG 1HWTC 2FY8A 2QJPC 3KQGA 3GL0A 2ZVOB 3H1JD 1CSBA 4IFFA 3MD0A 2DW3A 4H44C 4ZKUA 3CCJP 2HYNA 3V2NA 1SJGA 1NTZK 2H89C 2KB7P 4XE5B 1L0ND 3SWFA 3ZDMA 3JC22 2Q9IA 1BGYJ 3P8MC 2IZ0A 1PP9D 1CI6A 2WSFJ 1K04A 1BGYE 2YIUC 1JCDA 4OVNF 2NWFA 1G2CB 5AVZB 1FJKA 4GKGA 1QVGO 1OVRA 2ZYAA 2Q3WA 2HPCA 5KJ7D 3L73D 4JPZB 5GTHE 1QX8A 3MUDC 1N73B 2RH0A 2B24A 3RK3E 1S2EA 5AEUA 3CXHD 5B5EE 3JSVC 1KILE 2L91A 3CCVP 3BCCD 1KB9E 2IYPA 2LR2A 1OVVA 2IFMA 4EOTA 3SWKA 3GKEA 4Y28J 1KTMA 1GD2E 2IYOA 3IR9A 3VMGD 3TGUJ 4QDFA 3RBZA 3KPEA 2XNXA 3H1HJ 1K05A 1RE4C 2HR3A 4KT0J 4IFDK 1SFCD 2LKMA 3TGUE 1JNMA 2FKWB 3VMXA 3H1HE 1FZCB 1OW7A 1GU5A 1N7SA 1CZQA 1VDFA 3MIWA 3AEFC 1GW4A 4K3AA 3IF4A 1U7JA 2NPSC 3FXDA 2WSFH 3BATA 2E74C 5AVRB 5GTHH 1JMMA 2H43A 4HB1A 1VQ7P 1LWUC 4WY4A 4OH8B 4B86A 2K9JB 1IZNB 1L4AB 2WPSA 1L0NK 1NAYA 2YO3A 4IL6X 1H0TB 2BASA 1VQOP 1W2EA 5B5EH 2R32A 4L73A 2XNDH 1IFIA 3GTEA 5KLVJ 1FZBA 4YXWH 1KB9H 1L0LG 4L74A 4NB8D 1KQFB 1ZOYC 1NTMG 1NTKK 2I1JA 4BRYA 1FZCC 1FQTA 5KLVE 1QLED 1OW6A 1URQB 5AVSB 2JKVA 1Y9BA 3L72D 3WU2E 4QMAA 1LT9A 4QCKA 3GOBA 3FWNA 3P32A 1RY3A 2O1JA 4HJLA 1CW5A 1YJNP 3N4XA 2AEFA 1NU1J 2M3EA 1ZP0C 1L4AC 1KV4A 1QVFO 5KAIE 1DIPA 1YITP 2O1KA 3L4FA 3G6EP 2KXPB 1JEKA 3IN6A 1NU1E 1LTJA 3GZXA 1T6AA 3Q2YA 3AE3C 4RKUJ 1RIEA 4AIVA 5KKZB 2BMOA 1IFNA 1IO4A 1NTZJ 4W80A 1VQNP 3P7KA 3RBXA 3CC4P 2K3RA 1RQUA 3GB4A 3H1KD 1NTZE 1KQGB 2E76B 5APVA 5TJHA 2FYUG 5AVYB 2NPSA 3T97B 1VQ5P 3W67A 4YTPC 3HTKB 3M0DA 1BCCD 1LWUA 1BDDA 3USSA 1IFJA 3H32B 3U59A 2Y9YA 4IL6E 1R8EA 3WU2H 1SQXD 3QH9A 2N9BA 1FOSF 4ZKPA 4HM2A 3Q5RA 3CI9A 4KHXA 3UIAA 2ZJSE 5KKZC 3CWBD 3HE4B 1RE3A 4HM7A 5DJTB 2CKFA 1G8JB 2Z5IA 5KAIH 2BCCG 1NOHA 1FZAA 1UUVA 1JMBA 4QURA 2N1TD 4AAYB 1SFCB 5KJ7C 5BU5A 3BASA 1SQBD 2JO1A 4XFJA 4JBZA 3L75J 1KYOE 1GK4A 1DX7A 2IBZI 2XDJA 3AECC 3AE4C 1FZEA 3L75E 1M1JA 2YKQA 2OYOA 2QIWA 4C7NA 5GTIE 1K9MQ 2E4QA 3NTNA 3SFDC 4IL6H 1NKZB 4BWNA 1JY3P 3H1JJ 2QM8A 1SFCC 5AW6B 1BDCA 2GBWA 1L0NJ 3H1JE 3V4QA 3OAKA 4R4LA 3M9HA 1MUUA 3CX5E 1S1CX 1PP9J 1AFOA 1EDJA 1L0NE 4NBAD 3AE8C 2WT7A 1M90Q 1AA0A 2JZAA 3MHVA 1PP9E 5AW3B 5AW7B 1T3JA 3L73J 1KYOH 2FFDA 1EDIA 1FC2C 2IDBA 5L8RJ 1NVOA 2ZFCA 2Q3IA 3O8ZA 2HMMA 4NBED 3L73E 5AW5B 3NMDA 3GZYA 1YBKA 5GTIH 2FXPA 4ZNCA 3BRTB 1P84I 1RH5B 1Q90D 3BCCJ 3G71P 1FS0E 3V4WA 2IX7C 3QWOC 3CXHE 3RL0D 3VMZA 4PJ0E 2A06G 1SQBK 2M8RA 4JF7A 4PD4I 3BCCE 1GMJA 2M3BA 4ASVA 1Q82Q 1U57A 4P1BH 2E75D 1GL2A 4NBGD 3CX5H 3O6QA 1SP4A 1ZR2A 4W7ZA 2DE7D 2KSJA 2KS1B 3M91A 1VF5D 4HM1A 1JM1A 3L71J 2OTLP 2JP3A 3WUVA 4CPGA 2P1JA 1HVVA 1KD1Q 3P8CE 3L71E 3PLNA 2AEMA 2RN0A 4EYYQ 2O01N 5H2FE 1NHLA 3SSUA 3B8EB 5KLIC 4DT0A 2IFNA 3FX0A 5APWA 3N0QA 2C9LY 2YXRB 3GL2A 4HKZH 2R5BA 3A2AA 2QJYB 4GDOA 3CXHH 4PJ0H 3L74D 2WPQA 4N78D 1AV1A 1EZVD 1UIXA 1BGYG 1N86A 2BEZF 5CXMA 2KLUA 3L72J 1RF0A 4EIJA 4ZMDA 2QA4P 1AVYA 3AE7C 2OYIB 2N1TC 1FZFA 3L72E 2M5AB 1SQPG 1KC8Q 1XTGB 2FYNB 1PL5A 3IAOA 5CMZA 1LGHB 1O7MA 4D6TG 3B5NA 2D2CD 4U7JA 3ABVC 5APQA 4GT1A 2QJYC 4BXLA 2RKLA 2HMNA 1EC5A 3HUSA 4GIFA 2Q7CA 2WSCJ 5H2FH 2H88C 1DH3A 2K37A 1SLQA 5APYA 5CCGD 3H1KJ 2IPPA 3CXHI 3L70G 3CX5D 4I7ZB 3TGUG 1BCCJ 3H1KE 3D6ZA 4EDFA 2O01J 3H1HG 1KMIZ 2ZVNB 5APSA 2FBWC 1H8AA 4JYBA 4HM4A 2HODB 5CCHD 3VYIA 5AW8B 1BCCE 3GHGA 2FYNC 1SQXJ 1NTKD 3F89A 1K8AQ 2BCCD 3RL0B 2H8PD 3CWBJ 2E76D 1S72P 2XKMA 1BE3D 1SQXE 3HD7A 1H88A 4N6JA 3GF3A 1JY2P 4U3FD 1NTMK 2C9NY 3CWBE 2E75B 2P67A 1M57D 5M1BA 3C9IA 2AXCA 1LP1B 3V6IA 3KZIE 1SQBJ 1KILA 2IBZG 4I7ZC 1USEA 2V7QJ 2QSIA 2W83C 4H13B 3FOUA 2N1TA 4K35A 4TT3H 2YMYA 5KLVG 3PHLA 3BVHA 1SQBE 1RQVA 1VF5B 1NWQA 3AEAC 1Q90C 1RF1A 1OMIA 1OXZA 2WSCH 1AVOA 1FDOA 3RL0C 3H25A 3D89A 4I6MC 5AW9B 3VCAA 1M7LA 2Y0EA 2O01H 1NU1G 1YQ4C 1N73C 2BMRA 3P8CD 3L71D 1G8KB 1Y47A 1SQVG 4AYCA 1PGJA 2HFED 4WWIA 4QDCA 4NPDA 1VF5C 2KNCA 3AE6C 1ZRTD 3R2PA 3KZIH 1GTWA 2JDIH 2YKOA 5APTA 3AEBC 1SS1A 2OYHB 2Y0CA 1PPJD 2QJKB 2ZT9D 1WMKA 2V7QH 2E43A 3A5TA 2KK7A 1BSHA 3MUDA 4LLHA 2HG5D 2D2CB 4AUWA 4L75A 3I5CA 1M1JB 4P1CH 1YIJP 5AVQB 2B1XA 1PGOA 2UWJE 1E5WA 3WUTA 1MFZA 1M56D 1PGQA 1VQMP 1JY2N 3A3YB 1O7NA 1D7MA 3IFMA 2XSOA 1RFSA 1G2CA 2YFJA 3Q5SA 2A45H 3E1IA 1RE4A 2QJKC 5AVWB 2P10A 3H1IG 1N73A 2Y0DA 1KB9I 2CK3H 2D2CC 1HJ0A 1SVFA 1URQC 4IOIH 1M1KQ 1DEEG 2JR8A 2K88A 3ITKA 3W68A 5CCGC 1YHQP 1HTLC 3KYQA 1YJ9P 1HGVA 3B71A 4W7YA 1PFIA 1SQQG 2IZ1A 2Q1KA 2J5UA 2YXQB 2DE5D 2KZJA 1IK9A 2KP8A 1FZCA 1L0NG 1EG9A 3L74J 3TDKA 4JQ0D 3VTPC 1LJ2A 2E76C 2WQYC 2XR8A 3L74E 1SQPD 1QGKB 5BU8B 1Q2NA 4N78E 3E7KA 1EZVE 1GL2B 3S4RA 5KAFE 2JO6A 2K9JA 2ITAA 1L4AA 1N7LA 1WQLA 2WPRA 3L73G 4HJGH 1H0TA 1ULJA 2G3AA 3H1LD 3GF7A 3EWKA 1YYCA 1OZHA 2E5YA 2OQQA 3VMID 1KQLA 3RL0g 4QUQA 2B87B 1M8OB 3BCCG 1X0TA 2KLVA 1URQA 2G8YA 1YJWP 2ZT9B 1J1DB 2C0XA 1S4XA 2B89A 2P7JA 3Q3DA 4Z1MH 1N7SD 1IK7A 2J59M 3NFQA 1S5LX 2QRXA 1HBWA 2W27A 4I1LA 3D70A 1VQ9P 2BEQD 3CCQP 2Q3EA 1QL1A 1VQ6P 1NTKJ 3CMEP 1OX3A 4WY4D 2GM4A 3EQQA 2ZXEB 3CCUP 2BCCJ 3V2RA 2HMLA 1BE3J 3TNUB 5KAFH 1NTKE 5C39A 4NB9D 4U3FJ 2W6JH 3Q1MA 2BCCE 1MZ9A 2ZT9C 1J1DC 1E79H 5KJ7A 2M0BA 1HJBA 3T97A 1BE3E 2MJZA 1K73Q 1JO5A 1KFNA 2KSEA 3HTKA 4U3FE 3RK2D 3C8VA 4NBBD 1IFDA 1KORA 3U1AA 3H32A 4TLFA 3U1CA 1BSNA 1SQPK 3CMAP 2XSHA 3V2QA 2JWDA 2YFLA 3HE4A 1HGZA 2Z5HA 3L72G 2E5TA 3K5BA 1YQ3C 1GDTA 4H0LD 2GA1A 3FGAD 4RESB 1OWAA 2NVEA 1T3UA 1CI6B 4H13D 1S3JA 3MTUE 5AW0B 1SFCA 1SQVD 1ZLLA 3LIDA 4RO0A 2R5DA 3AE2C 3C0DA 1KYOI 3GCEA 1S5LE 1MV8A 5BVZA 2HPCB 1NH4A 1J2JB 2WWWA 4UB6E 3MGNA 1VQKP 4HM5A 2PAJA 3C1LA 3PJSK 1NO4A 1L0LD 1T2KD 2FXMA 3GMAA 2NUMA 4EI2A 4DJGA 1FBMA 1NTMD 3H1KG 1AJYA 3LW5J 1JTHA 1P84D 3FWLA 1OIPA 1ZRTE 1NYHA 2O3JA 2OTKE 1BCCG 1PPJE 4PD4D 2W6BA 1RF1B 4A7PA 3JCUE 1O7GA 3CX5I 4QDFB 3OJAB 2Q5UA 1Y8AA 1SQXG 1KZUB 3A7OA 1DD4A 5CBOA 3CWBG 1W5CE 2A06E 3OA7A 1N7SB 2WTYA 2W6AA 2AEJA 2XZRA 4C7RA 4OGQD 3H1ID 4AQRD 1Q81Q 4EMJB 1S5LH 2WPVB 2YFIA 5AW1B 5AW4B 2QVAA 2FYUD 4UB6H 5EFWB 1LNQA 4WY4B 3AZCA 2YIUB 1LTSC 1NU1K 1NAFA 1ZXGA 3L35A 1SQQD 3S9OA 3V2PA 2OYIC 1SQVK 3LW5H 1JOCA 4BRYB 3LIEA 3G4SP 3RK2B 3R4YA 5CJ0A 2YNYA 3HE5A 2WSSH 1N7SC 3JCUH 2NZ2A 4M3LA 2A45G 3CPWO 3PRJA 1LT9B 1GU4A 4HM3A 3VCPA 3CCLP 1KFMA 3PH0A 2NRGA 3F5HA 1L0LK 4WY4C 3H6PA 4L76A 5E79E 3I55P 2RMZA 1ZR4A 1PIXA 2KS1A 2NVFA 2XRXA 4NBDD 4XA4A 1LTJB 1SQPJ 4H0LB 2I1KA 2WSEJ 3B4SA 1EXJA 1GW3A 3SFEC 2PRRA 4NBHD 1SQPE 3VMAA 5AVVB 2QE7H 4OWFA 3RK2C 4D6TJ 1UUWA 2KIKA 3M9QA 3H1LJ 1X79B 3AE1C 1JUNA 2NPSB 3L36A 1LT9C 1JCCA 2E74B 3FXEA 4D6TE 2KZIA 1EDLA 1PGPA 1LTGC 3M06A 3H1LE 1LWUB 4HM8A 3VP8A 1VPCA 3L70J 2DE6D 2SPZA 3GTSA 1W2BO 1X8YA 1GL2D 4PV1D 2E75C 4GODA 1Z56A 3KXDA 3A0BE 2OGUA 2HMJA 1LTJC 4H0LC 3L70E 4YXDC 2FYUK 2R3SA 2OYIA 4H13C 3CD6P 2M5AA 1JY3O 3CLQA 3II6A 1JB0J 3V5BA 1EXIA 5AVXB 1N8RQ 2XU6A 1YTZI 2K9YA 5E79H 3GW6A 1NTZG 4MN4C 2BMQA 1J1EB 2FYZA 3EN1A 3VMHD 1AQTA 1SQQK 2H7HA 1FU1A 3SWYA 3M0DC 2GBXA 2ZYLA 1T2KC 1HH0A 1OVUA 4OGQB 1NJIQ 2WSEH 2ZAEB 1ZW0A 1G1JA 2PP6A 2NUKA 3TK1A 2I8DA 5CBNA 4HH2A 3Q5PA 2IBZE 1L2PA 4C7NB 2A06D 2JJLA 3VN0A 1RE3C 4I2LC 5APXA 2HODA 3D6YA 1X9VA 3N7NA 4R4MA 2FXOA 1J1EC
chains in the Genus database with same CATH topology
3CX5E 4H0LD 2BMRA 1L0NE 1ULIA 4NBAD 3H1KE 2Q3WA 3GTEA 4D6TE 4NBFD 1G8KB 2NVEA 3L71E 4H13D 4HM2A 3DQYA 3H1LE 4QDDA 4NB8D 4HM4A 3AZCA 4HM8A 5KKZC 2JZAA 3C0DA 1PP9E 2DE6D 4NBCD 5KLIC 4QDCA 1BCCE 3GTSA 2FYNC 3GCEA 4HM7A 1FQTA 5KLVE 3N0QA 4PV1D 2CKFA 4HKVA 1G8JB 3H1IE 2B24A 2E4PA 3GL2A 5AEUA 1O7HA 2NVGA 2I7FA 2HMJA 3L70E 1UUVA 4QURA 2E76D 4QCKA 3GOBA 2HMMA 1KB9E 4NBED 4AAYB 5BOKA 2ZT9D 1SQXE 4HM6A 2DE5D 4QUPA 4HM5A 3L73E 4HJLA 2FYUE 2HMKA 3GZYA 5CXMA 2NUMA 1SQVE 3EQQA 4HM0A 4H44D 3CWBE 3GKEA 1EG9A 2HMLA 3VMGD 1KYOE 2BMQA 4QDFA 3EN1A 1NTKE 3VMHD 1ZRTE 2YVJB 4NB9D 4HM3A 3CXHE 1NU1E 3VCPA 3GZXA 4P1CH 3FOUA 2BCCE 3L72E 2E74D 2B1XA 2XR8A 2QJPC 3L75E 1RIEA 1SQQE 3BCCE 3L74E 1PPJE 2GBXA 3GL0A 3TGUE 4AIVA 1BE3E 2ZYLA 2BMOA 1O7PA 1SQBE 1EZVE 3H1HE 4U3FE 1L0LE 4P1BH 2E4QA 1O7GA 4QDFB 1SJGA 1NYKA 2E75D 1O7NA 2NVFA 1NDOA 1Q90C 2NUKA 2XRXA 4NBGD 4NBBD 4NBDD 1NTME 2QPZA 1O7MA 2XSOA 2JO6A 3GB4A 1WQLA 1O7WA 2D2CD 1P84E 1RFSA 5HL4A 1NTZE 1VCKA 1ULJA 2YFJA 2QJYC 5AEWA 2XSHA 2IBZE 2HMNA 3D89A 2DE7D 2QJKC 4NBHD 3VCAA 1VM9A 2A06E 1SQPE 2GBWA 4PD4E 3H1JE 3VMID 1VF5D 2YFLA 1UUWA 4OGQD 4HM1A 1JM1A 4QUQA 2HMOA 4EMJB 1BGYE 2YIUC 2YFIA 2NWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX5 E;  4H0L D;  2BMR A;  1L0N E;  1ULI A;  4NBA D;  3H1K E;  2Q3W A;  3GTE A;  4D6T E;  4NBF D;  1G8K B;  2NVE A;  3L71 E;  4H13 D;  4HM2 A;  3DQY A;  3H1L E;  4QDD A;  4NB8 D;  4HM4 A;  3AZC A;  4HM8 A;  5KKZ C;  2JZA A;  3C0D A;  1PP9 E;  2DE6 D;  4NBC D;  5KLI C;  4QDC A;  1BCC E;  3GTS A;  2FYN C;  3GCE A;  4HM7 A;  1FQT A;  5KLV E;  3N0Q A;  4PV1 D;  2CKF A;  4HKV A;  1G8J B;  3H1I E;  2B24 A;  2E4P A;  3GL2 A;  5AEU A;  1O7H A;  2NVG A;  2I7F A;  2HMJ A;  3L70 E;  1UUV A;  4QUR A;  2E76 D;  4QCK A;  3GOB A;  2HMM A;  1KB9 E;  4NBE D;  4AAY B;  5BOK A;  2ZT9 D;  1SQX E;  4HM6 A;  2DE5 D;  4QUP A;  4HM5 A;  3L73 E;  4HJL A;  2FYU E;  2HMK A;  3GZY A;  5CXM A;  2NUM A;  1SQV E;  3EQQ A;  4HM0 A;  4H44 D;  3CWB E;  3GKE A;  1EG9 A;  2HML A;  3VMG D;  1KYO E;  2BMQ A;  4QDF A;  3EN1 A;  1NTK E;  3VMH D;  1ZRT E;  2YVJ B;  4NB9 D;  4HM3 A;  3CXH E;  1NU1 E;  3VCP A;  3GZX A;  4P1C H;  3FOU A;  2BCC E;  3L72 E;  2E74 D;  2B1X A;  2XR8 A;  2QJP C;  3L75 E;  1RIE A;  1SQQ E;  3BCC E;  3L74 E;  1PPJ E;  2GBX A;  3GL0 A;  3TGU E;  4AIV A;  1BE3 E;  2ZYL A;  2BMO A;  1O7P A;  1SQB E;  1EZV E;  3H1H E;  4U3F E;  1L0L E;  4P1B H;  2E4Q A;  1O7G A;  4QDF B;  1SJG A;  1NYK A;  2E75 D;  1O7N A;  2NVF A;  1NDO A;  1Q90 C;  2NUK A;  2XRX A;  4NBG D;  4NBB D;  4NBD D;  1NTM E;  2QPZ A;  1O7M A;  2XSO A;  2JO6 A;  3GB4 A;  1WQL A;  1O7W A;  2D2C D;  1P84 E;  1RFS A;  5HL4 A;  1NTZ E;  1VCK A;  1ULJ A;  2YFJ A;  2QJY C;  5AEW A;  2XSH A;  2IBZ E;  2HMN A;  3D89 A;  2DE7 D;  2QJK C;  4NBH D;  3VCA A;  1VM9 A;  2A06 E;  1SQP E;  2GBW A;  4PD4 E;  3H1J E;  3VMI D;  1VF5 D;  2YFL A;  1UUW A;  4OGQ D;  4HM1 A;  1JM1 A;  4QUQ A;  2HMO A;  4EMJ B;  1BGY E;  2YIU C;  2YFI A;  2NWF A; 
#chains in the Genus database with same CATH topology
 1U7M A;  3A0B H;  3L74 G;  2JWA A;  4NPE A;  4NBF D;  3M9B A;  1EZV G;  2OYH C;  1KQS O;  2WVR A;  3DQY A;  4QDD A;  3AE9 C;  4UB8 E;  1ZME C;  1S9K E;  1Q7Y Q;  4OGQ C;  1PV3 A;  4DZO A;  4HKV A;  2L5G B;  3B5N D;  1DEB A;  1KN7 A;  2WT7 B;  2QEX P;  3BRV B;  3L75 G;  1SQV J;  2P2U A;  1LP1 A;  1FDM A;  1M1J C;  1OW8 A;  4HM6 A;  1MFT A;  2HMK A;  3KDP B;  1SQV E;  1LTA C;  2E42 A;  2GUV A;  1R5L A;  2FFD B;  2QG4 A;  3HRN A;  1EDK A;  2YVJ B;  1L0L J;  2AXT E;  4GOE A;  2N9Y B;  3TF5 A;  1NTM J;  3H1J G;  1NKN A;  2Q6Q A;  1O7P A;  3MP7 B;  3CCM P;  1L0L E;  4C46 A;  3AEG C;  5CCH C;  1BGY D;  4ASW A;  1IFM A;  1NYK A;  2MKV A;  2VRS A;  1NTM E;  2A45 I;  1O7W A;  1P84 E;  1QEX A;  3HD7 D;  1PP9 G;  1RHZ B;  4LGD E;  1VM9 A;  4UB8 H;  1TU3 F;  4PD4 E;  1NTK G;  3RGU A;  2KI7 B;  4PV1 B;  4Y99 B;  1GK6 A;  1LTI C;  3RK3 D;  2HMO A;  3EFF K;  2FFD C;  3O6Q B;  1KIL D;  1IFP A;  5KTB A;  1BE3 G;  1KB9 D;  2POH A;  4D6T D;  1H89 A;  1A02 F;  1X22 A;  2OYH A;  3GG2 A;  4U3F G;  5B66 E;  3H1I J;  2CPB A;  2R44 A;  1ZV8 A;  3WMM 0;  1VQL P;  3VP9 A;  3A0H E;  1FE6 A;  3H1I E;  1UII A;  2FYU J;  2B88 A;  1O7H A;  3L70 D;  2AXT H;  4DCK A;  1N2D C;  3TGU D;  5BOK A;  1PZQ A;  2ZXX A;  4O9B A;  4QUP A;  2ZYD A;  2WMM A;  4IFM A;  3H1H D;  2FYU E;  3CCE P;  2GUS A;  4H44 D;  1JTH B;  5CCG A;  1GL2 C;  4PV1 C;  1SQQ J;  4Y99 C;  4N3Y B;  2K1A A;  4DOJ A;  3TSI A;  1P84 H;  4WVZ A;  2LXB A;  3AED C;  3M0A A;  1SQQ E;  3EFG A;  1ZN5 A;  3E1R A;  4LC1 A;  4PD4 H;  1R5S A;  3TYY A;  5CCH A;  1VL2 A;  2R3C A;  2B9B A;  2J58 A;  1NDO A;  2KYV A;  2QPZ A;  1USD A;  5AVT B;  3L71 G;  5HL4 A;  4WB4 A;  2IBZ D;  1XTC C;  5AEW A;  5B66 H;  4HYT B;  3VMY A;  1QL2 A;  4RJT A;  5DJU B;  1VQ4 P;  5KLV D;  2YKP A;  1YTZ T;  3PTZ A;  3G9R A;  1T8Z A;  3A0H H;  3B5N B;  1JY2 O;  1JM0 A;  3WUU A;  1SQX K;  2YMK A;  1HUC A;  1PPJ G;  1AQ5 A;  1ULI A;  3HUS B;  5CJ4 A;  3CCR P;  2XV5 A;  2W8Z A;  1FOS E;  1S9K D;  1FDI A;  2LXC B;  4NBC D;  1RF0 C;  3AEE C;  1NGM B;  3EQ2 A;  5K5G B;  2YO2 A;  5AVU B;  1A02 J;  1LT1 A;  1NU1 D;  1FZG A;  2I7F A;  4GOF A;  3CC7 P;  5CHX A;  1EZV I;  1DD3 A;  3HE5 B;  4NPF X;  5KLI B;  3GHG B;  1Q86 Q;  2CPS A;  4HM0 A;  4JYC A;  5TIS E;  4WBA A;  1G1I A;  3B5N C;  1NTZ D;  3GLM A;  3MZW B;  3HD7 B;  2NPS D;  2E74 D;  3HUS C;  1LTT C;  2WZ7 A;  3OW2 O;  5APU A;  1GZL A;  1WT6 A;  3D71 A;  3RK3 B;  2HLO A;  1LTB C;  1KIL B;  2W90 A;  2Z4E A;  1FJP A;  2B87 A;  3CL3 D;  2N1T B;  2OTJ P;  1VCK A;  3CCS P;  1EQ7 A;  2WIT A;  1JY3 N;  4KJM A;  2QM7 A;  1YI2 P;  3GHG C;  1FAV A;  2PFX A;  1OFC X;  4YPC A;  5AW2 B;  3NXS A;  3CC2 P;  2P58 A;  3HD7 C;  2QJP B;  2Y9Z A;  1VQ8 P;  5KLV K;  1WRG A;  1IC2 A;  4H44 B;  5TIS H;  3I56 P;  1KYO D;  1MKM A;  3RK3 C;  1L4A D;  3S1K A;  2E4P A;  1KIL C;  2NVG A;  1HF9 A;  3TNU A;  2JEE A;  3L75 D;  1SQB G;  2ZYG A;  2KUB A;  3KHU A;  3G3Z A;  3L37 A;  2V4H A;  2KNC B;  1VQP P;  3VOP A;  1RF1 C;  2OAR A;  2C0W A;  3AE5 C;  2KOG A;  3PP5 A;  2PGD A;  1URQ D;  1IJD B;  3H1L G;  1HWT C;  2FY8 A;  2QJP C;  3KQG A;  3GL0 A;  2ZVO B;  3H1J D;  1CSB A;  4IFF A;  3MD0 A;  2DW3 A;  4H44 C;  4ZKU A;  3CCJ P;  2HYN A;  3V2N A;  1SJG A;  1NTZ K;  2H89 C;  2KB7 P;  4XE5 B;  1L0N D;  3SWF A;  3ZDM A;  3JC2 2;  2Q9I A;  1BGY J;  3P8M C;  2IZ0 A;  1PP9 D;  1CI6 A;  2WSF J;  1K04 A;  1BGY E;  2YIU C;  1JCD A;  4OVN F;  2NWF A;  1G2C B;  5AVZ B;  1FJK A;  4GKG A;  1QVG O;  1OVR A;  2ZYA A;  2Q3W A;  2HPC A;  5KJ7 D;  3L73 D;  4JPZ B;  5GTH E;  1QX8 A;  3MUD C;  1N73 B;  2RH0 A;  2B24 A;  3RK3 E;  1S2E A;  5AEU A;  3CXH D;  5B5E E;  3JSV C;  1KIL E;  2L91 A;  3CCV P;  3BCC D;  1KB9 E;  2IYP A;  2LR2 A;  1OVV A;  2IFM A;  4EOT A;  3SWK A;  3GKE A;  4Y28 J;  1KTM A;  1GD2 E;  2IYO A;  3IR9 A;  3VMG D;  3TGU J;  4QDF A;  3RBZ A;  3KPE A;  2XNX A;  3H1H J;  1K05 A;  1RE4 C;  2HR3 A;  4KT0 J;  4IFD K;  1SFC D;  2LKM A;  3TGU E;  1JNM A;  2FKW B;  3VMX A;  3H1H E;  1FZC B;  1OW7 A;  1GU5 A;  1N7S A;  1CZQ A;  1VDF A;  3MIW A;  3AEF C;  1GW4 A;  4K3A A;  3IF4 A;  1U7J A;  2NPS C;  3FXD A;  2WSF H;  3BAT A;  2E74 C;  5AVR B;  5GTH H;  1JMM A;  2H43 A;  4HB1 A;  1VQ7 P;  1LWU C;  4WY4 A;  4OH8 B;  4B86 A;  2K9J B;  1IZN B;  1L4A B;  2WPS A;  1L0N K;  1NAY A;  2YO3 A;  4IL6 X;  1H0T B;  2BAS A;  1VQO P;  1W2E A;  5B5E H;  2R32 A;  4L73 A;  2XND H;  1IFI A;  3GTE A;  5KLV J;  1FZB A;  4YXW H;  1KB9 H;  1L0L G;  4L74 A;  4NB8 D;  1KQF B;  1ZOY C;  1NTM G;  1NTK K;  2I1J A;  4BRY A;  1FZC C;  1FQT A;  5KLV E;  1QLE D;  1OW6 A;  1URQ B;  5AVS B;  2JKV A;  1Y9B A;  3L72 D;  3WU2 E;  4QMA A;  1LT9 A;  4QCK A;  3GOB A;  3FWN A;  3P32 A;  1RY3 A;  2O1J A;  4HJL A;  1CW5 A;  1YJN P;  3N4X A;  2AEF A;  1NU1 J;  2M3E A;  1ZP0 C;  1L4A C;  1KV4 A;  1QVF O;  5KAI E;  1DIP A;  1YIT P;  2O1K A;  3L4F A;  3G6E P;  2KXP B;  1JEK A;  3IN6 A;  1NU1 E;  1LTJ A;  3GZX A;  1T6A A;  3Q2Y A;  3AE3 C;  4RKU J;  1RIE A;  4AIV A;  5KKZ B;  2BMO A;  1IFN A;  1IO4 A;  1NTZ J;  4W80 A;  1VQN P;  3P7K A;  3RBX A;  3CC4 P;  2K3R A;  1RQU A;  3GB4 A;  3H1K D;  1NTZ E;  1KQG B;  2E76 B;  5APV A;  5TJH A;  2FYU G;  5AVY B;  2NPS A;  3T97 B;  1VQ5 P;  3W67 A;  4YTP C;  3HTK B;  3M0D A;  1BCC D;  1LWU A;  1BDD A;  3USS A;  1IFJ A;  3H32 B;  3U59 A;  2Y9Y A;  4IL6 E;  1R8E A;  3WU2 H;  1SQX D;  3QH9 A;  2N9B A;  1FOS F;  4ZKP A;  4HM2 A;  3Q5R A;  3CI9 A;  4KHX A;  3UIA A;  2ZJS E;  5KKZ C;  3CWB D;  3HE4 B;  1RE3 A;  4HM7 A;  5DJT B;  2CKF A;  1G8J B;  2Z5I A;  5KAI H;  2BCC G;  1NOH A;  1FZA A;  1UUV A;  1JMB A;  4QUR A;  2N1T D;  4AAY B;  1SFC B;  5KJ7 C;  5BU5 A;  3BAS A;  1SQB D;  2JO1 A;  4XFJ A;  4JBZ A;  3L75 J;  1KYO E;  1GK4 A;  1DX7 A;  2IBZ I;  2XDJ A;  3AEC C;  3AE4 C;  1FZE A;  3L75 E;  1M1J A;  2YKQ A;  2OYO A;  2QIW A;  4C7N A;  5GTI E;  1K9M Q;  2E4Q A;  3NTN A;  3SFD C;  4IL6 H;  1NKZ B;  4BWN A;  1JY3 P;  3H1J J;  2QM8 A;  1SFC C;  5AW6 B;  1BDC A;  2GBW A;  1L0N J;  3H1J E;  3V4Q A;  3OAK A;  4R4L A;  3M9H A;  1MUU A;  3CX5 E;  1S1C X;  1PP9 J;  1AFO A;  1EDJ A;  1L0N E;  4NBA D;  3AE8 C;  2WT7 A;  1M90 Q;  1AA0 A;  2JZA A;  3MHV A;  1PP9 E;  5AW3 B;  5AW7 B;  1T3J A;  3L73 J;  1KYO H;  2FFD A;  1EDI A;  1FC2 C;  2IDB A;  5L8R J;  1NVO A;  2ZFC A;  2Q3I A;  3O8Z A;  2HMM A;  4NBE D;  3L73 E;  5AW5 B;  3NMD A;  3GZY A;  1YBK A;  5GTI H;  2FXP A;  4ZNC A;  3BRT B;  1P84 I;  1RH5 B;  1Q90 D;  3BCC J;  3G71 P;  1FS0 E;  3V4W A;  2IX7 C;  3QWO C;  3CXH E;  3RL0 D;  3VMZ A;  4PJ0 E;  2A06 G;  1SQB K;  2M8R A;  4JF7 A;  4PD4 I;  3BCC E;  1GMJ A;  2M3B A;  4ASV A;  1Q82 Q;  1U57 A;  4P1B H;  2E75 D;  1GL2 A;  4NBG D;  3CX5 H;  3O6Q A;  1SP4 A;  1ZR2 A;  4W7Z A;  2DE7 D;  2KSJ A;  2KS1 B;  3M91 A;  1VF5 D;  4HM1 A;  1JM1 A;  3L71 J;  2OTL P;  2JP3 A;  3WUV A;  4CPG A;  2P1J A;  1HVV A;  1KD1 Q;  3P8C E;  3L71 E;  3PLN A;  2AEM A;  2RN0 A;  4EYY Q;  2O01 N;  5H2F E;  1NHL A;  3SSU A;  3B8E B;  5KLI C;  4DT0 A;  2IFN A;  3FX0 A;  5APW A;  3N0Q A;  2C9L Y;  2YXR B;  3GL2 A;  4HKZ H;  2R5B A;  3A2A A;  2QJY B;  4GDO A;  3CXH H;  4PJ0 H;  3L74 D;  2WPQ A;  4N78 D;  1AV1 A;  1EZV D;  1UIX A;  1BGY G;  1N86 A;  2BEZ F;  5CXM A;  2KLU A;  3L72 J;  1RF0 A;  4EIJ A;  4ZMD A;  2QA4 P;  1AVY A;  3AE7 C;  2OYI B;  2N1T C;  1FZF A;  3L72 E;  2M5A B;  1SQP G;  1KC8 Q;  1XTG B;  2FYN B;  1PL5 A;  3IAO A;  5CMZ A;  1LGH B;  1O7M A;  4D6T G;  3B5N A;  2D2C D;  4U7J A;  3ABV C;  5APQ A;  4GT1 A;  2QJY C;  4BXL A;  2RKL A;  2HMN A;  1EC5 A;  3HUS A;  4GIF A;  2Q7C A;  2WSC J;  5H2F H;  2H88 C;  1DH3 A;  2K37 A;  1SLQ A;  5APY A;  5CCG D;  3H1K J;  2IPP A;  3CXH I;  3L70 G;  3CX5 D;  4I7Z B;  3TGU G;  1BCC J;  3H1K E;  3D6Z A;  4EDF A;  2O01 J;  3H1H G;  1KMI Z;  2ZVN B;  5APS A;  2FBW C;  1H8A A;  4JYB A;  4HM4 A;  2HOD B;  5CCH D;  3VYI A;  5AW8 B;  1BCC E;  3GHG A;  2FYN C;  1SQX J;  1NTK D;  3F89 A;  1K8A Q;  2BCC D;  3RL0 B;  2H8P D;  3CWB J;  2E76 D;  1S72 P;  2XKM A;  1BE3 D;  1SQX E;  3HD7 A;  1H88 A;  4N6J A;  3GF3 A;  1JY2 P;  4U3F D;  1NTM K;  2C9N Y;  3CWB E;  2E75 B;  2P67 A;  1M57 D;  5M1B A;  3C9I A;  2AXC A;  1LP1 B;  3V6I A;  3KZI E;  1SQB J;  1KIL A;  2IBZ G;  4I7Z C;  1USE A;  2V7Q J;  2QSI A;  2W83 C;  4H13 B;  3FOU A;  2N1T A;  4K35 A;  4TT3 H;  2YMY A;  5KLV G;  3PHL A;  3BVH A;  1SQB E;  1RQV A;  1VF5 B;  1NWQ A;  3AEA C;  1Q90 C;  1RF1 A;  1OMI A;  1OXZ A;  2WSC H;  1AVO A;  1FDO A;  3RL0 C;  3H25 A;  3D89 A;  4I6M C;  5AW9 B;  3VCA A;  1M7L A;  2Y0E A;  2O01 H;  1NU1 G;  1YQ4 C;  1N73 C;  2BMR A;  3P8C D;  3L71 D;  1G8K B;  1Y47 A;  1SQV G;  4AYC A;  1PGJ A;  2HFE D;  4WWI A;  4QDC A;  4NPD A;  1VF5 C;  2KNC A;  3AE6 C;  1ZRT D;  3R2P A;  3KZI H;  1GTW A;  2JDI H;  2YKO A;  5APT A;  3AEB C;  1SS1 A;  2OYH B;  2Y0C A;  1PPJ D;  2QJK B;  2ZT9 D;  1WMK A;  2V7Q H;  2E43 A;  3A5T A;  2KK7 A;  1BSH A;  3MUD A;  4LLH A;  2HG5 D;  2D2C B;  4AUW A;  4L75 A;  3I5C A;  1M1J B;  4P1C H;  1YIJ P;  5AVQ B;  2B1X A;  1PGO A;  2UWJ E;  1E5W A;  3WUT A;  1MFZ A;  1M56 D;  1PGQ A;  1VQM P;  1JY2 N;  3A3Y B;  1O7N A;  1D7M A;  3IFM A;  2XSO A;  1RFS A;  1G2C A;  2YFJ A;  3Q5S A;  2A45 H;  3E1I A;  1RE4 A;  2QJK C;  5AVW B;  2P10 A;  3H1I G;  1N73 A;  2Y0D A;  1KB9 I;  2CK3 H;  2D2C C;  1HJ0 A;  1SVF A;  1URQ C;  4IOI H;  1M1K Q;  1DEE G;  2JR8 A;  2K88 A;  3ITK A;  3W68 A;  5CCG C;  1YHQ P;  1HTL C;  3KYQ A;  1YJ9 P;  1HGV A;  3B71 A;  4W7Y A;  1PFI A;  1SQQ G;  2IZ1 A;  2Q1K A;  2J5U A;  2YXQ B;  2DE5 D;  2KZJ A;  1IK9 A;  2KP8 A;  1FZC A;  1L0N G;  1EG9 A;  3L74 J;  3TDK A;  4JQ0 D;  3VTP C;  1LJ2 A;  2E76 C;  2WQY C;  2XR8 A;  3L74 E;  1SQP D;  1QGK B;  5BU8 B;  1Q2N A;  4N78 E;  3E7K A;  1EZV E;  1GL2 B;  3S4R A;  5KAF E;  2JO6 A;  2K9J A;  2ITA A;  1L4A A;  1N7L A;  1WQL A;  2WPR A;  3L73 G;  4HJG H;  1H0T A;  1ULJ A;  2G3A A;  3H1L D;  3GF7 A;  3EWK A;  1YYC A;  1OZH A;  2E5Y A;  2OQQ A;  3VMI D;  1KQL A;  3RL0 g;  4QUQ A;  2B87 B;  1M8O B;  3BCC G;  1X0T A;  2KLV A;  1URQ A;  2G8Y A;  1YJW P;  2ZT9 B;  1J1D B;  2C0X A;  1S4X A;  2B89 A;  2P7J A;  3Q3D A;  4Z1M H;  1N7S D;  1IK7 A;  2J59 M;  3NFQ A;  1S5L X;  2QRX A;  1HBW A;  2W27 A;  4I1L A;  3D70 A;  1VQ9 P;  2BEQ D;  3CCQ P;  2Q3E A;  1QL1 A;  1VQ6 P;  1NTK J;  3CME P;  1OX3 A;  4WY4 D;  2GM4 A;  3EQQ A;  2ZXE B;  3CCU P;  2BCC J;  3V2R A;  2HML A;  1BE3 J;  3TNU B;  5KAF H;  1NTK E;  5C39 A;  4NB9 D;  4U3F J;  2W6J H;  3Q1M A;  2BCC E;  1MZ9 A;  2ZT9 C;  1J1D C;  1E79 H;  5KJ7 A;  2M0B A;  1HJB A;  3T97 A;  1BE3 E;  2MJZ A;  1K73 Q;  1JO5 A;  1KFN A;  2KSE A;  3HTK A;  4U3F E;  3RK2 D;  3C8V A;  4NBB D;  1IFD A;  1KOR A;  3U1A A;  3H32 A;  4TLF A;  3U1C A;  1BSN A;  1SQP K;  3CMA P;  2XSH A;  3V2Q A;  2JWD A;  2YFL A;  3HE4 A;  1HGZ A;  2Z5H A;  3L72 G;  2E5T A;  3K5B A;  1YQ3 C;  1GDT A;  4H0L D;  2GA1 A;  3FGA D;  4RES B;  1OWA A;  2NVE A;  1T3U A;  1CI6 B;  4H13 D;  1S3J A;  3MTU E;  5AW0 B;  1SFC A;  1SQV D;  1ZLL A;  3LID A;  4RO0 A;  2R5D A;  3AE2 C;  3C0D A;  1KYO I;  3GCE A;  1S5L E;  1MV8 A;  5BVZ A;  2HPC B;  1NH4 A;  1J2J B;  2WWW A;  4UB6 E;  3MGN A;  1VQK P;  4HM5 A;  2PAJ A;  3C1L A;  3PJS K;  1NO4 A;  1L0L D;  1T2K D;  2FXM A;  3GMA A;  2NUM A;  4EI2 A;  4DJG A;  1FBM A;  1NTM D;  3H1K G;  1AJY A;  3LW5 J;  1JTH A;  1P84 D;  3FWL A;  1OIP A;  1ZRT E;  1NYH A;  2O3J A;  2OTK E;  1BCC G;  1PPJ E;  4PD4 D;  2W6B A;  1RF1 B;  4A7P A;  3JCU E;  1O7G A;  3CX5 I;  4QDF B;  3OJA B;  2Q5U A;  1Y8A A;  1SQX G;  1KZU B;  3A7O A;  1DD4 A;  5CBO A;  3CWB G;  1W5C E;  2A06 E;  3OA7 A;  1N7S B;  2WTY A;  2W6A A;  2AEJ A;  2XZR A;  4C7R A;  4OGQ D;  3H1I D;  4AQR D;  1Q81 Q;  4EMJ B;  1S5L H;  2WPV B;  2YFI A;  5AW1 B;  5AW4 B;  2QVA A;  2FYU D;  4UB6 H;  5EFW B;  1LNQ A;  4WY4 B;  3AZC A;  2YIU B;  1LTS C;  1NU1 K;  1NAF A;  1ZXG A;  3L35 A;  1SQQ D;  3S9O A;  3V2P A;  2OYI C;  1SQV K;  3LW5 H;  1JOC A;  4BRY B;  3LIE A;  3G4S P;  3RK2 B;  3R4Y A;  5CJ0 A;  2YNY A;  3HE5 A;  2WSS H;  1N7S C;  3JCU H;  2NZ2 A;  4M3L A;  2A45 G;  3CPW O;  3PRJ A;  1LT9 B;  1GU4 A;  4HM3 A;  3VCP A;  3CCL P;  1KFM A;  3PH0 A;  2NRG A;  3F5H A;  1L0L K;  4WY4 C;  3H6P A;  4L76 A;  5E79 E;  3I55 P;  2RMZ A;  1ZR4 A;  1PIX A;  2KS1 A;  2NVF A;  2XRX A;  4NBD D;  4XA4 A;  1LTJ B;  1SQP J;  4H0L B;  2I1K A;  2WSE J;  3B4S A;  1EXJ A;  1GW3 A;  3SFE C;  2PRR A;  4NBH D;  1SQP E;  3VMA A;  5AVV B;  2QE7 H;  4OWF A;  3RK2 C;  4D6T J;  1UUW A;  2KIK A;  3M9Q A;  3H1L J;  1X79 B;  3AE1 C;  1JUN A;  2NPS B;  3L36 A;  1LT9 C;  1JCC A;  2E74 B;  3FXE A;  4D6T E;  2KZI A;  1EDL A;  1PGP A;  1LTG C;  3M06 A;  3H1L E;  1LWU B;  4HM8 A;  3VP8 A;  1VPC A;  3L70 J;  2DE6 D;  2SPZ A;  3GTS A;  1W2B O;  1X8Y A;  1GL2 D;  4PV1 D;  2E75 C;  4GOD A;  1Z56 A;  3KXD A;  3A0B E;  2OGU A;  2HMJ A;  1LTJ C;  4H0L C;  3L70 E;  4YXD C;  2FYU K;  2R3S A;  2OYI A;  4H13 C;  3CD6 P;  2M5A A;  1JY3 O;  3CLQ A;  3II6 A;  1JB0 J;  3V5B A;  1EXI A;  5AVX B;  1N8R Q;  2XU6 A;  1YTZ I;  2K9Y A;  5E79 H;  3GW6 A;  1NTZ G;  4MN4 C;  2BMQ A;  1J1E B;  2FYZ A;  3EN1 A;  3VMH D;  1AQT A;  1SQQ K;  2H7H A;  1FU1 A;  3SWY A;  3M0D C;  2GBX A;  2ZYL A;  1T2K C;  1HH0 A;  1OVU A;  4OGQ B;  1NJI Q;  2WSE H;  2ZAE B;  1ZW0 A;  1G1J A;  2PP6 A;  2NUK A;  3TK1 A;  2I8D A;  5CBN A;  4HH2 A;  3Q5P A;  2IBZ E;  1L2P A;  4C7N B;  2A06 D;  2JJL A;  3VN0 A;  1RE3 C;  4I2L C;  5APX A;  2HOD A;  3D6Y A;  1X9V A;  3N7N A;  4R4M A;  2FXO A;  1J1E C; 
#chains in the Genus database with same CATH homology
 3CX5 E;  4H0L D;  2BMR A;  1L0N E;  1ULI A;  4NBA D;  3H1K E;  2Q3W A;  3GTE A;  4D6T E;  4NBF D;  1G8K B;  2NVE A;  3L71 E;  4H13 D;  4HM2 A;  3DQY A;  3H1L E;  4QDD A;  4NB8 D;  4HM4 A;  3AZC A;  4HM8 A;  5KKZ C;  2JZA A;  3C0D A;  1PP9 E;  2DE6 D;  4NBC D;  5KLI C;  4QDC A;  1BCC E;  3GTS A;  2FYN C;  3GCE A;  4HM7 A;  1FQT A;  5KLV E;  3N0Q A;  4PV1 D;  2CKF A;  4HKV A;  1G8J B;  3H1I E;  2B24 A;  2E4P A;  3GL2 A;  5AEU A;  1O7H A;  2NVG A;  2I7F A;  2HMJ A;  3L70 E;  1UUV A;  4QUR A;  2E76 D;  4QCK A;  3GOB A;  2HMM A;  1KB9 E;  4NBE D;  4AAY B;  5BOK A;  2ZT9 D;  1SQX E;  4HM6 A;  2DE5 D;  4QUP A;  4HM5 A;  3L73 E;  4HJL A;  2FYU E;  2HMK A;  3GZY A;  5CXM A;  2NUM A;  1SQV E;  3EQQ A;  4HM0 A;  4H44 D;  3CWB E;  3GKE A;  1EG9 A;  2HML A;  3VMG D;  1KYO E;  2BMQ A;  4QDF A;  3EN1 A;  1NTK E;  3VMH D;  1ZRT E;  2YVJ B;  4NB9 D;  4HM3 A;  3CXH E;  1NU1 E;  3VCP A;  3GZX A;  4P1C H;  3FOU A;  2BCC E;  3L72 E;  2E74 D;  2B1X A;  2XR8 A;  2QJP C;  3L75 E;  1RIE A;  1SQQ E;  3BCC E;  3L74 E;  1PPJ E;  2GBX A;  3GL0 A;  3TGU E;  4AIV A;  1BE3 E;  2ZYL A;  2BMO A;  1O7P A;  1SQB E;  1EZV E;  3H1H E;  4U3F E;  1L0L E;  4P1B H;  2E4Q A;  1O7G A;  4QDF B;  1SJG A;  1NYK A;  2E75 D;  1O7N A;  2NVF A;  1NDO A;  1Q90 C;  2NUK A;  2XRX A;  4NBG D;  4NBB D;  4NBD D;  1NTM E;  2QPZ A;  1O7M A;  2XSO A;  2JO6 A;  3GB4 A;  1WQL A;  1O7W A;  2D2C D;  1P84 E;  1RFS A;  5HL4 A;  1NTZ E;  1VCK A;  1ULJ A;  2YFJ A;  2QJY C;  5AEW A;  2XSH A;  2IBZ E;  2HMN A;  3D89 A;  2DE7 D;  2QJK C;  4NBH D;  3VCA A;  1VM9 A;  2A06 E;  1SQP E;  2GBW A;  4PD4 E;  3H1J E;  3VMI D;  1VF5 D;  2YFL A;  1UUW A;  4OGQ D;  4HM1 A;  1JM1 A;  4QUQ A;  2HMO A;  4EMJ B;  1BGY E;  2YIU C;  2YFI A;  2NWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...