1NTXA

Secondary structure determination for alpha-neurotoxin from dendroaspis polylepis polylepis based on sequence specific proton nuclear magnetic resonance assignments
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
RICYNHQSTTRATTKSCEENSCYKKYWRDHRGTIIERGCGCPKVKPGVGIHCCQSDKCNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-NEUROTOXIN
publication title Secondary structure determination for alpha-neurotoxin from Dendroaspis polylepis polylepis based on sequence-specific 1H-nuclear-magnetic-resonance assignments.
pubmed doi rcsb
source organism Dendroaspis polylepis polylepis
molecule tags Neurotoxin
total genus 10
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1992-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ntxA00
4BDTB 2MUOA 4XJJA 1NORA 5DU1A 2H5FA 2K3GA 1FASA 3NH7A 1CDRA 1HAJA 1ES7B 4ZQYA 1KS6A 2LCRA 1CXNA 1KXIA 1HOYA 1NEAA 3KFDE 1CODA 1KTZB 2QJBC 3BT2U 3NDSA 1HC9B 1JE9A 1I02A 1V6PA 1S4YA 2H64B 3PLCA 4QTIU 3NEQA 1IDIA 3HH7A 1B41B 1CXOA 1CREA 5IMYC 2MJ4A 2PJYC 3U74U 1CDQA 1KL8A 1IK8A 1PLOA 1KC4A 2MJ0A 4EY8B 2LA1A 4FAOE 2QJ9C 1KBSA 1CCQA 4OM5A 1LX5B 3BT1U 3U73U 4DO8A 1CRFA 1KFHA 2BHIA 2QC1A 1FSCA 1FSSB 4IYEA 1JBDA 2H7ZB 1CTXA 4UY2C 1TXAA 1F8UB 1MAHF 5DZ5A 3FEVA 1IJCA 2ERAA 2MFAA 4RUDA 1YWHA 1RL5A 2MJYA 2J8BA 1G6MA 1HC9A 2GOOC 3LAQU 1RGJA 2N99A 1KBTA 3QB4B 2L03A 2VLWA 2ABXA 1FF4A 1LXHA 4P7UA 2JVEA 1CDSA 1BTEA 1CVOA 1NYUA 2CCXA 3ERAA 1LJZA 2I9BE 1NTXA 2UWRA 2BTXA 1REWC 2H62D 2H8UA 2MUPA 5EBXA 1HAAA 4AEAA 1TGXA 2QJAC 1IQ9A 1W6BA 4BIKB 2H7ZA 6EBXA 2PJYB 3KFDI 1L4WA 2CTXA 1ERGA 2H64C 1LXGA 1QKDA 1DRSA 3VTSA 3EBXA 1ERAA 1FRAA 2H62C 1CB9A 1QM7A 1MR6A 1XT3A 1NTNA 1QKEA 1FFJA 2CRTA 1ABTA 2CDXA 1M9ZA 2X8BB 2FD6U 1TXBA 1UG4A 1IDGA 2CRSA 1JGKA 1IDLA 1NXBA 4LFTA 1NYSA 1BXPA 3EVSC 1CHVS 2GOOB 4HQPF 2JQPA 2L5SA 1ZADA 2UX2A 1CDTA 1H0JA 5IMTD 2HLRA 1IDHA 2NBTA 1VB0A 1ONJA 5DO6A 2HLQA 2MHYA 2OFSA 1COEA 1LSIA 1TFSA 1IKCA 4FAOC 1KBAA 1F94A 1KU6B 4OM4A
chains in the Genus database with same CATH superfamily
4BDTB 2MUOA 4XJJA 1NORA 5DU1A 2H5FA 2K3GA 1FASA 3NH7A 1CDRA 1HAJA 1ES7B 4ZQYA 1KS6A 2LCRA 1CXNA 1KXIA 1HOYA 1NEAA 3KFDE 1CODA 1KTZB 2QJBC 3BT2U 3NDSA 1HC9B 1JE9A 1I02A 1V6PA 1S4YA 2H64B 3PLCA 4QTIU 3NEQA 1IDIA 3HH7A 1B41B 1CXOA 1CREA 5IMYC 2MJ4A 2PJYC 3U74U 1CDQA 1KL8A 1IK8A 1PLOA 1KC4A 2MJ0A 4EY8B 2LA1A 4FAOE 2QJ9C 1KBSA 1CCQA 4OM5A 1LX5B 3BT1U 3U73U 4DO8A 1CRFA 1KFHA 2BHIA 2QC1A 1FSCA 1FSSB 4IYEA 1JBDA 2H7ZB 1CTXA 4UY2C 1TXAA 1F8UB 1MAHF 5DZ5A 3FEVA 1IJCA 2ERAA 2MFAA 4RUDA 4KSNA 1YWHA 1RL5A 2MJYA 2J8BA 1G6MA 1HC9A 2GOOC 3LAQU 1RGJA 2N99A 1KBTA 3QB4B 2L03A 2VLWA 2ABXA 1FF4A 1LXHA 4P7UA 2JVEA 1CDSA 1BTEA 1CVOA 1NYUA 2CCXA 3ERAA 1LJZA 2I9BE 1NTXA 2UWRA 2BTXA 1REWC 2H62D 2H8UA 2MUPA 5EBXA 1HAAA 4AEAA 1TGXA 2QJAC 1IQ9A 1W6BA 4BIKB 2H7ZA 6EBXA 2PJYB 3KFDI 1L4WA 2CTXA 1ERGA 2H64C 1LXGA 1QKDA 1DRSA 3VTSA 3EBXA 1ERAA 1FRAA 2H62C 1CB9A 1QM7A 1MR6A 1XT3A 1NTNA 1QKEA 1FFJA 2CRTA 1ABTA 2CDXA 1M9ZA 2X8BB 2FD6U 1TXBA 1UG4A 1IDGA 2CRSA 1JGKA 1IDLA 1NXBA 4LFTA 1NYSA 1BXPA 3EVSC 1CHVS 2GOOB 4HQPF 2JQPA 2L5SA 1ZADA 2UX2A 1CDTA 1H0JA 5IMTD 2HLRA 1IDHA 2NBTA 1VB0A 1ONJA 5DO6A 2HLQA 2MHYA 2OFSA 1COEA 1LSIA 1TFSA 1IKCA 4FAOC 1KBAA 1F94A 1KU6B 4OM4A
chains in the Genus database with same CATH topology
4BDTB 2MUOA 4XJJA 1NORA 5DU1A 2H5FA 2K3GA 1FASA 3NH7A 1CDRA 1HAJA 1ES7B 4ZQYA 1KS6A 2LCRA 1CXNA 1KXIA 1HOYA 1NEAA 3KFDE 1CODA 1KTZB 2QJBC 3BT2U 3NDSA 1HC9B 1JE9A 1I02A 1V6PA 1S4YA 2H64B 3PLCA 4QTIU 3NEQA 1IDIA 3HH7A 1B41B 1CXOA 1CREA 5IMYC 2MJ4A 2PJYC 3U74U 1CDQA 1KL8A 1IK8A 1PLOA 1KC4A 2MJ0A 4EY8B 2LA1A 4FAOE 2QJ9C 1KBSA 1CCQA 4OM5A 1LX5B 3BT1U 3U73U 4DO8A 1CRFA 1KFHA 2BHIA 2QC1A 1FSCA 1FSSB 4IYEA 1JBDA 2H7ZB 1CTXA 4UY2C 1TXAA 1F8UB 1MAHF 5DZ5A 3FEVA 1IJCA 2ERAA 2MFAA 4RUDA 4KSNA 1YWHA 1RL5A 2MJYA 2J8BA 1G6MA 1HC9A 2GOOC 3LAQU 1RGJA 2N99A 1KBTA 3QB4B 2L03A 2VLWA 2ABXA 1FF4A 1LXHA 4P7UA 2JVEA 1CDSA 1BTEA 1CVOA 1NYUA 2CCXA 3ERAA 1LJZA 2I9BE 1NTXA 2UWRA 2BTXA 1REWC 2H62D 2H8UA 2MUPA 5EBXA 1HAAA 4AEAA 1TGXA 2QJAC 1IQ9A 1W6BA 4BIKB 2H7ZA 6EBXA 2PJYB 3KFDI 1L4WA 2CTXA 1ERGA 2H64C 1LXGA 1QKDA 1DRSA 3VTSA 3EBXA 1ERAA 1FRAA 2H62C 1CB9A 1QM7A 1MR6A 1XT3A 1NTNA 1QKEA 1FFJA 2CRTA 1ABTA 2CDXA 1M9ZA 2X8BB 2FD6U 1TXBA 1UG4A 1IDGA 2CRSA 1JGKA 1IDLA 1NXBA 4LFTA 1NYSA 1BXPA 3EVSC 1CHVS 2GOOB 4HQPF 2JQPA 2L5SA 1ZADA 2UX2A 1CDTA 1H0JA 5IMTD 2HLRA 1IDHA 2NBTA 1VB0A 1ONJA 5DO6A 2HLQA 2MHYA 2OFSA 1COEA 1LSIA 1TFSA 1IKCA 4FAOC 1KBAA 1F94A 1KU6B 4OM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BDT B;  2MUO A;  4XJJ A;  1NOR A;  5DU1 A;  2H5F A;  2K3G A;  1FAS A;  3NH7 A;  1CDR A;  1HAJ A;  1ES7 B;  4ZQY A;  1KS6 A;  2LCR A;  1CXN A;  1KXI A;  1HOY A;  1NEA A;  3KFD E;  1COD A;  1KTZ B;  2QJB C;  3BT2 U;  3NDS A;  1HC9 B;  1JE9 A;  1I02 A;  1V6P A;  1S4Y A;  2H64 B;  3PLC A;  4QTI U;  3NEQ A;  1IDI A;  3HH7 A;  1B41 B;  1CXO A;  1CRE A;  5IMY C;  2MJ4 A;  2PJY C;  3U74 U;  1CDQ A;  1KL8 A;  1IK8 A;  1PLO A;  1KC4 A;  2MJ0 A;  4EY8 B;  2LA1 A;  4FAO E;  2QJ9 C;  1KBS A;  1CCQ A;  4OM5 A;  1LX5 B;  3BT1 U;  3U73 U;  4DO8 A;  1CRF A;  1KFH A;  2BHI A;  2QC1 A;  1FSC A;  1FSS B;  4IYE A;  1JBD A;  2H7Z B;  1CTX A;  4UY2 C;  1TXA A;  1F8U B;  1MAH F;  5DZ5 A;  3FEV A;  1IJC A;  2ERA A;  2MFA A;  4RUD A;  1YWH A;  1RL5 A;  2MJY A;  2J8B A;  1G6M A;  1HC9 A;  2GOO C;  3LAQ U;  1RGJ A;  2N99 A;  1KBT A;  3QB4 B;  2L03 A;  2VLW A;  2ABX A;  1FF4 A;  1LXH A;  4P7U A;  2JVE A;  1CDS A;  1BTE A;  1CVO A;  1NYU A;  2CCX A;  3ERA A;  1LJZ A;  2I9B E;  1NTX A;  2UWR A;  2BTX A;  1REW C;  2H62 D;  2H8U A;  2MUP A;  5EBX A;  1HAA A;  4AEA A;  1TGX A;  2QJA C;  1IQ9 A;  1W6B A;  4BIK B;  2H7Z A;  6EBX A;  2PJY B;  3KFD I;  1L4W A;  2CTX A;  1ERG A;  2H64 C;  1LXG A;  1QKD A;  1DRS A;  3VTS A;  3EBX A;  1ERA A;  1FRA A;  2H62 C;  1CB9 A;  1QM7 A;  1MR6 A;  1XT3 A;  1NTN A;  1QKE A;  1FFJ A;  2CRT A;  1ABT A;  2CDX A;  1M9Z A;  2X8B B;  2FD6 U;  1TXB A;  1UG4 A;  1IDG A;  2CRS A;  1JGK A;  1IDL A;  1NXB A;  4LFT A;  1NYS A;  1BXP A;  3EVS C;  1CHV S;  2GOO B;  4HQP F;  2JQP A;  2L5S A;  1ZAD A;  2UX2 A;  1CDT A;  1H0J A;  5IMT D;  2HLR A;  1IDH A;  2NBT A;  1VB0 A;  1ONJ A;  5DO6 A;  2HLQ A;  2MHY A;  2OFS A;  1COE A;  1LSI A;  1TFS A;  1IKC A;  4FAO C;  1KBA A;  1F94 A;  1KU6 B;  4OM4 A; 
#chains in the Genus database with same CATH topology
 4BDT B;  2MUO A;  4XJJ A;  1NOR A;  5DU1 A;  2H5F A;  2K3G A;  1FAS A;  3NH7 A;  1CDR A;  1HAJ A;  1ES7 B;  4ZQY A;  1KS6 A;  2LCR A;  1CXN A;  1KXI A;  1HOY A;  1NEA A;  3KFD E;  1COD A;  1KTZ B;  2QJB C;  3BT2 U;  3NDS A;  1HC9 B;  1JE9 A;  1I02 A;  1V6P A;  1S4Y A;  2H64 B;  3PLC A;  4QTI U;  3NEQ A;  1IDI A;  3HH7 A;  1B41 B;  1CXO A;  1CRE A;  5IMY C;  2MJ4 A;  2PJY C;  3U74 U;  1CDQ A;  1KL8 A;  1IK8 A;  1PLO A;  1KC4 A;  2MJ0 A;  4EY8 B;  2LA1 A;  4FAO E;  2QJ9 C;  1KBS A;  1CCQ A;  4OM5 A;  1LX5 B;  3BT1 U;  3U73 U;  4DO8 A;  1CRF A;  1KFH A;  2BHI A;  2QC1 A;  1FSC A;  1FSS B;  4IYE A;  1JBD A;  2H7Z B;  1CTX A;  4UY2 C;  1TXA A;  1F8U B;  1MAH F;  5DZ5 A;  3FEV A;  1IJC A;  2ERA A;  2MFA A;  4RUD A;  4KSN A;  1YWH A;  1RL5 A;  2MJY A;  2J8B A;  1G6M A;  1HC9 A;  2GOO C;  3LAQ U;  1RGJ A;  2N99 A;  1KBT A;  3QB4 B;  2L03 A;  2VLW A;  2ABX A;  1FF4 A;  1LXH A;  4P7U A;  2JVE A;  1CDS A;  1BTE A;  1CVO A;  1NYU A;  2CCX A;  3ERA A;  1LJZ A;  2I9B E;  1NTX A;  2UWR A;  2BTX A;  1REW C;  2H62 D;  2H8U A;  2MUP A;  5EBX A;  1HAA A;  4AEA A;  1TGX A;  2QJA C;  1IQ9 A;  1W6B A;  4BIK B;  2H7Z A;  6EBX A;  2PJY B;  3KFD I;  1L4W A;  2CTX A;  1ERG A;  2H64 C;  1LXG A;  1QKD A;  1DRS A;  3VTS A;  3EBX A;  1ERA A;  1FRA A;  2H62 C;  1CB9 A;  1QM7 A;  1MR6 A;  1XT3 A;  1NTN A;  1QKE A;  1FFJ A;  2CRT A;  1ABT A;  2CDX A;  1M9Z A;  2X8B B;  2FD6 U;  1TXB A;  1UG4 A;  1IDG A;  2CRS A;  1JGK A;  1IDL A;  1NXB A;  4LFT A;  1NYS A;  1BXP A;  3EVS C;  1CHV S;  2GOO B;  4HQP F;  2JQP A;  2L5S A;  1ZAD A;  2UX2 A;  1CDT A;  1H0J A;  5IMT D;  2HLR A;  1IDH A;  2NBT A;  1VB0 A;  1ONJ A;  5DO6 A;  2HLQ A;  2MHY A;  2OFS A;  1COE A;  1LSI A;  1TFS A;  1IKC A;  4FAO C;  1KBA A;  1F94 A;  1KU6 B;  4OM4 A; 
#chains in the Genus database with same CATH homology
 4BDT B;  2MUO A;  4XJJ A;  1NOR A;  5DU1 A;  2H5F A;  2K3G A;  1FAS A;  3NH7 A;  1CDR A;  1HAJ A;  1ES7 B;  4ZQY A;  1KS6 A;  2LCR A;  1CXN A;  1KXI A;  1HOY A;  1NEA A;  3KFD E;  1COD A;  1KTZ B;  2QJB C;  3BT2 U;  3NDS A;  1HC9 B;  1JE9 A;  1I02 A;  1V6P A;  1S4Y A;  2H64 B;  3PLC A;  4QTI U;  3NEQ A;  1IDI A;  3HH7 A;  1B41 B;  1CXO A;  1CRE A;  5IMY C;  2MJ4 A;  2PJY C;  3U74 U;  1CDQ A;  1KL8 A;  1IK8 A;  1PLO A;  1KC4 A;  2MJ0 A;  4EY8 B;  2LA1 A;  4FAO E;  2QJ9 C;  1KBS A;  1CCQ A;  4OM5 A;  1LX5 B;  3BT1 U;  3U73 U;  4DO8 A;  1CRF A;  1KFH A;  2BHI A;  2QC1 A;  1FSC A;  1FSS B;  4IYE A;  1JBD A;  2H7Z B;  1CTX A;  4UY2 C;  1TXA A;  1F8U B;  1MAH F;  5DZ5 A;  3FEV A;  1IJC A;  2ERA A;  2MFA A;  4RUD A;  4KSN A;  1YWH A;  1RL5 A;  2MJY A;  2J8B A;  1G6M A;  1HC9 A;  2GOO C;  3LAQ U;  1RGJ A;  2N99 A;  1KBT A;  3QB4 B;  2L03 A;  2VLW A;  2ABX A;  1FF4 A;  1LXH A;  4P7U A;  2JVE A;  1CDS A;  1BTE A;  1CVO A;  1NYU A;  2CCX A;  3ERA A;  1LJZ A;  2I9B E;  1NTX A;  2UWR A;  2BTX A;  1REW C;  2H62 D;  2H8U A;  2MUP A;  5EBX A;  1HAA A;  4AEA A;  1TGX A;  2QJA C;  1IQ9 A;  1W6B A;  4BIK B;  2H7Z A;  6EBX A;  2PJY B;  3KFD I;  1L4W A;  2CTX A;  1ERG A;  2H64 C;  1LXG A;  1QKD A;  1DRS A;  3VTS A;  3EBX A;  1ERA A;  1FRA A;  2H62 C;  1CB9 A;  1QM7 A;  1MR6 A;  1XT3 A;  1NTN A;  1QKE A;  1FFJ A;  2CRT A;  1ABT A;  2CDX A;  1M9Z A;  2X8B B;  2FD6 U;  1TXB A;  1UG4 A;  1IDG A;  2CRS A;  1JGK A;  1IDL A;  1NXB A;  4LFT A;  1NYS A;  1BXP A;  3EVS C;  1CHV S;  2GOO B;  4HQP F;  2JQP A;  2L5S A;  1ZAD A;  2UX2 A;  1CDT A;  1H0J A;  5IMT D;  2HLR A;  1IDH A;  2NBT A;  1VB0 A;  1ONJ A;  5DO6 A;  2HLQ A;  2MHY A;  2OFS A;  1COE A;  1LSI A;  1TFS A;  1IKC A;  4FAO C;  1KBA A;  1F94 A;  1KU6 B;  4OM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...