1NTZH

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 22
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1ntzH00
3H1HH 3L74H 3CX5F 1KB9F 1L0LH 3CWBH 1BCCH 1SQPH 3TGUH 1BE3H 4D6TH 3BCCH 3L72H 4U3FH 2BCCH 1BGYH 1SQBH 1NTMH 4PD4F 3L73H 1SQQH 1PPJH 2IBZH 1SQVH 1P84F 1PP9H 2A06H 2FYUH 3CXHF 3H1JH 3H1LH 3L75H 1SQXH 3L70H 1EZVH 1NTKH 1NU1H 3H1KH 1L0NH 5KLVH 3H1IH 1NTZH 1KYOF 3L71H
chains in the Genus database with same CATH superfamily
5IJ0A 3OM3B 2PI5A 1AI6A 4AQYO 1N34O 1FJGB 4MTGA 4YY3B 3T2MA 4AILC 4FFBB 3ZHQA 1EN4A 1NH2B 1Q43A 3N2GB 4DV3O 3KCXA 4DV4B 2NR5A 3K5LA 3B4SA 2G38A 4CS2A 3GWOA 1VQOV 4DUZO 3B2EE 4ABMA 1A32A 1IBMB 3OW2U 3CB2A 3JATA 2ZKOA 4LCUC 1ZLZA 3OE7G 2WAMA 3E22A 3TJTA 3E22B 2UUCO 3BABA 4X64B 3CCVV 1S76D 1QR9A 5EIBC 3H1JH 4X62B 1IX9A 3HPLC 3RWRD 5EBMC 1VP7A 2ZE5A 4K8ZA 5JCOC 1SQFA 3WB1A 1SS3A 1R1BA 1NBMG 4F6RB 3DXRB 1BE3H 3H01A 4LF7O 1XILA 2BTQA 4L8JA 5IY5C 4NB5A 1P84F 4DR1B 2OTJV 3JALA 3G4SV 4JYBA 5IJ0B 4I55A 4X9QA 2DMXA 4GX5A 1WPBA 2UUAO 3G80A 4YIPA 4U7OA 1IXBA 1ZL8B 4B3RB 3DGEA 5LOVA 1MZFA 3HKBB 3I55V 2LFSA 5A9GA 5LGNA 2KB1A 2OIEA 4DUYO 4DO2A 1Y76B 4TQFA 4GX0A 5E79Z 2XHBA 4ZHQB 5EZYB 1GH6A 3L73H 2RN9A 2DYSC 2JIZG 1AROP 1UFIA 3I5DA 1VF7A 3D36A 5KLVH 1M4UA 5B1BC 4RQEA 3KKYA 2E74B 3CP1A 4DV0B 4GKJB 4LH7A 4B3RO 3ABMB 5BMVA 1XHZA 4JASA 2FB5A 3ZX6A 5EC1C 2EILC 3N2KA 1HW7A 1XQ8A 1LUVA 2E5LB 4BW9A 2LO1A 4LFBO 3EHBB 2JJ1G 5JQGA 4ZBMA 5IT9N 3J7AU 1YITV 2F1MA 1Y76A 2Z3YA 2RQ6A 3KZIZ 1RPOA 3DSQA 4TV9B 3CE2A 2Q7GA 5HFMA 4R8CA 5E1AC 5DEDA 4XDJA 1S72V 4K3AA 1BL8A 2UU9B 5B1AB 2AXTZ 2IJKA 5JCOA 3HR0A 4CH3A 5KA6A 4DR3O 1KP3A 1QLNA 1VQ4V 1NTMH 1AI4A 2ZXWB 2ITCC 3GVMA 3OUSA 1AJPA 1AILA 4UCTA 1M1KW 2PY5A 2JDIG 1K8AW 1VF6C 3L71H 3ZIAG 4NKGB 2B5UA 3OTFA 2YXHA 2YS8A 2WLMA 1VIBA 5LGTA 4DR6B 4TOIA 2ZR2A 4WBNB 1GTOA 1QLEB 1Z5VA 3GWKC 4I55B 2QKAA 2IBZH 2UXCB 2XAFA 3RBZA 4B3SB 2DW4A 3L70H 3WG7B 3CC4V 2QTSA 2LGWA 4YJ2B 5H2FZ 4JI2B 3ABKB 5GTHZ 2E3CA 2CDYA 2HR3A 4O4HA 4G27B 4X64O 3FD9A 3LNMB 1CPYA 3JD1A 3LUTB 3QVNA 4B7EA 4RUFA 2N05A 4MW3A 2ADQB 5BY1A 4E2LA 4DR2B 1KMIZ 4IL6Z 3E8HA 1I94B 2QM8A 3ABLB 3CHXA 5KX5B 3RYFB 1JFFB 4Q6GA 1ENVA 4WFBV 1XMQO 3S3XA 5ITZA 5ITZB 1K33A 1OCOB 4J80A 2WLLB 3JD2A 1Q3EA 1WP8A 3FX7A 2ETNA 2HVJC 3APOA 4U3JB 5JQGB 2QDOA 4NR1A 4LH6A 2ODMA 1PM9A 3AK1A 3AG4B 1GAXA 1YF2A 3HKCB 1HNWO 1EN5A 4X20B 3ZHRA 4HAMA 4R7CA 2XAGA 3J80N 2BSKB 1DTOA 4TWKA 1P7GA 4LFAB 2UXDO 2DYRC 4O4JA 4F4LA 3UCSC 1OCRC 2R9AA 1GK9A 2BOCC 3AG7A 3ZJZA 5L3CA 3T1CA 1NR1A 3W7SA 1H8HG 2D3OW 1OCZB 2YICA 2O57A 3NXSA 1MABG 2EILB 1KYOF 3G6EV 1XNQB 2IH1C 3LDEA 1JFFA 5IJ9B 4UCOA 5EYPB 5K1XA 1GN3A 2JGDB 4LF6B 1W2BU 2HHHO 3ASNC 4FFBA 4KHPB 3CC2V 1G4YB 1WPXA 1YEWA 1B3QA 2NN4A 2AZ2A 2Q68A 5H9CA 4CH6A 4X62O 2P90A 4J9ZB 2EX3A 2GV9A 3ZCCA 3RYCB 1K4CC 2IU0A 2X7RB 4I0XB 5KAFZ 3ASOC 3AK3A 1MOFA 2A79B 4TUYA 1YHQV 1BQZA 1Z5WA 4XDLA 2RCVA 1XBLA 3P32A 3G67A 1FXVA 4AHCA 3LDCA 2PZSA 3P3NA 1AB3A 3OD4A 1OJHA 4GLXA 4WCEV 3OMIB 4QIWF 3SPJA 1N8RW 2LGQA 1D5AA 1EZJA 2UXXA 3AG2B 3O9OA 4DXWA 1DK1A 3CD6V 4CH5A 3M99B 2P67A 3T1HB 4YIOA 2BOBC 3FYEB 1H2KA 1SRYA 1IZ3A 4DV1B 2HG5C 1WA8A 4YJ3A 3OUFA 3CCQV 2ZDIC 1EBOA 4PELA 3SR2C 2DOSA 4JI5O 2Q6AA 3KCYA 1T5EA 4D7TA 3IFXA 3K9SA 4LF4B 1BQ0A 4JI3O 2AHYA 3PJSK 4LF5O 4LFCO 1LR1A 4DK1A 2LQTA 4J9YB 3S3WA 4FZ1A 2PYJA 4I7ZB 3LDDA 4X88A 3SPIA 2OIGA 3H9VA 3LNNA 4PA4A 4D6TH 3CEIA 3WB2A 1WN7A 2EIJB 1R3LC 5CN0A 3AK2A 3ZMZA 4ICGA 3N2KB 2UXBB 2GHYA 1GMGA 5LBQA 4JI8O 2LW7A 4RO2A 2WWWA 3JCUZ 4P9PA 3K03A 1K92A 4YJ2A 3A0RA 3CSXA 4LF5B 2VQFO 3F7YC 3BA8A 3AG3C 4WBNA 3K59A 5CBHA 2YI8A 2B1IA 3K3WA 1P49A 1VQ9V 2QEXV 4BIOA 4PJ0Z 1IXMA 4DR7O 2EIMB 2KKWA 3ZRVA 3APQA 2Q8VA 3W7WA 4ZHQA 4KXRA 5FPRA 5LA6A 1TUEB 5LHIA 2DQ3A 5L3DA 3CXCU 4DR7B 4UV8A 1GKFA 3THOA 4FIPC 1NR7A 4O2AA 1HDJA 2HVKC 3T1HO 1NJIW 1HR0O 2LFRA 3K5OA 1JMKC 2F93B 3TXQA 3OTOO 3D8CA 1Y66A 4KHPO 3RYIB 1PL4A 5BZBA 2WA3A 1E1QG 3K79A 3L72H 5L3BA 2DQ0A 5KHKA 4I50A 2Y48A 5J2TB 3BY6A 3ZN0A 5IE9A 1QNMA 1B06A 1GM9A 2ZT9B 3JASA 3RYHA 1SKVA 2EJRA 2X0LA 4G28B 1ZAUA 2P7TC 3KG2A 2X6AA 4LF9O 3UO3A 2CUGA 5J2TA 2JJ2G 1KBHA 4NVPA 2L35A 2LP7A 1I0HA 3K0DA 3WFVA 5H6QA 4XBFA 3JAKA 3ML0A 4PDVA 1QCEA 2R9IA 5J2UB 1FPOA 1O9HA 5JH7B 4DR4O 1RPRA 3K04A 4ZI7A 1QLEC 4I9WA 2W6IG 4OPAA 2H8PC 4J11A 1WAZA 3VQVA 1M90W 4DR4B 2VQFB 5DM6V 3JAWB 2PI4A 1L8DA 1MG1A 3SYOA 4NXMB 2C2AA 3JAMN 1THZA 3RVYA 4TSFG 2YSUB 3A0HZ 4PA6A 3AG2C 3X2QC 1M57C 4FK5C 4NXMO 1L0LH 3QTCA 3CWBH 1H8EG 1K5SA 3T1YB 1H2GA 4H0LB 3FAVA 4CC5A 3BPZA 1VQ7V 1NH2D 1Y67A 2P4VA 2LW1A 5BR8O 3D36C 3SJCC 3U0ZA 4PI0A 3ZRXA 3CJHA 1TUBB 1TGOA 1U97A 1Z2GA 3HKCA 1US6A 3F7VC 2ZCEA 4B3MO 4EKWA 5KHGA 4DR5O 5JJEB 2BE3A 2QJ1A 4X65B 1BGYH 2A06H 1H38A 2F66C 3CCLV 1I08A 3E83A 2QGNA 1NU1H 3R66A 4DV6B 3CMEV 3TCUA 4H44B 4U7NA 1OCCC 4UUJC 1L0NH 3CMAV 3SGIA 4O2BA 1SETA 5JWPA 4GZRB 2FMLA 4JI1B 4JI7B 3ZRWB 3IAYA 1N32O 1NZ6A 3QO8A 4WFAV 1FFTB 2RNBA 2QKCA 4CS3A 2Q7EA 2H3OA 2D2CB 1WP7A 2GDSA 3ZMUA 1BSMA 4DV1O 3ICXA 1TA8A 5FLXN 3L74H 4JTDB 5L3EA 1FFXA 5JJJB 1XMOB 4JV5O 1AP5A 1JJOA 1KKDA 3VQWA 4Q20A 2DN9A 5B3SB 2Q5ZA 2VRZA 4GKKB 2EULA 2ZINA 4E4EA 1X4TA 1S5HC 3OEEG 3L9DA 4EB6A 1HWYA 1K34A 4PHZA 1Q7YW 1PNLA 2UUBO 3EVKA 2QM4A 3JSLA 4GCZA 1N33B 2YI9A 4KUMA 3FYIB 4TUYB 1I5YA 4HYOA 2AZ0A 4H37A 4R50A 1VEWA 5LHHA 4JTAB 1JQ0A 5F2VO 1LNQA 2Y0PA 2XNDG 2FKXA 2VS0A 1Q86W 2QA4V 1TVKB 5L3FA 4IT5A 2ADPA 2UXDB 1OZ0A 2FL4A 3H1KH 4Z2WA 1FXKB 1H2LA 3U10A 4BR6A 5KHHA 3GB7C 1VQLV 1V54C 1XI1A 1JX9A 4P30A 2F4VB 4LF8B 1YXBA 4LWSA 1N33O 1GRJA 5LA6B 4HNAA 4PA7A 4HNAB 4OGQB 4JF3A 1VF6A 2M7WA 4JI8B 1XDCA 1IBKO 5CA1A 1BMFG 4OPHA 2H94A 2ZXWC 4WFEA 2ILMA 4GT1A 4JGSA 2EINC 1GN6A 2QWNB 4O4JB 4WFHA 1X59A 4L87A 4UFZA 1YIJV 2ZIMA 3JD0A 2FYUH 2AGAA 2OCCB 1U96A 4I50B 4MW8A 1WJZA 4IHJA 1W0JG 5BMVB 4W4LA 4FM1A 4BAYA 2JGUA 1KQSU 3HKDB 1M5IA 2FTKA 1BHAA 3E86A 1SQQH 2HFEC 2YIDA 4JI1O 1AP6A 2ZM6O 3UT5B 3B09A 3X2QB 2EIKB 1JPXA 1W0KG 4N21A 2VQEB 5HFLA 1GM7A 5LL6Y 2V4DA 1XEQA 5L3GA 3ASOB 4IYHA 3ZHVA 2YEVA 4JI0B 4UXNA 3HKBA 4MVRA 1Q8IA 2XT9A 3CCUV 5DN6G 1Q90D 3CRMA 2PYLA 3H1LH 2YEVB 2CH7A 1R6TA 4MVUA 3C90A 1KUQA 2ZD9A 1R3KC 1SF9A 2E76B 3K08A 5JH7A 1SESA 4C7UA 1VQMV 3P30A 4N23A 4JZGA 1KB9F 3A2FA 3AG1C 2F23A 4GKKO 4O4LA 5LXTA 2EIMC 2UUBB 3HKDA 1VF5B 3P3PA 1FAFA 4MVOA 2YC0A 3ABKC 4GX1A 2PF4E 1XL4A 3CCEV 2YIAA 3E89A 3VQYA 4FFKA 2WSSG 1JR9A 2QSAA 3ZN1A 1G1XB 3IC7A 4UVBA 5EZYA 1PPJH 5KMGB 1R73A 4HZ3A 3N2GA 3B8MA 5LMNB 1F23A 3JCZA 2UUCB 2DWDC 4FM0A 2R9RB 3RVZA 5JVDA 4QE7A 1XHXA 2K1EA 2YXYA 5TISZ 4JYAO 3VOUA 1R6NA 3RFRA 1Q6HA 2Y69B 4JAUA 2OT5A 2PTMA 4PV1B 1GN4A 1PV0A 1QVFU 3JARA 2EIJC 3F5WC 4G2KA 4UVCA 1JCHA 1KC8W 1E79G 2N74A 2L6LA 5B1NA 1VQPV 1TAEA 5LOVB 1NKDA 2WLHA 4XDKA 3E35A 2JVDA 3WB0A 1UPGA 3W7UA 1N32B 3MDSA 4MVMA 2Q0AA 1P7BA 5DECA 2QWRB 3W7XA 1XOUA 4I0XA 2Y69C 1OCZC 4YJ3B 1HR0B 2DE0X 2NNUA 2QR4A 4X8AA 2OWOA 4FPPA 5LYJA 3B40A 2QE7G 4JZ2A 5LP6B 2P06A 5BXZA 4FM2A 5KA5A 2R72A 1NQTA 5JJNB 4LNUB 4FLXA 4DW0A 1HNZO 4O2AB 4Z1MG 3QO7A 2DYSB 4DV7O 3PN1A 1AJNA 1SC5B 4DK0A 2CTQA 1YCIA 2ZE7A 4MT8A 5IJ9A 1UJWB 1MSWD 2VWKA 1VQ5V 3R65A 4Z1VA 2UU9O 1COWG 2WLLA 3CS5A 4RWUA 4DV5B 3IGAC 3SPHA 3IC9A 2DWEC 2W0FC 2XUMA 4FLVA 1KKCA 3OR6C 4JI5B 3K57A 1SA0B 2ZNIA 3ZRWA 3UM7A 4PA3A 5GONA 1URFA 1EZVH 2DYRB 3TXSA 4IYIA 5IYBO 5FPOA 1XMQB 1BHBA 5C8YA 2PGGA 1NT2B 2ZQMA 3CRRA 1AR5A 4JAAA 4H33A 2F43G 4DUZB 3DTUB 2V7QG 1VQ6V 1PKXA 2LJ2A 1CP9A 4UVAA 3CXHF 4JI4O 4FZ0A 4I4TA 2EIKC 4BWAA 2JS3A 3ZMVA 3SJAC 3OGCC 1WB7A 4J7JA 1SZTA 3BVOA 1Q6UA 2WLKA 1MZEA 2P6JA 4JI4B 3E8GA 1RM1C 1VQKV 4OX9B 3WU2Z 5CA0A 4PDLA 5CA0B 5B5EZ 1PP9H 4LF7B 2A0LA 5IWAB 2Y4UA 4JYAB 1SQGA 3MHHC 1FXHA 4FLWA 1S3JA 3STZC 3BFRA 4MTFA 3QO5A 4DR2O 3BHPA 1H2NA 5LMNO 3ZHSA 3J81N 4EFBA 2JGDA 3G71V 1FXKA 1IBKB 3BAAA 4NTYA 3MAQA 1XUQA 2EZPA 3ZRSA 5C8YB 4QGPA 3SDLA 1Y4MA 1BZKA 3Q4HA 1CEZA 2Q9LA 4DV7B 3CRQA 4OXSA 1F4NA 1NI8A 2Z0AA 2WLIA 4RUEA 3K5MA 3M8AA 3SYQA 2AW9A 1Q5OA 2IW5A 3ETDA 4IIJA 5GTIZ 4JI6O 3E2EA 3FB7C 3SJQC 4ZOLB 4H13B 3G6BA 1JJ2U 1DF4A 4DV2B 4PDMA 3ABLC 1CXZB 5EBLC 3A0BZ 2E75B 2QKSA 4DR1O 2A9HA 1Y74B 2RMKB 3E8BA 2UXCO 1BCCH 3TGUH 3FB5C 4IHJB 4KFMA 1OCCB 1TVKA 4W4KA 3RN4A 1OCOC 4LFAO 4EEQA 3F5TA 3RYIA 3ZBHA 2CTPA 3QG5A 3U11A 5EYPA 2CAZC 2JRIA 1PNKA 1D2DA 2CTRA 1K3EA 1HNZB 4CH4A 5FNVA 1ROPA 1Q81W 4P9OA 4QE9A 4LWSB 3TK1A 4DR3B 3L75H 1J95A 1AVMA 2HEPA 4HBNA 3BEHA 3QNEA 5KAIZ 4O4LB 3B77A 4UCSA 1EN6A 4CS4A 3JARB 5CA3A 4X1KA 5BR8B 3CPWU 4ASUG 4ZI7B 1Y6XA 3FB8C 4R6ZA 1JVMA 1V54B 5B1AC 1ORQC 2PUSA 4DR5B 2QWPB 3T4ZA 4IGGA 4TT3G 2ZR3A 1F4MA 5CBFA 3CX5F 4UB6Z 3T1YO 2A7WA 1FS0G 3JD3A 5D5QA 4KL1A 4JI2O 4FMTA 3FAVB 1N0JA 3JD4A 2ITDC 3UT5A 2GBOA 2V1DA 4FLZA 2BTOA 1EM1A 1IVSA 1QVGU 3SPCA 2ARHA 2XAJA 4DR6O 3OEHG 4JYCA 2F95B 4JYYA 1SERA 4JI6B 2IJJA 1NTZH 2HP8A 4UCVA 2QWQB 4X20A 1ZL8A 2W0XA 3AEIA 3N27A 3BCCH 1IBLO 2ZIOA 1RM1B 3LSUA 2X6CA 4QNHB 2IH3C 1DLBA 1SZXA 4JI0O 1IBLB 4NYKA 2ZE8A 1JOYA 2EINB 3K58A 4F6RA 1WA8B 3CCMV 4PA9A 2HKOA 1N0NA 3OGIB 1SA0A 2EZOA 4DW1A 4J42A 3JAWA 1SQXH 1JA8A 4WFFA 5KMGA 4WFGA 1RP3B 1BS3A 1VQ8V 1QBZA 1NVPB 1WB8A 2K9PA 2UXNA 5EBWC 2XAHA 1S0VA 3ZEDA 5KUMA 1SQBH 3OR7C 4I4TB 3O65A 4QPJA 1KD1W 4B7KA 4K8XA 3OMAB 5LHGA 1KU9A 3TETA 1VARA 2NLJC 2WA4A 1PL0A 4K35A 4GKJO 1HNXO 2HLDG 4YHHB 4EB6B 3VQXA 4BIZA 3ABTA 5CB4A 4NTWA 1N4CA 1FD9A 1FJGO 2Q73A 1ZTEA 3LSSA 3MHSC 5CBGA 1VMGA 5EC2C 4X65O 3AG1B 3OAAG 1E1RG 4LF4O 3ZHTA 1MA1A 3ETGA 4J41A 1YZBA 4LF8O 2MW2B 2XOKG 3WG7C 1W59A 2AHZA 4PD4F 5IY5B 1F7YA 3JAKB 3BA9A 2HJDA 1ZX3A 4LNUA 4O4IA 5K1PA 1HP8A 3OFNG 4LF6O 5EIBD 1K73W 4B3SO 2CGOA 4X66O 5LYJB 1Q82W 2UXBO 1M93A 2Z5UA 3ZMSA 3SYPA 1FXKC 2WLJA 1AI7A 3FFQA 2IJHA 3RT3C 2UUAB 1J5EB 1SQVH 1K4DC 4B3MB 4NTXA 4GUNA 1F51A 5KHIA 2IM9A 2XTAA 4MS2A 4J7ZA 4F6EA 1M9NA 3OMNB 4BIUA 5CA1B 3SYAA 2CGNA 1ZWIC 1IURA 3UO2A 1RFYA 1BT8A 3JALB 3MD0A 4FLTA 1B6QA 1AR1B 4KP4A 1YSCA 3RYFA 1XMOO 4JI7O 3BRCA 3UQ8A 2GTAA 5AG2A 5IDJA 1WNSA 2BCCH 2B9ZA 4MVSA 2IU3A 2X6BA 3CCRV 1B04A 4YHHO 1P4RA 3CJHB 4TV9A 4LF9B 3OTOB 1O9GA 5C93A 1ZSPA 3DC6A 2Y4TA 4YY3O 3B8NA 4DV0O 1S5LZ 3RGBA 4FLUA 3C3SA 1N36O 2KSDA 1YJ9V 4DV3B 4B3TO 4DV4O 3ASNB 1MSDA 2E5LO 1K7DA 4ZIBA 1LUWA 1R3IC 3JSNA 4B3TB 1G8MA 1V55C 2QTOA 2CK3G 5LXTB 1TUBA 2Q69A 3CCJV 2YXLA 3DC5A 1XREA 1DGSA 1M56C 3HKEB 2Q7HA 5GW7A 5IWAO 3CC7V 4TV8B 2P5OA 4DYLA 1GO3F 2GUZA 1IBMO 2CH7B 4DRXB 3C3TA 4IIJB 1V55B 2KQXA 3D3IA 2HHHB 5J9PC 4I5SA 4FJCC 2EBOA 3STLC 3SYCA 4LC1A 3RYCA 1VQNV 2OCCC 3SPGA 4GX2A 2JEXA 5CB4B 4J10A 4U3FH 1NS1A 4YXWG 5FNVB 1FKAO 1NVPD 4MSWC 4LP8A 3FKSG 2QWOB 4X89A 2QM7A 1OV9A 1S5JA 4PI2A 2MK3A 4DUYB 4K0KB 1KECA 2BTQB 4ZKIA 4JAVA 1IDSA 3T4DA 2ZNJA 3DXRA 1Q6IA 1XNRO 2ATKC 4P2ZA 4NXNB 2WPDG 2DJVA 4CZZA 1V9PA 4WF9V 1KP2A 1GN2A 4MTXA 4LBEC 3ZHUA 5KUKA 2VWJA 2Y0IA 4X66B 1XL6A 1M56B 3A8TA 1PNMA 1I5XA 4U3JA 5D5PA 4X1IB 4X1IA 4D7SA 5A2QN 5B1OA 1ZUQA 1YJWV 4CBCA 2ZDIA 1L1FA 1QR8A 3Q4HB 2WLNA 1H2MA 4BW5A 3JYCA 1MNGA 5IYZA 4EFEA 1FFXB 4JI3B 4AQYB 3K9AA 4AI8A 1N34B 2VQEO 3EXAA 1OCRB 3LSQA 3VBBA 1QHTA 3H1HH 3ABUA 4X1YA 2XAQA 4X1YB 1S77D 1RSOB 3K5NA 1I7FA 5LP6A 1HNXB 2GSMB 2YUAA 4TQDA 3HB3B 2ZE6A 3NR7A 3AG3B 3CRCA 4J7KA 1YI2V 5B66Z 5IYDO 4UCUA 1DF5A 2IJIA 1H2SB 4MVQA 5LP6C 3QF7A 1PD3A 3HKEA 5H5NA 3SJBC 3D3QA 5IYCO 1EFRG 5EK0A 1MMMA 1WLEA 2OTLV 2W6JG 4GYCB 2A3QA 1YDXA 5LMUB 1D5NA 4OX9O 1RSOA 1K97A 3K0GA 4A5UB 2F4VO 5KHJA 4K0KO 1R3JC 4UV9A 1OHHG 3ZS8C 5B1BB 4I9QA 4B08A 2HJFC 1XNQO 4QJFB 1XNRB 1QU7A 5LMUO 2OCHA 4NXNO 1G6UA 4LR3A 4X1KB 2Q67A 3I56V 4UB8Z 5GONB 4ZOLA 3AG4C 2KG7A 5CMUA 3ABMC 1NTKH 4FVMA 1AI5A 4MTOA 1R6KA 2WLIB 4RQFA 3H1IH 2RJZA 4MVZA 2JS5A 3EFFK 5LGUA 4O2BB 3ETQA 2YDEA 4TV8A 4JTCB 1AJQA 4PDRA 2KG7B 1GM8A 4DRXA 3UKMA 3JASB 3RYHB 2XASA 4FLYA 4DV5O 3IJ4A 1J5EO 1FYJA 2Q4PA 2P4KA 3ZMTA 5FL7G 3FB6C 3ETEA 1M57B 1YVWA 5J2UA 1YTFB 3K06A 5JVDB 2JEUA 3E8FA 4O4HB 5IYZB 4DV6O 2YIBA 4DV2O 4O4IB 1K5QA 1Y74A 4LFBB 1I94O 3RW0A 2M6YA 4JV5B 2N04A 2P22C 2EJ7A 1YJNV 1K9MW 2JK5C 1HNWB 3JATB 5H6RA 2BSKA 4LFCB 2RDCA 2CE4A 3CYOA 4JPRA 2R70A 4CC6A 1SQPH 1AR4A 5B3SC 2GTSA 2ZM6B 1N36B 4UCRA 2Q0OC 3OT7A 2GUZB 5KX5A 3CRAA 1YTFD 2YIBD 4RAIA 4QPKA 2CTWA 3CCSV 2B1GA 1QQCA 2OYQA 3M7MX 3W7TA
chains in the Genus database with same CATH topology
3H1HH 3L74H 3CX5F 1KB9F 1L0LH 3CWBH 1BCCH 1SQPH 3TGUH 1BE3H 4D6TH 3BCCH 3L72H 4U3FH 2BCCH 1BGYH 1SQBH 1NTMH 4PD4F 3L73H 1SQQH 1PPJH 2IBZH 1SQVH 1P84F 1PP9H 2A06H 2FYUH 3CXHF 3H1JH 3H1LH 3L75H 1SQXH 3L70H 1EZVH 1NTKH 1NU1H 3H1KH 1L0NH 5KLVH 3H1IH 1NTZH 1KYOF 3L71H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1H H;  3L74 H;  3CX5 F;  1KB9 F;  1L0L H;  3CWB H;  1BCC H;  1SQP H;  3TGU H;  1BE3 H;  4D6T H;  3BCC H;  3L72 H;  4U3F H;  2BCC H;  1BGY H;  1SQB H;  1NTM H;  4PD4 F;  3L73 H;  1SQQ H;  1PPJ H;  2IBZ H;  1SQV H;  1P84 F;  1PP9 H;  2A06 H;  2FYU H;  3CXH F;  3H1J H;  3H1L H;  3L75 H;  1SQX H;  3L70 H;  1EZV H;  1NTK H;  1NU1 H;  3H1K H;  1L0N H;  5KLV H;  3H1I H;  1NTZ H;  1KYO F;  3L71 H; 
#chains in the Genus database with same CATH topology
 5IJ0 A;  3OM3 B;  2PI5 A;  1AI6 A;  4AQY O;  1N34 O;  1FJG B;  4MTG A;  4YY3 B;  3T2M A;  4AIL C;  4FFB B;  3ZHQ A;  1EN4 A;  1NH2 B;  1Q43 A;  3N2G B;  4DV3 O;  3KCX A;  4DV4 B;  2NR5 A;  3K5L A;  3B4S A;  2G38 A;  4CS2 A;  3GWO A;  1VQO V;  4DUZ O;  3B2E E;  4ABM A;  1A32 A;  1IBM B;  3OW2 U;  3CB2 A;  3JAT A;  2ZKO A;  4LCU C;  1ZLZ A;  3OE7 G;  2WAM A;  3E22 A;  3TJT A;  3E22 B;  2UUC O;  3BAB A;  4X64 B;  3CCV V;  1S76 D;  1QR9 A;  5EIB C;  3H1J H;  4X62 B;  1IX9 A;  3HPL C;  3RWR D;  5EBM C;  1VP7 A;  2ZE5 A;  4K8Z A;  5JCO C;  1SQF A;  3WB1 A;  1SS3 A;  1R1B A;  1NBM G;  4F6R B;  3DXR B;  1BE3 H;  3H01 A;  4LF7 O;  1XIL A;  2BTQ A;  4L8J A;  5IY5 C;  4NB5 A;  1P84 F;  4DR1 B;  2OTJ V;  3JAL A;  3G4S V;  4JYB A;  5IJ0 B;  4I55 A;  4X9Q A;  2DMX A;  4GX5 A;  1WPB A;  2UUA O;  3G80 A;  4YIP A;  4U7O A;  1IXB A;  1ZL8 B;  4B3R B;  3DGE A;  5LOV A;  1MZF A;  3HKB B;  3I55 V;  2LFS A;  5A9G A;  5LGN A;  2KB1 A;  2OIE A;  4DUY O;  4DO2 A;  1Y76 B;  4TQF A;  4GX0 A;  5E79 Z;  2XHB A;  4ZHQ B;  5EZY B;  1GH6 A;  3L73 H;  2RN9 A;  2DYS C;  2JIZ G;  1ARO P;  1UFI A;  3I5D A;  1VF7 A;  3D36 A;  5KLV H;  1M4U A;  5B1B C;  4RQE A;  3KKY A;  2E74 B;  3CP1 A;  4DV0 B;  4GKJ B;  4LH7 A;  4B3R O;  3ABM B;  5BMV A;  1XHZ A;  4JAS A;  2FB5 A;  3ZX6 A;  5EC1 C;  2EIL C;  3N2K A;  1HW7 A;  1XQ8 A;  1LUV A;  2E5L B;  4BW9 A;  2LO1 A;  4LFB O;  3EHB B;  2JJ1 G;  5JQG A;  4ZBM A;  5IT9 N;  3J7A U;  1YIT V;  2F1M A;  1Y76 A;  2Z3Y A;  2RQ6 A;  3KZI Z;  1RPO A;  3DSQ A;  4TV9 B;  3CE2 A;  2Q7G A;  5HFM A;  4R8C A;  5E1A C;  5DED A;  4XDJ A;  1S72 V;  4K3A A;  1BL8 A;  2UU9 B;  5B1A B;  2AXT Z;  2IJK A;  5JCO A;  3HR0 A;  4CH3 A;  5KA6 A;  4DR3 O;  1KP3 A;  1QLN A;  1VQ4 V;  1NTM H;  1AI4 A;  2ZXW B;  2ITC C;  3GVM A;  3OUS A;  1AJP A;  1AIL A;  4UCT A;  1M1K W;  2PY5 A;  2JDI G;  1K8A W;  1VF6 C;  3L71 H;  3ZIA G;  4NKG B;  2B5U A;  3OTF A;  2YXH A;  2YS8 A;  2WLM A;  1VIB A;  5LGT A;  4DR6 B;  4TOI A;  2ZR2 A;  4WBN B;  1GTO A;  1QLE B;  1Z5V A;  3GWK C;  4I55 B;  2QKA A;  2IBZ H;  2UXC B;  2XAF A;  3RBZ A;  4B3S B;  2DW4 A;  3L70 H;  3WG7 B;  3CC4 V;  2QTS A;  2LGW A;  4YJ2 B;  5H2F Z;  4JI2 B;  3ABK B;  5GTH Z;  2E3C A;  2CDY A;  2HR3 A;  4O4H A;  4G27 B;  4X64 O;  3FD9 A;  3LNM B;  1CPY A;  3JD1 A;  3LUT B;  3QVN A;  4B7E A;  4RUF A;  2N05 A;  4MW3 A;  2ADQ B;  5BY1 A;  4E2L A;  4DR2 B;  1KMI Z;  4IL6 Z;  3E8H A;  1I94 B;  2QM8 A;  3ABL B;  3CHX A;  5KX5 B;  3RYF B;  1JFF B;  4Q6G A;  1ENV A;  4WFB V;  1XMQ O;  3S3X A;  5ITZ A;  5ITZ B;  1K33 A;  1OCO B;  4J80 A;  2WLL B;  3JD2 A;  1Q3E A;  1WP8 A;  3FX7 A;  2ETN A;  2HVJ C;  3APO A;  4U3J B;  5JQG B;  2QDO A;  4NR1 A;  4LH6 A;  2ODM A;  1PM9 A;  3AK1 A;  3AG4 B;  1GAX A;  1YF2 A;  3HKC B;  1HNW O;  1EN5 A;  4X20 B;  3ZHR A;  4HAM A;  4R7C A;  2XAG A;  3J80 N;  2BSK B;  1DTO A;  4TWK A;  1P7G A;  4LFA B;  2UXD O;  2DYR C;  4O4J A;  4F4L A;  3UCS C;  1OCR C;  2R9A A;  1GK9 A;  2BOC C;  3AG7 A;  3ZJZ A;  5L3C A;  3T1C A;  1NR1 A;  3W7S A;  1H8H G;  2D3O W;  1OCZ B;  2YIC A;  2O57 A;  3NXS A;  1MAB G;  2EIL B;  1KYO F;  3G6E V;  1XNQ B;  2IH1 C;  3LDE A;  1JFF A;  5IJ9 B;  4UCO A;  5EYP B;  5K1X A;  1GN3 A;  2JGD B;  4LF6 B;  1W2B U;  2HHH O;  3ASN C;  4FFB A;  4KHP B;  3CC2 V;  1G4Y B;  1WPX A;  1YEW A;  1B3Q A;  2NN4 A;  2AZ2 A;  2Q68 A;  5H9C A;  4CH6 A;  4X62 O;  2P90 A;  4J9Z B;  2EX3 A;  2GV9 A;  3ZCC A;  3RYC B;  1K4C C;  2IU0 A;  2X7R B;  4I0X B;  5KAF Z;  3ASO C;  3AK3 A;  1MOF A;  2A79 B;  4TUY A;  1YHQ V;  1BQZ A;  1Z5W A;  4XDL A;  2RCV A;  1XBL A;  3P32 A;  3G67 A;  1FXV A;  4AHC A;  3LDC A;  2PZS A;  3P3N A;  1AB3 A;  3OD4 A;  1OJH A;  4GLX A;  4WCE V;  3OMI B;  4QIW F;  3SPJ A;  1N8R W;  2LGQ A;  1D5A A;  1EZJ A;  2UXX A;  3AG2 B;  3O9O A;  4DXW A;  1DK1 A;  3CD6 V;  4CH5 A;  3M99 B;  2P67 A;  3T1H B;  4YIO A;  2BOB C;  3FYE B;  1H2K A;  1SRY A;  1IZ3 A;  4DV1 B;  2HG5 C;  1WA8 A;  4YJ3 A;  3OUF A;  3CCQ V;  2ZDI C;  1EBO A;  4PEL A;  3SR2 C;  2DOS A;  4JI5 O;  2Q6A A;  3KCY A;  1T5E A;  4D7T A;  3IFX A;  3K9S A;  4LF4 B;  1BQ0 A;  4JI3 O;  2AHY A;  3PJS K;  4LF5 O;  4LFC O;  1LR1 A;  4DK1 A;  2LQT A;  4J9Y B;  3S3W A;  4FZ1 A;  2PYJ A;  4I7Z B;  3LDD A;  4X88 A;  3SPI A;  2OIG A;  3H9V A;  3LNN A;  4PA4 A;  4D6T H;  3CEI A;  3WB2 A;  1WN7 A;  2EIJ B;  1R3L C;  5CN0 A;  3AK2 A;  3ZMZ A;  4ICG A;  3N2K B;  2UXB B;  2GHY A;  1GMG A;  5LBQ A;  4JI8 O;  2LW7 A;  4RO2 A;  2WWW A;  3JCU Z;  4P9P A;  3K03 A;  1K92 A;  4YJ2 A;  3A0R A;  3CSX A;  4LF5 B;  2VQF O;  3F7Y C;  3BA8 A;  3AG3 C;  4WBN A;  3K59 A;  5CBH A;  2YI8 A;  2B1I A;  3K3W A;  1P49 A;  1VQ9 V;  2QEX V;  4BIO A;  4PJ0 Z;  1IXM A;  4DR7 O;  2EIM B;  2KKW A;  3ZRV A;  3APQ A;  2Q8V A;  3W7W A;  4ZHQ A;  4KXR A;  5FPR A;  5LA6 A;  1TUE B;  5LHI A;  2DQ3 A;  5L3D A;  3CXC U;  4DR7 B;  4UV8 A;  1GKF A;  3THO A;  4FIP C;  1NR7 A;  4O2A A;  1HDJ A;  2HVK C;  3T1H O;  1NJI W;  1HR0 O;  2LFR A;  3K5O A;  1JMK C;  2F93 B;  3TXQ A;  3OTO O;  3D8C A;  1Y66 A;  4KHP O;  3RYI B;  1PL4 A;  5BZB A;  2WA3 A;  1E1Q G;  3K79 A;  3L72 H;  5L3B A;  2DQ0 A;  5KHK A;  4I50 A;  2Y48 A;  5J2T B;  3BY6 A;  3ZN0 A;  5IE9 A;  1QNM A;  1B06 A;  1GM9 A;  2ZT9 B;  3JAS A;  3RYH A;  1SKV A;  2EJR A;  2X0L A;  4G28 B;  1ZAU A;  2P7T C;  3KG2 A;  2X6A A;  4LF9 O;  3UO3 A;  2CUG A;  5J2T A;  2JJ2 G;  1KBH A;  4NVP A;  2L35 A;  2LP7 A;  1I0H A;  3K0D A;  3WFV A;  5H6Q A;  4XBF A;  3JAK A;  3ML0 A;  4PDV A;  1QCE A;  2R9I A;  5J2U B;  1FPO A;  1O9H A;  5JH7 B;  4DR4 O;  1RPR A;  3K04 A;  4ZI7 A;  1QLE C;  4I9W A;  2W6I G;  4OPA A;  2H8P C;  4J11 A;  1WAZ A;  3VQV A;  1M90 W;  4DR4 B;  2VQF B;  5DM6 V;  3JAW B;  2PI4 A;  1L8D A;  1MG1 A;  3SYO A;  4NXM B;  2C2A A;  3JAM N;  1THZ A;  3RVY A;  4TSF G;  2YSU B;  3A0H Z;  4PA6 A;  3AG2 C;  3X2Q C;  1M57 C;  4FK5 C;  4NXM O;  1L0L H;  3QTC A;  3CWB H;  1H8E G;  1K5S A;  3T1Y B;  1H2G A;  4H0L B;  3FAV A;  4CC5 A;  3BPZ A;  1VQ7 V;  1NH2 D;  1Y67 A;  2P4V A;  2LW1 A;  5BR8 O;  3D36 C;  3SJC C;  3U0Z A;  4PI0 A;  3ZRX A;  3CJH A;  1TUB B;  1TGO A;  1U97 A;  1Z2G A;  3HKC A;  1US6 A;  3F7V C;  2ZCE A;  4B3M O;  4EKW A;  5KHG A;  4DR5 O;  5JJE B;  2BE3 A;  2QJ1 A;  4X65 B;  1BGY H;  2A06 H;  1H38 A;  2F66 C;  3CCL V;  1I08 A;  3E83 A;  2QGN A;  1NU1 H;  3R66 A;  4DV6 B;  3CME V;  3TCU A;  4H44 B;  4U7N A;  1OCC C;  4UUJ C;  1L0N H;  3CMA V;  3SGI A;  4O2B A;  1SET A;  5JWP A;  4GZR B;  2FML A;  4JI1 B;  4JI7 B;  3ZRW B;  3IAY A;  1N32 O;  1NZ6 A;  3QO8 A;  4WFA V;  1FFT B;  2RNB A;  2QKC A;  4CS3 A;  2Q7E A;  2H3O A;  2D2C B;  1WP7 A;  2GDS A;  3ZMU A;  1BSM A;  4DV1 O;  3ICX A;  1TA8 A;  5FLX N;  3L74 H;  4JTD B;  5L3E A;  1FFX A;  5JJJ B;  1XMO B;  4JV5 O;  1AP5 A;  1JJO A;  1KKD A;  3VQW A;  4Q20 A;  2DN9 A;  5B3S B;  2Q5Z A;  2VRZ A;  4GKK B;  2EUL A;  2ZIN A;  4E4E A;  1X4T A;  1S5H C;  3OEE G;  3L9D A;  4EB6 A;  1HWY A;  1K34 A;  4PHZ A;  1Q7Y W;  1PNL A;  2UUB O;  3EVK A;  2QM4 A;  3JSL A;  4GCZ A;  1N33 B;  2YI9 A;  4KUM A;  3FYI B;  4TUY B;  1I5Y A;  4HYO A;  2AZ0 A;  4H37 A;  4R50 A;  1VEW A;  5LHH A;  4JTA B;  1JQ0 A;  5F2V O;  1LNQ A;  2Y0P A;  2XND G;  2FKX A;  2VS0 A;  1Q86 W;  2QA4 V;  1TVK B;  5L3F A;  4IT5 A;  2ADP A;  2UXD B;  1OZ0 A;  2FL4 A;  3H1K H;  4Z2W A;  1FXK B;  1H2L A;  3U10 A;  4BR6 A;  5KHH A;  3GB7 C;  1VQL V;  1V54 C;  1XI1 A;  1JX9 A;  4P30 A;  2F4V B;  4LF8 B;  1YXB A;  4LWS A;  1N33 O;  1GRJ A;  5LA6 B;  4HNA A;  4PA7 A;  4HNA B;  4OGQ B;  4JF3 A;  1VF6 A;  2M7W A;  4JI8 B;  1XDC A;  1IBK O;  5CA1 A;  1BMF G;  4OPH A;  2H94 A;  2ZXW C;  4WFE A;  2ILM A;  4GT1 A;  4JGS A;  2EIN C;  1GN6 A;  2QWN B;  4O4J B;  4WFH A;  1X59 A;  4L87 A;  4UFZ A;  1YIJ V;  2ZIM A;  3JD0 A;  2FYU H;  2AGA A;  2OCC B;  1U96 A;  4I50 B;  4MW8 A;  1WJZ A;  4IHJ A;  1W0J G;  5BMV B;  4W4L A;  4FM1 A;  4BAY A;  2JGU A;  1KQS U;  3HKD B;  1M5I A;  2FTK A;  1BHA A;  3E86 A;  1SQQ H;  2HFE C;  2YID A;  4JI1 O;  1AP6 A;  2ZM6 O;  3UT5 B;  3B09 A;  3X2Q B;  2EIK B;  1JPX A;  1W0K G;  4N21 A;  2VQE B;  5HFL A;  1GM7 A;  5LL6 Y;  2V4D A;  1XEQ A;  5L3G A;  3ASO B;  4IYH A;  3ZHV A;  2YEV A;  4JI0 B;  4UXN A;  3HKB A;  4MVR A;  1Q8I A;  2XT9 A;  3CCU V;  5DN6 G;  1Q90 D;  3CRM A;  2PYL A;  3H1L H;  2YEV B;  2CH7 A;  1R6T A;  4MVU A;  3C90 A;  1KUQ A;  2ZD9 A;  1R3K C;  1SF9 A;  2E76 B;  3K08 A;  5JH7 A;  1SES A;  4C7U A;  1VQM V;  3P30 A;  4N23 A;  4JZG A;  1KB9 F;  3A2F A;  3AG1 C;  2F23 A;  4GKK O;  4O4L A;  5LXT A;  2EIM C;  2UUB B;  3HKD A;  1VF5 B;  3P3P A;  1FAF A;  4MVO A;  2YC0 A;  3ABK C;  4GX1 A;  2PF4 E;  1XL4 A;  3CCE V;  2YIA A;  3E89 A;  3VQY A;  4FFK A;  2WSS G;  1JR9 A;  2QSA A;  3ZN1 A;  1G1X B;  3IC7 A;  4UVB A;  5EZY A;  1PPJ H;  5KMG B;  1R73 A;  4HZ3 A;  3N2G A;  3B8M A;  5LMN B;  1F23 A;  3JCZ A;  2UUC B;  2DWD C;  4FM0 A;  2R9R B;  3RVZ A;  5JVD A;  4QE7 A;  1XHX A;  2K1E A;  2YXY A;  5TIS Z;  4JYA O;  3VOU A;  1R6N A;  3RFR A;  1Q6H A;  2Y69 B;  4JAU A;  2OT5 A;  2PTM A;  4PV1 B;  1GN4 A;  1PV0 A;  1QVF U;  3JAR A;  2EIJ C;  3F5W C;  4G2K A;  4UVC A;  1JCH A;  1KC8 W;  1E79 G;  2N74 A;  2L6L A;  5B1N A;  1VQP V;  1TAE A;  5LOV B;  1NKD A;  2WLH A;  4XDK A;  3E35 A;  2JVD A;  3WB0 A;  1UPG A;  3W7U A;  1N32 B;  3MDS A;  4MVM A;  2Q0A A;  1P7B A;  5DEC A;  2QWR B;  3W7X A;  1XOU A;  4I0X A;  2Y69 C;  1OCZ C;  4YJ3 B;  1HR0 B;  2DE0 X;  2NNU A;  2QR4 A;  4X8A A;  2OWO A;  4FPP A;  5LYJ A;  3B40 A;  2QE7 G;  4JZ2 A;  5LP6 B;  2P06 A;  5BXZ A;  4FM2 A;  5KA5 A;  2R72 A;  1NQT A;  5JJN B;  4LNU B;  4FLX A;  4DW0 A;  1HNZ O;  4O2A B;  4Z1M G;  3QO7 A;  2DYS B;  4DV7 O;  3PN1 A;  1AJN A;  1SC5 B;  4DK0 A;  2CTQ A;  1YCI A;  2ZE7 A;  4MT8 A;  5IJ9 A;  1UJW B;  1MSW D;  2VWK A;  1VQ5 V;  3R65 A;  4Z1V A;  2UU9 O;  1COW G;  2WLL A;  3CS5 A;  4RWU A;  4DV5 B;  3IGA C;  3SPH A;  3IC9 A;  2DWE C;  2W0F C;  2XUM A;  4FLV A;  1KKC A;  3OR6 C;  4JI5 B;  3K57 A;  1SA0 B;  2ZNI A;  3ZRW A;  3UM7 A;  4PA3 A;  5GON A;  1URF A;  1EZV H;  2DYR B;  3TXS A;  4IYI A;  5IYB O;  5FPO A;  1XMQ B;  1BHB A;  5C8Y A;  2PGG A;  1NT2 B;  2ZQM A;  3CRR A;  1AR5 A;  4JAA A;  4H33 A;  2F43 G;  4DUZ B;  3DTU B;  2V7Q G;  1VQ6 V;  1PKX A;  2LJ2 A;  1CP9 A;  4UVA A;  3CXH F;  4JI4 O;  4FZ0 A;  4I4T A;  2EIK C;  4BWA A;  2JS3 A;  3ZMV A;  3SJA C;  3OGC C;  1WB7 A;  4J7J A;  1SZT A;  3BVO A;  1Q6U A;  2WLK A;  1MZE A;  2P6J A;  4JI4 B;  3E8G A;  1RM1 C;  1VQK V;  4OX9 B;  3WU2 Z;  5CA0 A;  4PDL A;  5CA0 B;  5B5E Z;  1PP9 H;  4LF7 B;  2A0L A;  5IWA B;  2Y4U A;  4JYA B;  1SQG A;  3MHH C;  1FXH A;  4FLW A;  1S3J A;  3STZ C;  3BFR A;  4MTF A;  3QO5 A;  4DR2 O;  3BHP A;  1H2N A;  5LMN O;  3ZHS A;  3J81 N;  4EFB A;  2JGD A;  3G71 V;  1FXK A;  1IBK B;  3BAA A;  4NTY A;  3MAQ A;  1XUQ A;  2EZP A;  3ZRS A;  5C8Y B;  4QGP A;  3SDL A;  1Y4M A;  1BZK A;  3Q4H A;  1CEZ A;  2Q9L A;  4DV7 B;  3CRQ A;  4OXS A;  1F4N A;  1NI8 A;  2Z0A A;  2WLI A;  4RUE A;  3K5M A;  3M8A A;  3SYQ A;  2AW9 A;  1Q5O A;  2IW5 A;  3ETD A;  4IIJ A;  5GTI Z;  4JI6 O;  3E2E A;  3FB7 C;  3SJQ C;  4ZOL B;  4H13 B;  3G6B A;  1JJ2 U;  1DF4 A;  4DV2 B;  4PDM A;  3ABL C;  1CXZ B;  5EBL C;  3A0B Z;  2E75 B;  2QKS A;  4DR1 O;  2A9H A;  1Y74 B;  2RMK B;  3E8B A;  2UXC O;  1BCC H;  3TGU H;  3FB5 C;  4IHJ B;  4KFM A;  1OCC B;  1TVK A;  4W4K A;  3RN4 A;  1OCO C;  4LFA O;  4EEQ A;  3F5T A;  3RYI A;  3ZBH A;  2CTP A;  3QG5 A;  3U11 A;  5EYP A;  2CAZ C;  2JRI A;  1PNK A;  1D2D A;  2CTR A;  1K3E A;  1HNZ B;  4CH4 A;  5FNV A;  1ROP A;  1Q81 W;  4P9O A;  4QE9 A;  4LWS B;  3TK1 A;  4DR3 B;  3L75 H;  1J95 A;  1AVM A;  2HEP A;  4HBN A;  3BEH A;  3QNE A;  5KAI Z;  4O4L B;  3B77 A;  4UCS A;  1EN6 A;  4CS4 A;  3JAR B;  5CA3 A;  4X1K A;  5BR8 B;  3CPW U;  4ASU G;  4ZI7 B;  1Y6X A;  3FB8 C;  4R6Z A;  1JVM A;  1V54 B;  5B1A C;  1ORQ C;  2PUS A;  4DR5 B;  2QWP B;  3T4Z A;  4IGG A;  4TT3 G;  2ZR3 A;  1F4M A;  5CBF A;  3CX5 F;  4UB6 Z;  3T1Y O;  2A7W A;  1FS0 G;  3JD3 A;  5D5Q A;  4KL1 A;  4JI2 O;  4FMT A;  3FAV B;  1N0J A;  3JD4 A;  2ITD C;  3UT5 A;  2GBO A;  2V1D A;  4FLZ A;  2BTO A;  1EM1 A;  1IVS A;  1QVG U;  3SPC A;  2ARH A;  2XAJ A;  4DR6 O;  3OEH G;  4JYC A;  2F95 B;  4JYY A;  1SER A;  4JI6 B;  2IJJ A;  1NTZ H;  2HP8 A;  4UCV A;  2QWQ B;  4X20 A;  1ZL8 A;  2W0X A;  3AEI A;  3N27 A;  3BCC H;  1IBL O;  2ZIO A;  1RM1 B;  3LSU A;  2X6C A;  4QNH B;  2IH3 C;  1DLB A;  1SZX A;  4JI0 O;  1IBL B;  4NYK A;  2ZE8 A;  1JOY A;  2EIN B;  3K58 A;  4F6R A;  1WA8 B;  3CCM V;  4PA9 A;  2HKO A;  1N0N A;  3OGI B;  1SA0 A;  2EZO A;  4DW1 A;  4J42 A;  3JAW A;  1SQX H;  1JA8 A;  4WFF A;  5KMG A;  4WFG A;  1RP3 B;  1BS3 A;  1VQ8 V;  1QBZ A;  1NVP B;  1WB8 A;  2K9P A;  2UXN A;  5EBW C;  2XAH A;  1S0V A;  3ZED A;  5KUM A;  1SQB H;  3OR7 C;  4I4T B;  3O65 A;  4QPJ A;  1KD1 W;  4B7K A;  4K8X A;  3OMA B;  5LHG A;  1KU9 A;  3TET A;  1VAR A;  2NLJ C;  2WA4 A;  1PL0 A;  4K35 A;  4GKJ O;  1HNX O;  2HLD G;  4YHH B;  4EB6 B;  3VQX A;  4BIZ A;  3ABT A;  5CB4 A;  4NTW A;  1N4C A;  1FD9 A;  1FJG O;  2Q73 A;  1ZTE A;  3LSS A;  3MHS C;  5CBG A;  1VMG A;  5EC2 C;  4X65 O;  3AG1 B;  3OAA G;  1E1R G;  4LF4 O;  3ZHT A;  1MA1 A;  3ETG A;  4J41 A;  1YZB A;  4LF8 O;  2MW2 B;  2XOK G;  3WG7 C;  1W59 A;  2AHZ A;  4PD4 F;  5IY5 B;  1F7Y A;  3JAK B;  3BA9 A;  2HJD A;  1ZX3 A;  4LNU A;  4O4I A;  5K1P A;  1HP8 A;  3OFN G;  4LF6 O;  5EIB D;  1K73 W;  4B3S O;  2CGO A;  4X66 O;  5LYJ B;  1Q82 W;  2UXB O;  1M93 A;  2Z5U A;  3ZMS A;  3SYP A;  1FXK C;  2WLJ A;  1AI7 A;  3FFQ A;  2IJH A;  3RT3 C;  2UUA B;  1J5E B;  1SQV H;  1K4D C;  4B3M B;  4NTX A;  4GUN A;  1F51 A;  5KHI A;  2IM9 A;  2XTA A;  4MS2 A;  4J7Z A;  4F6E A;  1M9N A;  3OMN B;  4BIU A;  5CA1 B;  3SYA A;  2CGN A;  1ZWI C;  1IUR A;  3UO2 A;  1RFY A;  1BT8 A;  3JAL B;  3MD0 A;  4FLT A;  1B6Q A;  1AR1 B;  4KP4 A;  1YSC A;  3RYF A;  1XMO O;  4JI7 O;  3BRC A;  3UQ8 A;  2GTA A;  5AG2 A;  5IDJ A;  1WNS A;  2BCC H;  2B9Z A;  4MVS A;  2IU3 A;  2X6B A;  3CCR V;  1B04 A;  4YHH O;  1P4R A;  3CJH B;  4TV9 A;  4LF9 B;  3OTO B;  1O9G A;  5C93 A;  1ZSP A;  3DC6 A;  2Y4T A;  4YY3 O;  3B8N A;  4DV0 O;  1S5L Z;  3RGB A;  4FLU A;  3C3S A;  1N36 O;  2KSD A;  1YJ9 V;  4DV3 B;  4B3T O;  4DV4 O;  3ASN B;  1MSD A;  2E5L O;  1K7D A;  4ZIB A;  1LUW A;  1R3I C;  3JSN A;  4B3T B;  1G8M A;  1V55 C;  2QTO A;  2CK3 G;  5LXT B;  1TUB A;  2Q69 A;  3CCJ V;  2YXL A;  3DC5 A;  1XRE A;  1DGS A;  1M56 C;  3HKE B;  2Q7H A;  5GW7 A;  5IWA O;  3CC7 V;  4TV8 B;  2P5O A;  4DYL A;  1GO3 F;  2GUZ A;  1IBM O;  2CH7 B;  4DRX B;  3C3T A;  4IIJ B;  1V55 B;  2KQX A;  3D3I A;  2HHH B;  5J9P C;  4I5S A;  4FJC C;  2EBO A;  3STL C;  3SYC A;  4LC1 A;  3RYC A;  1VQN V;  2OCC C;  3SPG A;  4GX2 A;  2JEX A;  5CB4 B;  4J10 A;  4U3F H;  1NS1 A;  4YXW G;  5FNV B;  1FKA O;  1NVP D;  4MSW C;  4LP8 A;  3FKS G;  2QWO B;  4X89 A;  2QM7 A;  1OV9 A;  1S5J A;  4PI2 A;  2MK3 A;  4DUY B;  4K0K B;  1KEC A;  2BTQ B;  4ZKI A;  4JAV A;  1IDS A;  3T4D A;  2ZNJ A;  3DXR A;  1Q6I A;  1XNR O;  2ATK C;  4P2Z A;  4NXN B;  2WPD G;  2DJV A;  4CZZ A;  1V9P A;  4WF9 V;  1KP2 A;  1GN2 A;  4MTX A;  4LBE C;  3ZHU A;  5KUK A;  2VWJ A;  2Y0I A;  4X66 B;  1XL6 A;  1M56 B;  3A8T A;  1PNM A;  1I5X A;  4U3J A;  5D5P A;  4X1I B;  4X1I A;  4D7S A;  5A2Q N;  5B1O A;  1ZUQ A;  1YJW V;  4CBC A;  2ZDI A;  1L1F A;  1QR8 A;  3Q4H B;  2WLN A;  1H2M A;  4BW5 A;  3JYC A;  1MNG A;  5IYZ A;  4EFE A;  1FFX B;  4JI3 B;  4AQY B;  3K9A A;  4AI8 A;  1N34 B;  2VQE O;  3EXA A;  1OCR B;  3LSQ A;  3VBB A;  1QHT A;  3H1H H;  3ABU A;  4X1Y A;  2XAQ A;  4X1Y B;  1S77 D;  1RSO B;  3K5N A;  1I7F A;  5LP6 A;  1HNX B;  2GSM B;  2YUA A;  4TQD A;  3HB3 B;  2ZE6 A;  3NR7 A;  3AG3 B;  3CRC A;  4J7K A;  1YI2 V;  5B66 Z;  5IYD O;  4UCU A;  1DF5 A;  2IJI A;  1H2S B;  4MVQ A;  5LP6 C;  3QF7 A;  1PD3 A;  3HKE A;  5H5N A;  3SJB C;  3D3Q A;  5IYC O;  1EFR G;  5EK0 A;  1MMM A;  1WLE A;  2OTL V;  2W6J G;  4GYC B;  2A3Q A;  1YDX A;  5LMU B;  1D5N A;  4OX9 O;  1RSO A;  1K97 A;  3K0G A;  4A5U B;  2F4V O;  5KHJ A;  4K0K O;  1R3J C;  4UV9 A;  1OHH G;  3ZS8 C;  5B1B B;  4I9Q A;  4B08 A;  2HJF C;  1XNQ O;  4QJF B;  1XNR B;  1QU7 A;  5LMU O;  2OCH A;  4NXN O;  1G6U A;  4LR3 A;  4X1K B;  2Q67 A;  3I56 V;  4UB8 Z;  5GON B;  4ZOL A;  3AG4 C;  2KG7 A;  5CMU A;  3ABM C;  1NTK H;  4FVM A;  1AI5 A;  4MTO A;  1R6K A;  2WLI B;  4RQF A;  3H1I H;  2RJZ A;  4MVZ A;  2JS5 A;  3EFF K;  5LGU A;  4O2B B;  3ETQ A;  2YDE A;  4TV8 A;  4JTC B;  1AJQ A;  4PDR A;  2KG7 B;  1GM8 A;  4DRX A;  3UKM A;  3JAS B;  3RYH B;  2XAS A;  4FLY A;  4DV5 O;  3IJ4 A;  1J5E O;  1FYJ A;  2Q4P A;  2P4K A;  3ZMT A;  5FL7 G;  3FB6 C;  3ETE A;  1M57 B;  1YVW A;  5J2U A;  1YTF B;  3K06 A;  5JVD B;  2JEU A;  3E8F A;  4O4H B;  5IYZ B;  4DV6 O;  2YIB A;  4DV2 O;  4O4I B;  1K5Q A;  1Y74 A;  4LFB B;  1I94 O;  3RW0 A;  2M6Y A;  4JV5 B;  2N04 A;  2P22 C;  2EJ7 A;  1YJN V;  1K9M W;  2JK5 C;  1HNW B;  3JAT B;  5H6R A;  2BSK A;  4LFC B;  2RDC A;  2CE4 A;  3CYO A;  4JPR A;  2R70 A;  4CC6 A;  1SQP H;  1AR4 A;  5B3S C;  2GTS A;  2ZM6 B;  1N36 B;  4UCR A;  2Q0O C;  3OT7 A;  2GUZ B;  5KX5 A;  3CRA A;  1YTF D;  2YIB D;  4RAI A;  4QPK A;  2CTW A;  3CCS V;  2B1G A;  1QQC A;  2OYQ A;  3M7M X;  3W7T A; 
#chains in the Genus database with same CATH homology
 3H1H H;  3L74 H;  3CX5 F;  1KB9 F;  1L0L H;  3CWB H;  1BCC H;  1SQP H;  3TGU H;  1BE3 H;  4D6T H;  3BCC H;  3L72 H;  4U3F H;  2BCC H;  1BGY H;  1SQB H;  1NTM H;  4PD4 F;  3L73 H;  1SQQ H;  1PPJ H;  2IBZ H;  1SQV H;  1P84 F;  1PP9 H;  2A06 H;  2FYU H;  3CXH F;  3H1J H;  3H1L H;  3L75 H;  1SQX H;  3L70 H;  1EZV H;  1NTK H;  1NU1 H;  3H1K H;  1L0N H;  5KLV H;  3H1I H;  1NTZ H;  1KYO F;  3L71 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...