1NTZH

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
EEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 22
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1ntzH00
1BGYH 3CWBH 1KB9F 1KYOF 1NU1H 2FYUH 3L72H 3H1IH 3L74H 3H1HH 4U3FH 3CX5F 2IBZH 1L0LH 1SQQH 1SQPH 3L70H 1SQXH 2A06H 3L75H 4D6TH 1NTKH 3CXHF 3H1LH 3H1KH 1PP9H 1BCCH 2BCCH 3L71H 1EZVH 3BCCH 1SQVH 4PD4F 1NTZH 1NTMH 3TGUH 1P84F 1SQBH 1BE3H 3L73H 1L0NH 3H1JH 1PPJH 5KLVH
chains in the Genus database with same CATH superfamily
4BIUA 1K5SA 4RQFA 2AHYA 2Y69C 2ZE8A 3VQWA 4DUYB 4X9QA 5KAFZ 4JTAB 3RT3C 2JDIG 5BZBA 3ZCCA 5CMUA 1FKAO 2ZD9A 3JATA 4H33A 2IM9A 1J95A 3FX7A 1XHXA 2ZCEA 4X65B 1NVPB 1TAEA 3OMIB 4NXMO 4ZOLA 1Z2GA 3ZX6A 3ZJZA 4JYAO 1WA8A 3CS5A 1SQVH 1I5XA 3AG2B 1S77D 3M99B 5H5NA 2WLLB 2PI5A 1S72V 3SPGA 4O4IA 3G6BA 2YIBA 2MW2B 2HJFC 1VQ6V 4X89A 1E79G 4WFEA 1RSOA 3N2KB 4EEQA 4AI8A 1WB7A 2IJJA 4J11A 4H37A 3B4SA 2P4KA 1NBMG 2HG5C 1DLBA 5LBQA 3BAAA 3E8GA 4YJ3A 3UCSC 1H2SB 2W0XA 2QWPB 4LFAO 1SETA 4TSFG 1Y76A 2YICA 1V9PA 2ZDIA 4LF5B 1K9MW 4UUJC 5E79Z 5IYZB 2NR5A 5BXZA 1JCHA 1N4CA 5F2VO 4G28B 2HP8A 2LP7A 4DYLA 1P84F 1K4DC 5KHKA 2PF4E 3OD4A 2HEPA 4WBNB 2A9HA 5L3GA 3B40A 3A0BZ 3ZHQA 3W7UA 3J81N 3CCRV 1PD3A 4YIOA 3E8BA 1D2DA 1SQFA 2DE0X 2MK3A 3WB2A 1NR7A 1Q82W 2QA4V 2V7QG 1AR5A 1Q5OA 3CRCA 4DV6O 4B08A 1BE3H 3I55V 4JTDB 3G6EV 3JAKB 1JJ2U 4XDLA 4PDVA 3BVOA 4N21A 4FJCC 4LWSB 4TV9B 3CRMA 2DN9A 1WAZA 4RAIA 4ZBMA 1WPXA 1YJ9V 1NJIW 4B3SB 2BTQA 2CE4A 3QTCA 1R3IC 1R73A 1DK1A 1SC5B 4K0KO 4H44B 3PN1A 3MAQA 3G67A 4LF8B 4JYCA 2LO1A 4TUYB 4KUMA 2Y0PA 4O4JA 3P3NA 1EBOA 2HHHB 1U96A 5JVDA 4JI5O 1Q90D 4KP4A 4DR1B 3ZN0A 1HW7A 2WLIA 4I9WA 4CBCA 2NLJC 5GTIZ 4DV0B 1HP8A 1PNMA 1R6TA 2Y4UA 4D7TA 3D3QA 5JJJB 2CGOA 1Q7YW 2Q73A 3OUSA 4UVBA 1A32A 1N34O 1I5YA 3UKMA 4YIPA 2H3OA 3JSLA 3SYPA 3ZBHA 5FPRA 5KX5B 3JCUZ 1RM1C 1X4TA 1ORQC 4DUYO 3HR0A 1M57C 4B3TB 1GM8A 3UT5A 1ZWIC 3E86A 4DRXA 2D2CB 5DEDA 4PELA 1KD1W 5EZYA 2CTRA 1L8DA 1PNKA 2FMLA 4JYBA 1J5EB 1NZ6A 2P4VA 4X1IB 1BSMA 3G4SV 3A8TA 4X65O 1WLEA 1E1QG 2CAZC 4MVQA 3OGIB 5EC1C 3K0DA 2DYSC 3OM3B 1SA0A 4TQDA 4KXRA 1FFXA 4OPAA 3K5LA 4MT8A 4JGSA 1VF7A 3OMNB 2Q67A 4P2ZA 2E74B 5JCOC 1L0NH 2YI8A 5D5PA 1XL6A 3H1JH 2AW9A 1TVKA 2YEVB 1Z5VA 3MD0A 2R72A 2R9IA 1DTOA 3HKBA 3OAAG 4BR6A 5JH7A 1H8EG 4X64B 5A2QN 4DW0A 1OCOC 1ZL8A 2Y69B 3UM7A 2IJIA 2KG7B 2PUSA 3LNNA 3W7SA 1GN4A 2X6AA 1DF5A 1GO3F 2EIKC 2A7WA 2P06A 4LF4B 2Q8VA 4R6ZA 5IY5C 2K9PA 1JFFB 1EN5A 4QNHB 2V4DA 4FM2A 2QTOA 4FLTA 1VF6A 4LF5O 3TK1A 1XHZA 2K1EA 1N32B 5IJ9B 4NXNB 4HBNA 2F93B 4PJ0Z 4ZIBA 1QHTA 1VP7A 2EIJC 2F66C 4LF9B 4HNAA 3ABKC 3LDEA 4O4HB 3C3SA 3ZHVA 3EFFK 4NTXA 2FB5A 4YJ2B 2F95B 2WLLA 4MVUA 1H2MA 1NKDA 4RWUA 3A0HZ 3D36A 3ABLC 4DV1B 5KHHA 4CC5A 4GX1A 4TOIA 4H13B 3JATB 1Y4MA 1YHQV 2BTOA 2EULA 3E8HA 1WPBA 5IJ0A 3KKYA 4GKKO 1SQQH 3N2KA 4UCUA 3GVMA 4DV4B 1AILA 2LW7A 4B3SO 1FYJA 2OYQA 4NVPA 2YC0A 4I9QA 1PL4A 3K03A 4LF8O 5KLVH 2YIBD 2WA3A 4WF9V 1U97A 2LFRA 1G1XB 3T1HO 5IYZA 1IBLB 1BQZA 2IW5A 4DR1O 1OZ0A 4DV0O 2UU9B 1XQ8A 1SF9A 5C8YB 4UCSA 1MA1A 2W6JG 3CRQA 2XHBA 3ETGA 3JARB 1UJWB 3A0RA 2ZIOA 1XDCA 4B3TO 2E3CA 4MW3A 5KMGA 2UXXA 2PGGA 1Y76B 2CUGA 2KQXA 3CC4V 4LWSA 4TV9A 4TV8B 3K5MA 3HPLC 1PPJH 4MTOA 3K9AA 1J5EO 5KHGA 4JI2B 4PA7A 3TJTA 4IGGA 4MW8A 3Q4HB 2QDOA 4UXNA 2ILMA 4TUYA 5J2TB 1XL4A 1O9HA 2LW1A 1XUQA 1BHAA 2Q9LA 1GKFA 5LP6B 2RJZA 3ASNC 1M90W 3S3WA 1FPOA 1XILA 1NT2B 2ZE7A 1Q3EA 3CC2V 3RN4A 4DXWA 5IT9N 4X64O 1IZ3A 4LC1A 4E2LA 1GN3A 3LSSA 4O2AB 2X7RB 4EFBA 5KX5A 2X6BA 1FXVA 3FB5C 3FAVB 1HNZB 3SGIA 4LF4O 1Y74A 2DOSA 4CS3A 3OT7A 2YXLA 2WLNA 3C3TA 4PA3A 4LP8A 4UVAA 3OEHG 4MTGA 3FB6C 2FTKA 3T4DA 4X1IA 1VEWA 4QIWF 3ZEDA 3SYQA 1W2BU 5LGNA 1N32O 2HVJC 4NXNO 3VBBA 3E22B 3IC9A 2GHYA 2GUZA 1AI5A 4I7ZB 4LF9O 4YY3O 4I4TB 2WLMA 2VQFB 1P7GA 4QE9A 1KU9A 1HWYA 1NQTA 2DW4A 2RCVA 2XAGA 2Q7GA 3RGBA 1JJOA 5B1BB 3UT5B 2YEVA 2A79B 1WN7A 2M6YA 2WAMA 4UVCA 4DV1O 4FIPC 2KSDA 3BA8A 3OR7C 4PI0A 4B3MB 2AHZA 3ETDA 1QR9A 4R8CA 3QO8A 1AR4A 3L70H 2A3QA 1YVWA 2KG7A 3IFXA 1LNQA 1KP3A 5IY5B 1EZVH 4DV4O 4LBEC 4X1YB 1IBKB 4DV3B 4EKWA 5IE9A 3GWOA 4RQEA 4JI1B 1MZEA 3ABTA 3K9SA 1JFFA 4PI2A 1HNWB 4P9PA 2CTWA 1CPYA 1M5IA 2P67A 4I55B 4O2BA 1QNMA 1M56B 1THZA 1XNRB 4G2KA 2QJ1A 2YIAA 1IBLO 1G8MA 1JX9A 4JAVA 4JI7B 1W0JG 4GX0A 4X20B 2WA4A 1IURA 1KKCA 1AB3A 2UU9O 4O4HA 4I0XB 4NTYA 5KA5A 4J42A 1TUEB 5EIBD 1K92A 4UV8A 2LQTA 4YJ2A 1F51A 1S3JA 3RYCA 1M4UA 3CCVV 3FYIB 4NTWA 4WFGA 1NVPD 2RQ6A 4PDRA 1I94B 1M93A 3ICXA 2PI4A 2RNBA 2EX3A 2O57A 2R9AA 4JI2O 2PTMA 3EXAA 2HR3A 1GTOA 4WFFA 4FFKA 5FL7G 2BSKB 3CMAV 4HNAB 3D3IA 5EK0A 3THOA 3OTOB 1NH2B 3CJHB 4ICGA 1G4YB 3X2QB 4L87A 3ABUA 4R50A 4PD4F 4DK1A 3CCQV 1EN4A 3E35A 2WLHA 2A0LA 5TISZ 2ARHA 5LHIA 1DF4A 1K34A 2RDCA 1B3QA 1FFTB 3P30A 1S5HC 2EBOA 2QM8A 2H94A 1R3JC 3T2MA 4C7UA 2XUMA 1BHBA 1N0NA 5IJ0B 2JEXA 4I5SA 1SZTA 4WFAV 3O9OA 1XMOB 3JD4A 3KZIZ 5C8YA 3CXCU 4IHJB 1VQMV 3CP1A 5K1XA 5IWAB 2R70A 1ENVA 1KBHA 4UCRA 3JARA 4DK0A 3K5OA 4XBFA 1YSCA 1HNZO 1MNGA 4HYOA 1X59A 2P90A 3VQXA 1S76D 4QGPA 4JI8B 4DR5B 1Z5WA 4QJFB 4TV8A 3U0ZA 1FXKC 1F23A 1BMFG 2WLKA 2QWNB 4FMTA 5CA0B 3JCZA 1CEZA 4CZZA 4DV5B 4JI0B 2QM4A 2Y0IA 3Q4HA 3J80N 3LSQA 5J2TA 2VQFO 4DR7B 4J7KA 2G38A 1ZLZA 3ASNB 3CHXA 5KMGB 1K7DA 5LP6A 2Q5ZA 1Q8IA 5BY1A 2HJDA 1KKDA 4UV9A 3D8CA 5K1PA 2ZKOA 3ZHSA 3KCYA 5GONB 4B3MO 1XREA 3AK3A 2BCCH 1YTFB 1K4CC 3BA9A 4O2AA 5B1AC 2UXBB 2JK5C 2VWJA 3FAVA 5EBMC 1IBKO 4BAYA 5JJNB 4DV3O 2AZ2A 1VARA 3STLC 3AG7A 4JI1O 3G71V 1SS3A 2ZDIC 1HNWO 3K5NA 1K33A 1VQ9V 1N36O 2GTSA 1KUQA 4JPRA 2WWWA 5KUKA 1XNRO 3QVNA 1F4MA 3IC7A 2JGDA 1H8HG 4JI7O 3ZN1A 5BR8B 4TWKA 1BT8A 2ZNJA 3K08A 4DR2B 3E22A 5HFLA 1VQ7V 4RUEA 3ZMSA 4I4TA 1QU7A 2ZR2A 3H1IH 4UB8Z 2IJKA 1UFIA 4D6TH 1SZXA 3E89A 2B9ZA 3I5DA 1Y74B 2HLDG 2Q7HA 3RWRD 3ASOC 2ZNIA 3RFRA 2QKCA 1HR0B 1FJGB 3ZRWB 3AG4C 1I94O 5B5EZ 1CXZB 4JZGA 4FZ0A 2Q7EA 1GRJA 4NKGB 2EIMC 4AHCA 1KYOF 2JGUA 3K59A 3OR6C 2UXNA 2GUZB 2HKOA 4X1YA 3OTOO 2F23A 3TGUH 2W0FC 2GV9A 1VQNV 3ML0A 3C90A 2ZIMA 4I55A 2OCCC 4ABMA 4CH4A 4O4LB 2E75B 2EJRA 1RP3B 1AP6A 5EBLC 3AEIA 4QPJA 2YS8A 4X20A 2ITCC 1VMGA 5LA6B 2CTQA 1Q86W 4OX9B 4I0XA 5B1OA 1XMOO 3LUTB 3BHPA 3CCEV 5IWAO 5DECA 3HKEB 2RMKB 4DV7B 1MSWD 1OCZC 4X62B 4F6EA 5KA6A 3H9VA 3CCLV 4O2BB 4JI8O 4DR5O 3SPJA 3T1CA 3E2EA 1P7BA 3BEHA 1VQ4V 3K3WA 1K8AW 1TA8A 5H6RA 4LH7A 1OHHG 2BSKA 3ABMC 4JV5B 5EYPB 3FKSG 3CJHA 2Q69A 4U3FH 2IH1C 3B77A 3APOA 2GTAA 4OGQB 1YJWV 4DV5O 2ATKC 3H1LH 4JI0O 4J80A 3IGAC 4J41A 1ROPA 4DR7O 3RYCB 1GH6A 3E83A 3EVKA 4JTCB 5JWPA 4B7EA 3MDSA 2R9RB 1MG1A 2OTLV 2WSSG 1YF2A 2V1DA 2ZR3A 1L1FA 3R66A 1Q6IA 4IIJB 1VQ8V 1JQ0A 3SJBC 4IHJA 3OEEG 3ZMUA 2QGNA 5E1AC 5BMVB 2UXBO 2ZT9B 2H8PC 1EFRG 2GDSA 3DC6A 2GBOA 5EIBC 1JPXA 2L35A 4GUNA 2JVDA 3RYFB 2WLJA 2HHHO 1FXKB 5IDJA 4KHPB 1K97A 1LUWA 2XASA 3RVYA 1NTKH 1VIBA 2ADQB 3PJSK 4Q20A 3LDCA 3JD3A 5LHHA 2Z3YA 3SPIA 4F6RB 4J9ZB 2ZINA 5BR8O 5CA0A 4X1KB 4DR2O 4DV2B 1LUVA 1UPGA 2LGWA 4GX5A 3AG2C 3CCUV 3K06A 3K58A 2ZE5A 3D36C 1AJPA 1GK9A 3QNEA 5LL6Y 2XT9A 1Y6XA 2JIZG 1HR0O 1FJGO 1SQBH 2IH3C 3BRCA 1D5NA 3DTUB 5GONA 2QWRB 4OXSA 5L3EA 3F5TA 4CH3A 5KAIZ 2ZM6B 4YHHB 1FS0G 3CRAA 3VQVA 4BIZA 4IT5A 2Y4TA 1YCIA 4K8ZA 1VF5B 1XI1A 2EZOA 1K3EA 2Q4PA 2M7WA 3SYAA 3FD9A 3RYHA 4LNUB 1BZKA 1LR1A 2YUAA 4CS4A 4GLXA 4ZHQA 4DO2A 1H38A 4U3JB 1V55C 5IYCO 3G80A 4E4EA 1R6NA 1RM1B 1M57B 3WB0A 4OX9O 1V54C 4P30A 2XAJA 3AG4B 5KHIA 4MVRA 4RO2A 4DV7O 3AK2A 5CA1B 3ZRWA 2EIMB 3M8AA 4CS2A 4X62O 5LGTA 4UCTA 1JVMA 2BE3A 4J10A 5FNVB 4EB6B 4TT3G 2DYSB 1B6QA 2JGDB 1QQCA 4GT1A 5LMUB 2CH7B 1H2LA 5D5QA 4QPKA 3TCUA 4J7JA 2UUBB 1KMIZ 4JV5O 2QKSA 2VQEB 1VQPV 2OCCB 4UCVA 1DGSA 3QO7A 1YITV 3O65A 2Q0OC 2VWKA 4MTXA 4IYIA 1ZSPA 2EILC 3SDLA 4O4LA 4FLVA 4X8AA 2QTSA 5GW7A 1OCOB 1BL8A 3FB7C 4AQYB 1XNQB 1YJNV 2AXTZ 4RUFA 2BOBC 1AI6A 1FXHA 5LA6A 2EIKB 5LYJB 3ZRXA 2EINC 2B1GA 2YI9A 3L71H 3BCCH 1PV0A 1EM1A 5H9CA 3JD1A 1IDSA 1NR1A 1JA8A 3HKEA 2KKWA 2OTJV 3SYCA 3RYIB 4DW1A 3H01A 1MABG 3LSUA 4JI3B 2PYLA 1YZBA 1IBMB 2UUCB 4GYCB 1OCCC 4KHPO 3CXHF 1WP7A 4NYKA 2EIJB 3CD6V 1SESA 2W6IG 3ABMB 3ABKB 3U10A 3BABA 3SR2C 3IJ4A 1IX9A 3ZIAG 3OMAB 5JQGB 3OUFA 5EYPA 3S3XA 3DGEA 4DV2O 3ABLB 3FB8C 5CN0A 3MHHC 5CA3A 1PL0A 1BCCH 5CBGA 1GN2A 5GTHZ 3ZMVA 2DJVA 2XAFA 3ZRSA 2DQ3A 3OW2U 4FVMA 1SKVA 2VS0A 1S0VA 1F4NA 3HKDB 2HFEC 3CEIA 1NH2D 2CGNA 4IIJA 4PV1B 1AJNA 2ZM6O 1OCRC 4YHHO 3DXRA 1WP8A 1PM9A 5BMVA 3JAWB 1I08A 3SPHA 4MTFA 1GMGA 3FYEB 5L3DA 5ITZA 2E5LB 4A5UB 2LGQA 2Q68A 3RYFA 5B66Z 3T1YB 1FXKA 4FPPA 3CWBH 1R3LC 1QLEC 2OIGA 2IBZH 5B1NA 4F6RA 4LH6A 4EFEA 5H2FZ 2EZPA 3HB3B 4JAUA 4X1KA 1T5EA 2CK3G 3BPZA 2YIDA 4GX2A 2JJ2G 5DN6G 3E8FA 2Q6AA 1Q6HA 2P5OA 1YI2V 1VQLV 2UUAB 4N23A 3GWKC 1JR9A 1OJHA 1Y67A 3LDDA 1H2NA 2AGAA 3SJCC 4DUZB 3M7MX 3J7AU 1M1KW 3QG5A 1NTZH 1GN6A 4R7CA 5CBHA 3SJQC 3KG2A 2F1MA 3WG7C 1HNXB 5IYDO 1ZUQA 5LMUO 1NU1H 5LOVB 2JS3A 2UUBO 5FPOA 2HVKC 2VQEO 4PHZA 2FL4A 3HKCB 1K5QA 2DQ0A 3CCSV 4BW5A 4XDJA 4JI4B 4JYYA 2Z0AA 1R1BA 4DR4B 1V55B 3ETEA 4LNUA 3JALB 1N33B 1B04A 1KQSU 2ZXWC 3JD2A 2JEUA 1RFYA 4U3JA 2FYUH 1YTFD 4AQYO 4X66B 1XNQO 1V54B 2DWDC 2OT5A 3ZHUA 5DM6V 1ZTEA 1W59A 2JRIA 3AG1C 3GB7C 1AVMA 4H0LB 1GM7A 2QKAA 1WJZA 2CDYA 3P3PA 2Y48A 2YSUB 3N2GB 3DC5A 2P6JA 4FFBB 4GKKB 5CA1A 3SPCA 4LF7B 4LCUC 2UXDB 4JI3O 3ZMZA 4XDKA 4ZI7B 3RYHB 1IBMO 5LGUA 2UUCO 2E76B 1FAFA 1PP9H 5FNVA 2N74A 4EB6A 4ZHQB 5CBFA 2CH7A 1O9GA 4DR3B 1P4RA 3ZRVA 2YDEA 4I50B 2P22C 2QM7A 5IYBO 1IXMA 5LXTB 1KC8W 5J9PC 3T1HB 5JCOA 1YIJV 2EILB 4CH5A 1QLNA 2ETNA 3OTFA 1XMQB 2DYRC 4CH6A 5KHJA 2F4VB 4MSWC 5LP6C 4JAAA 2RN9A 2EINB 4K3AA 3LNMB 1P49A 4KL1A 3K57A 5LYJA 1QBZA 1ZX3A 1AJQA 5L3FA 1ZAUA 2KB1A 1KECA 3CE2A 3CC7V 2BOCC 1IVSA 1AP5A 3F7YC 1TUBB 1S5JA 3AG3C 2NN4A 4LR3A 4GKJB 4JZ2A 1OCCB 4FLYA 2B5UA 3RYIA 3QO5A 2E5LO 1NS1A 2YXYA 4PDLA 1VQ5V 1I0HA 3T1YO 1KB9F 4NB5A 2EJ7A 5AG2A 1MSDA 3U11A 1XOUA 5EC2C 1N0JA 3UO2A 5JQGA 3FFQA 3EHBB 4DR6B 5CB4B 2OCHA 2DMXA 4OPHA 2XAQA 3BFRA 1N8RW 4W4LA 4Q6GA 5B1BC 5J2UB 2UUAO 1YEWA 4L8JA 1VQOV 2PYJA 3H1KH 3JASB 4KFMA 3CRRA 4DUZO 3KCXA 1OCRB 4JI6B 3HKDA 5B3SC 1HNXO 4MVOA 4LF6B 3JYCA 2B1IA 1BQ0A 1RPRA 4JF3A 2QR4A 3JAWA 2WPDG 4B7KA 2IJHA 2ZE6A 4B3RB 1QLEB 4MVSA 3OE7G 3QF7A 4Z1VA 3L9DA 2ZQMA 2JS5A 1URFA 2F43G 1H2KA 3A2FA 2D3OW 3B8MA 1M56C 2L6LA 4JI4O 4X88A 4DR4O 1N33O 1XEQA 4BIOA 4YY3B 1XBLA 4YXWG 2ADPA 4X66O 1W0KG 3WU2Z 4CC6A 4ZKIA 5H6QA 4G27B 3CYOA 2Q0AA 2XOKG 1AI7A 3DXRB 5LMNB 3CCMV 4FLUA 1QCEA 1QVGU 4IL6Z 2LJ2A 5ITZB 3B09A 4HAMA 2C2AA 3NXSA 3WG7B 4U7OA 1L0LH 4LF7O 2P7TC 1VF6C 2VRZA 2UXDO 5JJEB 4ZOLB 2ODMA 3N27A 4LFCB 1NI8A 3RVZA 2JJ1G 4J9YB 1WA8B 5FLXN 4ASUG 1SERA 4DR3O 4PA6A 5LOVA 1AROP 3P32A 3X2QC 4FM1A 1GM9A 5C93A 4AILC 2UXCB 4O4IB 2ITDC 4JASA 3B8NA 3HKCA 2YXHA 3SYOA 4UFZA 1XMQO 2ZXWB 2PY5A 2CTPA 1MZFA 3K0GA 4PDMA 1RPOA 3CB2A 2F4VO 1K73W 3JALA 4WCEV 1RSOB 3UQ8A 4LFBB 4WBNA 4K35A 3RBZA 1CP9A 1GAXA 1BGYH 1SRYA 5B1AB 3AG1B 1AI4A 2OIEA 4J7ZA 3R65A 1F7YA 4YJ3B 1SQXH 2QSAA 3OFNG 3ZMTA 4FZ1A 1R6KA 4UCOA 3JAKA 3N2GA 2PZSA 1COWG 3BY6A 3APQA 3B2EE 1SQGA 4GKJO 1Q81W 4FFBA 4NXMB 2IU3A 3F7VC 4F4LA 1I7FA 3W7WA 4ZI7A 2NNUA 1JMKC 4D7SA 3CPWU 4GCZA 2DWEC 3TXQA 1SQPH 1YXBA 4JYAB 2LFSA 4BWAA 3DSQA 1HDJA 4I50A 4WFHA 2DYRB 5LXTA 2XNDG 4DR6O 3L73H 4W4KA 3ASOB 1Q43A 3CCJV 1TGOA 5EBWC 2X0LA 1WNSA 2IU0A 3L75H 4FM0A 4FLWA 1EZJA 1Y66A 5L3BA 1YDXA 2BTQB 1EN6A 2QWOB 4JI6O 5A9GA 4MVZA 3SJAC 2X6CA 5HFMA 3AG3B 4LFAB 3VOUA 3WFVA 3ETQA 4LF6O 4O4JB 3ZHRA 1Q6UA 1TUBA 1D5AA 4UB6Z 2A06H 5JVDB 3JAMN 3CMEV 4B3RO 3MHSC 1FD9A 5LHGA 4TQFA 3VQYA 2GSMB 2WLIB 4NR1A 3AK1A 3F5WC 4WFBV 4QE7A 1PNLA 3STZC 3TXSA 3CSXA 3L72H 3L74H 1KP2A 2AZ0A 1IXBA 1G6UA 3WB1A 1WB8A 2QE7G 2XAHA 1JOYA 3W7TA 1E1RG 5L3CA 3ZHTA 1PKXA 4DV6B 5CB4A 1OCZB 5LMNO 4DRXB 4HZ3A 5EZYB 5J2UA 4BW9A 2N05A 2OWOA 4Z2WA 1AR1B 3JASA 2Z5UA 5B3SB 1R3KC 5KUMA 3JSNA 4FK5C 4U7NA 2XTAA 2FKXA 1VQKV 4K0KB 3K79A 4Z1MG 3NR7A 3W7XA 3I56V 1SA0B 1H2GA 4K8XA 3T4ZA 4LFCO 3RW0A 2QEXV 4FLZA 1QR8A 1FFXB 1S5LZ 4MVMA 1NTMH 4IYHA 3OGCC 2QWQB 1N36B 3IAYA 4FLXA 4JI5B 1TVKB 2UXCO 3H1HH 3CX5F 4MS2A 2N04A 1MMMA 3HKBB 4PA9A 5IJ9A 5JH7B 3ZS8C 3K04A 1B06A 4GZRB 1QVFU 1ZL8B 4PA4A 1US6A 1BS3A 1M9NA 3JD0A 4LFBO 1N34B 1OV9A 4P9OA 3TETA 1MOFA 3UO3A
chains in the Genus database with same CATH topology
1BGYH 3CWBH 1KB9F 1KYOF 1NU1H 2FYUH 3L72H 3H1IH 3L74H 3H1HH 4U3FH 3CX5F 2IBZH 1L0LH 1SQQH 1SQPH 3L70H 1SQXH 2A06H 3L75H 4D6TH 1NTKH 3CXHF 3H1LH 3H1KH 1PP9H 1BCCH 2BCCH 3L71H 1EZVH 3BCCH 1SQVH 4PD4F 1NTZH 1NTMH 3TGUH 1P84F 1SQBH 1BE3H 3L73H 1L0NH 3H1JH 1PPJH 5KLVH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY H;  3CWB H;  1KB9 F;  1KYO F;  1NU1 H;  2FYU H;  3L72 H;  3H1I H;  3L74 H;  3H1H H;  4U3F H;  3CX5 F;  2IBZ H;  1L0L H;  1SQQ H;  1SQP H;  3L70 H;  1SQX H;  2A06 H;  3L75 H;  4D6T H;  1NTK H;  3CXH F;  3H1L H;  3H1K H;  1PP9 H;  1BCC H;  2BCC H;  3L71 H;  1EZV H;  3BCC H;  1SQV H;  4PD4 F;  1NTZ H;  1NTM H;  3TGU H;  1P84 F;  1SQB H;  1BE3 H;  3L73 H;  1L0N H;  3H1J H;  1PPJ H;  5KLV H; 
#chains in the Genus database with same CATH topology
 4BIU A;  1K5S A;  4RQF A;  2AHY A;  2Y69 C;  2ZE8 A;  3VQW A;  4DUY B;  4X9Q A;  5KAF Z;  4JTA B;  3RT3 C;  2JDI G;  5BZB A;  3ZCC A;  5CMU A;  1FKA O;  2ZD9 A;  3JAT A;  4H33 A;  2IM9 A;  1J95 A;  3FX7 A;  1XHX A;  2ZCE A;  4X65 B;  1NVP B;  1TAE A;  3OMI B;  4NXM O;  4ZOL A;  1Z2G A;  3ZX6 A;  3ZJZ A;  4JYA O;  1WA8 A;  3CS5 A;  1SQV H;  1I5X A;  3AG2 B;  1S77 D;  3M99 B;  5H5N A;  2WLL B;  2PI5 A;  1S72 V;  3SPG A;  4O4I A;  3G6B A;  2YIB A;  2MW2 B;  2HJF C;  1VQ6 V;  4X89 A;  1E79 G;  4WFE A;  1RSO A;  3N2K B;  4EEQ A;  4AI8 A;  1WB7 A;  2IJJ A;  4J11 A;  4H37 A;  3B4S A;  2P4K A;  1NBM G;  2HG5 C;  1DLB A;  5LBQ A;  3BAA A;  3E8G A;  4YJ3 A;  3UCS C;  1H2S B;  2W0X A;  2QWP B;  4LFA O;  1SET A;  4TSF G;  1Y76 A;  2YIC A;  1V9P A;  2ZDI A;  4LF5 B;  1K9M W;  4UUJ C;  5E79 Z;  5IYZ B;  2NR5 A;  5BXZ A;  1JCH A;  1N4C A;  5F2V O;  4G28 B;  2HP8 A;  2LP7 A;  4DYL A;  1P84 F;  1K4D C;  5KHK A;  2PF4 E;  3OD4 A;  2HEP A;  4WBN B;  2A9H A;  5L3G A;  3B40 A;  3A0B Z;  3ZHQ A;  3W7U A;  3J81 N;  3CCR V;  1PD3 A;  4YIO A;  3E8B A;  1D2D A;  1SQF A;  2DE0 X;  2MK3 A;  3WB2 A;  1NR7 A;  1Q82 W;  2QA4 V;  2V7Q G;  1AR5 A;  1Q5O A;  3CRC A;  4DV6 O;  4B08 A;  1BE3 H;  3I55 V;  4JTD B;  3G6E V;  3JAK B;  1JJ2 U;  4XDL A;  4PDV A;  3BVO A;  4N21 A;  4FJC C;  4LWS B;  4TV9 B;  3CRM A;  2DN9 A;  1WAZ A;  4RAI A;  4ZBM A;  1WPX A;  1YJ9 V;  1NJI W;  4B3S B;  2BTQ A;  2CE4 A;  3QTC A;  1R3I C;  1R73 A;  1DK1 A;  1SC5 B;  4K0K O;  4H44 B;  3PN1 A;  3MAQ A;  3G67 A;  4LF8 B;  4JYC A;  2LO1 A;  4TUY B;  4KUM A;  2Y0P A;  4O4J A;  3P3N A;  1EBO A;  2HHH B;  1U96 A;  5JVD A;  4JI5 O;  1Q90 D;  4KP4 A;  4DR1 B;  3ZN0 A;  1HW7 A;  2WLI A;  4I9W A;  4CBC A;  2NLJ C;  5GTI Z;  4DV0 B;  1HP8 A;  1PNM A;  1R6T A;  2Y4U A;  4D7T A;  3D3Q A;  5JJJ B;  2CGO A;  1Q7Y W;  2Q73 A;  3OUS A;  4UVB A;  1A32 A;  1N34 O;  1I5Y A;  3UKM A;  4YIP A;  2H3O A;  3JSL A;  3SYP A;  3ZBH A;  5FPR A;  5KX5 B;  3JCU Z;  1RM1 C;  1X4T A;  1ORQ C;  4DUY O;  3HR0 A;  1M57 C;  4B3T B;  1GM8 A;  3UT5 A;  1ZWI C;  3E86 A;  4DRX A;  2D2C B;  5DED A;  4PEL A;  1KD1 W;  5EZY A;  2CTR A;  1L8D A;  1PNK A;  2FML A;  4JYB A;  1J5E B;  1NZ6 A;  2P4V A;  4X1I B;  1BSM A;  3G4S V;  3A8T A;  4X65 O;  1WLE A;  1E1Q G;  2CAZ C;  4MVQ A;  3OGI B;  5EC1 C;  3K0D A;  2DYS C;  3OM3 B;  1SA0 A;  4TQD A;  4KXR A;  1FFX A;  4OPA A;  3K5L A;  4MT8 A;  4JGS A;  1VF7 A;  3OMN B;  2Q67 A;  4P2Z A;  2E74 B;  5JCO C;  1L0N H;  2YI8 A;  5D5P A;  1XL6 A;  3H1J H;  2AW9 A;  1TVK A;  2YEV B;  1Z5V A;  3MD0 A;  2R72 A;  2R9I A;  1DTO A;  3HKB A;  3OAA G;  4BR6 A;  5JH7 A;  1H8E G;  4X64 B;  5A2Q N;  4DW0 A;  1OCO C;  1ZL8 A;  2Y69 B;  3UM7 A;  2IJI A;  2KG7 B;  2PUS A;  3LNN A;  3W7S A;  1GN4 A;  2X6A A;  1DF5 A;  1GO3 F;  2EIK C;  2A7W A;  2P06 A;  4LF4 B;  2Q8V A;  4R6Z A;  5IY5 C;  2K9P A;  1JFF B;  1EN5 A;  4QNH B;  2V4D A;  4FM2 A;  2QTO A;  4FLT A;  1VF6 A;  4LF5 O;  3TK1 A;  1XHZ A;  2K1E A;  1N32 B;  5IJ9 B;  4NXN B;  4HBN A;  2F93 B;  4PJ0 Z;  4ZIB A;  1QHT A;  1VP7 A;  2EIJ C;  2F66 C;  4LF9 B;  4HNA A;  3ABK C;  3LDE A;  4O4H B;  3C3S A;  3ZHV A;  3EFF K;  4NTX A;  2FB5 A;  4YJ2 B;  2F95 B;  2WLL A;  4MVU A;  1H2M A;  1NKD A;  4RWU A;  3A0H Z;  3D36 A;  3ABL C;  4DV1 B;  5KHH A;  4CC5 A;  4GX1 A;  4TOI A;  4H13 B;  3JAT B;  1Y4M A;  1YHQ V;  2BTO A;  2EUL A;  3E8H A;  1WPB A;  5IJ0 A;  3KKY A;  4GKK O;  1SQQ H;  3N2K A;  4UCU A;  3GVM A;  4DV4 B;  1AIL A;  2LW7 A;  4B3S O;  1FYJ A;  2OYQ A;  4NVP A;  2YC0 A;  4I9Q A;  1PL4 A;  3K03 A;  4LF8 O;  5KLV H;  2YIB D;  2WA3 A;  4WF9 V;  1U97 A;  2LFR A;  1G1X B;  3T1H O;  5IYZ A;  1IBL B;  1BQZ A;  2IW5 A;  4DR1 O;  1OZ0 A;  4DV0 O;  2UU9 B;  1XQ8 A;  1SF9 A;  5C8Y B;  4UCS A;  1MA1 A;  2W6J G;  3CRQ A;  2XHB A;  3ETG A;  3JAR B;  1UJW B;  3A0R A;  2ZIO A;  1XDC A;  4B3T O;  2E3C A;  4MW3 A;  5KMG A;  2UXX A;  2PGG A;  1Y76 B;  2CUG A;  2KQX A;  3CC4 V;  4LWS A;  4TV9 A;  4TV8 B;  3K5M A;  3HPL C;  1PPJ H;  4MTO A;  3K9A A;  1J5E O;  5KHG A;  4JI2 B;  4PA7 A;  3TJT A;  4IGG A;  4MW8 A;  3Q4H B;  2QDO A;  4UXN A;  2ILM A;  4TUY A;  5J2T B;  1XL4 A;  1O9H A;  2LW1 A;  1XUQ A;  1BHA A;  2Q9L A;  1GKF A;  5LP6 B;  2RJZ A;  3ASN C;  1M90 W;  3S3W A;  1FPO A;  1XIL A;  1NT2 B;  2ZE7 A;  1Q3E A;  3CC2 V;  3RN4 A;  4DXW A;  5IT9 N;  4X64 O;  1IZ3 A;  4LC1 A;  4E2L A;  1GN3 A;  3LSS A;  4O2A B;  2X7R B;  4EFB A;  5KX5 A;  2X6B A;  1FXV A;  3FB5 C;  3FAV B;  1HNZ B;  3SGI A;  4LF4 O;  1Y74 A;  2DOS A;  4CS3 A;  3OT7 A;  2YXL A;  2WLN A;  3C3T A;  4PA3 A;  4LP8 A;  4UVA A;  3OEH G;  4MTG A;  3FB6 C;  2FTK A;  3T4D A;  4X1I A;  1VEW A;  4QIW F;  3ZED A;  3SYQ A;  1W2B U;  5LGN A;  1N32 O;  2HVJ C;  4NXN O;  3VBB A;  3E22 B;  3IC9 A;  2GHY A;  2GUZ A;  1AI5 A;  4I7Z B;  4LF9 O;  4YY3 O;  4I4T B;  2WLM A;  2VQF B;  1P7G A;  4QE9 A;  1KU9 A;  1HWY A;  1NQT A;  2DW4 A;  2RCV A;  2XAG A;  2Q7G A;  3RGB A;  1JJO A;  5B1B B;  3UT5 B;  2YEV A;  2A79 B;  1WN7 A;  2M6Y A;  2WAM A;  4UVC A;  4DV1 O;  4FIP C;  2KSD A;  3BA8 A;  3OR7 C;  4PI0 A;  4B3M B;  2AHZ A;  3ETD A;  1QR9 A;  4R8C A;  3QO8 A;  1AR4 A;  3L70 H;  2A3Q A;  1YVW A;  2KG7 A;  3IFX A;  1LNQ A;  1KP3 A;  5IY5 B;  1EZV H;  4DV4 O;  4LBE C;  4X1Y B;  1IBK B;  4DV3 B;  4EKW A;  5IE9 A;  3GWO A;  4RQE A;  4JI1 B;  1MZE A;  3ABT A;  3K9S A;  1JFF A;  4PI2 A;  1HNW B;  4P9P A;  2CTW A;  1CPY A;  1M5I A;  2P67 A;  4I55 B;  4O2B A;  1QNM A;  1M56 B;  1THZ A;  1XNR B;  4G2K A;  2QJ1 A;  2YIA A;  1IBL O;  1G8M A;  1JX9 A;  4JAV A;  4JI7 B;  1W0J G;  4GX0 A;  4X20 B;  2WA4 A;  1IUR A;  1KKC A;  1AB3 A;  2UU9 O;  4O4H A;  4I0X B;  4NTY A;  5KA5 A;  4J42 A;  1TUE B;  5EIB D;  1K92 A;  4UV8 A;  2LQT A;  4YJ2 A;  1F51 A;  1S3J A;  3RYC A;  1M4U A;  3CCV V;  3FYI B;  4NTW A;  4WFG A;  1NVP D;  2RQ6 A;  4PDR A;  1I94 B;  1M93 A;  3ICX A;  2PI4 A;  2RNB A;  2EX3 A;  2O57 A;  2R9A A;  4JI2 O;  2PTM A;  3EXA A;  2HR3 A;  1GTO A;  4WFF A;  4FFK A;  5FL7 G;  2BSK B;  3CMA V;  4HNA B;  3D3I A;  5EK0 A;  3THO A;  3OTO B;  1NH2 B;  3CJH B;  4ICG A;  1G4Y B;  3X2Q B;  4L87 A;  3ABU A;  4R50 A;  4PD4 F;  4DK1 A;  3CCQ V;  1EN4 A;  3E35 A;  2WLH A;  2A0L A;  5TIS Z;  2ARH A;  5LHI A;  1DF4 A;  1K34 A;  2RDC A;  1B3Q A;  1FFT B;  3P30 A;  1S5H C;  2EBO A;  2QM8 A;  2H94 A;  1R3J C;  3T2M A;  4C7U A;  2XUM A;  1BHB A;  1N0N A;  5IJ0 B;  2JEX A;  4I5S A;  1SZT A;  4WFA V;  3O9O A;  1XMO B;  3JD4 A;  3KZI Z;  5C8Y A;  3CXC U;  4IHJ B;  1VQM V;  3CP1 A;  5K1X A;  5IWA B;  2R70 A;  1ENV A;  1KBH A;  4UCR A;  3JAR A;  4DK0 A;  3K5O A;  4XBF A;  1YSC A;  1HNZ O;  1MNG A;  4HYO A;  1X59 A;  2P90 A;  3VQX A;  1S76 D;  4QGP A;  4JI8 B;  4DR5 B;  1Z5W A;  4QJF B;  4TV8 A;  3U0Z A;  1FXK C;  1F23 A;  1BMF G;  2WLK A;  2QWN B;  4FMT A;  5CA0 B;  3JCZ A;  1CEZ A;  4CZZ A;  4DV5 B;  4JI0 B;  2QM4 A;  2Y0I A;  3Q4H A;  3J80 N;  3LSQ A;  5J2T A;  2VQF O;  4DR7 B;  4J7K A;  2G38 A;  1ZLZ A;  3ASN B;  3CHX A;  5KMG B;  1K7D A;  5LP6 A;  2Q5Z A;  1Q8I A;  5BY1 A;  2HJD A;  1KKD A;  4UV9 A;  3D8C A;  5K1P A;  2ZKO A;  3ZHS A;  3KCY A;  5GON B;  4B3M O;  1XRE A;  3AK3 A;  2BCC H;  1YTF B;  1K4C C;  3BA9 A;  4O2A A;  5B1A C;  2UXB B;  2JK5 C;  2VWJ A;  3FAV A;  5EBM C;  1IBK O;  4BAY A;  5JJN B;  4DV3 O;  2AZ2 A;  1VAR A;  3STL C;  3AG7 A;  4JI1 O;  3G71 V;  1SS3 A;  2ZDI C;  1HNW O;  3K5N A;  1K33 A;  1VQ9 V;  1N36 O;  2GTS A;  1KUQ A;  4JPR A;  2WWW A;  5KUK A;  1XNR O;  3QVN A;  1F4M A;  3IC7 A;  2JGD A;  1H8H G;  4JI7 O;  3ZN1 A;  5BR8 B;  4TWK A;  1BT8 A;  2ZNJ A;  3K08 A;  4DR2 B;  3E22 A;  5HFL A;  1VQ7 V;  4RUE A;  3ZMS A;  4I4T A;  1QU7 A;  2ZR2 A;  3H1I H;  4UB8 Z;  2IJK A;  1UFI A;  4D6T H;  1SZX A;  3E89 A;  2B9Z A;  3I5D A;  1Y74 B;  2HLD G;  2Q7H A;  3RWR D;  3ASO C;  2ZNI A;  3RFR A;  2QKC A;  1HR0 B;  1FJG B;  3ZRW B;  3AG4 C;  1I94 O;  5B5E Z;  1CXZ B;  4JZG A;  4FZ0 A;  2Q7E A;  1GRJ A;  4NKG B;  2EIM C;  4AHC A;  1KYO F;  2JGU A;  3K59 A;  3OR6 C;  2UXN A;  2GUZ B;  2HKO A;  4X1Y A;  3OTO O;  2F23 A;  3TGU H;  2W0F C;  2GV9 A;  1VQN V;  3ML0 A;  3C90 A;  2ZIM A;  4I55 A;  2OCC C;  4ABM A;  4CH4 A;  4O4L B;  2E75 B;  2EJR A;  1RP3 B;  1AP6 A;  5EBL C;  3AEI A;  4QPJ A;  2YS8 A;  4X20 A;  2ITC C;  1VMG A;  5LA6 B;  2CTQ A;  1Q86 W;  4OX9 B;  4I0X A;  5B1O A;  1XMO O;  3LUT B;  3BHP A;  3CCE V;  5IWA O;  5DEC A;  3HKE B;  2RMK B;  4DV7 B;  1MSW D;  1OCZ C;  4X62 B;  4F6E A;  5KA6 A;  3H9V A;  3CCL V;  4O2B B;  4JI8 O;  4DR5 O;  3SPJ A;  3T1C A;  3E2E A;  1P7B A;  3BEH A;  1VQ4 V;  3K3W A;  1K8A W;  1TA8 A;  5H6R A;  4LH7 A;  1OHH G;  2BSK A;  3ABM C;  4JV5 B;  5EYP B;  3FKS G;  3CJH A;  2Q69 A;  4U3F H;  2IH1 C;  3B77 A;  3APO A;  2GTA A;  4OGQ B;  1YJW V;  4DV5 O;  2ATK C;  3H1L H;  4JI0 O;  4J80 A;  3IGA C;  4J41 A;  1ROP A;  4DR7 O;  3RYC B;  1GH6 A;  3E83 A;  3EVK A;  4JTC B;  5JWP A;  4B7E A;  3MDS A;  2R9R B;  1MG1 A;  2OTL V;  2WSS G;  1YF2 A;  2V1D A;  2ZR3 A;  1L1F A;  3R66 A;  1Q6I A;  4IIJ B;  1VQ8 V;  1JQ0 A;  3SJB C;  4IHJ A;  3OEE G;  3ZMU A;  2QGN A;  5E1A C;  5BMV B;  2UXB O;  2ZT9 B;  2H8P C;  1EFR G;  2GDS A;  3DC6 A;  2GBO A;  5EIB C;  1JPX A;  2L35 A;  4GUN A;  2JVD A;  3RYF B;  2WLJ A;  2HHH O;  1FXK B;  5IDJ A;  4KHP B;  1K97 A;  1LUW A;  2XAS A;  3RVY A;  1NTK H;  1VIB A;  2ADQ B;  3PJS K;  4Q20 A;  3LDC A;  3JD3 A;  5LHH A;  2Z3Y A;  3SPI A;  4F6R B;  4J9Z B;  2ZIN A;  5BR8 O;  5CA0 A;  4X1K B;  4DR2 O;  4DV2 B;  1LUV A;  1UPG A;  2LGW A;  4GX5 A;  3AG2 C;  3CCU V;  3K06 A;  3K58 A;  2ZE5 A;  3D36 C;  1AJP A;  1GK9 A;  3QNE A;  5LL6 Y;  2XT9 A;  1Y6X A;  2JIZ G;  1HR0 O;  1FJG O;  1SQB H;  2IH3 C;  3BRC A;  1D5N A;  3DTU B;  5GON A;  2QWR B;  4OXS A;  5L3E A;  3F5T A;  4CH3 A;  5KAI Z;  2ZM6 B;  4YHH B;  1FS0 G;  3CRA A;  3VQV A;  4BIZ A;  4IT5 A;  2Y4T A;  1YCI A;  4K8Z A;  1VF5 B;  1XI1 A;  2EZO A;  1K3E A;  2Q4P A;  2M7W A;  3SYA A;  3FD9 A;  3RYH A;  4LNU B;  1BZK A;  1LR1 A;  2YUA A;  4CS4 A;  4GLX A;  4ZHQ A;  4DO2 A;  1H38 A;  4U3J B;  1V55 C;  5IYC O;  3G80 A;  4E4E A;  1R6N A;  1RM1 B;  1M57 B;  3WB0 A;  4OX9 O;  1V54 C;  4P30 A;  2XAJ A;  3AG4 B;  5KHI A;  4MVR A;  4RO2 A;  4DV7 O;  3AK2 A;  5CA1 B;  3ZRW A;  2EIM B;  3M8A A;  4CS2 A;  4X62 O;  5LGT A;  4UCT A;  1JVM A;  2BE3 A;  4J10 A;  5FNV B;  4EB6 B;  4TT3 G;  2DYS B;  1B6Q A;  2JGD B;  1QQC A;  4GT1 A;  5LMU B;  2CH7 B;  1H2L A;  5D5Q A;  4QPK A;  3TCU A;  4J7J A;  2UUB B;  1KMI Z;  4JV5 O;  2QKS A;  2VQE B;  1VQP V;  2OCC B;  4UCV A;  1DGS A;  3QO7 A;  1YIT V;  3O65 A;  2Q0O C;  2VWK A;  4MTX A;  4IYI A;  1ZSP A;  2EIL C;  3SDL A;  4O4L A;  4FLV A;  4X8A A;  2QTS A;  5GW7 A;  1OCO B;  1BL8 A;  3FB7 C;  4AQY B;  1XNQ B;  1YJN V;  2AXT Z;  4RUF A;  2BOB C;  1AI6 A;  1FXH A;  5LA6 A;  2EIK B;  5LYJ B;  3ZRX A;  2EIN C;  2B1G A;  2YI9 A;  3L71 H;  3BCC H;  1PV0 A;  1EM1 A;  5H9C A;  3JD1 A;  1IDS A;  1NR1 A;  1JA8 A;  3HKE A;  2KKW A;  2OTJ V;  3SYC A;  3RYI B;  4DW1 A;  3H01 A;  1MAB G;  3LSU A;  4JI3 B;  2PYL A;  1YZB A;  1IBM B;  2UUC B;  4GYC B;  1OCC C;  4KHP O;  3CXH F;  1WP7 A;  4NYK A;  2EIJ B;  3CD6 V;  1SES A;  2W6I G;  3ABM B;  3ABK B;  3U10 A;  3BAB A;  3SR2 C;  3IJ4 A;  1IX9 A;  3ZIA G;  3OMA B;  5JQG B;  3OUF A;  5EYP A;  3S3X A;  3DGE A;  4DV2 O;  3ABL B;  3FB8 C;  5CN0 A;  3MHH C;  5CA3 A;  1PL0 A;  1BCC H;  5CBG A;  1GN2 A;  5GTH Z;  3ZMV A;  2DJV A;  2XAF A;  3ZRS A;  2DQ3 A;  3OW2 U;  4FVM A;  1SKV A;  2VS0 A;  1S0V A;  1F4N A;  3HKD B;  2HFE C;  3CEI A;  1NH2 D;  2CGN A;  4IIJ A;  4PV1 B;  1AJN A;  2ZM6 O;  1OCR C;  4YHH O;  3DXR A;  1WP8 A;  1PM9 A;  5BMV A;  3JAW B;  1I08 A;  3SPH A;  4MTF A;  1GMG A;  3FYE B;  5L3D A;  5ITZ A;  2E5L B;  4A5U B;  2LGQ A;  2Q68 A;  3RYF A;  5B66 Z;  3T1Y B;  1FXK A;  4FPP A;  3CWB H;  1R3L C;  1QLE C;  2OIG A;  2IBZ H;  5B1N A;  4F6R A;  4LH6 A;  4EFE A;  5H2F Z;  2EZP A;  3HB3 B;  4JAU A;  4X1K A;  1T5E A;  2CK3 G;  3BPZ A;  2YID A;  4GX2 A;  2JJ2 G;  5DN6 G;  3E8F A;  2Q6A A;  1Q6H A;  2P5O A;  1YI2 V;  1VQL V;  2UUA B;  4N23 A;  3GWK C;  1JR9 A;  1OJH A;  1Y67 A;  3LDD A;  1H2N A;  2AGA A;  3SJC C;  4DUZ B;  3M7M X;  3J7A U;  1M1K W;  3QG5 A;  1NTZ H;  1GN6 A;  4R7C A;  5CBH A;  3SJQ C;  3KG2 A;  2F1M A;  3WG7 C;  1HNX B;  5IYD O;  1ZUQ A;  5LMU O;  1NU1 H;  5LOV B;  2JS3 A;  2UUB O;  5FPO A;  2HVK C;  2VQE O;  4PHZ A;  2FL4 A;  3HKC B;  1K5Q A;  2DQ0 A;  3CCS V;  4BW5 A;  4XDJ A;  4JI4 B;  4JYY A;  2Z0A A;  1R1B A;  4DR4 B;  1V55 B;  3ETE A;  4LNU A;  3JAL B;  1N33 B;  1B04 A;  1KQS U;  2ZXW C;  3JD2 A;  2JEU A;  1RFY A;  4U3J A;  2FYU H;  1YTF D;  4AQY O;  4X66 B;  1XNQ O;  1V54 B;  2DWD C;  2OT5 A;  3ZHU A;  5DM6 V;  1ZTE A;  1W59 A;  2JRI A;  3AG1 C;  3GB7 C;  1AVM A;  4H0L B;  1GM7 A;  2QKA A;  1WJZ A;  2CDY A;  3P3P A;  2Y48 A;  2YSU B;  3N2G B;  3DC5 A;  2P6J A;  4FFB B;  4GKK B;  5CA1 A;  3SPC A;  4LF7 B;  4LCU C;  2UXD B;  4JI3 O;  3ZMZ A;  4XDK A;  4ZI7 B;  3RYH B;  1IBM O;  5LGU A;  2UUC O;  2E76 B;  1FAF A;  1PP9 H;  5FNV A;  2N74 A;  4EB6 A;  4ZHQ B;  5CBF A;  2CH7 A;  1O9G A;  4DR3 B;  1P4R A;  3ZRV A;  2YDE A;  4I50 B;  2P22 C;  2QM7 A;  5IYB O;  1IXM A;  5LXT B;  1KC8 W;  5J9P C;  3T1H B;  5JCO A;  1YIJ V;  2EIL B;  4CH5 A;  1QLN A;  2ETN A;  3OTF A;  1XMQ B;  2DYR C;  4CH6 A;  5KHJ A;  2F4V B;  4MSW C;  5LP6 C;  4JAA A;  2RN9 A;  2EIN B;  4K3A A;  3LNM B;  1P49 A;  4KL1 A;  3K57 A;  5LYJ A;  1QBZ A;  1ZX3 A;  1AJQ A;  5L3F A;  1ZAU A;  2KB1 A;  1KEC A;  3CE2 A;  3CC7 V;  2BOC C;  1IVS A;  1AP5 A;  3F7Y C;  1TUB B;  1S5J A;  3AG3 C;  2NN4 A;  4LR3 A;  4GKJ B;  4JZ2 A;  1OCC B;  4FLY A;  2B5U A;  3RYI A;  3QO5 A;  2E5L O;  1NS1 A;  2YXY A;  4PDL A;  1VQ5 V;  1I0H A;  3T1Y O;  1KB9 F;  4NB5 A;  2EJ7 A;  5AG2 A;  1MSD A;  3U11 A;  1XOU A;  5EC2 C;  1N0J A;  3UO2 A;  5JQG A;  3FFQ A;  3EHB B;  4DR6 B;  5CB4 B;  2OCH A;  2DMX A;  4OPH A;  2XAQ A;  3BFR A;  1N8R W;  4W4L A;  4Q6G A;  5B1B C;  5J2U B;  2UUA O;  1YEW A;  4L8J A;  1VQO V;  2PYJ A;  3H1K H;  3JAS B;  4KFM A;  3CRR A;  4DUZ O;  3KCX A;  1OCR B;  4JI6 B;  3HKD A;  5B3S C;  1HNX O;  4MVO A;  4LF6 B;  3JYC A;  2B1I A;  1BQ0 A;  1RPR A;  4JF3 A;  2QR4 A;  3JAW A;  2WPD G;  4B7K A;  2IJH A;  2ZE6 A;  4B3R B;  1QLE B;  4MVS A;  3OE7 G;  3QF7 A;  4Z1V A;  3L9D A;  2ZQM A;  2JS5 A;  1URF A;  2F43 G;  1H2K A;  3A2F A;  2D3O W;  3B8M A;  1M56 C;  2L6L A;  4JI4 O;  4X88 A;  4DR4 O;  1N33 O;  1XEQ A;  4BIO A;  4YY3 B;  1XBL A;  4YXW G;  2ADP A;  4X66 O;  1W0K G;  3WU2 Z;  4CC6 A;  4ZKI A;  5H6Q A;  4G27 B;  3CYO A;  2Q0A A;  2XOK G;  1AI7 A;  3DXR B;  5LMN B;  3CCM V;  4FLU A;  1QCE A;  1QVG U;  4IL6 Z;  2LJ2 A;  5ITZ B;  3B09 A;  4HAM A;  2C2A A;  3NXS A;  3WG7 B;  4U7O A;  1L0L H;  4LF7 O;  2P7T C;  1VF6 C;  2VRZ A;  2UXD O;  5JJE B;  4ZOL B;  2ODM A;  3N27 A;  4LFC B;  1NI8 A;  3RVZ A;  2JJ1 G;  4J9Y B;  1WA8 B;  5FLX N;  4ASU G;  1SER A;  4DR3 O;  4PA6 A;  5LOV A;  1ARO P;  3P32 A;  3X2Q C;  4FM1 A;  1GM9 A;  5C93 A;  4AIL C;  2UXC B;  4O4I B;  2ITD C;  4JAS A;  3B8N A;  3HKC A;  2YXH A;  3SYO A;  4UFZ A;  1XMQ O;  2ZXW B;  2PY5 A;  2CTP A;  1MZF A;  3K0G A;  4PDM A;  1RPO A;  3CB2 A;  2F4V O;  1K73 W;  3JAL A;  4WCE V;  1RSO B;  3UQ8 A;  4LFB B;  4WBN A;  4K35 A;  3RBZ A;  1CP9 A;  1GAX A;  1BGY H;  1SRY A;  5B1A B;  3AG1 B;  1AI4 A;  2OIE A;  4J7Z A;  3R65 A;  1F7Y A;  4YJ3 B;  1SQX H;  2QSA A;  3OFN G;  3ZMT A;  4FZ1 A;  1R6K A;  4UCO A;  3JAK A;  3N2G A;  2PZS A;  1COW G;  3BY6 A;  3APQ A;  3B2E E;  1SQG A;  4GKJ O;  1Q81 W;  4FFB A;  4NXM B;  2IU3 A;  3F7V C;  4F4L A;  1I7F A;  3W7W A;  4ZI7 A;  2NNU A;  1JMK C;  4D7S A;  3CPW U;  4GCZ A;  2DWE C;  3TXQ A;  1SQP H;  1YXB A;  4JYA B;  2LFS A;  4BWA A;  3DSQ A;  1HDJ A;  4I50 A;  4WFH A;  2DYR B;  5LXT A;  2XND G;  4DR6 O;  3L73 H;  4W4K A;  3ASO B;  1Q43 A;  3CCJ V;  1TGO A;  5EBW C;  2X0L A;  1WNS A;  2IU0 A;  3L75 H;  4FM0 A;  4FLW A;  1EZJ A;  1Y66 A;  5L3B A;  1YDX A;  2BTQ B;  1EN6 A;  2QWO B;  4JI6 O;  5A9G A;  4MVZ A;  3SJA C;  2X6C A;  5HFM A;  3AG3 B;  4LFA B;  3VOU A;  3WFV A;  3ETQ A;  4LF6 O;  4O4J B;  3ZHR A;  1Q6U A;  1TUB A;  1D5A A;  4UB6 Z;  2A06 H;  5JVD B;  3JAM N;  3CME V;  4B3R O;  3MHS C;  1FD9 A;  5LHG A;  4TQF A;  3VQY A;  2GSM B;  2WLI B;  4NR1 A;  3AK1 A;  3F5W C;  4WFB V;  4QE7 A;  1PNL A;  3STZ C;  3TXS A;  3CSX A;  3L72 H;  3L74 H;  1KP2 A;  2AZ0 A;  1IXB A;  1G6U A;  3WB1 A;  1WB8 A;  2QE7 G;  2XAH A;  1JOY A;  3W7T A;  1E1R G;  5L3C A;  3ZHT A;  1PKX A;  4DV6 B;  5CB4 A;  1OCZ B;  5LMN O;  4DRX B;  4HZ3 A;  5EZY B;  5J2U A;  4BW9 A;  2N05 A;  2OWO A;  4Z2W A;  1AR1 B;  3JAS A;  2Z5U A;  5B3S B;  1R3K C;  5KUM A;  3JSN A;  4FK5 C;  4U7N A;  2XTA A;  2FKX A;  1VQK V;  4K0K B;  3K79 A;  4Z1M G;  3NR7 A;  3W7X A;  3I56 V;  1SA0 B;  1H2G A;  4K8X A;  3T4Z A;  4LFC O;  3RW0 A;  2QEX V;  4FLZ A;  1QR8 A;  1FFX B;  1S5L Z;  4MVM A;  1NTM H;  4IYH A;  3OGC C;  2QWQ B;  1N36 B;  3IAY A;  4FLX A;  4JI5 B;  1TVK B;  2UXC O;  3H1H H;  3CX5 F;  4MS2 A;  2N04 A;  1MMM A;  3HKB B;  4PA9 A;  5IJ9 A;  5JH7 B;  3ZS8 C;  3K04 A;  1B06 A;  4GZR B;  1QVF U;  1ZL8 B;  4PA4 A;  1US6 A;  1BS3 A;  1M9N A;  3JD0 A;  4LFB O;  1N34 B;  1OV9 A;  4P9O A;  3TET A;  1MOF A;  3UO3 A; 
#chains in the Genus database with same CATH homology
 1BGY H;  3CWB H;  1KB9 F;  1KYO F;  1NU1 H;  2FYU H;  3L72 H;  3H1I H;  3L74 H;  3H1H H;  4U3F H;  3CX5 F;  2IBZ H;  1L0L H;  1SQQ H;  1SQP H;  3L70 H;  1SQX H;  2A06 H;  3L75 H;  4D6T H;  1NTK H;  3CXH F;  3H1L H;  3H1K H;  1PP9 H;  1BCC H;  2BCC H;  3L71 H;  1EZV H;  3BCC H;  1SQV H;  4PD4 F;  1NTZ H;  1NTM H;  3TGU H;  1P84 F;  1SQB H;  1BE3 H;  3L73 H;  1L0N H;  3H1J H;  1PPJ H;  5KLV H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...