1NTZH

Crystal structure of mitochondrial cytochrome bc1 complex bound with ubiquinone
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
b'EEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSQTEEDCTEELLDFLHARDHCVAHKLFNSLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 22
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02320 UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.20 Mainly Alpha Orthogonal Bundle Helix Hairpins Ubiquinol-cytochrome C reductase hinge domain 1ntzH00
2FYUH 3H1IH 5KLVH 4D6TH 1L0NH 3L70H 1KB9F 3BCCH 3L75H 4U3FH 4PD4F 1PP9H 3H1LH 1NTMH 1PPJH 1BGYH 1SQVH 1NU1H 1BCCH 3H1KH 2A06H 1SQQH 3CX5F 3CXHF 1KYOF 2IBZH 3H1JH 3L73H 3L72H 1NTZH 1NTKH 2BCCH 3TGUH 1SQXH 1L0LH 1SQBH 3L74H 3CWBH 3L71H 1BE3H 1P84F 1SQPH 3H1HH 1EZVH
chains in the Genus database with same CATH superfamily
5LL6Y 4BIOA 5IT9N 4F4LA 2V4DA 4LH6A 4B08A 2UUCO 3KCXA 4F6RB 2G38A 2AXTZ 3G6BA 3CCJV 5EC2C 4K0KB 1W0JG 1Y67A 1AI7A 2CH7B 1XNQO 1S5JA 3ZHRA 1GM9A 3H1KH 4J7KA 3SJBC 1M56B 1HW7A 2OIGA 2QWPB 2DOSA 2DYRC 3OR7C 2N05A 2YSUB 3ZN0A 3ZJZA 3D8CA 4DR3B 1QBZA 2DQ0A 5KA6A 4DV5O 2Q73A 4X64B 4AHCA 4X89A 3MD0A 1N34O 5J9PC 1O9GA 2WLLA 4OGQB 1WA8B 4DV6O 1M56C 4EFEA 4CS3A 2FKXA 3FX7A 4LF6B 3CXCU 1JX9A 5B1AB 4O4LB 1KUQA 2AW9A 2ZXWC 2DWDC 3ICXA 2RQ6A 3CCRV 1OJHA 3FB8C 4YJ2A 3T1HB 4I55B 2IBZH 3W7UA 4CC6A 1A32A 5DEDA 1Q8IA 4JI0B 2CK3G 2Q9LA 4O4LA 4WBNB 3WU2Z 5IJ0A 1E79G 3OEEG 2FYUH 2DE0X 5LBQA 5IYZA 4X1YA 4X8AA 1VP7A 3QVNA 3FKSG 3CRCA 4QIWF 2WLKA 4FFBA 4I55A 4Z2WA 3D36C 2L6LA 4YY3O 5KHHA 4PDVA 4WBNA 2YEVB 3NR7A 3QO5A 4X9QA 4AILC 3JAWB 1K97A 1OHHG 2HVKC 4H33A 4GX0A 5LMUB 2WLHA 2YUAA 2Q68A 1SQQH 2W0XA 5L3CA 4DO2A 2Y0IA 1PKXA 1XI1A 3HKDB 4U7OA 5H5NA 3WG7C 5CA1B 2XASA 5AG2A 2Q0AA 2PTMA 4UFZA 3JALB 3N2KA 3AK1A 4EEQA 1MOFA 1F51A 3FB5C 5L3BA 4J11A 4K3AA 1N32O 2QA4V 4R8CA 4TQFA 4DUYB 3FAVA 3ABKB 4UCUA 1PNKA 3PJSK 3DC5A 3J7AU 4KL1A 1US6A 2PI4A 4I50A 3OMAB 3JD2A 4DK1A 1SQVH 3CC7V 1UPGA 4YHHB 3OTFA 3JARB 5H9CA 3BFRA 2LGQA 3SJAC 1QR8A 1JOYA 5J2UB 4D7TA 4CZZA 3RT3C 3QF7A 4IYHA 3E35A 2QSAA 4GKKO 2X0LA 1LR1A 1RFYA 3E8HA 1KB9F 1YDXA 2RJZA 3ABKC 3QO7A 3JARA 5CA0B 1N33O 2PZSA 3BRCA 1XNRO 1R3JC 2IJHA 4LF4B 2CGOA 5EK0A 4O4HB 2HEPA 2Z5UA 3ZMZA 1NKDA 1YXBA 1KD1W 4PI2A 1AP5A 1I0HA 1K5SA 3BHPA 3HKEB 4MT8A 1IBLO 2BOBC 3AK3A 4HNAB 4DV1B 5LHGA 3BABA 2WWWA 4HBNA 2YI9A 1XBLA 4IT5A 2XAJA 2Y0PA 4GT1A 3OGCC 4LF8O 1AVMA 5LXTA 4Q6GA 1SA0A 4UV8A 3HKEA 2UXBB 4L87A 5B3SB 1BQ0A 4DR1O 2VS0A 4GX2A 1QQCA 1B3QA 4JI7B 4LNUB 1T5EA 1JR9A 4JI3B 3O9OA 1FFXB 3JATB 2QKSA 2ZNJA 2A06H 4R6ZA 3CMAV 3OD4A 3L74H 4FM2A 2WLNA 1SF9A 4JYCA 4LF9B 4N23A 2RCVA 1FFTB 1YHQV 3GVMA 3SYQA 4HZ3A 1W0KG 1AJPA 2GUZA 2P22C 2HG5C 3JCUZ 5BMVA 3U11A 3S3WA 2AZ0A 2XAFA 4IL6Z 4NKGB 1KP3A 1IURA 4ZBMA 1GN3A 2QM8A 1PL4A 2KB1A 3QNEA 2IJIA 4FLYA 2B5UA 3B2EE 4DR7B 1NJIW 3IFXA 1URFA 4LCUC 4JI1O 3NXSA 4DV7B 5FNVB 3L75H 1AR5A 3B77A 2P5OA 3K59A 5KAFZ 2E5LO 5DM6V 2A9HA 3CXHF 5LHHA 1CXZB 4LF5B 4X1IA 2E75B 4XDKA 1OCRC 3CEIA 2KQXA 5JCOC 3AG2C 1WPXA 3OE7G 2H8PC 3JYCA 3AK2A 2RNBA 3IC9A 5B1BB 4JYAO 4B3RB 3CMEV 5KA5A 4CBCA 2Y4UA 3WFVA 1S3JA 1HNXB 4KXRA 2P4VA 4WFFA 4IHJB 5EIBD 3ASOB 3OEHG 2JVDA 4I0XB 3OFNG 1RP3B 4UCOA 1XQ8A 4DUZO 5EZYA 1DF5A 4JI8B 1Y74B 4GLXA 2DMXA 1RSOA 5B1BC 1FKAO 1PL0A 4J80A 1NTZH 1GRJA 1S76D 5CBHA 1YJ9V 1MSDA 1V54C 3T4DA 1YJNV 1N36B 4LR3A 2QKAA 5KX5B 3ASOC 3T1YB 3WB1A 1Y74A 2OT5A 3E8BA 4LC1A 3UO2A 1P7BA 4BAYA 4EB6B 5EIBC 2EX3A 2LGWA 3RYFB 1VQ6V 1VIBA 1VQ5V 1GN2A 2EINB 3ZHSA 1RM1C 3R65A 1NT2B 3JASB 2Q69A 2QJ1A 2H94A 3ABMB 5EYPA 3G80A 4B3SO 2WPDG 3ZRVA 1RPOA 1ZLZA 4NXNB 2EIJC 1S5HC 3F5WC 2A7WA 3BY6A 5ITZB 2OWOA 1FPOA 2JDIG 5KMGB 4K0KO 5LA6A 3BEHA 2VQFO 1WB7A 2A0LA 1N4CA 1V9PA 3ABMC 3T2MA 5J2TB 4LFAB 1R6KA 2LQTA 4DR2O 1YITV 2ZQMA 1TVKB 1CEZA 4MVRA 5LGTA 3K04A 3CCUV 5JJJB 3L71H 4DR3O 5GW7A 3SYOA 3BA8A 5KMGA 2RMKB 2YXLA 5LP6A 5EBLC 4TUYB 3U0ZA 4G2KA 5C93A 2WA4A 4ZIBA 4AQYB 2EJ7A 3T1CA 2ADQB 5J2TA 2V1DA 3LDCA 3M7MX 2HHHB 2EZOA 5CN0A 3VQYA 5FPOA 3APQA 1K3EA 4Z1MG 4PDMA 1H2LA 1M57C 2A79B 2V7QG 4TUYA 4LF6O 2BTQA 4NTWA 1WB8A 4WFGA 1FXHA 1GTOA 1JFFB 4GKJO 3P32A 4LH7A 1IXMA 2DN9A 2D2CB 1Q6IA 3CE2A 4J10A 4JI0O 4H44B 3KG2A 2XAQA 1FJGB 1VMGA 2QM4A 1L0LH 1JFFA 1J5EB 4CH3A 4Z1VA 4MVSA 2Q7EA 4LF7O 3VQVA 1YEWA 2F93B 4MVUA 2OTJV 5LHIA 2ZE6A 1AI5A 3AG4C 2DJVA 1WJZA 2QEXV 1AR1B 1JJ2U 2EZPA 3K03A 1VQ4V 3HKBB 3OAAG 4NVPA 1IZ3A 5FPRA 1IBMO 5IYCO 1X4TA 2QKCA 1BT8A 2Z0AA 4MW8A 1MZEA 4XDJA 3MAQA 3ML0A 2Y69B 1G1XB 3ETEA 1XREA 1NVPD 3HKBA 1EM1A 1R3IC 5JWPA 4JV5B 4DR5O 1S72V 3LNNA 4CH4A 1NI8A 1VF6A 3ZBHA 4FVMA 2LJ2A 2DQ3A 3DTUB 2ZM6O 1NVPB 2AGAA 4DR4B 3LSSA 5IWAB 4JYYA 2F4VB 3BVOA 2Y69C 3EXAA 5L3EA 3SJCC 3L72H 4JZ2A 4XDLA 3UM7A 3K5LA 1H2MA 3RVZA 3TK1A 2JGDB 4O2AB 1GMGA 4OX9B 4J41A 2WLLB 1HNZB 5BR8O 4DV2B 2ZXWB 2EJRA 2PYLA 3H1IH 2YIBA 3W7XA 3SPHA 4PJ0Z 3LDEA 1Y76A 2GHYA 1N8RW 5CA3A 1NTMH 1BQZA 3TCUA 1X59A 4NTXA 2QDOA 4J7JA 3RFRA 2JGDA 4O2AA 3A0RA 1Q7YW 4YJ2B 4QPKA 3IGAC 1M9NA 3CCEV 2XAHA 1EN4A 1SZXA 2W6IG 2XAGA 2DYSC 3UQ8A 2R70A 1LUVA 4B3MO 2P4KA 5IJ0B 1ZL8A 1QCEA 3CRQA 5IYZB 4X1YB 1CPYA 2PGGA 4IIJA 3SPGA 4MTXA 4FFBB 4TT3G 2Q7HA 1K4CC 1M93A 3TJTA 4GYCB 1BSMA 1PV0A 4PELA 1K73W 2ITCC 2ZR2A 4RUFA 2UU9B 1QLEB 3ZRSA 2UUAB 3E22B 1M1KW 3GWOA 3RW0A 2DWEC 3CRRA 3WG7B 2WLJA 1TUEB 2WA3A 4JAAA 2XTAA 1VQMV 2UXDB 3K06A 1R6NA 4NXMB 1QU7A 3ZX6A 4DV4B 3K9SA 3E22A 3N2KB 5GTHZ 2QWQB 3RYHB 1R1BA 4JI2B 1E1QG 1QLEC 3I56V 3CCMV 1G8MA 1VQOV 1Q3EA 4I4TB 3JCZA 3EVKA 3KZIZ 2JRIA 1I94B 1L0NH 1YF2A 3P3PA 4U3FH 3RYHA 4JI4O 1FD9A 4A5UB 1W2BU 3FAVB 3HB3B 3K0DA 4BIUA 2IM9A 4PA9A 4PA3A 3ZCCA 5LMNB 3B4SA 2UXCB 4I4TA 1M90W 4I50B 4OPHA 1NTKH 4DR7O 3D3QA 4DW0A 4DXWA 3CWBH 3TXSA 1VQPV 1P84F 4MVMA 3K08A 4ABMA 5BZBA 1GK9A 1XILA 2UUCB 5JQGA 4JASA 4HYOA 1CP9A 4LF5O 1MG1A 2P67A 1E1RG 1PD3A 1DGSA 2M6YA 3K5OA 4MVZA 3CCLV 1AJQA 4BW9A 1KECA 3AG7A 3UCSC 3CP1A 3JAKA 4B7KA 2RDCA 1H2NA 4KHPB 2W6JG 3RGBA 3DC6A 2ZIMA 5KHGA 1HNXO 4J7ZA 3JD0A 1WNSA 4YXWG 4DV6B 1V55B 1K92A 3O65A 3J81N 2YS8A 3E89A 5B1OA 4I9WA 2R9RB 2VRZA 5LXTB 1SA0B 4D7SA 2EULA 2OTLV 3J80N 3OW2U 2ZE8A 2HP8A 3OT7A 5JVDB 3QG5A 2EIKC 1G4YB 4YJ3A 3OM3B 1SQGA 3VQXA 3L9DA 1RPRA 3B09A 1SQXH 2Y4TA 4LWSB 3T1YO 3AG1B 1V55C 4X65O 4FZ0A 4RAIA 2LFRA 5JVDA 4EKWA 1Q43A 2UUBB 4FM1A 3P30A 4JI6O 1XMOB 1GAXA 2OCHA 4Q20A 3QTCA 2GUZB 4I9QA 2HJFC 2CGNA 5BMVB 2ZR3A 4LWSA 2MK3A 4YY3B 5LGNA 2VWJA 1SESA 2H3OA 5LGUA 1Y66A 4UVCA 2PUSA 5L3DA 4QGPA 4ZHQB 3CC2V 4TV8B 3AG1C 4DV0B 3WB2A 2A3QA 1NQTA 3N2GB 1R3LC 2R9AA 2ZKOA 2HKOA 4ICGA 4EFBA 1IVSA 1OCRB 4ZHQA 2ARHA 5IJ9B 4TV8A 3UO3A 4X1IB 3AG2B 3CHXA 3ETGA 2P90A 1Q6UA 1H8EG 3RBZA 3CRMA 1GM8A 2YXYA 3B8NA 3N2GA 1YIJV 3ZHUA 3W7SA 2YICA 1EFRG 4LFAO 1AI6A 2QM7A 1WPBA 5IJ9A 3A2FA 1FXKB 3RVYA 4GX1A 1N32B 2IJKA 2CTPA 3STZC 3RYIA 2HLDG 4MSWC 2AHZA 3QO8A 2B1IA 1B06A 2Q6AA 2OIEA 2D3OW 2X6BA 4X88A 1EBOA 4J9ZB 3SJQC 1JPXA 4WF9V 3B40A 4DR6B 4RQEA 3SPCA 2HHHO 5DN6G 1FXKA 4QE9A 3G4SV 4MTFA 2B1GA 2F23A 1NS1A 5EZYB 4QE7A 4FLWA 3ABUA 1RSOB 1V54B 1FXKC 1HNWO 1AB3A 2ZDIA 2X6AA 3THOA 3CRAA 1VQ9V 1LNQA 2KG7A 5JJNB 2Q7GA 2WLIA 1HR0B 3MDSA 4FM0A 4X1KA 4TV9A 2R9IA 1PPJH 2PI5A 1N33B 2IJJA 3Q4HA 2BOCC 4UCRA 1FJGO 1H2KA 4O4JB 4MW3A 2EBOA 4DW1A 1J5EO 1RM1B 1L1FA 5FL7G 5KHIA 4NTYA 1DLBA 3JD3A 4XBFA 4I7ZB 1WP7A 1HDJA 1OCOC 1B04A 1IBLB 3CSXA 4O4JA 1VEWA 4OXSA 2BE3A 1NU1H 5EYPB 2EIJB 1KYOF 3LSUA 3L73H 1Z5VA 1ZAUA 2AHYA 1JCHA 1XMQO 1Q90D 4DR1B 2ZNIA 5LOVA 2ETNA 3FFQA 3UT5B 4UCVA 3LDDA 4KFMA 4JI5B 4IGGA 1H2SB 3SYPA 4UUJC 1UFIA 3K58A 2ZCEA 5LA6B 3OUSA 1PNLA 2K1EA 4X66O 2F95B 4UB8Z 1SQPH 3UT5A 1K5QA 3IJ4A 4J9YB 3K0GA 1F23A 5JH7B 5IWAO 1M4UA 1P4RA 1AROP 5JJEB 2F4VO 2CTRA 5LP6B 1K8AW 1K34A 5KHJA 3SYAA 5C8YB 3CD6V 1M57B 1JVMA 5JH7A 4DV2O 1EN6A 5D5QA 2IU3A 1QVFU 4L8JA 2Q4PA 2XNDG 3BAAA 4UCTA 2BTQB 4X64O 1IDSA 1R73A 3JSNA 4PD4F 1VQKV 2FB5A 1HP8A 4ZKIA 5C8YA 2OCCB 2Q5ZA 1ORQC 2JEUA 1JA8A 5LP6C 4U3JA 2E5LB 4JAUA 3ZEDA 4CC5A 2ADPA 2ZE5A 1KKDA 3VOUA 4W4LA 5KHKA 1GH6A 4H37A 1FS0G 4MS2A 1EZJA 3AG4B 3HPLC 3DXRA 3C3SA 1D5NA 3T1HO 3TXQA 1Y4MA 2OCCC 3ZMUA 1BZKA 3OGIB 2VQEB 3CC4V 1VF5B 3TGUH 3JAMN 3EFFK 4FZ1A 2BTOA 4O4IA 4E4EA 4FMTA 1I5YA 5LYJA 3CCSV 2UU9O 3H1LH 2PYJA 2WAMA 1IX9A 2UUAO 4DUZB 3BA9A 3E8FA 3HKCB 3JD4A 4H13B 1MZFA 4JYBA 1Q81W 5TISZ 4AI8A 4UV9A 1XEQA 4DRXB 4WFHA 2UXDO 3OTOB 4OPAA 4PDLA 1XUQA 3LNMB 4NXMO 3P3NA 1NH2B 1I7FA 1TUBA 4CS2A 4ASUG 3FYEB 4WFAV 3IC7A 1K9MW 5GONA 5H6RA 3HKCA 3EHBB 2KSDA 5LMUO 3GB7C 1LUWA 2IH1C 4DRXA 4FJCC 2YIBD 5EBMC 4RQFA 5GTIZ 3ZHQA 4X20B 1O9HA 1DF4A 4MVQA 1VF6C 4PA7A 4BW5A 4DV3B 4P30A 4RO2A 2X7RB 1P49A 2ZT9B 1Z5WA 2UXCO 4B3SB 3ZRWB 1PNMA 4PDRA 1BCCH 5CBFA 1Y76B 1FAFA 1MNGA 1F7YA 3W7TA 4LP8A 2F1MA 1IBKB 4DUYO 4X20A 2DYSB 3GWKC 5K1PA 4TWKA 2XOKG 2HVJC 3BCCH 2E3CA 3ZRWA 4JAVA 3KKYA 5CB4B 3K9AA 4LFBB 3FYIB 2VQFB 4YHHO 1ZL8B 2K9PA 1Q6HA 2LFSA 4DR2B 1SETA 2QWNB 4IIJB 2CUGA 1ZUQA 4F6RA 4KUMA 1KQSU 5IDJA 4KHPO 2O57A 4FLTA 5CB4A 3CS5A 2CH7A 1XHZA 3UKMA 1Q82W 1H8HG 1AILA 4FLXA 3K57A 4LF4O 1FYJA 5F2VO 1YSCA 4HAMA 4LFCB 3OMNB 4E2LA 1OV9A 4DV1O 4GKJB 3K5MA 2JS3A 3ZRXA 1COWG 4YIOA 1WA8A 4FFKA 1N0NA 4JTDB 3OR6C 3I55V 2EIMB 1WP8A 2QTSA 2JS5A 2UXBO 3ZMSA 1YJWV 2P7TC 1NR7A 3CJHB 1YCIA 4ZOLB 5A2QN 4JF3A 1S0VA 2JK5C 3WB0A 3D36A 2IW5A 1SQFA 4P2ZA 2UUBO 4JI7O 1XMOO 4LF7B 4WFEA 5B1AC 1I08A 1KKCA 4JI3O 1MABG 3OMIB 2XT9A 4B3TB 3R66A 3ZHVA 3W7WA 1KBHA 4ZI7B 3F7YC 4X62B 3ZIAG 2E74B 3CJHA 4ZOLA 2JGUA 2ATKC 2Q67A 2EIMC 4LF9O 1THZA 3SDLA 1IBMB 1AP6A 4BIZA 4DV0O 1I5XA 4D6TH 3T4ZA 2F43G 3I5DA 2GTAA 4ZI7A 2XHBA 2B9ZA 1VQ8V 3E8GA 2YEVA 4O2BB 2PF4E 2GSMB 2P06A 1TAEA 4DR5B 2QE7G 4K8XA 5JQGB 1QNMA 2PY5A 4UB6Z 1G6UA 3RN4A 1GN4A 3JAWA 3H1HH 2WSSG 5A9GA 3FB7C 4DV7O 3RYCB 2ZM6B 1JJOA 1KU9A 4PI0A 5IYBO 2QR4A 2YDEA 1JQ0A 4O2BA 3JAKB 1QHTA 2ZD9A 3HKDA 5L3FA 3D3IA 2JEXA 5CA1A 3CX5F 1XNQB 3JALA 3ZMTA 4H0LB 1F4MA 2WLMA 3KCYA 1K7DA 4TSFG 3RYCA 1U96A 1N0JA 2YC0A 4QJFB 1SZTA 5BR8B 1BS3A 5FLXN 2CDYA 4DR6O 3MHHC 3VQWA 4FLVA 1ZWIC 4GX5A 4DV5B 2EIKB 3B8MA 4B3RO 1XL6A 5EBWC 1B6QA 4KP4A 2GV9A 4UVAA 3LUTB 1MMMA 1H2GA 2GTSA 2N74A 2IU0A 1N34B 2FTKA 2UXNA 2GBOA 4YJ3B 1ZTEA 3E86A 1NBMG 1XOUA 2QWRB 1XL4A 3A0HZ 1VQ7V 2NR5A 1HR0O 1R6TA 2CE4A 4PA4A 3A8TA 4B3MB 1M5IA 4JI8O 5H2FZ 2HJDA 2Q8VA 2LO1A 5J2UA 1OCZB 1PM9A 3U10A 5BXZA 5B1NA 2DW4A 1UJWB 1N36O 1ENVA 1TA8A 1FXVA 2ODMA 1VQLV 3SYCA 5CA0A 5DECA 1GM7A 1MSWD 2CAZC 1WN7A 1MA1A 4GUNA 4MVOA 3ABTA 4I5SA 4O4HA 3ETDA 4G28B 1SERA 4B7EA 1ROPA 1Q5OA 4R7CA 1J95A 3CCVV 4JZGA 4QPJA 1QVGU 1OCZC 2QTOA 4UXNA 4HNAA 2X6CA 4JI5O 4PA6A 3H9VA 1VARA 1AI4A 4FLUA 3K79A 2LW7A 4NXNO 1NR1A 4UVBA 4N21A 2YIAA 4W4KA 3ABLB 4LNUA 1SRYA 5B3SC 3RYIB 1FFXA 5CBGA 3JATA 5E79Z 4GCZA 4U7NA 1JMKC 1PP9H 2Q0OC 2KKWA 4JI4B 3ZHTA 3X2QB 1KP2A 4G27B 1XHXA 3N27A 3K5NA 5EC1C 5L3GA 3CB2A 1DK1A 1K4DC 3ABLC 4AQYO 1YI2V 2JJ2G 2BSKB 4J42A 2FL4A 2E76B 2KG7B 3MHSC 4F6EA 2Z3YA 3HR0A 2JJ1G 2WLIB 3C3TA 4X1KB 4TV9B 2P6JA 5JCOA 3C90A 3X2QC 3Q4HB 5FNVA 1YVWA 2JIZG 2BSKA 2MW2B 1OCOB 4GKKB 3JSLA 2AZ2A 3IAYA 4MTOA 1GO3F 1W59A 2ZDIC 3DSQA 2L35A 2CTQA 2VQEO 1KC8W 3STLC 5HFMA 1XNRB 3G71V 1SC5B 4RUEA 3PN1A 2IH3C 2XUMA 1H38A 1YTFD 3ASNB 4QNHB 4FK5C 1BHAA 1BHBA 1AR4A 1NZ6A 3S3XA 3OUFA 4YIPA 3ETQA 1QR9A 3M99B 5LOVB 1WAZA 3VBBA 3DGEA 4IHJA 3SGIA 4R50A 4TOIA 3OTOO 4P9PA 1YTFB 4PHZA 4I0XA 1SQBH 4NR1A 4LF8B 3AEIA 2VWKA 4JTAB 5IE9A 4K8ZA 5B66Z 4X65B 5D5PA 3RWRD 3ASNC 1TGOA 4FPPA 4JI6B 4JV5O 1OZ0A 2F66C 3E83A 1S5LZ 5KX5A 4CH6A 4WFBV 1KMIZ 1EZVH 1OCCB 2UXXA 3H01A 3CYOA 1ZSPA 1IXBA 4DR4O 2ZIOA 1AJNA 4DV3O 1QLNA 2CTWA 4EB6A 1Q86W 3E2EA 4NB5A 5HFLA 2RN9A 2QWOB 4RWUA 3RYFA 1IBKO 2QGNA 1BMFG 3JASA 4OX9O 4U3JB 2YXHA 3ZS8C 3ZMVA 5BY1A 3APOA 1HNZO 1WLEA 2EILB 3JD1A 2EINC 5K1XA 1OCCC 4JI1B 4BWAA 1S77D 4LFBO 4JPRA 2HFEC 3BPZA 2N04A 1Y6XA 3SPJA 3DXRB 3AG3B 2R72A 3FB6C 3F5TA 2Y48A 5ITZA 1Z2GA 2YI8A 4DK0A 5KLVH 2EILC 2NNUA 4DYLA 2YIDA 4O4IB 1TVKA 2LW1A 5H6QA 2LP7A 1XDCA 3LSQA 5LYJB 1K33A 4JYAB 4MTGA 2C2AA 1L8DA 3AG3C 4LFCO 1BE3H 1HNWB 1D5AA 4K35A 4BR6A 2FMLA 2W0FC 3SPIA 5CMUA 1DTOA 1GN6A 1NH2D 1TUBB 1EN5A 2M7WA 5KUKA 2ZINA 4JTCB 5GONB 4FLZA 4NYKA 4C7UA 2ILMA 1P7GA 1GKFA 4LBEC 4FIPC 4CH5A 1SS3A 1ZX3A 4DV4O 5E1AC 2NN4A 2NLJC 4B3TO 3L70H 3G67A 4WCEV 3SR2C 4JI2O 1U97A 4X62O 4JGSA 3CCQV 3M8AA 1D2DA 3F7VC 4CS4A 5IY5B 5IYDO 1BL8A 2OYQA 2ITDC 1XMQB 4GZRB 5B5EZ 1I94O 1SKVA 2ZE7A 1VF7A 3CPWU 3K3WA 1BGYH 3A0BZ 5LMNO 3G6EV 4PV1B 2HR3A 2GDSA 1YZBA 3ZN1A 2DYRB 3H1JH 1R3KC 4UCSA 1VQNV 4IYIA 2BCCH 1HWYA 4X66B 5KUMA 4P9OA 3FD9A 4TQDA 3TETA 5KAIZ 5IY5C 1F4NA
chains in the Genus database with same CATH topology
2FYUH 3H1IH 5KLVH 4D6TH 1L0NH 3L70H 1KB9F 3BCCH 3L75H 4U3FH 4PD4F 1PP9H 3H1LH 1NTMH 1PPJH 1BGYH 1SQVH 1NU1H 1BCCH 3H1KH 2A06H 1SQQH 3CX5F 3CXHF 1KYOF 2IBZH 3H1JH 3L73H 3L72H 1NTZH 1NTKH 2BCCH 3TGUH 1SQXH 1L0LH 1SQBH 3L74H 3CWBH 3L71H 1BE3H 1P84F 1SQPH 3H1HH 1EZVH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU H;  3H1I H;  5KLV H;  4D6T H;  1L0N H;  3L70 H;  1KB9 F;  3BCC H;  3L75 H;  4U3F H;  4PD4 F;  1PP9 H;  3H1L H;  1NTM H;  1PPJ H;  1BGY H;  1SQV H;  1NU1 H;  1BCC H;  3H1K H;  2A06 H;  1SQQ H;  3CX5 F;  3CXH F;  1KYO F;  2IBZ H;  3H1J H;  3L73 H;  3L72 H;  1NTZ H;  1NTK H;  2BCC H;  3TGU H;  1SQX H;  1L0L H;  1SQB H;  3L74 H;  3CWB H;  3L71 H;  1BE3 H;  1P84 F;  1SQP H;  3H1H H;  1EZV H; 
#chains in the Genus database with same CATH topology
 5LL6 Y;  4BIO A;  5IT9 N;  4F4L A;  2V4D A;  4LH6 A;  4B08 A;  2UUC O;  3KCX A;  4F6R B;  2G38 A;  2AXT Z;  3G6B A;  3CCJ V;  5EC2 C;  4K0K B;  1W0J G;  1Y67 A;  1AI7 A;  2CH7 B;  1XNQ O;  1S5J A;  3ZHR A;  1GM9 A;  3H1K H;  4J7K A;  3SJB C;  1M56 B;  1HW7 A;  2OIG A;  2QWP B;  2DOS A;  2DYR C;  3OR7 C;  2N05 A;  2YSU B;  3ZN0 A;  3ZJZ A;  3D8C A;  4DR3 B;  1QBZ A;  2DQ0 A;  5KA6 A;  4DV5 O;  2Q73 A;  4X64 B;  4AHC A;  4X89 A;  3MD0 A;  1N34 O;  5J9P C;  1O9G A;  2WLL A;  4OGQ B;  1WA8 B;  4DV6 O;  1M56 C;  4EFE A;  4CS3 A;  2FKX A;  3FX7 A;  4LF6 B;  3CXC U;  1JX9 A;  5B1A B;  4O4L B;  1KUQ A;  2AW9 A;  2ZXW C;  2DWD C;  3ICX A;  2RQ6 A;  3CCR V;  1OJH A;  3FB8 C;  4YJ2 A;  3T1H B;  4I55 B;  2IBZ H;  3W7U A;  4CC6 A;  1A32 A;  5DED A;  1Q8I A;  4JI0 B;  2CK3 G;  2Q9L A;  4O4L A;  4WBN B;  3WU2 Z;  5IJ0 A;  1E79 G;  3OEE G;  2FYU H;  2DE0 X;  5LBQ A;  5IYZ A;  4X1Y A;  4X8A A;  1VP7 A;  3QVN A;  3FKS G;  3CRC A;  4QIW F;  2WLK A;  4FFB A;  4I55 A;  4Z2W A;  3D36 C;  2L6L A;  4YY3 O;  5KHH A;  4PDV A;  4WBN A;  2YEV B;  3NR7 A;  3QO5 A;  4X9Q A;  4AIL C;  3JAW B;  1K97 A;  1OHH G;  2HVK C;  4H33 A;  4GX0 A;  5LMU B;  2WLH A;  2YUA A;  2Q68 A;  1SQQ H;  2W0X A;  5L3C A;  4DO2 A;  2Y0I A;  1PKX A;  1XI1 A;  3HKD B;  4U7O A;  5H5N A;  3WG7 C;  5CA1 B;  2XAS A;  5AG2 A;  2Q0A A;  2PTM A;  4UFZ A;  3JAL B;  3N2K A;  3AK1 A;  4EEQ A;  1MOF A;  1F51 A;  3FB5 C;  5L3B A;  4J11 A;  4K3A A;  1N32 O;  2QA4 V;  4R8C A;  4TQF A;  4DUY B;  3FAV A;  3ABK B;  4UCU A;  1PNK A;  3PJS K;  3DC5 A;  3J7A U;  4KL1 A;  1US6 A;  2PI4 A;  4I50 A;  3OMA B;  3JD2 A;  4DK1 A;  1SQV H;  3CC7 V;  1UPG A;  4YHH B;  3OTF A;  3JAR B;  5H9C A;  3BFR A;  2LGQ A;  3SJA C;  1QR8 A;  1JOY A;  5J2U B;  4D7T A;  4CZZ A;  3RT3 C;  3QF7 A;  4IYH A;  3E35 A;  2QSA A;  4GKK O;  2X0L A;  1LR1 A;  1RFY A;  3E8H A;  1KB9 F;  1YDX A;  2RJZ A;  3ABK C;  3QO7 A;  3JAR A;  5CA0 B;  1N33 O;  2PZS A;  3BRC A;  1XNR O;  1R3J C;  2IJH A;  4LF4 B;  2CGO A;  5EK0 A;  4O4H B;  2HEP A;  2Z5U A;  3ZMZ A;  1NKD A;  1YXB A;  1KD1 W;  4PI2 A;  1AP5 A;  1I0H A;  1K5S A;  3BHP A;  3HKE B;  4MT8 A;  1IBL O;  2BOB C;  3AK3 A;  4HNA B;  4DV1 B;  5LHG A;  3BAB A;  2WWW A;  4HBN A;  2YI9 A;  1XBL A;  4IT5 A;  2XAJ A;  2Y0P A;  4GT1 A;  3OGC C;  4LF8 O;  1AVM A;  5LXT A;  4Q6G A;  1SA0 A;  4UV8 A;  3HKE A;  2UXB B;  4L87 A;  5B3S B;  1BQ0 A;  4DR1 O;  2VS0 A;  4GX2 A;  1QQC A;  1B3Q A;  4JI7 B;  4LNU B;  1T5E A;  1JR9 A;  4JI3 B;  3O9O A;  1FFX B;  3JAT B;  2QKS A;  2ZNJ A;  2A06 H;  4R6Z A;  3CMA V;  3OD4 A;  3L74 H;  4FM2 A;  2WLN A;  1SF9 A;  4JYC A;  4LF9 B;  4N23 A;  2RCV A;  1FFT B;  1YHQ V;  3GVM A;  3SYQ A;  4HZ3 A;  1W0K G;  1AJP A;  2GUZ A;  2P22 C;  2HG5 C;  3JCU Z;  5BMV A;  3U11 A;  3S3W A;  2AZ0 A;  2XAF A;  4IL6 Z;  4NKG B;  1KP3 A;  1IUR A;  4ZBM A;  1GN3 A;  2QM8 A;  1PL4 A;  2KB1 A;  3QNE A;  2IJI A;  4FLY A;  2B5U A;  3B2E E;  4DR7 B;  1NJI W;  3IFX A;  1URF A;  4LCU C;  4JI1 O;  3NXS A;  4DV7 B;  5FNV B;  3L75 H;  1AR5 A;  3B77 A;  2P5O A;  3K59 A;  5KAF Z;  2E5L O;  5DM6 V;  2A9H A;  3CXH F;  5LHH A;  1CXZ B;  4LF5 B;  4X1I A;  2E75 B;  4XDK A;  1OCR C;  3CEI A;  2KQX A;  5JCO C;  3AG2 C;  1WPX A;  3OE7 G;  2H8P C;  3JYC A;  3AK2 A;  2RNB A;  3IC9 A;  5B1B B;  4JYA O;  4B3R B;  3CME V;  5KA5 A;  4CBC A;  2Y4U A;  3WFV A;  1S3J A;  1HNX B;  4KXR A;  2P4V A;  4WFF A;  4IHJ B;  5EIB D;  3ASO B;  3OEH G;  2JVD A;  4I0X B;  3OFN G;  1RP3 B;  4UCO A;  1XQ8 A;  4DUZ O;  5EZY A;  1DF5 A;  4JI8 B;  1Y74 B;  4GLX A;  2DMX A;  1RSO A;  5B1B C;  1FKA O;  1PL0 A;  4J80 A;  1NTZ H;  1GRJ A;  1S76 D;  5CBH A;  1YJ9 V;  1MSD A;  1V54 C;  3T4D A;  1YJN V;  1N36 B;  4LR3 A;  2QKA A;  5KX5 B;  3ASO C;  3T1Y B;  3WB1 A;  1Y74 A;  2OT5 A;  3E8B A;  4LC1 A;  3UO2 A;  1P7B A;  4BAY A;  4EB6 B;  5EIB C;  2EX3 A;  2LGW A;  3RYF B;  1VQ6 V;  1VIB A;  1VQ5 V;  1GN2 A;  2EIN B;  3ZHS A;  1RM1 C;  3R65 A;  1NT2 B;  3JAS B;  2Q69 A;  2QJ1 A;  2H94 A;  3ABM B;  5EYP A;  3G80 A;  4B3S O;  2WPD G;  3ZRV A;  1RPO A;  1ZLZ A;  4NXN B;  2EIJ C;  1S5H C;  3F5W C;  2A7W A;  3BY6 A;  5ITZ B;  2OWO A;  1FPO A;  2JDI G;  5KMG B;  4K0K O;  5LA6 A;  3BEH A;  2VQF O;  1WB7 A;  2A0L A;  1N4C A;  1V9P A;  3ABM C;  3T2M A;  5J2T B;  4LFA B;  1R6K A;  2LQT A;  4DR2 O;  1YIT V;  2ZQM A;  1TVK B;  1CEZ A;  4MVR A;  5LGT A;  3K04 A;  3CCU V;  5JJJ B;  3L71 H;  4DR3 O;  5GW7 A;  3SYO A;  3BA8 A;  5KMG A;  2RMK B;  2YXL A;  5LP6 A;  5EBL C;  4TUY B;  3U0Z A;  4G2K A;  5C93 A;  2WA4 A;  4ZIB A;  4AQY B;  2EJ7 A;  3T1C A;  2ADQ B;  5J2T A;  2V1D A;  3LDC A;  3M7M X;  2HHH B;  2EZO A;  5CN0 A;  3VQY A;  5FPO A;  3APQ A;  1K3E A;  4Z1M G;  4PDM A;  1H2L A;  1M57 C;  2A79 B;  2V7Q G;  4TUY A;  4LF6 O;  2BTQ A;  4NTW A;  1WB8 A;  4WFG A;  1FXH A;  1GTO A;  1JFF B;  4GKJ O;  3P32 A;  4LH7 A;  1IXM A;  2DN9 A;  2D2C B;  1Q6I A;  3CE2 A;  4J10 A;  4JI0 O;  4H44 B;  3KG2 A;  2XAQ A;  1FJG B;  1VMG A;  2QM4 A;  1L0L H;  1JFF A;  1J5E B;  4CH3 A;  4Z1V A;  4MVS A;  2Q7E A;  4LF7 O;  3VQV A;  1YEW A;  2F93 B;  4MVU A;  2OTJ V;  5LHI A;  2ZE6 A;  1AI5 A;  3AG4 C;  2DJV A;  1WJZ A;  2QEX V;  1AR1 B;  1JJ2 U;  2EZP A;  3K03 A;  1VQ4 V;  3HKB B;  3OAA G;  4NVP A;  1IZ3 A;  5FPR A;  1IBM O;  5IYC O;  1X4T A;  2QKC A;  1BT8 A;  2Z0A A;  4MW8 A;  1MZE A;  4XDJ A;  3MAQ A;  3ML0 A;  2Y69 B;  1G1X B;  3ETE A;  1XRE A;  1NVP D;  3HKB A;  1EM1 A;  1R3I C;  5JWP A;  4JV5 B;  4DR5 O;  1S72 V;  3LNN A;  4CH4 A;  1NI8 A;  1VF6 A;  3ZBH A;  4FVM A;  2LJ2 A;  2DQ3 A;  3DTU B;  2ZM6 O;  1NVP B;  2AGA A;  4DR4 B;  3LSS A;  5IWA B;  4JYY A;  2F4V B;  3BVO A;  2Y69 C;  3EXA A;  5L3E A;  3SJC C;  3L72 H;  4JZ2 A;  4XDL A;  3UM7 A;  3K5L A;  1H2M A;  3RVZ A;  3TK1 A;  2JGD B;  4O2A B;  1GMG A;  4OX9 B;  4J41 A;  2WLL B;  1HNZ B;  5BR8 O;  4DV2 B;  2ZXW B;  2EJR A;  2PYL A;  3H1I H;  2YIB A;  3W7X A;  3SPH A;  4PJ0 Z;  3LDE A;  1Y76 A;  2GHY A;  1N8R W;  5CA3 A;  1NTM H;  1BQZ A;  3TCU A;  1X59 A;  4NTX A;  2QDO A;  4J7J A;  3RFR A;  2JGD A;  4O2A A;  3A0R A;  1Q7Y W;  4YJ2 B;  4QPK A;  3IGA C;  1M9N A;  3CCE V;  2XAH A;  1EN4 A;  1SZX A;  2W6I G;  2XAG A;  2DYS C;  3UQ8 A;  2R70 A;  1LUV A;  4B3M O;  2P4K A;  5IJ0 B;  1ZL8 A;  1QCE A;  3CRQ A;  5IYZ B;  4X1Y B;  1CPY A;  2PGG A;  4IIJ A;  3SPG A;  4MTX A;  4FFB B;  4TT3 G;  2Q7H A;  1K4C C;  1M93 A;  3TJT A;  4GYC B;  1BSM A;  1PV0 A;  4PEL A;  1K73 W;  2ITC C;  2ZR2 A;  4RUF A;  2UU9 B;  1QLE B;  3ZRS A;  2UUA B;  3E22 B;  1M1K W;  3GWO A;  3RW0 A;  2DWE C;  3CRR A;  3WG7 B;  2WLJ A;  1TUE B;  2WA3 A;  4JAA A;  2XTA A;  1VQM V;  2UXD B;  3K06 A;  1R6N A;  4NXM B;  1QU7 A;  3ZX6 A;  4DV4 B;  3K9S A;  3E22 A;  3N2K B;  5GTH Z;  2QWQ B;  3RYH B;  1R1B A;  4JI2 B;  1E1Q G;  1QLE C;  3I56 V;  3CCM V;  1G8M A;  1VQO V;  1Q3E A;  4I4T B;  3JCZ A;  3EVK A;  3KZI Z;  2JRI A;  1I94 B;  1L0N H;  1YF2 A;  3P3P A;  4U3F H;  3RYH A;  4JI4 O;  1FD9 A;  4A5U B;  1W2B U;  3FAV B;  3HB3 B;  3K0D A;  4BIU A;  2IM9 A;  4PA9 A;  4PA3 A;  3ZCC A;  5LMN B;  3B4S A;  2UXC B;  4I4T A;  1M90 W;  4I50 B;  4OPH A;  1NTK H;  4DR7 O;  3D3Q A;  4DW0 A;  4DXW A;  3CWB H;  3TXS A;  1VQP V;  1P84 F;  4MVM A;  3K08 A;  4ABM A;  5BZB A;  1GK9 A;  1XIL A;  2UUC B;  5JQG A;  4JAS A;  4HYO A;  1CP9 A;  4LF5 O;  1MG1 A;  2P67 A;  1E1R G;  1PD3 A;  1DGS A;  2M6Y A;  3K5O A;  4MVZ A;  3CCL V;  1AJQ A;  4BW9 A;  1KEC A;  3AG7 A;  3UCS C;  3CP1 A;  3JAK A;  4B7K A;  2RDC A;  1H2N A;  4KHP B;  2W6J G;  3RGB A;  3DC6 A;  2ZIM A;  5KHG A;  1HNX O;  4J7Z A;  3JD0 A;  1WNS A;  4YXW G;  4DV6 B;  1V55 B;  1K92 A;  3O65 A;  3J81 N;  2YS8 A;  3E89 A;  5B1O A;  4I9W A;  2R9R B;  2VRZ A;  5LXT B;  1SA0 B;  4D7S A;  2EUL A;  2OTL V;  3J80 N;  3OW2 U;  2ZE8 A;  2HP8 A;  3OT7 A;  5JVD B;  3QG5 A;  2EIK C;  1G4Y B;  4YJ3 A;  3OM3 B;  1SQG A;  3VQX A;  3L9D A;  1RPR A;  3B09 A;  1SQX H;  2Y4T A;  4LWS B;  3T1Y O;  3AG1 B;  1V55 C;  4X65 O;  4FZ0 A;  4RAI A;  2LFR A;  5JVD A;  4EKW A;  1Q43 A;  2UUB B;  4FM1 A;  3P30 A;  4JI6 O;  1XMO B;  1GAX A;  2OCH A;  4Q20 A;  3QTC A;  2GUZ B;  4I9Q A;  2HJF C;  2CGN A;  5BMV B;  2ZR3 A;  4LWS A;  2MK3 A;  4YY3 B;  5LGN A;  2VWJ A;  1SES A;  2H3O A;  5LGU A;  1Y66 A;  4UVC A;  2PUS A;  5L3D A;  4QGP A;  4ZHQ B;  3CC2 V;  4TV8 B;  3AG1 C;  4DV0 B;  3WB2 A;  2A3Q A;  1NQT A;  3N2G B;  1R3L C;  2R9A A;  2ZKO A;  2HKO A;  4ICG A;  4EFB A;  1IVS A;  1OCR B;  4ZHQ A;  2ARH A;  5IJ9 B;  4TV8 A;  3UO3 A;  4X1I B;  3AG2 B;  3CHX A;  3ETG A;  2P90 A;  1Q6U A;  1H8E G;  3RBZ A;  3CRM A;  1GM8 A;  2YXY A;  3B8N A;  3N2G A;  1YIJ V;  3ZHU A;  3W7S A;  2YIC A;  1EFR G;  4LFA O;  1AI6 A;  2QM7 A;  1WPB A;  5IJ9 A;  3A2F A;  1FXK B;  3RVY A;  4GX1 A;  1N32 B;  2IJK A;  2CTP A;  3STZ C;  3RYI A;  2HLD G;  4MSW C;  2AHZ A;  3QO8 A;  2B1I A;  1B06 A;  2Q6A A;  2OIE A;  2D3O W;  2X6B A;  4X88 A;  1EBO A;  4J9Z B;  3SJQ C;  1JPX A;  4WF9 V;  3B40 A;  4DR6 B;  4RQE A;  3SPC A;  2HHH O;  5DN6 G;  1FXK A;  4QE9 A;  3G4S V;  4MTF A;  2B1G A;  2F23 A;  1NS1 A;  5EZY B;  4QE7 A;  4FLW A;  3ABU A;  1RSO B;  1V54 B;  1FXK C;  1HNW O;  1AB3 A;  2ZDI A;  2X6A A;  3THO A;  3CRA A;  1VQ9 V;  1LNQ A;  2KG7 A;  5JJN B;  2Q7G A;  2WLI A;  1HR0 B;  3MDS A;  4FM0 A;  4X1K A;  4TV9 A;  2R9I A;  1PPJ H;  2PI5 A;  1N33 B;  2IJJ A;  3Q4H A;  2BOC C;  4UCR A;  1FJG O;  1H2K A;  4O4J B;  4MW3 A;  2EBO A;  4DW1 A;  1J5E O;  1RM1 B;  1L1F A;  5FL7 G;  5KHI A;  4NTY A;  1DLB A;  3JD3 A;  4XBF A;  4I7Z B;  1WP7 A;  1HDJ A;  1OCO C;  1B04 A;  1IBL B;  3CSX A;  4O4J A;  1VEW A;  4OXS A;  2BE3 A;  1NU1 H;  5EYP B;  2EIJ B;  1KYO F;  3LSU A;  3L73 H;  1Z5V A;  1ZAU A;  2AHY A;  1JCH A;  1XMQ O;  1Q90 D;  4DR1 B;  2ZNI A;  5LOV A;  2ETN A;  3FFQ A;  3UT5 B;  4UCV A;  3LDD A;  4KFM A;  4JI5 B;  4IGG A;  1H2S B;  3SYP A;  4UUJ C;  1UFI A;  3K58 A;  2ZCE A;  5LA6 B;  3OUS A;  1PNL A;  2K1E A;  4X66 O;  2F95 B;  4UB8 Z;  1SQP H;  3UT5 A;  1K5Q A;  3IJ4 A;  4J9Y B;  3K0G A;  1F23 A;  5JH7 B;  5IWA O;  1M4U A;  1P4R A;  1ARO P;  5JJE B;  2F4V O;  2CTR A;  5LP6 B;  1K8A W;  1K34 A;  5KHJ A;  3SYA A;  5C8Y B;  3CD6 V;  1M57 B;  1JVM A;  5JH7 A;  4DV2 O;  1EN6 A;  5D5Q A;  2IU3 A;  1QVF U;  4L8J A;  2Q4P A;  2XND G;  3BAA A;  4UCT A;  2BTQ B;  4X64 O;  1IDS A;  1R73 A;  3JSN A;  4PD4 F;  1VQK V;  2FB5 A;  1HP8 A;  4ZKI A;  5C8Y A;  2OCC B;  2Q5Z A;  1ORQ C;  2JEU A;  1JA8 A;  5LP6 C;  4U3J A;  2E5L B;  4JAU A;  3ZED A;  4CC5 A;  2ADP A;  2ZE5 A;  1KKD A;  3VOU A;  4W4L A;  5KHK A;  1GH6 A;  4H37 A;  1FS0 G;  4MS2 A;  1EZJ A;  3AG4 B;  3HPL C;  3DXR A;  3C3S A;  1D5N A;  3T1H O;  3TXQ A;  1Y4M A;  2OCC C;  3ZMU A;  1BZK A;  3OGI B;  2VQE B;  3CC4 V;  1VF5 B;  3TGU H;  3JAM N;  3EFF K;  4FZ1 A;  2BTO A;  4O4I A;  4E4E A;  4FMT A;  1I5Y A;  5LYJ A;  3CCS V;  2UU9 O;  3H1L H;  2PYJ A;  2WAM A;  1IX9 A;  2UUA O;  4DUZ B;  3BA9 A;  3E8F A;  3HKC B;  3JD4 A;  4H13 B;  1MZF A;  4JYB A;  1Q81 W;  5TIS Z;  4AI8 A;  4UV9 A;  1XEQ A;  4DRX B;  4WFH A;  2UXD O;  3OTO B;  4OPA A;  4PDL A;  1XUQ A;  3LNM B;  4NXM O;  3P3N A;  1NH2 B;  1I7F A;  1TUB A;  4CS2 A;  4ASU G;  3FYE B;  4WFA V;  3IC7 A;  1K9M W;  5GON A;  5H6R A;  3HKC A;  3EHB B;  2KSD A;  5LMU O;  3GB7 C;  1LUW A;  2IH1 C;  4DRX A;  4FJC C;  2YIB D;  5EBM C;  4RQF A;  5GTI Z;  3ZHQ A;  4X20 B;  1O9H A;  1DF4 A;  4MVQ A;  1VF6 C;  4PA7 A;  4BW5 A;  4DV3 B;  4P30 A;  4RO2 A;  2X7R B;  1P49 A;  2ZT9 B;  1Z5W A;  2UXC O;  4B3S B;  3ZRW B;  1PNM A;  4PDR A;  1BCC H;  5CBF A;  1Y76 B;  1FAF A;  1MNG A;  1F7Y A;  3W7T A;  4LP8 A;  2F1M A;  1IBK B;  4DUY O;  4X20 A;  2DYS B;  3GWK C;  5K1P A;  4TWK A;  2XOK G;  2HVJ C;  3BCC H;  2E3C A;  3ZRW A;  4JAV A;  3KKY A;  5CB4 B;  3K9A A;  4LFB B;  3FYI B;  2VQF B;  4YHH O;  1ZL8 B;  2K9P A;  1Q6H A;  2LFS A;  4DR2 B;  1SET A;  2QWN B;  4IIJ B;  2CUG A;  1ZUQ A;  4F6R A;  4KUM A;  1KQS U;  5IDJ A;  4KHP O;  2O57 A;  4FLT A;  5CB4 A;  3CS5 A;  2CH7 A;  1XHZ A;  3UKM A;  1Q82 W;  1H8H G;  1AIL A;  4FLX A;  3K57 A;  4LF4 O;  1FYJ A;  5F2V O;  1YSC A;  4HAM A;  4LFC B;  3OMN B;  4E2L A;  1OV9 A;  4DV1 O;  4GKJ B;  3K5M A;  2JS3 A;  3ZRX A;  1COW G;  4YIO A;  1WA8 A;  4FFK A;  1N0N A;  4JTD B;  3OR6 C;  3I55 V;  2EIM B;  1WP8 A;  2QTS A;  2JS5 A;  2UXB O;  3ZMS A;  1YJW V;  2P7T C;  1NR7 A;  3CJH B;  1YCI A;  4ZOL B;  5A2Q N;  4JF3 A;  1S0V A;  2JK5 C;  3WB0 A;  3D36 A;  2IW5 A;  1SQF A;  4P2Z A;  2UUB O;  4JI7 O;  1XMO O;  4LF7 B;  4WFE A;  5B1A C;  1I08 A;  1KKC A;  4JI3 O;  1MAB G;  3OMI B;  2XT9 A;  4B3T B;  3R66 A;  3ZHV A;  3W7W A;  1KBH A;  4ZI7 B;  3F7Y C;  4X62 B;  3ZIA G;  2E74 B;  3CJH A;  4ZOL A;  2JGU A;  2ATK C;  2Q67 A;  2EIM C;  4LF9 O;  1THZ A;  3SDL A;  1IBM B;  1AP6 A;  4BIZ A;  4DV0 O;  1I5X A;  4D6T H;  3T4Z A;  2F43 G;  3I5D A;  2GTA A;  4ZI7 A;  2XHB A;  2B9Z A;  1VQ8 V;  3E8G A;  2YEV A;  4O2B B;  2PF4 E;  2GSM B;  2P06 A;  1TAE A;  4DR5 B;  2QE7 G;  4K8X A;  5JQG B;  1QNM A;  2PY5 A;  4UB6 Z;  1G6U A;  3RN4 A;  1GN4 A;  3JAW A;  3H1H H;  2WSS G;  5A9G A;  3FB7 C;  4DV7 O;  3RYC B;  2ZM6 B;  1JJO A;  1KU9 A;  4PI0 A;  5IYB O;  2QR4 A;  2YDE A;  1JQ0 A;  4O2B A;  3JAK B;  1QHT A;  2ZD9 A;  3HKD A;  5L3F A;  3D3I A;  2JEX A;  5CA1 A;  3CX5 F;  1XNQ B;  3JAL A;  3ZMT A;  4H0L B;  1F4M A;  2WLM A;  3KCY A;  1K7D A;  4TSF G;  3RYC A;  1U96 A;  1N0J A;  2YC0 A;  4QJF B;  1SZT A;  5BR8 B;  1BS3 A;  5FLX N;  2CDY A;  4DR6 O;  3MHH C;  3VQW A;  4FLV A;  1ZWI C;  4GX5 A;  4DV5 B;  2EIK B;  3B8M A;  4B3R O;  1XL6 A;  5EBW C;  1B6Q A;  4KP4 A;  2GV9 A;  4UVA A;  3LUT B;  1MMM A;  1H2G A;  2GTS A;  2N74 A;  2IU0 A;  1N34 B;  2FTK A;  2UXN A;  2GBO A;  4YJ3 B;  1ZTE A;  3E86 A;  1NBM G;  1XOU A;  2QWR B;  1XL4 A;  3A0H Z;  1VQ7 V;  2NR5 A;  1HR0 O;  1R6T A;  2CE4 A;  4PA4 A;  3A8T A;  4B3M B;  1M5I A;  4JI8 O;  5H2F Z;  2HJD A;  2Q8V A;  2LO1 A;  5J2U A;  1OCZ B;  1PM9 A;  3U10 A;  5BXZ A;  5B1N A;  2DW4 A;  1UJW B;  1N36 O;  1ENV A;  1TA8 A;  1FXV A;  2ODM A;  1VQL V;  3SYC A;  5CA0 A;  5DEC A;  1GM7 A;  1MSW D;  2CAZ C;  1WN7 A;  1MA1 A;  4GUN A;  4MVO A;  3ABT A;  4I5S A;  4O4H A;  3ETD A;  4G28 B;  1SER A;  4B7E A;  1ROP A;  1Q5O A;  4R7C A;  1J95 A;  3CCV V;  4JZG A;  4QPJ A;  1QVG U;  1OCZ C;  2QTO A;  4UXN A;  4HNA A;  2X6C A;  4JI5 O;  4PA6 A;  3H9V A;  1VAR A;  1AI4 A;  4FLU A;  3K79 A;  2LW7 A;  4NXN O;  1NR1 A;  4UVB A;  4N21 A;  2YIA A;  4W4K A;  3ABL B;  4LNU A;  1SRY A;  5B3S C;  3RYI B;  1FFX A;  5CBG A;  3JAT A;  5E79 Z;  4GCZ A;  4U7N A;  1JMK C;  1PP9 H;  2Q0O C;  2KKW A;  4JI4 B;  3ZHT A;  3X2Q B;  1KP2 A;  4G27 B;  1XHX A;  3N27 A;  3K5N A;  5EC1 C;  5L3G A;  3CB2 A;  1DK1 A;  1K4D C;  3ABL C;  4AQY O;  1YI2 V;  2JJ2 G;  2BSK B;  4J42 A;  2FL4 A;  2E76 B;  2KG7 B;  3MHS C;  4F6E A;  2Z3Y A;  3HR0 A;  2JJ1 G;  2WLI B;  3C3T A;  4X1K B;  4TV9 B;  2P6J A;  5JCO A;  3C90 A;  3X2Q C;  3Q4H B;  5FNV A;  1YVW A;  2JIZ G;  2BSK A;  2MW2 B;  1OCO B;  4GKK B;  3JSL A;  2AZ2 A;  3IAY A;  4MTO A;  1GO3 F;  1W59 A;  2ZDI C;  3DSQ A;  2L35 A;  2CTQ A;  2VQE O;  1KC8 W;  3STL C;  5HFM A;  1XNR B;  3G71 V;  1SC5 B;  4RUE A;  3PN1 A;  2IH3 C;  2XUM A;  1H38 A;  1YTF D;  3ASN B;  4QNH B;  4FK5 C;  1BHA A;  1BHB A;  1AR4 A;  1NZ6 A;  3S3X A;  3OUF A;  4YIP A;  3ETQ A;  1QR9 A;  3M99 B;  5LOV B;  1WAZ A;  3VBB A;  3DGE A;  4IHJ A;  3SGI A;  4R50 A;  4TOI A;  3OTO O;  4P9P A;  1YTF B;  4PHZ A;  4I0X A;  1SQB H;  4NR1 A;  4LF8 B;  3AEI A;  2VWK A;  4JTA B;  5IE9 A;  4K8Z A;  5B66 Z;  4X65 B;  5D5P A;  3RWR D;  3ASN C;  1TGO A;  4FPP A;  4JI6 B;  4JV5 O;  1OZ0 A;  2F66 C;  3E83 A;  1S5L Z;  5KX5 A;  4CH6 A;  4WFB V;  1KMI Z;  1EZV H;  1OCC B;  2UXX A;  3H01 A;  3CYO A;  1ZSP A;  1IXB A;  4DR4 O;  2ZIO A;  1AJN A;  4DV3 O;  1QLN A;  2CTW A;  4EB6 A;  1Q86 W;  3E2E A;  4NB5 A;  5HFL A;  2RN9 A;  2QWO B;  4RWU A;  3RYF A;  1IBK O;  2QGN A;  1BMF G;  3JAS A;  4OX9 O;  4U3J B;  2YXH A;  3ZS8 C;  3ZMV A;  5BY1 A;  3APO A;  1HNZ O;  1WLE A;  2EIL B;  3JD1 A;  2EIN C;  5K1X A;  1OCC C;  4JI1 B;  4BWA A;  1S77 D;  4LFB O;  4JPR A;  2HFE C;  3BPZ A;  2N04 A;  1Y6X A;  3SPJ A;  3DXR B;  3AG3 B;  2R72 A;  3FB6 C;  3F5T A;  2Y48 A;  5ITZ A;  1Z2G A;  2YI8 A;  4DK0 A;  5KLV H;  2EIL C;  2NNU A;  4DYL A;  2YID A;  4O4I B;  1TVK A;  2LW1 A;  5H6Q A;  2LP7 A;  1XDC A;  3LSQ A;  5LYJ B;  1K33 A;  4JYA B;  4MTG A;  2C2A A;  1L8D A;  3AG3 C;  4LFC O;  1BE3 H;  1HNW B;  1D5A A;  4K35 A;  4BR6 A;  2FML A;  2W0F C;  3SPI A;  5CMU A;  1DTO A;  1GN6 A;  1NH2 D;  1TUB B;  1EN5 A;  2M7W A;  5KUK A;  2ZIN A;  4JTC B;  5GON B;  4FLZ A;  4NYK A;  4C7U A;  2ILM A;  1P7G A;  1GKF A;  4LBE C;  4FIP C;  4CH5 A;  1SS3 A;  1ZX3 A;  4DV4 O;  5E1A C;  2NN4 A;  2NLJ C;  4B3T O;  3L70 H;  3G67 A;  4WCE V;  3SR2 C;  4JI2 O;  1U97 A;  4X62 O;  4JGS A;  3CCQ V;  3M8A A;  1D2D A;  3F7V C;  4CS4 A;  5IY5 B;  5IYD O;  1BL8 A;  2OYQ A;  2ITD C;  1XMQ B;  4GZR B;  5B5E Z;  1I94 O;  1SKV A;  2ZE7 A;  1VF7 A;  3CPW U;  3K3W A;  1BGY H;  3A0B Z;  5LMN O;  3G6E V;  4PV1 B;  2HR3 A;  2GDS A;  1YZB A;  3ZN1 A;  2DYR B;  3H1J H;  1R3K C;  4UCS A;  1VQN V;  4IYI A;  2BCC H;  1HWY A;  4X66 B;  5KUM A;  4P9O A;  3FD9 A;  4TQD A;  3TET A;  5KAI Z;  5IY5 C;  1F4N A; 
#chains in the Genus database with same CATH homology
 2FYU H;  3H1I H;  5KLV H;  4D6T H;  1L0N H;  3L70 H;  1KB9 F;  3BCC H;  3L75 H;  4U3F H;  4PD4 F;  1PP9 H;  3H1L H;  1NTM H;  1PPJ H;  1BGY H;  1SQV H;  1NU1 H;  1BCC H;  3H1K H;  2A06 H;  1SQQ H;  3CX5 F;  3CXH F;  1KYO F;  2IBZ H;  3H1J H;  3L73 H;  3L72 H;  1NTZ H;  1NTK H;  2BCC H;  3TGU H;  1SQX H;  1L0L H;  1SQB H;  3L74 H;  3CWB H;  3L71 H;  1BE3 H;  1P84 F;  1SQP H;  3H1H H;  1EZV H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...