1NU0A

Structure of the double mutant (l6m; f134m, semet form) of yqgf from escherichia coli, a hypothetical protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
131
Chain Sequence
MSGTLMAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGLPLNMDGTEQPLTARARKFANRIHGRFGVEVKLHDERLSTVEAGGYRALNKGKVDSASAVIILESYMEQGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of yqgF from Escherichia coli, a hypothetical protein
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein yqgF
total genus 35
structure length 131
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03652 RuvX Holliday junction resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.140 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 YqgF/RNase H-like domain 1nu0A00
2OCEA 1IV0A 1OVQA 1NMNA 3BZKA 3BZCA 1NU0A 3PSIA 3PSFA 1VHXA
chains in the Genus database with same CATH superfamily
4CJTA 4A5AA 3SBTA 2RHKA 4BRAA 4B8AB 4H0XB 3JYTA 3OYNA 4CZGA 3SAGA 1BQMA 3AVHA 1YAGA 5C10A 4HUGA 4B3OA 5KQ8A 3SZ2A 5JMVA 2A3ZA 2DFFA 3KK1A 3HM9A 3CMAN 1VAZA 4WCEL 3K5NA 4FLZA 4CBUA 3AA4A 2P5OA 1JLCA 4DQPA 4FSVA 3VQDA 4LF5K 3C7NB 5KGXA 3NF8A 1NGDA 3VGLA 3DLKA 4JK9A 5J2PA 2IS3A 1ZYQA 5LY3A 4C8LA 2ZF5O 5H1SQ 3AVAA 5K14A 1XHXA 4GNIA 1ATSA 3H45C 1IV0A 2QKBA 4O8KA 1RDUA 1B9FA 5AQFA 5AQPA 3CJ7A 4CERA 4CJFA 3HZ6A 4HUEA 3HP9A 3VN5A 5BPLA 3I56N 1QZ6A 3THXA 1WAJA 4JHDA 1TGOA 1LV5A 4M3UA 4JKGA 3KJVA 4FLVA 3AARA 4H4OA 2A1RA 3VOVA 4DLEA 4NYFA 1JLGA 4FK0A 4MO5A 4CZEA 4LH4A 3KD1E 1U2VA 4FJHA 2HBJA 4J8FA 3C94A 4LSNA 1R0AA 4BRCA 2VCPA 4AHCA 3M5RA 3PSIA 3LZIA 3OYCA 1U47A 4YDUA 4DR3K 2OPSA 2P9SA 1LWEA 4BRNA 3Q7CA 3T3FA 2BDPA 3HTVA 2JGUA 3OHRA 4EZ9A 1BA1A 4G9ZA 2GBZA 1HYVA 3M8PA 4GV9A 4H5VA 4R79A 3Q7BA 1RBTA 4FOEA 4KHNA 3AAPA 2P5GA 1K9MO 4AHSA 4JKFA 4KH4A 3HBTA 4BR0A 3K58A 2QA4N 3NH0A 4O8UA 1S72N 2BE2A 3TAPA 4CFCA 1TK8A 3AVGA 2XHBA 1RBUA 4F3TA 3IG1A 4C8NA 1NKEA 4FWKA 2HMPA 3DMJA 4B1WB 4KB1A 5FRNA 4BY9C 1DGKN 2IVNA 1E4FT 4BRQA 5CR4A 5EY4A 1HNIA 3QEWA 1C0FA 3GDQA 5KPTA 1Y64A 1O13A 1BWFO 4B9TA 4B9UA 3CCQN 4OVLA 3ZLJA 2RPIA 4O5FA 1OVQA 3DOKA 3VERA 3MWTA 1XI1A 4DTUA 4ILHA 3T19A 2W6LA 3ULDA 3VF2A 1KCFA 4JKAA 2V7ZA 2QKKA 3SAFA 2OA8A 3LP0A 3UIQA 4B3RK 2BH1A 3UKUB 3LP3A 1S6PA 1ZC6A 1M90O 2ASMA 5BRFA 2VG7A 3EZ5A 1IKXA 4B9QA 3R6MA 4DTXA 4OLAA 3GL1A 2ZD1A 4FLWA 1IG8A 1S1XA 1NM1A 4O0JA 4OPJA 1HJOA 4JV5K 4L8RB 1RCHA 4JI4K 5ADXA 5ADXH 3L3UA 2F9WA 3K5LA 1S3XA 4XIUA 1ITGA 4ELUA 3KVGA 4JI1K 5FPMA 3OYLA 1LW0A 3WNHA 1L3VA 3MAQA 4JRPA 2QTDA 3QMLA 5C15A 3HPHA 3R8EA 2DPNA 2P9UB 3E1YA 1BIZA 4KHWA 4MQ3A 2WOMA 2X6NA 3ZT1A 3D6RA 5AZIB 4CF2A 1IBLK 1TYQA 3TAGA 3LANA 4G1QA 2YHXA 2F7TA 1V4SA 3KLEA 1RT6A 1VQ6N 1NMNA 4CJPA 3H1VX 4UQGA 1GLCG 3CXCM 3U8XA 1J6ZA 3QBXA 3HOTA 4HCCA 5M1OA 2WC9A 3AVJA 5HRRA 3CYMA 3LAMA 1YJWN 3VF6A 1D5AA 1UOCA 4I2QA 5CZ2A 4BWJA 5M1PA 4CK2A 4RW9A 1DTQA 1N32K 1VQ9N 4KH6A 3UKRB 4CZLA 4WF9L 4B3TK 3ID8A 1ASWA 3OVNA 3BF1A 1RT1A 2QK9A 2GEMA 4DTPA 4DQQA 1KAXA 4BRLA 3KKSA 4U67L 3AVMA 2EWSA 1X9JA 4JK8A 3ZSXA 2VYPA 4C23A 4AHTA 3I0RA 1ASVA 3RVCA 2RKIA 4FJIA 3QFPA 4GY2B 3ITHA 4BC3A 1NU0A 4E89A 3HP6A 1HKGA 5AQYA 1RBSA 1JLFA 1HNVA 4BVOA 4DSIA 3ULEA 2I7PA 2ZM6K 1D9FA 3DLBA 1JKHA 1U6ZA 2GWJA 3CCVN 3F2KA 3VEYA 4A57A 1K73O 3HPOA 1HNXK 3EEQA 5AQXA 3DRSA 5AQGA 1OVYA 5FDLA 3WXMB 4BG9A 1RDBA 4YFUA 4KREA 1QQNA 1XNRK 3EO3A 2UUBK 3MEDA 3P1GA 1Q9YA 2OPQA 3AVNA 1GOAA 1KLNA 3CCUN 4DR1K 3D2EB 2KFNA 4Z4IA 4JKEA 4DV6K 3VMFB 3HI0A 3LWLA 2HHUA 1S9GA 2QWQA 2CH6A 1SV5A 4FWLA 4JEPA 4CGHA 3PX6A 4FZXC 2UXCK 3AVFA 3OJSA 3DXMB 3I0SA 4FXDA 4CD1A 2FSJA 2Q97A 4H0YB 4IG0A 4OX9K 3NVMA 4FK4A 3DOLA 2BGGA 1W0HA 2FXUA 2WFBA 3DJCA 3G6EN 1YUWA 4CIGA 4H5TA 4CHQA 1EO1A 3UE5A 4BDZA 1QSLA 4KPYA 2P9NB 3J7AP 3HXMA 2RF2A 1ILYA 1SZ2A 2QWNA 3OW2M 3V6DA 4CHZA 5GIPA 1HQUA 3ZYYX 3G4SN 1BU6O 2A6AA 3QNNA 2G8HA 3QETA 2XY7A 2HHQA 4JS4A 3V4IA 2E2QA 4YHHK 1BL3A 4BE1A 3AO5A 3TU5A 2RE2A 2QXLA 2HBMA 5C0YA 1YVUA 4RW8A 3EZWA 3MXIA 2YHWA 3ZSOA 1YF5L 2WONA 2CGLA 3TAQA 5AQTA 3WXLA 4FWOA 5FLXO 3M8SA 3PX0A 1HNZK 4JI8K 4JD2A 1XNQK 2W41A 2HVIA 3LZJA 2KLAA 2A42A 3M8RA 1MWKA 4X66K 1S22A 1YHQN 4KI6A 3TSQA 5HLFA 4DFPA 4OKKA 1VSLA 5AZJB 2PYJA 2E88A 4YNQA 5SZTA 4CJQA 2IGIA 4Y0WA 3S3MA 1K8AO 4FJGA 3PIPL 2ITMA 4A59A 4BGAA 3I55N 4BRFA 4OGEA 2NRWA 1QQOA 3EE8A 1VSMA 2P9KA 1W9HA 2YKMA 1WSFA 3SJJA 1VSEA 1WSHA 4IOCL 1BQNA 1VRUA 3T7ZA 4KBOA 4PKHA 2E2NA 3F9MA 2NZTA 3L2UA 2FC0A 4IZ9A 1GLJO 2P9LB 3NF7A 1VQMN 5BN9A 5LL6Z 4O0IA 2GUPA 4CHNA 1Y97A 1VQ8N 1JLEA 4B8CA 1JLBA 1Q81O 3H1QA 3H6EA 1VK0A 2HB5A 2G8FA 2HF4A 2IOCA 3MXMA 2ATQA 2QWOA 1NLVA 1P8ZA 3CJAA 2P9PA 1RDWX 4I6MA 3O1WA 3OYHA 3OS0A 1L3SA 4B1UB 3B6PA 1I3AA 4K41A 1GOBA 2GUIA 1MWMA 1FJGK 3O80A 3ZT2A 4N56A 2XY5A 4FJNA 3ZCMA 3THVA 3KZBA 1Q8IA 1NGHA 4W5RA 2A1SA 4GKKK 2W42A 4Y1DA 2D0OA 4X62K 4NLCA 4F9OA 2HHXA 3SMSA 4O55A 3ZT3A 4MDAA 1NJIO 4IO8A 4NO7A 4JLHA 4HVJA 5HL7L 3NH1A 3MX5A 4W5TA 4X64K 1X9WA 3K57A 1UA1A 2JLEA 3ID6A 4JYAK 2WTUA 1E4GT 2VQEK 5J1EA 3BP8A 2QWPA 3KK7A 3CD6N 4FM0A 4NCBA 5JVGL 3L4QA 1KXPA 1NKCA 1T8EA 4U7BA 4C8OA 4CD3A 3O6WA 3DYAA 2QWRA 4CJEA 1NGIA 3IUCA 4CFAA 3KTQA 5DK5A 3QERA 2O8BA 4N47A 5JLHA 3N4PA 2Z1IA 1Q82O 1RT7A 4CEBA 5BR8K 4DU1A 4DUYK 5T7BA 1HX1A 3T1HK 5GAHP 2J4RA 4GW6A 3RMCA 2KHOA 5BRHA 4Z4CA 3O9QA 2E2PA 4KHSA 4CGDA 3C6UA 3DXKA 4NXMK 4CJRA 1SL0A 3ZEUA 1NK0A 3K9KA 1K6YA 2GX9A 1VSJA 4FWRA 4DFMA 4FZYA 2HMIA 3OYBA 2HOEA 2O4GA 3O08A 1U04A 3VQEA 1RT2A 1J5OA 5J2QA 4IBNA 2D0BA 5LJWA 3BF3A 4K8XA 4C8MA 1TK5A 3AO2A 5I3UA 1WB9A 5EU7A 3FE1A 1NGCA 1ZBIA 2YNHA 3TSPA 4EIAA 3WEEA 4Z4EA 1D9DA 4B1VA 2O8EB 3V9WA 3AO3A 4CK3A 3R3LA 5GAEP 3VEVA 1JLAA 4AM6A 3OYKA 4M42A 2RN2A 2E6MA 4YOWA 1GLAG 1BCMA 4CZHA 3L3VA 3QLHA 4K25A 4PKGA 4UY8O 3U9DA 2W6KA 4CBXA 5MLCQ 2GV9A 4F8RA 5CYQA 1SS6A 1TVRA 1GLDG 1NK6A 4B9SA 5D3GA 3SBGA 4DR6K 1DKGD 3H08A 3BGRA 3A5OC 1JJ2M 1XQSC 4DV3K 4FJ7A 1U4BA 1JL1A 3K2PA 4DF8A 1G15A 5LJVA 4IWVA 3D7EO 1KFSA 1S9EA 1JXBA 2HW3A 5BPMA 3SPZA 3CFOA 3BZCA 3ISNC 3VGMA 4EZ6A 3L2RA 3C6HA 2I7NA 1UAXA 1TL3A 3A2FA 2GELA 4OJRA 3VA3A 1NJYA 1BUPA 2EX3A 3VQQA 4A61A 3NVKA 2A41A 2HHVA 4DSJA 2F8SA 5KI6A 2E4LA 3M8QA 4B9VA 4QOZB 1LWCA 1NGGA 2FBYA 3IFRA 4EP4A 1Z25A 3W3DA 3SQ2A 3SUPA 3SAHA 4ELVA 1VSDA 2VGMA 1LAVA 4IKFA 3AV9A 4WE1A 1K8KA 3O3HA 4CECA 1EETA 1JCFA 1U45A 4CFBA 3L2VA 3THYA 3THWB 5GIOA 3ZT4A 3RSEB 3MN6A 4F4KA 1BIUA 1F21A 3KK3A 3OBYA 5BN8A 3VA0A 4RG8A 1NK8A 1WBBA 1HUXA 4FM2A 4Z4GA 3CFPA 2G8VA 4JNEA 2VG6A 4DMNA 1W7AA 3AY9A 2YNFA 1B92A 4CE9A 3DWLA 1ZBFA 2HSTA 2ZGZA 3E9LA 3P31A 3M1FA 4JI3K 3DLHA 4DTOA 1T3VA 3CC2N 3JSMA 4GV3A 2G8WA 4FWQA 4IEIA 4IFYA 3EY1A 1V4TA 4CJLA 4EAHD 3RR8A 1WLJA 3AVLA 1CZAN 4KV8A 1KVCA 4H0PA 2A5XA 4JI7K 1KVAA 4DR7K 2UYTA 1HQEA 3SV3A 3K9JA 5M1NA 1IJJA 2CH5A 4BREA 1WBDA 1RILA 3VQ6A 4DSLA 3V81A 5AFUH 3TR8A 4NCGA 4FW2A 4Q5VA 5AQIA 1IBKK 2NLXA 3CC4N 2OTLN 5HROA 3AGRA 1T44A 3F9KA 4J2BA 1DTTA 1OH6A 3HSTB 1DT9A 1Q9XA 3AVBA 2P9IA 1IG9A 4OLBA 3D2EA 5F2RA 5B8HA 3C6TA 4JKCA 3S3OA 1XC3A 3NBPA 2XY6A 1TK0A 3CQ8A 3IKMA 3PY8A 4AH9A 1O1WA 1S1UA 4FJLA 3CCLN 2V51B 4IO9L 4B9NA 3SLCA 4FYDA 4A5BA 3OS1A 4LD0A 2FF3B 4BDPA 4PUOA 4BR5A 3TAFA 2Y1JA 3QESA 4NYNA 1HMVA 5BR9A 1ATRA 3VESA 4FJMA 3NF9A 1HYZA 4B08A 5E41A 5DMRA 3LDSA 3TTDA 4BR7A 3P4IA 3U4LA 3VTHA 1HNWK 3OBWA 5C42A 4DV5K 2E8AA 1XUPO 2ETJA 2E5LK 3V9UA 5AQOA 3CF5L 4HTUA 3C6AA 1QSYA 3BEXA 4KHYA 2X6SA 4CZKA 4BRPA 2O8CA 3ZSRA 2IC3A 3SCXA 3RRHA 4H4MA 3VETA 1WSEA 1XMQK 3VENA 2YHBA 2Z1GA 3FGUA 3LPUA 1ZBUA 3ZX0A 3PLAA 3G25A 3GG4A 5AQRA 1ZBLA 4NXNK 1XC9A 1SQKA 3RTVA 5BREA 3HK2A 4RWTA 2QEXN 3OA9A 3RR7A 1X9MA 3D2FB 1QS4A 1QTMA 1NJZA 2NRRA 1Q18A 1SL1A 3DI6A 5HRNA 1N6QA 1YI2N 2DFEA 4LF8K 5I42A 5AZJA 3PIOL 2QWLA 4CVNE 1QHAA 3LP2A 3O4WA 5F1XA 3NCIA 2PAVA 1FKOA 4N5SA 4WFBL 4QS7A 3A5NC 2P9KB 3SUNA 1NNEA 3VQ5A 3MEEA 4EHUA 3ASMA 2XO7A 3VQ8A 5AQKA 5JVHL 3HJFA 5HOOA 3DLEA 3WT0A 3ZSQA 1BI4A 3L4IA 1J53A 3O8MA 3RMDA 3ZSYA 3LL3A 4DFKA 4ID1A 3MMVA 3VPZA 2D0PA 3FZLA 4ICLA 3CCEN 3QBWA 1QVGM 4DU3A 4M3WA 1BGXT 1ZBSA 2X74A 2P9PB 5JLFA 1VQLN 1JLQA 4EP5A 4PHTX 5AFUA 4V19S 4CJ3A 3A0IX 1S1TA 4M63C 3OYEA 4Y1CA 4HHTA 3KLHA 4MLEA 3U6FA 1RTJA 5LMNK 2HBLA 1J5EK 3MX2A 4OPHA 2GTDA 4LF6K 3QINA 1ASUA 3OJUA 1T6DA 3DLGA 2P51A 1HPMA 3LAKA 4KO0A 4FCYA 1KTQA 2CGJA 2D0AA 2YHAA 4OPAA 1A5VA 4CK1A 3LDPA 1TUUA 4FW1A 3CMEN 4BVPA 3DM2A 1IO2A 3VEZA 2QXFA 3CM6A 3SJHA 2Q0UA 1EWRA 5M1QA 3O9RA 4PA1A 3SI6A 1G99A 4ID5A 2BANA 1C1CA 1TAQA 1JXEA 1C6VA 3CJBA 1CXUA 1YITN 3IS9A 4HTLA 5AQQA 2AJQA 3MK6A 1QVFM 4DS5A 4K43A 4CEFA 4CF8A 3V1QA 3LWMA 4FWSA 4CEQA 2I5JA 4QAGA 3OYIA 1NGEA 3LM9A 1KVBA 5M1KA 1KAZA 3HOSA 2HF3A 3V1OA 3EKUA 3OYFA 2VQFK 4KHPK 3JXUA 1H1VA 4DQIA 4XEIA 4F2SA 5GADP 4AHVA 3VQ9A 1BA0A 5EOYA 3O1BA 1GLBG 1A5XA 2JWKA 4O5BA 3QEPA 2HBKA 2R7YA 2F9TA 2VWJA 3E66A 1IBMK 3RWUA 4BC4A 3NGZA 4E7LA 2NRVA 3WXIA 4DQRA 4CBWA 3CCRN 3U3YA 1CLQA 2Q36A 5CHIA 4H5WA 1IKYA 3MDQA 3ZETA 4QS8A 3VGKA 5AR0A 3QB0A 4FJ5A 3RMBA 4LFCK 2FBXA 3CM5A 2FSNA 4WQ5C 2QWMA 1MU2A 4JI0K 4M3TA 1BG3A 4DQ8A 1J54A 1QHTA 1FKPA 2HNDA 4CF1A 2EHGA 4K8ZA 4H0VB 1T05A 1OH8A 5IWAK 4DQSA 3VF4A 3HVRA 3H3NO 3ZSWA 1W97L 3P38A 3THXB 4JKGB 4ZTJA 4KH5A 4YOYA 3FZFA 4FM1A 4JRQA 1YJ9N 4QS9A 4JK7A 1WSGA 3QIOA 1WSIA 2CGKA 3VEOA 4C8KA 1IKVA 2VG5A 3KLIA 1FK9A 5M1FA 4TSXA 3QDKA 3S41A 5C2FA 3CPWM 2NRXA 4BE2A 3GOIA 2XY8A 1GLEG 4IFVA 4KHUA 3D0PA 1XWLA 3HRGA 3AA2A 3ULEB 3TI0A 2B6AA 3GBTA 3WNGA 3LDOA 2O8FB 3QICA 3G10A 4CGIA 1MDUB 3TANA 5JS2A 3J81O 4ZTFA 3G71N 3P83D 4JKHA 2KZZA 1ESVA 2Z1HA 3KD5E 3LPTA 4CEAA 1QE1A 3MN9A 3P39A 2XRIA 3OYDA 4NCAA 1C1BA 4PL7A 5AQMA 3J80O 3KWGA 4CI6A 1KRPA 4LFBK 5ELZA 3K0SA 1YJNN 3CQYA 5EVZA 4CJVA 4FJ9A 4C1NI 3A5MC 1WSJA 1NJXA 4M7YA 1BCOA 5C25A 3DRPA 4QCLA 4FOIA 1RT5A 4DSEA 4CZMA 3TARA 1NGAA 1WN7A 1I94K 1VQ4N 5GINA 3S3NA 4CESA 3A8YA 4ZHRA 3KKRA 3O4NA 4BDYA 1KLMA 5CY4A 1KD1O 1D4XA 1VSIA 2YV0X 4E19A 3TWHA 3W0LA 4XH5A 1FW6A 3SYZA 1TUYA 4JI6K 4HCBA 4MFBA 3CJCA 1VSKA 3MCPA 4RW6A 3H3OB 3ZX3A 2H3GX 2IVPA 2QM1A 3FFIA 4FPAA 3HO1A 1X1PA 1SAZA 3TSUA 2PZSA 4DWIA 3UKUA 2KQ2A 1TKZA 3FFKB 2ZJRL 2IVOA 4M3XA 2YI1A 2YKNA 4WQ5A 4GVMA 1BISA 5AQVA 1T7PA 4LH5A 3TAEA 4B9LA 3KLGA 2HHWA 4ILGB 1NG9A 4W5OA 3BY5A 1BHLA 4CFDA 4CZIA 1BDGA 5EXWA 1S5JA 2E1YA 1UA0A 4I9QA 3NAEA 1U48A 1MA9B 4M7XA 1P90A 2AP1A 4FPBA 4X65K 4JD2B 3J7ZO 4H5NA 5FPEA 3KLFA 5AQUA 2BUPA 3C95A 4M41A 3HT3A 1X9SA 3AVKA 3ZSVA 2FBVA 3A5LC 1L3UA 4BQZA 1RDCA 2Q3SA 4DV7K 4PQUA 4KB0A 2G8IA 4FO0A 4AHRA 2P9UA 4FJKA 2G8UA 3M6GA 1Q86O 4LF9K 3EKSA 1RBRA 1NK4A 2Q2RA 4O4GA 4J2EA 4BACA 5KTQA 2PFUA 1Z26A 4KAZA 4DV1K 4E7KA 3SK3A 3HPGA 3KK2A 2V7YA 4WQ4A 1SKRA 3MCAB 4M3YA 4AQYK 2Z1JA 3CQXA 4BE0A 3SQ4A 2P9LA 3E9OA 1HLUA 3IAYA 3QEVA 2O8DB 2E6LA 2Q0RA 1GLFO 1NKBA 4RCHA 1WUAA 1HRHA 3DRRA 3TTCA 3VQ4A 3I8DA 1XMOK 4JKBA 4E7JA 1CZBA 4BG8A 3O9TA 1GOCA 1RFQA 5KRTA 5KQDA 2X78A 4LC9B 4Z0UA 5DM6L 2D1KA 4CHPA 4CEZA 3WQUA 4ISGA 4XH1A 3NH2A 1EP4A 2GWKA 3IMXA 5KPZA 4JAXA 3C65A 4W5QA 1RBVA 2YJFA 4BC2A 2HHSA 2OPPA 1NGBA 4WFNL 2NNWA 1ZBHA 5F0XA 1NK5A 4A2BA 2KZMA 4CHOA 1YVNA 4JN4A 3VQPA 1VQPN 4PWDA 2O8CB 3ATVA 3CJ1A 4Q0BA 3DAWA 4IJAA 3T69A 3L8BA 3MECA 4IEEA 4WQ4C 4CJKA 3EYZA 4I9LA 3WXKA 2UUAK 1NGFA 1RNHA 5AQNA 5BRDA 3NDKA 4BGBA 4DSKA 4IG3A 1TV6A 1EX4A 1JCGA 3E01A 4DTSA 1NOZA 1NK7A 4KTQA 2KTQA 4XH4A 3IRXA 4Z4FA 4DFJA 1X3MA 5AQZA 2DTUA 5GAGP 5J2NA 3K5MA 3J7YP 4LF7K 1KAYA 1D8YA 1HKBA 5KRSA 1IH7A 3FZKA 5LMUK 3C0BA 1N33K 4BR4A 5TKWA 1VRTA 2FSKA 3EE9A 4K0KK 4CGFA 1BO5O 5HRSA 3CETA 2P1JA 3I33A 2HNYA 3D45A 3ZEUB 3QEXA 1S1VA 3NMUA 4BR9A 1SL2A 4FVMA 4H0TB 5AQHA 4PY5A 4DV0K 1VQON 4J2AA 3HVTA 3DXMA 3SNNA 4R5PA 4GMJB 4BC5A 3O9SA 4IDKA 1QQCA 3CFRA 3LP1A 4ISEA 3PO4A 5JICA 2WBNA 1N34K 3V9ZA 4MDBA 2P9NA 3M3ZA 3CCJN 3C7NA 3SMPA 1EXQA 2A40A 4DV4K 4B3SK 3AVIA 3RMAA 1N36K 3L2WA 1DLOA 4CF0A 3OYAA 2OPRA 3CJ9A 2B4JA 1VSFA 2O8EA 3P5JA 5E26A 2ZE2A 3FZHA 1C0GA 4OKEA 2QI2A 1FXXA 2PBDA 3WQTA 4AF1A 1M1KO 4IOAL 2ZQBA 3LDQA 3FLCO 3O9UA 1HJRA 1SKWA 4E7IA 2ZJPL 4JHDB 1RTIA 1SUQA 3CHWA 3FZMA 4KFBA 3VQCA 4H03B 1WOQA 2HHHK 1HKCA 4B1ZA 4CJ5A 4BRGA 1KQSM 1QZ5A 1U2VB 3AA3A 3ZT0A 2D4WA 4A2AA 3ZSZA 4JI5K 2DFHA 3HM8A 1N8RO 3JAMO 1JL2A 4OGCA 5KPRA 4NLBA 1J9AA 3R1XA 2P9SB 4FWMA 3NE6A 4BROA 2D0CA 4DB3A 5IT9O 3RRGA 4N76A 3IDHA 3WXJA 4PL8A 4E0DA 3NHGA 4AHUA 2PY5A 2NUBA 4HWIA 1IKWA 1VQKN 1L5UA 2F4VK 1C0TA 3I8BA 2Y1IA 1BOTO 4M3ZA 3SUOA 1NBWA 4ILJA 3ALYA 4YOXA 4DSFA 1A5WA 2UXBK 2UU9K 4RW4A 5AQJA 1TKDA 4B1XB 3F5TA 2IIRA 4CJUA 1LWFA 4LF4K 2B5JA 4AILC 4B3MK 4RW7A 2OZMA 4DR2K 2W40A 3SV4A 3SQ1A 4I6MB 4DHYA 4KI4A 3CI5A 2PYLA 3O3GA 1C1AA 3QFUA 2DY4A 4E1JA 3ZETB 4HUFA 4PKIA 3GE1A 4BRDA 4O44A 3O4QA 4I2PA 3THWA 4F2RA 4IJNA 5TKYA 3HYFA 3NGYA 2KKZA 4MO4A 1KC8O 2ASOA 1T6CA 2UUCK 3PUFA 3OYJA 1E3MA 4YOTA 3KWIA 3AO4A 1KSPA 4WYBA 2E2OA 4E1NA 3BDPA 3QO9A 5J2MA 5KGWA 3OYGA 4CF9A 3MWPA 3QEIA 1NMDA 1TL1A 5AJ3K 4FLYA 3KHYA 1EWQA 1NWKA 5HRPA 3R9PA 1U49A 3L0QA 3U3GA 2YNIA 1REVA 3SUQA 2VWBA 2ZWHA 4DUZK 1WNSA 3MXJA 3G0ZA 3FR0A 3CCMN 1QQMA 2Q31A 1RTHA 5CE3A 2OANA 1SKSA 3N4QA 4M3RA 3EL2A 4Z4HA 4CJWA 3ENBA 3K5OA 2O8BB 1WAFA 4CEEA 5CYMA 4K42A 3VQAA 3B6OA 3VEWA 4DU4A 1C0MA 4GKJK 1C0UA 2OYQA 2HNZA 2O8FA 4FWPA 4LFAK 5E84A 5EX5A 3K59A 5FRMA 1VQNN 4KTWA 1YTUA 4DTNA 3LDLA 2F96A 1DEJA 1VHXA 5AZIA 3DXKB 4CJSA 3DLLL 1RDDA 4B1YB 3BZKA 1TYQB 1YT3A 3ENHA 1GLLO 2YNGA 1I39A 2WUSA 4GV6A 2P9IB 4CIFA 4YOUA 3AA5X 3VEXA 1L3TA 2ITGA 1ZXOA 3CIPA 4FL9A 4LSLA 2OCEA 5CZ1A 2UXDK 5I9EB 2YX6A 2NRZA 3TAMA 3TPQA 5FPDA 4DLGA 1LW2A 3KIOA 2F8TA 3B8AX 3WNEA 4YOVA 4BRHA 4W5NA 5C2DA 4DV2K 4CEDA 2E20A 3TTFA 4DTJA 4I7FA 3WEEB 2NRTA 4FK2A 4KRFA 2KW4A 3U9ZA 3TABA 1RDAA 3UKRA 1VQ7N 2QW9A 2IAJA 1LAWA 4FJ8A 2IDOA 3H46O 3OTOK 3SQ0A 3O3FA 4IDHA 4AM7A 3NGIA 4IFEA 3OYMA 1S6QA 3V9SA 2FF6A 4CZJA 4FLTA 1N5YA 1CZ9A 3AO1A 4L3QA 4BRKA 3HL8A 4KHQA 1HYSA 3O5BA 2AA4A 1RGIA 4CHYA 1VQ5N 3NFAA 3PO5A 4JI2K 1OH5A 1UWBA 4YY3K 3QNOA 3HSCA 1Z05A 2LSNA 5AQWA 4F3OA 1X3NA 4BQLA 4Z94A 4DG1A 2FLOA 4CEOA 1VSHA 1Z6RA 3J8AA 4E3SA 3D2FA 4YDUC 3L2QA 2FBTA 3WUHA 4C1NK 3MN5A 2OZSA 5AQLA 3VQ7A 1TKXA 1EKEA 1NK9A 3LM2A 3ZX2A 2KFZA 4IXCA 4H8KA 5C24A 4EHTA 4CCHA 2YCHA 3CPEA 1TKTA 4KKOA 2ZGYA 4N41A 4RTFD 1RT4A 1KFDA 3QIPA 5A2QO 1QSSA 4KTZA 3MEGA 2D5RA 2O4IA 3CC7N 3JS6A 4M45A 3SPYA 4DKWA 1BI4B 4DF4A 4BR2A 1T03A 3T1AA 1K8KB 3CG7A 4MLHA 5FROA 2HHTA 2O8DA 4GVEA 5DM7L 4JS5A 4WFAL 4ELTA 2ASPA 3THYB 3AAQA 5HBMA 3L6QA 3PX4A 1Q7YO 1YTAA 3OS2A 3RSEA 2ZJQL 1OH7A 1B9DA 4FJJA 4FZZA 4NB4A 3EN9A 4FLUA 1JCEA 4H5RA 3OY9A 1HR0K 4FVUA 4CW7B 2Q1NA 4CGJA 4CIEA 1R59O 4CJ4A 1TAUA 4CJ7A 3PV8A 1W2BM 1NJWA 3WNFA 4E1MA 1OKJA 4CZFA 4BRIA 2VWKA 2V52B 1RTDA 1XHZA 4CGGA 4J2DA 3S9HA 3VTIA 4DR5K 3PSFA 5FPNA 2BTFA 4BRMA 4JKDA 1RT3A 4DCHA 4FJXA 4E7HA 2JWLA 2OTJN 3F73A 1CXQA 2YHYA 2VGNA 1YXQA 3ENOA 3CERA 5AQSA 2E1ZA 3V9XA 2G8KA 1LOTB 4H0OA 2HVHA 1HPZA 1NGJA 4EFHA 2NRHA 4YORA 5JS1A 4ISFA 3VQBA 4DTRA 3CCSN 4OO1J 3UB5A 3MN7A 4FWNA 2YJEA 1NOYA 4FLXA 1YIJN 3V1RA 5C12A 3AGKA 4OKJA 4B9MA 4BWMA 1S1WA 4OPKA 1EQYA 4DR4K 5HP1A 3NF6A 3T1YK 3E9PA 3ATUA 3LDNA 4DS4A 3LALA 4IOXA 4A62A 5SWMA 1ATNA 5BPNA 3AVCA 1LCUA 4LY7A 4DTMA 3DLRA 3BUZB
chains in the Genus database with same CATH topology
2OCEA 1IV0A 1OVQA 1NMNA 3BZKA 3BZCA 1NU0A 3PSIA 3PSFA 1VHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCE A;  1IV0 A;  1OVQ A;  1NMN A;  3BZK A;  3BZC A;  1NU0 A;  3PSI A;  3PSF A;  1VHX A; 
#chains in the Genus database with same CATH topology
 4CJT A;  4A5A A;  3SBT A;  2RHK A;  4BRA A;  4B8A B;  4H0X B;  3JYT A;  3OYN A;  4CZG A;  3SAG A;  1BQM A;  3AVH A;  1YAG A;  5C10 A;  4HUG A;  4B3O A;  5KQ8 A;  3SZ2 A;  5JMV A;  2A3Z A;  2DFF A;  3KK1 A;  3HM9 A;  3CMA N;  1VAZ A;  4WCE L;  3K5N A;  4FLZ A;  4CBU A;  3AA4 A;  2P5O A;  1JLC A;  4DQP A;  4FSV A;  3VQD A;  4LF5 K;  3C7N B;  5KGX A;  3NF8 A;  1NGD A;  3VGL A;  3DLK A;  4JK9 A;  5J2P A;  2IS3 A;  1ZYQ A;  5LY3 A;  4C8L A;  2ZF5 O;  5H1S Q;  3AVA A;  5K14 A;  1XHX A;  4GNI A;  1ATS A;  3H45 C;  1IV0 A;  2QKB A;  4O8K A;  1RDU A;  1B9F A;  5AQF A;  5AQP A;  3CJ7 A;  4CER A;  4CJF A;  3HZ6 A;  4HUE A;  3HP9 A;  3VN5 A;  5BPL A;  3I56 N;  1QZ6 A;  3THX A;  1WAJ A;  4JHD A;  1TGO A;  1LV5 A;  4M3U A;  4JKG A;  3KJV A;  4FLV A;  3AAR A;  4H4O A;  2A1R A;  3VOV A;  4DLE A;  4NYF A;  1JLG A;  4FK0 A;  4MO5 A;  4CZE A;  4LH4 A;  3KD1 E;  1U2V A;  4FJH A;  2HBJ A;  4J8F A;  3C94 A;  4LSN A;  1R0A A;  4BRC A;  2VCP A;  4AHC A;  3M5R A;  3PSI A;  3LZI A;  3OYC A;  1U47 A;  4YDU A;  4DR3 K;  2OPS A;  2P9S A;  1LWE A;  4BRN A;  3Q7C A;  3T3F A;  2BDP A;  3HTV A;  2JGU A;  3OHR A;  4EZ9 A;  1BA1 A;  4G9Z A;  2GBZ A;  1HYV A;  3M8P A;  4GV9 A;  4H5V A;  4R79 A;  3Q7B A;  1RBT A;  4FOE A;  4KHN A;  3AAP A;  2P5G A;  1K9M O;  4AHS A;  4JKF A;  4KH4 A;  3HBT A;  4BR0 A;  3K58 A;  2QA4 N;  3NH0 A;  4O8U A;  1S72 N;  2BE2 A;  3TAP A;  4CFC A;  1TK8 A;  3AVG A;  2XHB A;  1RBU A;  4F3T A;  3IG1 A;  4C8N A;  1NKE A;  4FWK A;  2HMP A;  3DMJ A;  4B1W B;  4KB1 A;  5FRN A;  4BY9 C;  1DGK N;  2IVN A;  1E4F T;  4BRQ A;  5CR4 A;  5EY4 A;  1HNI A;  3QEW A;  1C0F A;  3GDQ A;  5KPT A;  1Y64 A;  1O13 A;  1BWF O;  4B9T A;  4B9U A;  3CCQ N;  4OVL A;  3ZLJ A;  2RPI A;  4O5F A;  1OVQ A;  3DOK A;  3VER A;  3MWT A;  1XI1 A;  4DTU A;  4ILH A;  3T19 A;  2W6L A;  3ULD A;  3VF2 A;  1KCF A;  4JKA A;  2V7Z A;  2QKK A;  3SAF A;  2OA8 A;  3LP0 A;  3UIQ A;  4B3R K;  2BH1 A;  3UKU B;  3LP3 A;  1S6P A;  1ZC6 A;  1M90 O;  2ASM A;  5BRF A;  2VG7 A;  3EZ5 A;  1IKX A;  4B9Q A;  3R6M A;  4DTX A;  4OLA A;  3GL1 A;  2ZD1 A;  4FLW A;  1IG8 A;  1S1X A;  1NM1 A;  4O0J A;  4OPJ A;  1HJO A;  4JV5 K;  4L8R B;  1RCH A;  4JI4 K;  5ADX A;  5ADX H;  3L3U A;  2F9W A;  3K5L A;  1S3X A;  4XIU A;  1ITG A;  4ELU A;  3KVG A;  4JI1 K;  5FPM A;  3OYL A;  1LW0 A;  3WNH A;  1L3V A;  3MAQ A;  4JRP A;  2QTD A;  3QML A;  5C15 A;  3HPH A;  3R8E A;  2DPN A;  2P9U B;  3E1Y A;  1BIZ A;  4KHW A;  4MQ3 A;  2WOM A;  2X6N A;  3ZT1 A;  3D6R A;  5AZI B;  4CF2 A;  1IBL K;  1TYQ A;  3TAG A;  3LAN A;  4G1Q A;  2YHX A;  2F7T A;  1V4S A;  3KLE A;  1RT6 A;  1VQ6 N;  1NMN A;  4CJP A;  3H1V X;  4UQG A;  1GLC G;  3CXC M;  3U8X A;  1J6Z A;  3QBX A;  3HOT A;  4HCC A;  5M1O A;  2WC9 A;  3AVJ A;  5HRR A;  3CYM A;  3LAM A;  1YJW N;  3VF6 A;  1D5A A;  1UOC A;  4I2Q A;  5CZ2 A;  4BWJ A;  5M1P A;  4CK2 A;  4RW9 A;  1DTQ A;  1N32 K;  1VQ9 N;  4KH6 A;  3UKR B;  4CZL A;  4WF9 L;  4B3T K;  3ID8 A;  1ASW A;  3OVN A;  3BF1 A;  1RT1 A;  2QK9 A;  2GEM A;  4DTP A;  4DQQ A;  1KAX A;  4BRL A;  3KKS A;  4U67 L;  3AVM A;  2EWS A;  1X9J A;  4JK8 A;  3ZSX A;  2VYP A;  4C23 A;  4AHT A;  3I0R A;  1ASV A;  3RVC A;  2RKI A;  4FJI A;  3QFP A;  4GY2 B;  3ITH A;  4BC3 A;  1NU0 A;  4E89 A;  3HP6 A;  1HKG A;  5AQY A;  1RBS A;  1JLF A;  1HNV A;  4BVO A;  4DSI A;  3ULE A;  2I7P A;  2ZM6 K;  1D9F A;  3DLB A;  1JKH A;  1U6Z A;  2GWJ A;  3CCV N;  3F2K A;  3VEY A;  4A57 A;  1K73 O;  3HPO A;  1HNX K;  3EEQ A;  5AQX A;  3DRS A;  5AQG A;  1OVY A;  5FDL A;  3WXM B;  4BG9 A;  1RDB A;  4YFU A;  4KRE A;  1QQN A;  1XNR K;  3EO3 A;  2UUB K;  3MED A;  3P1G A;  1Q9Y A;  2OPQ A;  3AVN A;  1GOA A;  1KLN A;  3CCU N;  4DR1 K;  3D2E B;  2KFN A;  4Z4I A;  4JKE A;  4DV6 K;  3VMF B;  3HI0 A;  3LWL A;  2HHU A;  1S9G A;  2QWQ A;  2CH6 A;  1SV5 A;  4FWL A;  4JEP A;  4CGH A;  3PX6 A;  4FZX C;  2UXC K;  3AVF A;  3OJS A;  3DXM B;  3I0S A;  4FXD A;  4CD1 A;  2FSJ A;  2Q97 A;  4H0Y B;  4IG0 A;  4OX9 K;  3NVM A;  4FK4 A;  3DOL A;  2BGG A;  1W0H A;  2FXU A;  2WFB A;  3DJC A;  3G6E N;  1YUW A;  4CIG A;  4H5T A;  4CHQ A;  1EO1 A;  3UE5 A;  4BDZ A;  1QSL A;  4KPY A;  2P9N B;  3J7A P;  3HXM A;  2RF2 A;  1ILY A;  1SZ2 A;  2QWN A;  3OW2 M;  3V6D A;  4CHZ A;  5GIP A;  1HQU A;  3ZYY X;  3G4S N;  1BU6 O;  2A6A A;  3QNN A;  2G8H A;  3QET A;  2XY7 A;  2HHQ A;  4JS4 A;  3V4I A;  2E2Q A;  4YHH K;  1BL3 A;  4BE1 A;  3AO5 A;  3TU5 A;  2RE2 A;  2QXL A;  2HBM A;  5C0Y A;  1YVU A;  4RW8 A;  3EZW A;  3MXI A;  2YHW A;  3ZSO A;  1YF5 L;  2WON A;  2CGL A;  3TAQ A;  5AQT A;  3WXL A;  4FWO A;  5FLX O;  3M8S A;  3PX0 A;  1HNZ K;  4JI8 K;  4JD2 A;  1XNQ K;  2W41 A;  2HVI A;  3LZJ A;  2KLA A;  2A42 A;  3M8R A;  1MWK A;  4X66 K;  1S22 A;  1YHQ N;  4KI6 A;  3TSQ A;  5HLF A;  4DFP A;  4OKK A;  1VSL A;  5AZJ B;  2PYJ A;  2E88 A;  4YNQ A;  5SZT A;  4CJQ A;  2IGI A;  4Y0W A;  3S3M A;  1K8A O;  4FJG A;  3PIP L;  2ITM A;  4A59 A;  4BGA A;  3I55 N;  4BRF A;  4OGE A;  2NRW A;  1QQO A;  3EE8 A;  1VSM A;  2P9K A;  1W9H A;  2YKM A;  1WSF A;  3SJJ A;  1VSE A;  1WSH A;  4IOC L;  1BQN A;  1VRU A;  3T7Z A;  4KBO A;  4PKH A;  2E2N A;  3F9M A;  2NZT A;  3L2U A;  2FC0 A;  4IZ9 A;  1GLJ O;  2P9L B;  3NF7 A;  1VQM N;  5BN9 A;  5LL6 Z;  4O0I A;  2GUP A;  4CHN A;  1Y97 A;  1VQ8 N;  1JLE A;  4B8C A;  1JLB A;  1Q81 O;  3H1Q A;  3H6E A;  1VK0 A;  2HB5 A;  2G8F A;  2HF4 A;  2IOC A;  3MXM A;  2ATQ A;  2QWO A;  1NLV A;  1P8Z A;  3CJA A;  2P9P A;  1RDW X;  4I6M A;  3O1W A;  3OYH A;  3OS0 A;  1L3S A;  4B1U B;  3B6P A;  1I3A A;  4K41 A;  1GOB A;  2GUI A;  1MWM A;  1FJG K;  3O80 A;  3ZT2 A;  4N56 A;  2XY5 A;  4FJN A;  3ZCM A;  3THV A;  3KZB A;  1Q8I A;  1NGH A;  4W5R A;  2A1S A;  4GKK K;  2W42 A;  4Y1D A;  2D0O A;  4X62 K;  4NLC A;  4F9O A;  2HHX A;  3SMS A;  4O55 A;  3ZT3 A;  4MDA A;  1NJI O;  4IO8 A;  4NO7 A;  4JLH A;  4HVJ A;  5HL7 L;  3NH1 A;  3MX5 A;  4W5T A;  4X64 K;  1X9W A;  3K57 A;  1UA1 A;  2JLE A;  3ID6 A;  4JYA K;  2WTU A;  1E4G T;  2VQE K;  5J1E A;  3BP8 A;  2QWP A;  3KK7 A;  3CD6 N;  4FM0 A;  4NCB A;  5JVG L;  3L4Q A;  1KXP A;  1NKC A;  1T8E A;  4U7B A;  4C8O A;  4CD3 A;  3O6W A;  3DYA A;  2QWR A;  4CJE A;  1NGI A;  3IUC A;  4CFA A;  3KTQ A;  5DK5 A;  3QER A;  2O8B A;  4N47 A;  5JLH A;  3N4P A;  2Z1I A;  1Q82 O;  1RT7 A;  4CEB A;  5BR8 K;  4DU1 A;  4DUY K;  5T7B A;  1HX1 A;  3T1H K;  5GAH P;  2J4R A;  4GW6 A;  3RMC A;  2KHO A;  5BRH A;  4Z4C A;  3O9Q A;  2E2P A;  4KHS A;  4CGD A;  3C6U A;  3DXK A;  4NXM K;  4CJR A;  1SL0 A;  3ZEU A;  1NK0 A;  3K9K A;  1K6Y A;  2GX9 A;  1VSJ A;  4FWR A;  4DFM A;  4FZY A;  2HMI A;  3OYB A;  2HOE A;  2O4G A;  3O08 A;  1U04 A;  3VQE A;  1RT2 A;  1J5O A;  5J2Q A;  4IBN A;  2D0B A;  5LJW A;  3BF3 A;  4K8X A;  4C8M A;  1TK5 A;  3AO2 A;  5I3U A;  1WB9 A;  5EU7 A;  3FE1 A;  1NGC A;  1ZBI A;  2YNH A;  3TSP A;  4EIA A;  3WEE A;  4Z4E A;  1D9D A;  4B1V A;  2O8E B;  3V9W A;  3AO3 A;  4CK3 A;  3R3L A;  5GAE P;  3VEV A;  1JLA A;  4AM6 A;  3OYK A;  4M42 A;  2RN2 A;  2E6M A;  4YOW A;  1GLA G;  1BCM A;  4CZH A;  3L3V A;  3QLH A;  4K25 A;  4PKG A;  4UY8 O;  3U9D A;  2W6K A;  4CBX A;  5MLC Q;  2GV9 A;  4F8R A;  5CYQ A;  1SS6 A;  1TVR A;  1GLD G;  1NK6 A;  4B9S A;  5D3G A;  3SBG A;  4DR6 K;  1DKG D;  3H08 A;  3BGR A;  3A5O C;  1JJ2 M;  1XQS C;  4DV3 K;  4FJ7 A;  1U4B A;  1JL1 A;  3K2P A;  4DF8 A;  1G15 A;  5LJV A;  4IWV A;  3D7E O;  1KFS A;  1S9E A;  1JXB A;  2HW3 A;  5BPM A;  3SPZ A;  3CFO A;  3BZC A;  3ISN C;  3VGM A;  4EZ6 A;  3L2R A;  3C6H A;  2I7N A;  1UAX A;  1TL3 A;  3A2F A;  2GEL A;  4OJR A;  3VA3 A;  1NJY A;  1BUP A;  2EX3 A;  3VQQ A;  4A61 A;  3NVK A;  2A41 A;  2HHV A;  4DSJ A;  2F8S A;  5KI6 A;  2E4L A;  3M8Q A;  4B9V A;  4QOZ B;  1LWC A;  1NGG A;  2FBY A;  3IFR A;  4EP4 A;  1Z25 A;  3W3D A;  3SQ2 A;  3SUP A;  3SAH A;  4ELV A;  1VSD A;  2VGM A;  1LAV A;  4IKF A;  3AV9 A;  4WE1 A;  1K8K A;  3O3H A;  4CEC A;  1EET A;  1JCF A;  1U45 A;  4CFB A;  3L2V A;  3THY A;  3THW B;  5GIO A;  3ZT4 A;  3RSE B;  3MN6 A;  4F4K A;  1BIU A;  1F21 A;  3KK3 A;  3OBY A;  5BN8 A;  3VA0 A;  4RG8 A;  1NK8 A;  1WBB A;  1HUX A;  4FM2 A;  4Z4G A;  3CFP A;  2G8V A;  4JNE A;  2VG6 A;  4DMN A;  1W7A A;  3AY9 A;  2YNF A;  1B92 A;  4CE9 A;  3DWL A;  1ZBF A;  2HST A;  2ZGZ A;  3E9L A;  3P31 A;  3M1F A;  4JI3 K;  3DLH A;  4DTO A;  1T3V A;  3CC2 N;  3JSM A;  4GV3 A;  2G8W A;  4FWQ A;  4IEI A;  4IFY A;  3EY1 A;  1V4T A;  4CJL A;  4EAH D;  3RR8 A;  1WLJ A;  3AVL A;  1CZA N;  4KV8 A;  1KVC A;  4H0P A;  2A5X A;  4JI7 K;  1KVA A;  4DR7 K;  2UYT A;  1HQE A;  3SV3 A;  3K9J A;  5M1N A;  1IJJ A;  2CH5 A;  4BRE A;  1WBD A;  1RIL A;  3VQ6 A;  4DSL A;  3V81 A;  5AFU H;  3TR8 A;  4NCG A;  4FW2 A;  4Q5V A;  5AQI A;  1IBK K;  2NLX A;  3CC4 N;  2OTL N;  5HRO A;  3AGR A;  1T44 A;  3F9K A;  4J2B A;  1DTT A;  1OH6 A;  3HST B;  1DT9 A;  1Q9X A;  3AVB A;  2P9I A;  1IG9 A;  4OLB A;  3D2E A;  5F2R A;  5B8H A;  3C6T A;  4JKC A;  3S3O A;  1XC3 A;  3NBP A;  2XY6 A;  1TK0 A;  3CQ8 A;  3IKM A;  3PY8 A;  4AH9 A;  1O1W A;  1S1U A;  4FJL A;  3CCL N;  2V51 B;  4IO9 L;  4B9N A;  3SLC A;  4FYD A;  4A5B A;  3OS1 A;  4LD0 A;  2FF3 B;  4BDP A;  4PUO A;  4BR5 A;  3TAF A;  2Y1J A;  3QES A;  4NYN A;  1HMV A;  5BR9 A;  1ATR A;  3VES A;  4FJM A;  3NF9 A;  1HYZ A;  4B08 A;  5E41 A;  5DMR A;  3LDS A;  3TTD A;  4BR7 A;  3P4I A;  3U4L A;  3VTH A;  1HNW K;  3OBW A;  5C42 A;  4DV5 K;  2E8A A;  1XUP O;  2ETJ A;  2E5L K;  3V9U A;  5AQO A;  3CF5 L;  4HTU A;  3C6A A;  1QSY A;  3BEX A;  4KHY A;  2X6S A;  4CZK A;  4BRP A;  2O8C A;  3ZSR A;  2IC3 A;  3SCX A;  3RRH A;  4H4M A;  3VET A;  1WSE A;  1XMQ K;  3VEN A;  2YHB A;  2Z1G A;  3FGU A;  3LPU A;  1ZBU A;  3ZX0 A;  3PLA A;  3G25 A;  3GG4 A;  5AQR A;  1ZBL A;  4NXN K;  1XC9 A;  1SQK A;  3RTV A;  5BRE A;  3HK2 A;  4RWT A;  2QEX N;  3OA9 A;  3RR7 A;  1X9M A;  3D2F B;  1QS4 A;  1QTM A;  1NJZ A;  2NRR A;  1Q18 A;  1SL1 A;  3DI6 A;  5HRN A;  1N6Q A;  1YI2 N;  2DFE A;  4LF8 K;  5I42 A;  5AZJ A;  3PIO L;  2QWL A;  4CVN E;  1QHA A;  3LP2 A;  3O4W A;  5F1X A;  3NCI A;  2PAV A;  1FKO A;  4N5S A;  4WFB L;  4QS7 A;  3A5N C;  2P9K B;  3SUN A;  1NNE A;  3VQ5 A;  3MEE A;  4EHU A;  3ASM A;  2XO7 A;  3VQ8 A;  5AQK A;  5JVH L;  3HJF A;  5HOO A;  3DLE A;  3WT0 A;  3ZSQ A;  1BI4 A;  3L4I A;  1J53 A;  3O8M A;  3RMD A;  3ZSY A;  3LL3 A;  4DFK A;  4ID1 A;  3MMV A;  3VPZ A;  2D0P A;  3FZL A;  4ICL A;  3CCE N;  3QBW A;  1QVG M;  4DU3 A;  4M3W A;  1BGX T;  1ZBS A;  2X74 A;  2P9P B;  5JLF A;  1VQL N;  1JLQ A;  4EP5 A;  4PHT X;  5AFU A;  4V19 S;  4CJ3 A;  3A0I X;  1S1T A;  4M63 C;  3OYE A;  4Y1C A;  4HHT A;  3KLH A;  4MLE A;  3U6F A;  1RTJ A;  5LMN K;  2HBL A;  1J5E K;  3MX2 A;  4OPH A;  2GTD A;  4LF6 K;  3QIN A;  1ASU A;  3OJU A;  1T6D A;  3DLG A;  2P51 A;  1HPM A;  3LAK A;  4KO0 A;  4FCY A;  1KTQ A;  2CGJ A;  2D0A A;  2YHA A;  4OPA A;  1A5V A;  4CK1 A;  3LDP A;  1TUU A;  4FW1 A;  3CME N;  4BVP A;  3DM2 A;  1IO2 A;  3VEZ A;  2QXF A;  3CM6 A;  3SJH A;  2Q0U A;  1EWR A;  5M1Q A;  3O9R A;  4PA1 A;  3SI6 A;  1G99 A;  4ID5 A;  2BAN A;  1C1C A;  1TAQ A;  1JXE A;  1C6V A;  3CJB A;  1CXU A;  1YIT N;  3IS9 A;  4HTL A;  5AQQ A;  2AJQ A;  3MK6 A;  1QVF M;  4DS5 A;  4K43 A;  4CEF A;  4CF8 A;  3V1Q A;  3LWM A;  4FWS A;  4CEQ A;  2I5J A;  4QAG A;  3OYI A;  1NGE A;  3LM9 A;  1KVB A;  5M1K A;  1KAZ A;  3HOS A;  2HF3 A;  3V1O A;  3EKU A;  3OYF A;  2VQF K;  4KHP K;  3JXU A;  1H1V A;  4DQI A;  4XEI A;  4F2S A;  5GAD P;  4AHV A;  3VQ9 A;  1BA0 A;  5EOY A;  3O1B A;  1GLB G;  1A5X A;  2JWK A;  4O5B A;  3QEP A;  2HBK A;  2R7Y A;  2F9T A;  2VWJ A;  3E66 A;  1IBM K;  3RWU A;  4BC4 A;  3NGZ A;  4E7L A;  2NRV A;  3WXI A;  4DQR A;  4CBW A;  3CCR N;  3U3Y A;  1CLQ A;  2Q36 A;  5CHI A;  4H5W A;  1IKY A;  3MDQ A;  3ZET A;  4QS8 A;  3VGK A;  5AR0 A;  3QB0 A;  4FJ5 A;  3RMB A;  4LFC K;  2FBX A;  3CM5 A;  2FSN A;  4WQ5 C;  2QWM A;  1MU2 A;  4JI0 K;  4M3T A;  1BG3 A;  4DQ8 A;  1J54 A;  1QHT A;  1FKP A;  2HND A;  4CF1 A;  2EHG A;  4K8Z A;  4H0V B;  1T05 A;  1OH8 A;  5IWA K;  4DQS A;  3VF4 A;  3HVR A;  3H3N O;  3ZSW A;  1W97 L;  3P38 A;  3THX B;  4JKG B;  4ZTJ A;  4KH5 A;  4YOY A;  3FZF A;  4FM1 A;  4JRQ A;  1YJ9 N;  4QS9 A;  4JK7 A;  1WSG A;  3QIO A;  1WSI A;  2CGK A;  3VEO A;  4C8K A;  1IKV A;  2VG5 A;  3KLI A;  1FK9 A;  5M1F A;  4TSX A;  3QDK A;  3S41 A;  5C2F A;  3CPW M;  2NRX A;  4BE2 A;  3GOI A;  2XY8 A;  1GLE G;  4IFV A;  4KHU A;  3D0P A;  1XWL A;  3HRG A;  3AA2 A;  3ULE B;  3TI0 A;  2B6A A;  3GBT A;  3WNG A;  3LDO A;  2O8F B;  3QIC A;  3G10 A;  4CGI A;  1MDU B;  3TAN A;  5JS2 A;  3J81 O;  4ZTF A;  3G71 N;  3P83 D;  4JKH A;  2KZZ A;  1ESV A;  2Z1H A;  3KD5 E;  3LPT A;  4CEA A;  1QE1 A;  3MN9 A;  3P39 A;  2XRI A;  3OYD A;  4NCA A;  1C1B A;  4PL7 A;  5AQM A;  3J80 O;  3KWG A;  4CI6 A;  1KRP A;  4LFB K;  5ELZ A;  3K0S A;  1YJN N;  3CQY A;  5EVZ A;  4CJV A;  4FJ9 A;  4C1N I;  3A5M C;  1WSJ A;  1NJX A;  4M7Y A;  1BCO A;  5C25 A;  3DRP A;  4QCL A;  4FOI A;  1RT5 A;  4DSE A;  4CZM A;  3TAR A;  1NGA A;  1WN7 A;  1I94 K;  1VQ4 N;  5GIN A;  3S3N A;  4CES A;  3A8Y A;  4ZHR A;  3KKR A;  3O4N A;  4BDY A;  1KLM A;  5CY4 A;  1KD1 O;  1D4X A;  1VSI A;  2YV0 X;  4E19 A;  3TWH A;  3W0L A;  4XH5 A;  1FW6 A;  3SYZ A;  1TUY A;  4JI6 K;  4HCB A;  4MFB A;  3CJC A;  1VSK A;  3MCP A;  4RW6 A;  3H3O B;  3ZX3 A;  2H3G X;  2IVP A;  2QM1 A;  3FFI A;  4FPA A;  3HO1 A;  1X1P A;  1SAZ A;  3TSU A;  2PZS A;  4DWI A;  3UKU A;  2KQ2 A;  1TKZ A;  3FFK B;  2ZJR L;  2IVO A;  4M3X A;  2YI1 A;  2YKN A;  4WQ5 A;  4GVM A;  1BIS A;  5AQV A;  1T7P A;  4LH5 A;  3TAE A;  4B9L A;  3KLG A;  2HHW A;  4ILG B;  1NG9 A;  4W5O A;  3BY5 A;  1BHL A;  4CFD A;  4CZI A;  1BDG A;  5EXW A;  1S5J A;  2E1Y A;  1UA0 A;  4I9Q A;  3NAE A;  1U48 A;  1MA9 B;  4M7X A;  1P90 A;  2AP1 A;  4FPB A;  4X65 K;  4JD2 B;  3J7Z O;  4H5N A;  5FPE A;  3KLF A;  5AQU A;  2BUP A;  3C95 A;  4M41 A;  3HT3 A;  1X9S A;  3AVK A;  3ZSV A;  2FBV A;  3A5L C;  1L3U A;  4BQZ A;  1RDC A;  2Q3S A;  4DV7 K;  4PQU A;  4KB0 A;  2G8I A;  4FO0 A;  4AHR A;  2P9U A;  4FJK A;  2G8U A;  3M6G A;  1Q86 O;  4LF9 K;  3EKS A;  1RBR A;  1NK4 A;  2Q2R A;  4O4G A;  4J2E A;  4BAC A;  5KTQ A;  2PFU A;  1Z26 A;  4KAZ A;  4DV1 K;  4E7K A;  3SK3 A;  3HPG A;  3KK2 A;  2V7Y A;  4WQ4 A;  1SKR A;  3MCA B;  4M3Y A;  4AQY K;  2Z1J A;  3CQX A;  4BE0 A;  3SQ4 A;  2P9L A;  3E9O A;  1HLU A;  3IAY A;  3QEV A;  2O8D B;  2E6L A;  2Q0R A;  1GLF O;  1NKB A;  4RCH A;  1WUA A;  1HRH A;  3DRR A;  3TTC A;  3VQ4 A;  3I8D A;  1XMO K;  4JKB A;  4E7J A;  1CZB A;  4BG8 A;  3O9T A;  1GOC A;  1RFQ A;  5KRT A;  5KQD A;  2X78 A;  4LC9 B;  4Z0U A;  5DM6 L;  2D1K A;  4CHP A;  4CEZ A;  3WQU A;  4ISG A;  4XH1 A;  3NH2 A;  1EP4 A;  2GWK A;  3IMX A;  5KPZ A;  4JAX A;  3C65 A;  4W5Q A;  1RBV A;  2YJF A;  4BC2 A;  2HHS A;  2OPP A;  1NGB A;  4WFN L;  2NNW A;  1ZBH A;  5F0X A;  1NK5 A;  4A2B A;  2KZM A;  4CHO A;  1YVN A;  4JN4 A;  3VQP A;  1VQP N;  4PWD A;  2O8C B;  3ATV A;  3CJ1 A;  4Q0B A;  3DAW A;  4IJA A;  3T69 A;  3L8B A;  3MEC A;  4IEE A;  4WQ4 C;  4CJK A;  3EYZ A;  4I9L A;  3WXK A;  2UUA K;  1NGF A;  1RNH A;  5AQN A;  5BRD A;  3NDK A;  4BGB A;  4DSK A;  4IG3 A;  1TV6 A;  1EX4 A;  1JCG A;  3E01 A;  4DTS A;  1NOZ A;  1NK7 A;  4KTQ A;  2KTQ A;  4XH4 A;  3IRX A;  4Z4F A;  4DFJ A;  1X3M A;  5AQZ A;  2DTU A;  5GAG P;  5J2N A;  3K5M A;  3J7Y P;  4LF7 K;  1KAY A;  1D8Y A;  1HKB A;  5KRS A;  1IH7 A;  3FZK A;  5LMU K;  3C0B A;  1N33 K;  4BR4 A;  5TKW A;  1VRT A;  2FSK A;  3EE9 A;  4K0K K;  4CGF A;  1BO5 O;  5HRS A;  3CET A;  2P1J A;  3I33 A;  2HNY A;  3D45 A;  3ZEU B;  3QEX A;  1S1V A;  3NMU A;  4BR9 A;  1SL2 A;  4FVM A;  4H0T B;  5AQH A;  4PY5 A;  4DV0 K;  1VQO N;  4J2A A;  3HVT A;  3DXM A;  3SNN A;  4R5P A;  4GMJ B;  4BC5 A;  3O9S A;  4IDK A;  1QQC A;  3CFR A;  3LP1 A;  4ISE A;  3PO4 A;  5JIC A;  2WBN A;  1N34 K;  3V9Z A;  4MDB A;  2P9N A;  3M3Z A;  3CCJ N;  3C7N A;  3SMP A;  1EXQ A;  2A40 A;  4DV4 K;  4B3S K;  3AVI A;  3RMA A;  1N36 K;  3L2W A;  1DLO A;  4CF0 A;  3OYA A;  2OPR A;  3CJ9 A;  2B4J A;  1VSF A;  2O8E A;  3P5J A;  5E26 A;  2ZE2 A;  3FZH A;  1C0G A;  4OKE A;  2QI2 A;  1FXX A;  2PBD A;  3WQT A;  4AF1 A;  1M1K O;  4IOA L;  2ZQB A;  3LDQ A;  3FLC O;  3O9U A;  1HJR A;  1SKW A;  4E7I A;  2ZJP L;  4JHD B;  1RTI A;  1SUQ A;  3CHW A;  3FZM A;  4KFB A;  3VQC A;  4H03 B;  1WOQ A;  2HHH K;  1HKC A;  4B1Z A;  4CJ5 A;  4BRG A;  1KQS M;  1QZ5 A;  1U2V B;  3AA3 A;  3ZT0 A;  2D4W A;  4A2A A;  3ZSZ A;  4JI5 K;  2DFH A;  3HM8 A;  1N8R O;  3JAM O;  1JL2 A;  4OGC A;  5KPR A;  4NLB A;  1J9A A;  3R1X A;  2P9S B;  4FWM A;  3NE6 A;  4BRO A;  2D0C A;  4DB3 A;  5IT9 O;  3RRG A;  4N76 A;  3IDH A;  3WXJ A;  4PL8 A;  4E0D A;  3NHG A;  4AHU A;  2PY5 A;  2NUB A;  4HWI A;  1IKW A;  1VQK N;  1L5U A;  2F4V K;  1C0T A;  3I8B A;  2Y1I A;  1BOT O;  4M3Z A;  3SUO A;  1NBW A;  4ILJ A;  3ALY A;  4YOX A;  4DSF A;  1A5W A;  2UXB K;  2UU9 K;  4RW4 A;  5AQJ A;  1TKD A;  4B1X B;  3F5T A;  2IIR A;  4CJU A;  1LWF A;  4LF4 K;  2B5J A;  4AIL C;  4B3M K;  4RW7 A;  2OZM A;  4DR2 K;  2W40 A;  3SV4 A;  3SQ1 A;  4I6M B;  4DHY A;  4KI4 A;  3CI5 A;  2PYL A;  3O3G A;  1C1A A;  3QFU A;  2DY4 A;  4E1J A;  3ZET B;  4HUF A;  4PKI A;  3GE1 A;  4BRD A;  4O44 A;  3O4Q A;  4I2P A;  3THW A;  4F2R A;  4IJN A;  5TKY A;  3HYF A;  3NGY A;  2KKZ A;  4MO4 A;  1KC8 O;  2ASO A;  1T6C A;  2UUC K;  3PUF A;  3OYJ A;  1E3M A;  4YOT A;  3KWI A;  3AO4 A;  1KSP A;  4WYB A;  2E2O A;  4E1N A;  3BDP A;  3QO9 A;  5J2M A;  5KGW A;  3OYG A;  4CF9 A;  3MWP A;  3QEI A;  1NMD A;  1TL1 A;  5AJ3 K;  4FLY A;  3KHY A;  1EWQ A;  1NWK A;  5HRP A;  3R9P A;  1U49 A;  3L0Q A;  3U3G A;  2YNI A;  1REV A;  3SUQ A;  2VWB A;  2ZWH A;  4DUZ K;  1WNS A;  3MXJ A;  3G0Z A;  3FR0 A;  3CCM N;  1QQM A;  2Q31 A;  1RTH A;  5CE3 A;  2OAN A;  1SKS A;  3N4Q A;  4M3R A;  3EL2 A;  4Z4H A;  4CJW A;  3ENB A;  3K5O A;  2O8B B;  1WAF A;  4CEE A;  5CYM A;  4K42 A;  3VQA A;  3B6O A;  3VEW A;  4DU4 A;  1C0M A;  4GKJ K;  1C0U A;  2OYQ A;  2HNZ A;  2O8F A;  4FWP A;  4LFA K;  5E84 A;  5EX5 A;  3K59 A;  5FRM A;  1VQN N;  4KTW A;  1YTU A;  4DTN A;  3LDL A;  2F96 A;  1DEJ A;  1VHX A;  5AZI A;  3DXK B;  4CJS A;  3DLL L;  1RDD A;  4B1Y B;  3BZK A;  1TYQ B;  1YT3 A;  3ENH A;  1GLL O;  2YNG A;  1I39 A;  2WUS A;  4GV6 A;  2P9I B;  4CIF A;  4YOU A;  3AA5 X;  3VEX A;  1L3T A;  2ITG A;  1ZXO A;  3CIP A;  4FL9 A;  4LSL A;  2OCE A;  5CZ1 A;  2UXD K;  5I9E B;  2YX6 A;  2NRZ A;  3TAM A;  3TPQ A;  5FPD A;  4DLG A;  1LW2 A;  3KIO A;  2F8T A;  3B8A X;  3WNE A;  4YOV A;  4BRH A;  4W5N A;  5C2D A;  4DV2 K;  4CED A;  2E20 A;  3TTF A;  4DTJ A;  4I7F A;  3WEE B;  2NRT A;  4FK2 A;  4KRF A;  2KW4 A;  3U9Z A;  3TAB A;  1RDA A;  3UKR A;  1VQ7 N;  2QW9 A;  2IAJ A;  1LAW A;  4FJ8 A;  2IDO A;  3H46 O;  3OTO K;  3SQ0 A;  3O3F A;  4IDH A;  4AM7 A;  3NGI A;  4IFE A;  3OYM A;  1S6Q A;  3V9S A;  2FF6 A;  4CZJ A;  4FLT A;  1N5Y A;  1CZ9 A;  3AO1 A;  4L3Q A;  4BRK A;  3HL8 A;  4KHQ A;  1HYS A;  3O5B A;  2AA4 A;  1RGI A;  4CHY A;  1VQ5 N;  3NFA A;  3PO5 A;  4JI2 K;  1OH5 A;  1UWB A;  4YY3 K;  3QNO A;  3HSC A;  1Z05 A;  2LSN A;  5AQW A;  4F3O A;  1X3N A;  4BQL A;  4Z94 A;  4DG1 A;  2FLO A;  4CEO A;  1VSH A;  1Z6R A;  3J8A A;  4E3S A;  3D2F A;  4YDU C;  3L2Q A;  2FBT A;  3WUH A;  4C1N K;  3MN5 A;  2OZS A;  5AQL A;  3VQ7 A;  1TKX A;  1EKE A;  1NK9 A;  3LM2 A;  3ZX2 A;  2KFZ A;  4IXC A;  4H8K A;  5C24 A;  4EHT A;  4CCH A;  2YCH A;  3CPE A;  1TKT A;  4KKO A;  2ZGY A;  4N41 A;  4RTF D;  1RT4 A;  1KFD A;  3QIP A;  5A2Q O;  1QSS A;  4KTZ A;  3MEG A;  2D5R A;  2O4I A;  3CC7 N;  3JS6 A;  4M45 A;  3SPY A;  4DKW A;  1BI4 B;  4DF4 A;  4BR2 A;  1T03 A;  3T1A A;  1K8K B;  3CG7 A;  4MLH A;  5FRO A;  2HHT A;  2O8D A;  4GVE A;  5DM7 L;  4JS5 A;  4WFA L;  4ELT A;  2ASP A;  3THY B;  3AAQ A;  5HBM A;  3L6Q A;  3PX4 A;  1Q7Y O;  1YTA A;  3OS2 A;  3RSE A;  2ZJQ L;  1OH7 A;  1B9D A;  4FJJ A;  4FZZ A;  4NB4 A;  3EN9 A;  4FLU A;  1JCE A;  4H5R A;  3OY9 A;  1HR0 K;  4FVU A;  4CW7 B;  2Q1N A;  4CGJ A;  4CIE A;  1R59 O;  4CJ4 A;  1TAU A;  4CJ7 A;  3PV8 A;  1W2B M;  1NJW A;  3WNF A;  4E1M A;  1OKJ A;  4CZF A;  4BRI A;  2VWK A;  2V52 B;  1RTD A;  1XHZ A;  4CGG A;  4J2D A;  3S9H A;  3VTI A;  4DR5 K;  3PSF A;  5FPN A;  2BTF A;  4BRM A;  4JKD A;  1RT3 A;  4DCH A;  4FJX A;  4E7H A;  2JWL A;  2OTJ N;  3F73 A;  1CXQ A;  2YHY A;  2VGN A;  1YXQ A;  3ENO A;  3CER A;  5AQS A;  2E1Z A;  3V9X A;  2G8K A;  1LOT B;  4H0O A;  2HVH A;  1HPZ A;  1NGJ A;  4EFH A;  2NRH A;  4YOR A;  5JS1 A;  4ISF A;  3VQB A;  4DTR A;  3CCS N;  4OO1 J;  3UB5 A;  3MN7 A;  4FWN A;  2YJE A;  1NOY A;  4FLX A;  1YIJ N;  3V1R A;  5C12 A;  3AGK A;  4OKJ A;  4B9M A;  4BWM A;  1S1W A;  4OPK A;  1EQY A;  4DR4 K;  5HP1 A;  3NF6 A;  3T1Y K;  3E9P A;  3ATU A;  3LDN A;  4DS4 A;  3LAL A;  4IOX A;  4A62 A;  5SWM A;  1ATN A;  5BPN A;  3AVC A;  1LCU A;  4LY7 A;  4DTM A;  3DLR A;  3BUZ B; 
#chains in the Genus database with same CATH homology
 2OCE A;  1IV0 A;  1OVQ A;  1NMN A;  3BZK A;  3BZC A;  1NU0 A;  3PSI A;  3PSF A;  1VHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...