1NU0A

Structure of the double mutant (l6m; f134m, semet form) of yqgf from escherichia coli, a hypothetical protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
131
Chain Sequence
MSGTLMAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGLPLNMDGTEQPLTARARKFANRIHGRFGVEVKLHDERLSTVEAGGYRALNKGKVDSASAVIILESYMEQGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yqgF
publication title Structure of yqgF from Escherichia coli, a hypothetical protein
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 35
structure length 131
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03652 RuvX Holliday junction resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.140 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 YqgF/RNase H-like domain 1nu0A00
3BZCA 1OVQA 3BZKA 1NU0A 1IV0A 1NMNA 2OCEA 3PSFA 1VHXA 3PSIA
chains in the Genus database with same CATH superfamily
3ZT4A 2ZD1A 5KGWA 4IOXA 3AVGA 3R3LA 4YHHK 3AVFA 3AVJA 2E1ZA 2IVOA 4LD0A 3F9KA 3QLHA 4E1MA 1NK8A 5FRMA 3SJJA 1I3AA 1Z25A 3DLGA 4H0PA 4JKBA 2QWLA 4Y0WA 5H1SQ 4DV4K 1HYSA 4E7LA 1VSHA 5AFUA 1BCOA 3RWUA 4J2EA 1TK0A 3TAEA 3HPOA 4GV3A 4YORA 1VHXA 2YHYA 2HBLA 4RTFD 2F96A 2WUSA 3GG4A 2HHHK 2HW3A 4H5VA 3NF8A 4B8AB 3J81O 1FK9A 4F3OA 4HUEA 2WC9A 4WQ4C 5EX5A 4FOIA 1Z26A 1WUAA 3NH1A 1UA0A 3HBTA 3M8SA 3CCRN 2VG5A 3DLEA 4BRMA 2O4GA 4ICLA 4FJMA 1NGHA 3THYA 1NOZA 1CZBA 3LDPA 4CGHA 3LAKA 5DM7L 5AFUH 1W9HA 3L0QA 3LDQA 1W7AA 1VQMN 5AJ3K 4DTSA 3CM5A 4JRPA 3THYB 5C15A 1HYZA 3CMEN 4ISFA 3SAFA 3ULDA 3WNEA 4M3WA 4EHUA 5LY3A 3SK3A 4BRHA 2HHQA 1JL1A 3VENA 4CJLA 4JKGA 5KRSA 3TTFA 1NMNA 3ZCMA 4BRKA 3BDPA 1RNHA 1K6YA 1RTHA 1X3MA 2Q36A 3VOVA 4LFBK 4KKOA 3KLHA 3C0BA 3WUHA 5GINA 4YDUC 3OYDA 3P4IA 1T6CA 3OYJA 3DXMA 3CCQN 2P9UA 1B92A 4MLHA 3UKRA 2FBXA 4CZFA 2D0CA 3THXA 3KZBA 3I8DA 1C0TA 1DLOA 5HRRA 4IEIA 5FPMA 2NLXA 3O3HA 4JI2K 3I55N 4DSFA 1XMOK 3TU5A 3UKRB 3THXB 2VYPA 3O4QA 2IOCA 1N6QA 4GKJK 2VWBA 5BRHA 3CCJN 4XH5A 3HL8A 5AQWA 4BR4A 1KVBA 4FCYA 1Z05A 3T1AA 3L2QA 1UWBA 2PZSA 5CYMA 2A5XA 4CW7B 3TARA 4J2DA 4CJVA 4JI3K 3T69A 3KTQA 2VG7A 4DR1K 3V1RA 2PFUA 3PLAA 3C6TA 4RW4A 4K8ZA 4FJKA 1VSMA 1T44A 3R9PA 3TAQA 1U4BA 3EY1A 4AHSA 3AAPA 4FLUA 1K8AO 1OVQA 5KI6A 2FBVA 4C8KA 1YAGA 1T8EA 4EHTA 3D45A 3K0SA 2A3ZA 2GTDA 1BG3A 3CYMA 1ZBSA 4PKHA 4X66K 3OYCA 5KRTA 3CJ1A 4XH4A 2QWPA 1XC9A 3L4QA 4IO8A 2ASPA 4HUFA 2Y1JA 3T19A 3SQ1A 3E66A 1RBVA 1HMVA 2Q0UA 1I94K 4DR5K 4W5OA 2UU9K 1CZAN 3I56N 4DLGA 3S3OA 4FJLA 1VK0A 1A5VA 3I33A 3HXMA 4BRQA 2NRVA 5M1OA 5AQLA 3A5OC 4Q5VA 1TGOA 5JS1A 1HJRA 1DEJA 4LF6K 3DRRA 4BE0A 3QEWA 3OBYA 4WFNL 4ELTA 5FROA 4OGCA 3M1FA 3MCAB 4CHQA 1BA0A 2OPSA 2OZSA 4JI0K 4BQZA 4DR7K 3ZETB 3NF9A 3AA4A 4FOEA 4AHCA 2YNIA 3D2EA 4CEEA 4QOZB 3MXIA 3AARA 3EZWA 2GEMA 4BR9A 3K9JA 1XHZA 3P5JA 4J2BA 3AVCA 4H0OA 3WXJA 1SKSA 3DOKA 3J7AP 4CJ3A 1TL3A 4FWKA 4CJPA 2UUBK 1GOAA 4RW8A 2IVNA 4H0TB 3QIPA 3OHRA 1RDWX 3EYZA 5T7BA 3QEXA 3ZT1A 5FLXO 1MWMA 4KH4A 3TSQA 4PQUA 2NRWA 4LF4K 1YJNN 3JYTA 2XO7A 2ETJA 1ZYQA 2HMIA 4BDZA 2ZGYA 3WNFA 1ITGA 5ADXA 3DOLA 3VEZA 3QERA 1LOTB 4TSXA 4JAXA 1D8YA 1HQEA 2HVIA 1CLQA 5HBMA 3O1BA 2NUBA 2HVHA 1S22A 2W41A 4AQYK 2HSTA 3KHYA 2A1SA 5CZ1A 2YJEA 4E0DA 2QKBA 1RT2A 1T05A 3IKMA 4Q0BA 4XEIA 4BC5A 3P1GA 4DV6K 3L2RA 5M1PA 4FWMA 4J8FA 1QE1A 4KHWA 1N33K 5AQUA 1NG9A 2OANA 3ZEUA 2WFBA 2G8FA 1NLVA 1OH6A 3H1VX 5JLHA 5AQPA 2W42A 2E2OA 2VQEK 5HL7L 4WQ5C 3VPZA 4BQLA 3V1OA 5ADXH 1S5JA 4LFAK 1VSDA 4DQQA 4H8KA 1P8ZA 4Y1DA 2WBNA 4C23A 5AZIA 5HRNA 1VQ8N 1BU6O 3SBGA 4DSEA 3KD5E 1Q9XA 1NGGA 4N5SA 1TKTA 3PSFA 3LM2A 5C12A 1RT5A 3VEXA 5AZIB 3CD6N 3HP6A 3R1XA 1T7PA 4FLWA 3NCIA 2HF4A 3ID8A 2ASOA 3HOTA 3GDQA 4B8CA 3U6FA 4CJKA 4YOWA 3UIQA 5I9EB 4CGJA 1KXPA 1Q18A 5CR4A 1X9MA 3P31A 3ZYYX 4K8XA 4DUZK 4GKKK 2Q97A 1Q8IA 1NMDA 4B1XB 4E1NA 5JVGL 1BO5O 3V1QA 1RT7A 2IIRA 1NJWA 1JXBA 3K5NA 3TANA 2ZJPL 4FWNA 3RMCA 1LCUA 3AO2A 3ZX3A 3QMLA 3VA0A 1EX4A 4FJ8A 1NGBA 4YY3K 4ZTFA 4M63C 3J8AA 4JN4A 4WYBA 2Q31A 1IH7A 4MLEA 3E9OA 4CJFA 1XI1A 5AQFA 4IWVA 4JI4K 4CJ4A 4F2SA 4NCAA 4DQIA 4L3QA 2YX6A 3S3MA 3OS2A 4K41A 1X9JA 4B3RK 2OCEA 4KTWA 3D7EO 4M7YA 3DLBA 2OTJN 3K9KA 3DMJA 2Y1IA 1S1TA 4A5BA 4JD2B 3U9ZA 2DPNA 3CIPA 3KLGA 1NKBA 1D9FA 4MO4A 3DRPA 3VF2A 1QQMA 3O3FA 3SPZA 4DU4A 2F9TA 4U7BA 4BRPA 3C94A 3VGLA 1H1VA 4NLCA 3LZIA 3LPTA 1BCMA 3L2VA 3HM9A 4DCHA 4YOXA 1NGJA 2GWKA 4F9OA 4BRCA 1RTDA 4OLAA 1ASUA 4O44A 1QQOA 1SL2A 4AHUA 3ENBA 3KKRA 1JCEA 2FF6A 3ZSXA 2G8UA 2WTUA 4FJ5A 2ZJRL 1JLGA 1JKHA 5A2QO 3U3GA 5EY4A 3F9MA 3WEEA 1NK7A 1U04A 4A59A 4CESA 3GBTA 3C7NA 5EVZA 2X78A 3SZ2A 3QEIA 4B1WB 1U2VA 4O4GA 4DFPA 3WEEB 3T7ZA 3ZSVA 4IO9L 1J6ZA 4H5NA 1NJIO 4DWIA 4E1JA 3BP8A 4NYNA 4FWQA 1OH8A 1C0FA 3K5OA 3BF3A 3U4LA 1OVYA 3F5TA 5KQ8A 4IJNA 2KQ2A 3CC4N 5I42A 4M3XA 1SZ2A 4B9TA 4KHQA 3O4WA 1T3VA 1HYVA 4E7IA 3IG1A 3C6HA 3WXKA 5KPTA 4BDPA 5AQQA 4G1QA 4GW6A 4DTPA 1TKDA 1TL1A 3VQ7A 3SUOA 1RDDA 3ZT2A 5BRDA 4H5TA 1YJ9N 4EAHD 3F73A 2F8TA 3AVMA 4KH5A 1IBLK 4FYDA 3SV4A 4FWOA 4H03B 3AVKA 1NK9A 4KV8A 5AZJA 1KQSM 4CEBA 3AVLA 4M3RA 4PHTX 2ZGZA 3VERA 3L2WA 1VSFA 3MWTA 4H0YB 4H4OA 3OYGA 4GV9A 4JKHA 1HPMA 2A42A 5AZJB 5CZ2A 1HNVA 5GAHP 2ATQA 2G8HA 2QKKA 2OYQA 2D0PA 4QAGA 1CXQA 1C1BA 2HNDA 4FK0A 1ASVA 2ASMA 4FLYA 1GLJO 2FBTA 1YF5L 3OJUA 1SS6A 3SNNA 4B9SA 4IJAA 1U49A 3ENHA 3ASMA 3O5BA 3EO3A 4CF2A 2ZE2A 1C0GA 1ZBFA 4ILJA 1ZBIA 3O9UA 2O4IA 3HRGA 4WFAL 3FZKA 4N41A 3THVA 4A62A 2G8KA 3E1YA 5HOOA 3PV8A 1EQYA 4DTRA 4KBOA 1MWKA 4FWLA 1HUXA 4EZ9A 4A61A 4N47A 3JAMO 1A5WA 4DFKA 3LP2A 3CCMN 2CH6A 5GIPA 4BC4A 5CE3A 2CH5A 5AQHA 2QWRA 4AM7A 3GL1A 3AO5A 4MFBA 4BR7A 5JS2A 4KTZA 3DLLL 1L3TA 4CJTA 3ALYA 4DR4K 3QFPA 1YT3A 3ZSQA 2V52B 1QSLA 2P9NA 4KHUA 3L3UA 3BY5A 3LALA 4IG0A 3VF6A 3D6RA 1BQMA 4CGFA 4O0IA 3CFRA 1VQ7N 1JL2A 4CFDA 3N4QA 4FM2A 5C10A 2JWLA 1YXQA 2QW9A 4RCHA 5M1QA 3OJSA 4IEEA 1BHLA 5BPLA 3FE1A 3K5MA 1S3XA 3DRSA 3PX4A 3LPUA 4CEZA 5M1FA 3QFUA 3VQ8A 3SMSA 1YTUA 2D4WA 2GUIA 2KHOA 3BGRA 4FJGA 3OYLA 2A6AA 3HP9A 4GMJB 4CJWA 1S9EA 3M3ZA 4JKCA 4FM0A 4HCBA 1YVNA 1BIZA 1NOYA 4WE1A 3O1WA 4CF0A 3CCSN 3O08A 2OPQA 3EKSA 1NNEA 4N76A 4E7HA 1WB9A 3FGUA 1KLNA 5AQRA 1IKXA 4E3SA 3U9DA 2KKZA 4FM1A 3ZSWA 3QETA 4H5WA 3DLRA 1SUQA 3MCPA 2ZF5O 3LDOA 3RMAA 1HJOA 1SQKA 3O80A 1NK5A 1BISA 5AQNA 4B9MA 2RPIA 5AQXA 2EX3A 3CPEA 4B1ZA 4KREA 1FJGK 4CI6A 4JKGB 2LSNA 2OPPA 3NAEA 3ISNC 3SPYA 2E5LK 3NGZA 3FLCO 1L5UA 3ZSYA 3V6DA 1QSSA 1N5YA 1YVUA 4CHYA 2O8CA 3C6UA 3R8EA 4C8OA 4DV0K 1ESVA 4NXNK 4CZKA 1K9MO 4CVNE 4F3TA 5J2NA 2YNFA 3VQDA 1YIJN 1FW6A 3CMAN 3LANA 4FJ9A 4K25A 5FPDA 2FF3B 4KO0A 3VTHA 4FZYA 4CGIA 3RRGA 2E4LA 3CJBA 3DXMB 2P9UB 3EEQA 4LH5A 4NO7A 4CK2A 3WNGA 1S1WA 1CXUA 2GX9A 1J53A 3TAFA 1N8RO 3MDQA 1HNZK 3H6EA 2JWKA 4PKIA 4DTUA 4FJXA 1KAZA 2HHTA 4A2AA 2GBZA 4DFJA 1FKPA 4ELVA 4FPAA 2VGMA 4DV3K 4JLHA 3OYMA 1TKZA 1R0AA 4NCGA 3AY9A 3PO4A 5C2DA 5EU7A 3AO1A 3DLKA 3L8BA 3VN5A 4CD3A 3RRHA 2E1YA 5KPZA 4FXDA 3OYKA 3W3DA 4XIUA 1KLMA 4AH9A 1GLLO 1M90O 3LL3A 3IFRA 2A1RA 2UXCK 2W6LA 5C25A 1TK8A 3DAWA 1KC8O 2BH1A 4HUGA 1OKJA 1XNRK 4CGGA 4CK1A 3BUZB 2VGNA 2P5OA 5EXWA 3QESA 4CJRA 1BUPA 2P9PA 3OVNA 3RMBA 1NU0A 4M7XA 2B6AA 3AO4A 4QS8A 2KW4A 1WBBA 2P9IA 4DB3A 1M1KO 2CGLA 3SI6A 1NJYA 3P83D 1IG8A 1WSHA 2QM1A 4LF8K 3LP1A 3J80O 3DWLA 5AQYA 3P39A 3WQTA 1RT1A 2P9PB 5EOYA 2HHSA 4DG1A 1G15A 1WNSA 4JYAK 5J2MA 4IFYA 3VQ5A 2VWJA 2PAVA 2O8BA 1C6VA 3GOIA 3HSTB 3OBWA 4IBNA 4JK8A 3VQAA 2O8DA 1RDBA 1JLBA 3I0SA 5AQIA 4WCEL 5D3GA 4PKGA 2O8BB 5GAGP 3FZLA 2ZJQL 1U6ZA 3D2FA 4WQ4A 1WOQA 1EKEA 3IDHA 4FLZA 1GLFO 4BE2A 4DQSA 3SQ0A 5AQKA 1MDUB 5JICA 3CETA 2EHGA 2G8WA 1VQPN 3D2FB 4CHZA 3SAHA 4F2RA 1C0UA 1B9DA 3A0IX 3NVMA 3VQ4A 1VQNN 1HKBA 3KVGA 1EWRA 4BROA 4CF1A 1IG9A 4B1VA 3D2EB 4AHVA 3MX2A 4DTJA 4DV1K 1OH5A 1LWEA 3MN9A 4I2QA 3E01A 4RW6A 4IOAL 3SYZA 4EP4A 2BGGA 3CQYA 4Z4EA 4OKJA 4Z4FA 4FVMA 3LM9A 1S1VA 3CF5L 4M45A 2FLOA 5HROA 1FXXA 4BRNA 3UB5A 2PYJA 5JVHL 5IWAK 2UXDK 1QS4A 1LAWA 1YTAA 3HZ6A 3MN5A 4BC2A 4ELUA 3L3VA 1VSEA 5BR8K 3SUQA 1S6PA 4BGBA 3O9TA 5E41A 2HHVA 2HOEA 1NGIA 1RDCA 3MN7A 4CEDA 1GOCA 4DMNA 4DTMA 4DV2K 3EE8A 3VMFB 3A2FA 5AQTA 5GIOA 4LC9B 1HPZA 3NDKA 3LAMA 3KKSA 3OW2M 4N56A 4KI6A 4B9VA 3SQ4A 1WSIA 2HHUA 5GAEP 1ATSA 3ZT0A 4CFCA 4BRDA 2Z1HA 3NE6A 2YNHA 2UXBK 1BWFO 1KAYA 2A41A 2DFEA 4CEFA 3SJHA 3KK1A 3ZEUB 3WXLA 4CE9A 4Z4IA 4DR2K 3J7YP 1OH7A 1EP4A 4C8MA 1MA9B 4JI5K 3R6MA 4CZIA 5TKWA 3S9HA 4KH6A 2XHBA 4DU1A 1V4SA 5AQZA 4FJ7A 3VQCA 1EXQA 1VRUA 2E20A 4ID5A 4CBXA 2YHAA 5I3UA 3WNHA 3VA3A 1J5OA 4CBUA 4CF8A 4QS9A 4FW1A 1RDUA 3OYEA 4WFBL 3TI0A 2P1JA 4DQ8A 1VQ4N 1QSYA 1VSJA 3OY9A 1VQKN 3LWLA 2FBYA 1TK5A 2V51B 2OTLN 3BEXA 4PL7A 2BTFA 3HTVA 1VQLN 2YHXA 4H0VB 5HRPA 1JLEA 5BPNA 3SV3A 2HNZA 4BE1A 4DS5A 1NWKA 2RE2A 3HI0A 4OJRA 3C65A 3RTVA 4QCLA 5AQOA 1BI4A 2YKNA 3QINA 1XQSC 3M8PA 1U48A 3VESA 1YUWA 1RFQA 4GVEA 1QQNA 4HWIA 1BI4B 3CJ7A 4CJUA 3VEWA 5MLCQ 3CFOA 1IKWA 1VSKA 2FSKA 3PO5A 4CD1A 4ZTJA 1NGAA 1NJZA 4JKDA 2IGIA 4CZHA 3PIOL 2YKMA 4IOCL 1X9SA 4G9ZA 2KFNA 1IO2A 1HNIA 5CHIA 3CPWM 4LF5K 4YOYA 3K59A 2VWKA 3AVNA 3RSEA 3SUNA 3CCEN 1L3SA 5C42A 3CI5A 3EL2A 2G8VA 1RILA 3FZFA 4CZMA 3VQPA 1KFDA 3KIOA 4FJHA 2HMPA 5FDLA 3EN9A 4W5QA 4JKAA 2OZMA 4KPYA 4CHNA 4NB4A 4CEAA 5C24A 4MDAA 2P51A 3H3NO 1X9WA 1BGXT 2IVPA 1JCFA 1J54A 4IG3A 1K8KA 4KB0A 1D4XA 1J5EK 4CERA 3OS0A 3KLEA 4LF9K 2D0BA 4FJIA 4JKFA 4B08A 1YJWN 3C7NB 1F21A 2G8IA 1B9FA 4Z0UA 1RBRA 1U2VB 2P5GA 3BZKA 4CZLA 2NRXA 4X65K 3EE9A 1Q82O 3CJCA 1C1CA 4BRLA 4CFAA 3G25A 4C1NI 5AQSA 3CFPA 1ASWA 1K73O 3RVCA 3AVBA 2OPRA 2DFFA 3LWMA 2PBDA 3WXMB 3SUPA 4RG8A 2Q0RA 3LDSA 2RHKA 3NFAA 1R59O 3VF4A 2XY7A 2FXUA 3AA2A 2I5JA 5F0XA 3O3GA 5HRSA 4U67L 2HNYA 2IC3A 1SAZA 2I7PA 4BRFA 4IKFA 3HSCA 4QS7A 2XY8A 2XY5A 3CG7A 1QQCA 4Z4HA 1ZBUA 4BGAA 3TAPA 3VEVA 2BE2A 3VTIA 1FKOA 1I39A 3VEYA 1TYQA 4C8LA 4M3UA 2P9KA 4K0KK 4PA1A 4DF8A 4KHYA 4UY8O 4E7JA 2P9SA 4FW2A 4DSLA 1BOTO 3CCUN 3TR8A 1RT6A 2IAJA 2OA8A 4BVPA 2P9KB 4NYFA 2E88A 4JK7A 4OKEA 3TSPA 4CK3A 3SAGA 3TWHA 3NF7A 1E4FT 5AR0A 1VQON 5LJWA 4BR5A 4EZ6A 4DQPA 4XH1A 1YHQN 1KVAA 4BR0A 4R5PA 4BRAA 3EZ5A 4K42A 3MEEA 2KFZA 4ISEA 3RR8A 3THWA 4LFCK 5ELZA 4DSJA 4OLBA 4JI1K 3SMPA 1ZXOA 1TAQA 3W0LA 3MXMA 3THWB 3DLHA 2YCHA 3MEDA 5M1NA 4HVJA 3G4SN 1N32K 3LP0A 4RW7A 4BG9A 3KWIA 4HTLA 4HHTA 1TV6A 3ZLJA 2KTQA 1WLJA 1U45A 4BR2A 3HVRA 4B9NA 2H3GX 2E2PA 3OYAA 3OYBA 1A5XA 1XUPO 3DI6A 3FZHA 2X6SA 3V9SA 5F2RA 3IUCA 2JLEA 1JCGA 3CXCM 3I8BA 1HKCA 1Q81O 3QBXA 1KRPA 1NK6A 3A5MC 4KTQA 4O55A 4OPAA 4DLEA 4BRGA 4DV5K 4DFMA 4X62K 2QWQA 4W5NA 4CJ5A 2ZM6K 2QI2A 3O8MA 4M3TA 5AQVA 2EWSA 4KFBA 1NBWA 2P9NB 2I7NA 1JLQA 3SLCA 3NH0A 3QICA 4DS4A 2RN2A 4CFBA 1HKGA 5AQJA 3V9WA 3QEVA 1IBKK 2KLAA 3KLFA 1IBMK 4OPKA 2X6NA 1QZ6A 4JI7K 3ZSOA 1E4GT 3ZSZA 3QB0A 1V4TA 2YJFA 2QWOA 3QNNA 3NMUA 1JLFA 4F4KA 5J1EA 2UUCK 1NKCA 4JKEA 4CGDA 4FK4A 2GUPA 4DUYK 1DTQA 2P9LA 1VRTA 1KAXA 3BF1A 3NGYA 3CM6A 3VQ6A 1IKVA 5J2PA 4DSIA 2BDPA 3H45C 2FSNA 4O8KA 3ID6A 4FO0A 1KTQA 5F1XA 4M42A 2P9LB 4JHDA 3NVKA 2XRIA 2B5JA 3HVTA 1Q7YO 2HHWA 3B6OA 2J4RA 1NGDA 3AVHA 2F7TA 3V9XA 4NCBA 1QTMA 2QTDA 4JHDB 3HT3A 1NK4A 1L3VA 4V19S 4YFUA 1XMQK 2KZZA 4B9LA 2NRHA 4ZHRA 1O1WA 2X74A 3MXJA 4LY7A 4B9QA 5BR9A 1HNXK 1VAZA 1YI2N 1VQ5N 4IXCA 1NGFA 4FJJA 3BZCA 5B8HA 3M8RA 1ZBLA 3NH2A 4E7KA 2O8CB 4CJSA 3H3OB 4MO5A 1EO1A 1DKGD 4K43A 3OYHA 4OPHA 3P38A 4I7FA 4DTNA 2V7ZA 4E89A 1L3UA 4DQRA 1VSIA 3MAQA 3ZSRA 3O4NA 4OPJA 5KPRA 3AA3A 3ZT3A 4NXMK 3I0RA 2QK9A 4BY9C 1E3MA 1UOCA 1U47A 1WSEA 2CGKA 4O5FA 4F8RA 3MMVA 4B1UB 3WXIA 1WSGA 2YNGA 3U3YA 4KHNA 4DTOA 1WSFA 2A40A 2D0AA 4I2PA 4EFHA 4FWPA 4CZGA 4YOVA 3JXUA 4OGEA 1XC3A 1ZC6A 3KK3A 4GY2B 2VG6A 5LL6Z 1KSPA 1REVA 2QXLA 5C0YA 3CERA 1XHXA 1WN7A 2NNWA 2UYTA 2IS3A 2E6LA 1D9DA 3AGKA 1QHAA 1RDAA 4A57A 3C95A 3OYIA 2D1KA 4CZJA 2UUAK 4IFEA 3HJFA 3O9QA 3QDKA 3ZX0A 1T6DA 4DU3A 5BPMA 3AAQA 3QNOA 3VQQA 5CY4A 1C1AA 1GLEG 2P9IB 3PUFA 1SV5A 4KB1A 2GWJA 1S9GA 4NLBA 5DMRA 2YI1A 4B1YB 3E9LA 2FSJA 2AA4A 3B6PA 4CIEA 2XY6A 1RTIA 4R79A 3VEOA 1VQ9N 3VETA 4CHOA 1Q9YA 3OA9A 5LJVA 2O8DB 3OS1A 3HM8A 5GADP 3AVIA 2DFHA 4KHSA 1S1XA 3VQ9A 1HRHA 4H5RA 4LSNA 4GV6A 3ATUA 4MQ3A 4A5AA 2F8SA 3HPHA 4DR3K 4DTXA 2GV9A 3ZETA 3SBTA 2PY5A 4M3ZA 5J2QA 4JV5K 4CCHA 3ITHA 1LV5A 4BRIA 2QEXN 3LZJA 1JLAA 2KZMA 2YV0X 3O9SA 1RCHA 4KHPK 4FWRA 4LH4A 3ULEA 4IDKA 4DKWA 1BIUA 2HBKA 3PX0A 5HP1A 5LMUK 3M5RA 1ILYA 4AF1A 1IJJA 1KCFA 4C8NA 3TTCA 3ULEB 1SKRA 4B3SK 4ILGB 1S6QA 4CJQA 4GNIA 3CQXA 3MX5A 3V4IA 3UE5A 5TKYA 5AQMA 4BG8A 3MEGA 3OYFA 4YDUA 3RR7A 4MDBA 3DM2A 5E84A 3V81A 3LP3A 3SQ2A 1EWQA 2IDOA 4OO1J 1SKWA 3CJ9A 3C6AA 3NHGA 1G99A 3MN6A 3CC2N 3K58A 1NJXA 1RBTA 4DR6K 2QWMA 1HR0K 4JRQA 4CZEA 4Z94A 3ZX2A 2RKIA 1RBUA 4PY5A 3M6GA 3WT0A 2HF3A 4AM6A 3FZMA 3S3NA 1N34K 4CJ7A 3KD1E 3FR0A 4HTUA 1SL1A 4OVLA 4JI6K 3VGKA 2FC0A 4EIAA 4O8UA 4CIGA 3A8YA 4KI4A 4I9QA 1N36K 3NGIA 2O8FA 3PY8A 5BN8A 4KRFA 1LWFA 2F9WA 2WONA 3AO3A 2Q2RA 2O8FB 2R7YA 4BWJA 3D0PA 3UKUA 3L4IA 5KGXA 3CHWA 1HX1A 3NF6A 1W97L 3QO9A 4BWMA 3CCLN 3AVAA 2YHBA 2YHWA 4KAZA 3DXKA 3O9RA 1LW2A 1DTTA 3UKUB 3T1YK 1GLBG 1Y97A 3T3FA 1Z6RA 3N4PA 1BL3A 3PIPL 1VQ6N 2E8AA 3VQBA 5JLFA 1NGEA 4DF4A 2NRTA 3DXKB 4FLXA 1SL0A 1RT3A 5AQGA 4LF7K 3F2KA 1NGCA 3M8QA 4YOTA 1NK0A 4RW9A 1GLAG 4J2AA 3G71N 5FRNA 4PL8A 3O6WA 5FPEA 1GLDG 3TAGA 1MU2A 1O13A 3H1QA 2D5RA 1BDGA 3VGMA 1JJ2M 4JNEA 5KTQA 3TTDA 2Q3SA 4DHYA 3K5LA 3L6QA 4CF9A 4W5TA 4B9UA 4OKKA 3RMDA 1JXEA 1RTJA 4DV7K 3QEPA 1W0HA 1ATNA 2V7YA 2ZQBA 1TAUA 5FPNA 3MECA 4IDHA 2BUPA 1X1PA 4C1NK 4CEOA 3GE1A 4ISGA 4YOUA 1S72N 1J9AA 1BA1A 2B4JA 2HB5A 3FFKB 2Z1JA 3T1HK 2F4VK 1Y64A 3DJCA 3HYFA 1GOBA 2E2NA 4X64K 1RGIA 4JS5A 4JD2A 1VSLA 3TAMA 2VQFK 3RSEB 3OYNA 4FL9A 1TVRA 1JLCA 3J7ZO 5LMNK 3HO1A 3IAYA 5JMVA 1QVGM 2HHXA 3S41A 1LAVA 4W5RA 4FVUA 5M1KA 3IRXA 4O0JA 1XNQK 1C0MA 2DTUA 3V9UA 4FSVA 1TUUA 4LSLA 4Z4GA 4BDYA 3AA5X 4ILHA 3HK2A 4AILC 4BC3A 3TABA 2HBJA 1CZ9A 4GVMA 3A5LC 1RT4A 3FFIA 3K57A 1UA1A 5BN9A 4I9LA 3B8AX 1K8KB 1KVCA 3Q7CA 2VCPA 4FPBA 4YNQA 2O8EA 3LDLA 1S1UA 2RF2A 4PUOA 3TPQA 3L2UA 2BANA 3KWGA 1XWLA 2QWNA 4M3YA 3ENOA 5HLFA 4E19A 1W2BM 2WOMA 1TUYA 2O8EB 4WQ5A 4FJNA 1GLCG 1LWCA 4PWDA 3PSIA 4CBWA 1QVFM 3AGRA 1YITN 1EETA 3MWPA 2NZTA 3ATVA 4FZXC 3H46O 4AHRA 3CQ8A 1RBSA 1HQUA 3QIOA 3SCXA 2AJQA 5CYQA 1HNWK 3OTOK 3WQUA 3E9PA 4BACA 4FK2A 2GELA 2ITMA 4ID1A 5DK5A 1ZBHA 3QBWA 1BQNA 3DYAA 4BVOA 4FLVA 4L8RB 4BREA 4OX9K 2CGJA 4CHPA 3LDNA 1KD1O 4JS4A 3PX6A 5IT9O 4M41A 4CECA 1WSJA 4JI8K 5SWMA 2Z1IA 1IKYA 4UQGA 3JSMA 3G6EN 3AV9A 1P90A 4JEPA 3KK7A 4B3OA 1HLUA 3KJVA 1TKXA 3NBPA 2QXFA 2AP1A 3G0ZA 3U8XA 4HCCA 2NRZA 4AHTA 5E26A 2NRRA 4CIFA 5BREA 2ITGA 1TYQB 2DY4A 3KLIA 4FLTA 1DGKN 3IS9A 3MK6A 3IMXA 3V9ZA 1WAFA 3JS6A 2P9SB 4IFVA 3EKUA 1D5AA 1DT9A 1QHTA 4IZ9A 4CJEA 3CCVN 1NKEA 4JK9A 5KQDA 5K14A 2W40A 5DM6L 4B3TK 1WBDA 4O5BA 3A5NC 4WF9L 3TSUA 4CEQA 5BRFA 1ATRA 2W6KA 3CJAA 4A2BA 4Z4CA 3KK2A 5C2FA 2JGUA 2D0OA 4H0XB 1T03A 1QZ5A 4RWTA 2Z1GA 1WAJA 2E2QA 4DSKA 2QA4N 4I6MA 2HBMA 2E6MA 3HOSA 3G10A 2PYLA 1Q86O 5SZTA 4I6MB 2Q1NA 2ZWHA 3CC7N 4FZZA 1IV0A 3Q7BA 4FWSA 3K2PA 1UAXA 1LW0A 3HPGA 4Y1CA 1X3NA 4EP5A 1KFSA 1NM1A 4B3MK 3H08A 4H4MA 3VQEA
chains in the Genus database with same CATH topology
3BZCA 1OVQA 3BZKA 1NU0A 1IV0A 1NMNA 2OCEA 3PSFA 1VHXA 3PSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BZC A;  1OVQ A;  3BZK A;  1NU0 A;  1IV0 A;  1NMN A;  2OCE A;  3PSF A;  1VHX A;  3PSI A; 
#chains in the Genus database with same CATH topology
 3ZT4 A;  2ZD1 A;  5KGW A;  4IOX A;  3AVG A;  3R3L A;  4YHH K;  3AVF A;  3AVJ A;  2E1Z A;  2IVO A;  4LD0 A;  3F9K A;  3QLH A;  4E1M A;  1NK8 A;  5FRM A;  3SJJ A;  1I3A A;  1Z25 A;  3DLG A;  4H0P A;  4JKB A;  2QWL A;  4Y0W A;  5H1S Q;  4DV4 K;  1HYS A;  4E7L A;  1VSH A;  5AFU A;  1BCO A;  3RWU A;  4J2E A;  1TK0 A;  3TAE A;  3HPO A;  4GV3 A;  4YOR A;  1VHX A;  2YHY A;  2HBL A;  4RTF D;  2F96 A;  2WUS A;  3GG4 A;  2HHH K;  2HW3 A;  4H5V A;  3NF8 A;  4B8A B;  3J81 O;  1FK9 A;  4F3O A;  4HUE A;  2WC9 A;  4WQ4 C;  5EX5 A;  4FOI A;  1Z26 A;  1WUA A;  3NH1 A;  1UA0 A;  3HBT A;  3M8S A;  3CCR N;  2VG5 A;  3DLE A;  4BRM A;  2O4G A;  4ICL A;  4FJM A;  1NGH A;  3THY A;  1NOZ A;  1CZB A;  3LDP A;  4CGH A;  3LAK A;  5DM7 L;  5AFU H;  1W9H A;  3L0Q A;  3LDQ A;  1W7A A;  1VQM N;  5AJ3 K;  4DTS A;  3CM5 A;  4JRP A;  3THY B;  5C15 A;  1HYZ A;  3CME N;  4ISF A;  3SAF A;  3ULD A;  3WNE A;  4M3W A;  4EHU A;  5LY3 A;  3SK3 A;  4BRH A;  2HHQ A;  1JL1 A;  3VEN A;  4CJL A;  4JKG A;  5KRS A;  3TTF A;  1NMN A;  3ZCM A;  4BRK A;  3BDP A;  1RNH A;  1K6Y A;  1RTH A;  1X3M A;  2Q36 A;  3VOV A;  4LFB K;  4KKO A;  3KLH A;  3C0B A;  3WUH A;  5GIN A;  4YDU C;  3OYD A;  3P4I A;  1T6C A;  3OYJ A;  3DXM A;  3CCQ N;  2P9U A;  1B92 A;  4MLH A;  3UKR A;  2FBX A;  4CZF A;  2D0C A;  3THX A;  3KZB A;  3I8D A;  1C0T A;  1DLO A;  5HRR A;  4IEI A;  5FPM A;  2NLX A;  3O3H A;  4JI2 K;  3I55 N;  4DSF A;  1XMO K;  3TU5 A;  3UKR B;  3THX B;  2VYP A;  3O4Q A;  2IOC A;  1N6Q A;  4GKJ K;  2VWB A;  5BRH A;  3CCJ N;  4XH5 A;  3HL8 A;  5AQW A;  4BR4 A;  1KVB A;  4FCY A;  1Z05 A;  3T1A A;  3L2Q A;  1UWB A;  2PZS A;  5CYM A;  2A5X A;  4CW7 B;  3TAR A;  4J2D A;  4CJV A;  4JI3 K;  3T69 A;  3KTQ A;  2VG7 A;  4DR1 K;  3V1R A;  2PFU A;  3PLA A;  3C6T A;  4RW4 A;  4K8Z A;  4FJK A;  1VSM A;  1T44 A;  3R9P A;  3TAQ A;  1U4B A;  3EY1 A;  4AHS A;  3AAP A;  4FLU A;  1K8A O;  1OVQ A;  5KI6 A;  2FBV A;  4C8K A;  1YAG A;  1T8E A;  4EHT A;  3D45 A;  3K0S A;  2A3Z A;  2GTD A;  1BG3 A;  3CYM A;  1ZBS A;  4PKH A;  4X66 K;  3OYC A;  5KRT A;  3CJ1 A;  4XH4 A;  2QWP A;  1XC9 A;  3L4Q A;  4IO8 A;  2ASP A;  4HUF A;  2Y1J A;  3T19 A;  3SQ1 A;  3E66 A;  1RBV A;  1HMV A;  2Q0U A;  1I94 K;  4DR5 K;  4W5O A;  2UU9 K;  1CZA N;  3I56 N;  4DLG A;  3S3O A;  4FJL A;  1VK0 A;  1A5V A;  3I33 A;  3HXM A;  4BRQ A;  2NRV A;  5M1O A;  5AQL A;  3A5O C;  4Q5V A;  1TGO A;  5JS1 A;  1HJR A;  1DEJ A;  4LF6 K;  3DRR A;  4BE0 A;  3QEW A;  3OBY A;  4WFN L;  4ELT A;  5FRO A;  4OGC A;  3M1F A;  3MCA B;  4CHQ A;  1BA0 A;  2OPS A;  2OZS A;  4JI0 K;  4BQZ A;  4DR7 K;  3ZET B;  3NF9 A;  3AA4 A;  4FOE A;  4AHC A;  2YNI A;  3D2E A;  4CEE A;  4QOZ B;  3MXI A;  3AAR A;  3EZW A;  2GEM A;  4BR9 A;  3K9J A;  1XHZ A;  3P5J A;  4J2B A;  3AVC A;  4H0O A;  3WXJ A;  1SKS A;  3DOK A;  3J7A P;  4CJ3 A;  1TL3 A;  4FWK A;  4CJP A;  2UUB K;  1GOA A;  4RW8 A;  2IVN A;  4H0T B;  3QIP A;  3OHR A;  1RDW X;  3EYZ A;  5T7B A;  3QEX A;  3ZT1 A;  5FLX O;  1MWM A;  4KH4 A;  3TSQ A;  4PQU A;  2NRW A;  4LF4 K;  1YJN N;  3JYT A;  2XO7 A;  2ETJ A;  1ZYQ A;  2HMI A;  4BDZ A;  2ZGY A;  3WNF A;  1ITG A;  5ADX A;  3DOL A;  3VEZ A;  3QER A;  1LOT B;  4TSX A;  4JAX A;  1D8Y A;  1HQE A;  2HVI A;  1CLQ A;  5HBM A;  3O1B A;  2NUB A;  2HVH A;  1S22 A;  2W41 A;  4AQY K;  2HST A;  3KHY A;  2A1S A;  5CZ1 A;  2YJE A;  4E0D A;  2QKB A;  1RT2 A;  1T05 A;  3IKM A;  4Q0B A;  4XEI A;  4BC5 A;  3P1G A;  4DV6 K;  3L2R A;  5M1P A;  4FWM A;  4J8F A;  1QE1 A;  4KHW A;  1N33 K;  5AQU A;  1NG9 A;  2OAN A;  3ZEU A;  2WFB A;  2G8F A;  1NLV A;  1OH6 A;  3H1V X;  5JLH A;  5AQP A;  2W42 A;  2E2O A;  2VQE K;  5HL7 L;  4WQ5 C;  3VPZ A;  4BQL A;  3V1O A;  5ADX H;  1S5J A;  4LFA K;  1VSD A;  4DQQ A;  4H8K A;  1P8Z A;  4Y1D A;  2WBN A;  4C23 A;  5AZI A;  5HRN A;  1VQ8 N;  1BU6 O;  3SBG A;  4DSE A;  3KD5 E;  1Q9X A;  1NGG A;  4N5S A;  1TKT A;  3PSF A;  3LM2 A;  5C12 A;  1RT5 A;  3VEX A;  5AZI B;  3CD6 N;  3HP6 A;  3R1X A;  1T7P A;  4FLW A;  3NCI A;  2HF4 A;  3ID8 A;  2ASO A;  3HOT A;  3GDQ A;  4B8C A;  3U6F A;  4CJK A;  4YOW A;  3UIQ A;  5I9E B;  4CGJ A;  1KXP A;  1Q18 A;  5CR4 A;  1X9M A;  3P31 A;  3ZYY X;  4K8X A;  4DUZ K;  4GKK K;  2Q97 A;  1Q8I A;  1NMD A;  4B1X B;  4E1N A;  5JVG L;  1BO5 O;  3V1Q A;  1RT7 A;  2IIR A;  1NJW A;  1JXB A;  3K5N A;  3TAN A;  2ZJP L;  4FWN A;  3RMC A;  1LCU A;  3AO2 A;  3ZX3 A;  3QML A;  3VA0 A;  1EX4 A;  4FJ8 A;  1NGB A;  4YY3 K;  4ZTF A;  4M63 C;  3J8A A;  4JN4 A;  4WYB A;  2Q31 A;  1IH7 A;  4MLE A;  3E9O A;  4CJF A;  1XI1 A;  5AQF A;  4IWV A;  4JI4 K;  4CJ4 A;  4F2S A;  4NCA A;  4DQI A;  4L3Q A;  2YX6 A;  3S3M A;  3OS2 A;  4K41 A;  1X9J A;  4B3R K;  2OCE A;  4KTW A;  3D7E O;  4M7Y A;  3DLB A;  2OTJ N;  3K9K A;  3DMJ A;  2Y1I A;  1S1T A;  4A5B A;  4JD2 B;  3U9Z A;  2DPN A;  3CIP A;  3KLG A;  1NKB A;  1D9F A;  4MO4 A;  3DRP A;  3VF2 A;  1QQM A;  3O3F A;  3SPZ A;  4DU4 A;  2F9T A;  4U7B A;  4BRP A;  3C94 A;  3VGL A;  1H1V A;  4NLC A;  3LZI A;  3LPT A;  1BCM A;  3L2V A;  3HM9 A;  4DCH A;  4YOX A;  1NGJ A;  2GWK A;  4F9O A;  4BRC A;  1RTD A;  4OLA A;  1ASU A;  4O44 A;  1QQO A;  1SL2 A;  4AHU A;  3ENB A;  3KKR A;  1JCE A;  2FF6 A;  3ZSX A;  2G8U A;  2WTU A;  4FJ5 A;  2ZJR L;  1JLG A;  1JKH A;  5A2Q O;  3U3G A;  5EY4 A;  3F9M A;  3WEE A;  1NK7 A;  1U04 A;  4A59 A;  4CES A;  3GBT A;  3C7N A;  5EVZ A;  2X78 A;  3SZ2 A;  3QEI A;  4B1W B;  1U2V A;  4O4G A;  4DFP A;  3WEE B;  3T7Z A;  3ZSV A;  4IO9 L;  1J6Z A;  4H5N A;  1NJI O;  4DWI A;  4E1J A;  3BP8 A;  4NYN A;  4FWQ A;  1OH8 A;  1C0F A;  3K5O A;  3BF3 A;  3U4L A;  1OVY A;  3F5T A;  5KQ8 A;  4IJN A;  2KQ2 A;  3CC4 N;  5I42 A;  4M3X A;  1SZ2 A;  4B9T A;  4KHQ A;  3O4W A;  1T3V A;  1HYV A;  4E7I A;  3IG1 A;  3C6H A;  3WXK A;  5KPT A;  4BDP A;  5AQQ A;  4G1Q A;  4GW6 A;  4DTP A;  1TKD A;  1TL1 A;  3VQ7 A;  3SUO A;  1RDD A;  3ZT2 A;  5BRD A;  4H5T A;  1YJ9 N;  4EAH D;  3F73 A;  2F8T A;  3AVM A;  4KH5 A;  1IBL K;  4FYD A;  3SV4 A;  4FWO A;  4H03 B;  3AVK A;  1NK9 A;  4KV8 A;  5AZJ A;  1KQS M;  4CEB A;  3AVL A;  4M3R A;  4PHT X;  2ZGZ A;  3VER A;  3L2W A;  1VSF A;  3MWT A;  4H0Y B;  4H4O A;  3OYG A;  4GV9 A;  4JKH A;  1HPM A;  2A42 A;  5AZJ B;  5CZ2 A;  1HNV A;  5GAH P;  2ATQ A;  2G8H A;  2QKK A;  2OYQ A;  2D0P A;  4QAG A;  1CXQ A;  1C1B A;  2HND A;  4FK0 A;  1ASV A;  2ASM A;  4FLY A;  1GLJ O;  2FBT A;  1YF5 L;  3OJU A;  1SS6 A;  3SNN A;  4B9S A;  4IJA A;  1U49 A;  3ENH A;  3ASM A;  3O5B A;  3EO3 A;  4CF2 A;  2ZE2 A;  1C0G A;  1ZBF A;  4ILJ A;  1ZBI A;  3O9U A;  2O4I A;  3HRG A;  4WFA L;  3FZK A;  4N41 A;  3THV A;  4A62 A;  2G8K A;  3E1Y A;  5HOO A;  3PV8 A;  1EQY A;  4DTR A;  4KBO A;  1MWK A;  4FWL A;  1HUX A;  4EZ9 A;  4A61 A;  4N47 A;  3JAM O;  1A5W A;  4DFK A;  3LP2 A;  3CCM N;  2CH6 A;  5GIP A;  4BC4 A;  5CE3 A;  2CH5 A;  5AQH A;  2QWR A;  4AM7 A;  3GL1 A;  3AO5 A;  4MFB A;  4BR7 A;  5JS2 A;  4KTZ A;  3DLL L;  1L3T A;  4CJT A;  3ALY A;  4DR4 K;  3QFP A;  1YT3 A;  3ZSQ A;  2V52 B;  1QSL A;  2P9N A;  4KHU A;  3L3U A;  3BY5 A;  3LAL A;  4IG0 A;  3VF6 A;  3D6R A;  1BQM A;  4CGF A;  4O0I A;  3CFR A;  1VQ7 N;  1JL2 A;  4CFD A;  3N4Q A;  4FM2 A;  5C10 A;  2JWL A;  1YXQ A;  2QW9 A;  4RCH A;  5M1Q A;  3OJS A;  4IEE A;  1BHL A;  5BPL A;  3FE1 A;  3K5M A;  1S3X A;  3DRS A;  3PX4 A;  3LPU A;  4CEZ A;  5M1F A;  3QFU A;  3VQ8 A;  3SMS A;  1YTU A;  2D4W A;  2GUI A;  2KHO A;  3BGR A;  4FJG A;  3OYL A;  2A6A A;  3HP9 A;  4GMJ B;  4CJW A;  1S9E A;  3M3Z A;  4JKC A;  4FM0 A;  4HCB A;  1YVN A;  1BIZ A;  1NOY A;  4WE1 A;  3O1W A;  4CF0 A;  3CCS N;  3O08 A;  2OPQ A;  3EKS A;  1NNE A;  4N76 A;  4E7H A;  1WB9 A;  3FGU A;  1KLN A;  5AQR A;  1IKX A;  4E3S A;  3U9D A;  2KKZ A;  4FM1 A;  3ZSW A;  3QET A;  4H5W A;  3DLR A;  1SUQ A;  3MCP A;  2ZF5 O;  3LDO A;  3RMA A;  1HJO A;  1SQK A;  3O80 A;  1NK5 A;  1BIS A;  5AQN A;  4B9M A;  2RPI A;  5AQX A;  2EX3 A;  3CPE A;  4B1Z A;  4KRE A;  1FJG K;  4CI6 A;  4JKG B;  2LSN A;  2OPP A;  3NAE A;  3ISN C;  3SPY A;  2E5L K;  3NGZ A;  3FLC O;  1L5U A;  3ZSY A;  3V6D A;  1QSS A;  1N5Y A;  1YVU A;  4CHY A;  2O8C A;  3C6U A;  3R8E A;  4C8O A;  4DV0 K;  1ESV A;  4NXN K;  4CZK A;  1K9M O;  4CVN E;  4F3T A;  5J2N A;  2YNF A;  3VQD A;  1YIJ N;  1FW6 A;  3CMA N;  3LAN A;  4FJ9 A;  4K25 A;  5FPD A;  2FF3 B;  4KO0 A;  3VTH A;  4FZY A;  4CGI A;  3RRG A;  2E4L A;  3CJB A;  3DXM B;  2P9U B;  3EEQ A;  4LH5 A;  4NO7 A;  4CK2 A;  3WNG A;  1S1W A;  1CXU A;  2GX9 A;  1J53 A;  3TAF A;  1N8R O;  3MDQ A;  1HNZ K;  3H6E A;  2JWK A;  4PKI A;  4DTU A;  4FJX A;  1KAZ A;  2HHT A;  4A2A A;  2GBZ A;  4DFJ A;  1FKP A;  4ELV A;  4FPA A;  2VGM A;  4DV3 K;  4JLH A;  3OYM A;  1TKZ A;  1R0A A;  4NCG A;  3AY9 A;  3PO4 A;  5C2D A;  5EU7 A;  3AO1 A;  3DLK A;  3L8B A;  3VN5 A;  4CD3 A;  3RRH A;  2E1Y A;  5KPZ A;  4FXD A;  3OYK A;  3W3D A;  4XIU A;  1KLM A;  4AH9 A;  1GLL O;  1M90 O;  3LL3 A;  3IFR A;  2A1R A;  2UXC K;  2W6L A;  5C25 A;  1TK8 A;  3DAW A;  1KC8 O;  2BH1 A;  4HUG A;  1OKJ A;  1XNR K;  4CGG A;  4CK1 A;  3BUZ B;  2VGN A;  2P5O A;  5EXW A;  3QES A;  4CJR A;  1BUP A;  2P9P A;  3OVN A;  3RMB A;  1NU0 A;  4M7X A;  2B6A A;  3AO4 A;  4QS8 A;  2KW4 A;  1WBB A;  2P9I A;  4DB3 A;  1M1K O;  2CGL A;  3SI6 A;  1NJY A;  3P83 D;  1IG8 A;  1WSH A;  2QM1 A;  4LF8 K;  3LP1 A;  3J80 O;  3DWL A;  5AQY A;  3P39 A;  3WQT A;  1RT1 A;  2P9P B;  5EOY A;  2HHS A;  4DG1 A;  1G15 A;  1WNS A;  4JYA K;  5J2M A;  4IFY A;  3VQ5 A;  2VWJ A;  2PAV A;  2O8B A;  1C6V A;  3GOI A;  3HST B;  3OBW A;  4IBN A;  4JK8 A;  3VQA A;  2O8D A;  1RDB A;  1JLB A;  3I0S A;  5AQI A;  4WCE L;  5D3G A;  4PKG A;  2O8B B;  5GAG P;  3FZL A;  2ZJQ L;  1U6Z A;  3D2F A;  4WQ4 A;  1WOQ A;  1EKE A;  3IDH A;  4FLZ A;  1GLF O;  4BE2 A;  4DQS A;  3SQ0 A;  5AQK A;  1MDU B;  5JIC A;  3CET A;  2EHG A;  2G8W A;  1VQP N;  3D2F B;  4CHZ A;  3SAH A;  4F2R A;  1C0U A;  1B9D A;  3A0I X;  3NVM A;  3VQ4 A;  1VQN N;  1HKB A;  3KVG A;  1EWR A;  4BRO A;  4CF1 A;  1IG9 A;  4B1V A;  3D2E B;  4AHV A;  3MX2 A;  4DTJ A;  4DV1 K;  1OH5 A;  1LWE A;  3MN9 A;  4I2Q A;  3E01 A;  4RW6 A;  4IOA L;  3SYZ A;  4EP4 A;  2BGG A;  3CQY A;  4Z4E A;  4OKJ A;  4Z4F A;  4FVM A;  3LM9 A;  1S1V A;  3CF5 L;  4M45 A;  2FLO A;  5HRO A;  1FXX A;  4BRN A;  3UB5 A;  2PYJ A;  5JVH L;  5IWA K;  2UXD K;  1QS4 A;  1LAW A;  1YTA A;  3HZ6 A;  3MN5 A;  4BC2 A;  4ELU A;  3L3V A;  1VSE A;  5BR8 K;  3SUQ A;  1S6P A;  4BGB A;  3O9T A;  5E41 A;  2HHV A;  2HOE A;  1NGI A;  1RDC A;  3MN7 A;  4CED A;  1GOC A;  4DMN A;  4DTM A;  4DV2 K;  3EE8 A;  3VMF B;  3A2F A;  5AQT A;  5GIO A;  4LC9 B;  1HPZ A;  3NDK A;  3LAM A;  3KKS A;  3OW2 M;  4N56 A;  4KI6 A;  4B9V A;  3SQ4 A;  1WSI A;  2HHU A;  5GAE P;  1ATS A;  3ZT0 A;  4CFC A;  4BRD A;  2Z1H A;  3NE6 A;  2YNH A;  2UXB K;  1BWF O;  1KAY A;  2A41 A;  2DFE A;  4CEF A;  3SJH A;  3KK1 A;  3ZEU B;  3WXL A;  4CE9 A;  4Z4I A;  4DR2 K;  3J7Y P;  1OH7 A;  1EP4 A;  4C8M A;  1MA9 B;  4JI5 K;  3R6M A;  4CZI A;  5TKW A;  3S9H A;  4KH6 A;  2XHB A;  4DU1 A;  1V4S A;  5AQZ A;  4FJ7 A;  3VQC A;  1EXQ A;  1VRU A;  2E20 A;  4ID5 A;  4CBX A;  2YHA A;  5I3U A;  3WNH A;  3VA3 A;  1J5O A;  4CBU A;  4CF8 A;  4QS9 A;  4FW1 A;  1RDU A;  3OYE A;  4WFB L;  3TI0 A;  2P1J A;  4DQ8 A;  1VQ4 N;  1QSY A;  1VSJ A;  3OY9 A;  1VQK N;  3LWL A;  2FBY A;  1TK5 A;  2V51 B;  2OTL N;  3BEX A;  4PL7 A;  2BTF A;  3HTV A;  1VQL N;  2YHX A;  4H0V B;  5HRP A;  1JLE A;  5BPN A;  3SV3 A;  2HNZ A;  4BE1 A;  4DS5 A;  1NWK A;  2RE2 A;  3HI0 A;  4OJR A;  3C65 A;  3RTV A;  4QCL A;  5AQO A;  1BI4 A;  2YKN A;  3QIN A;  1XQS C;  3M8P A;  1U48 A;  3VES A;  1YUW A;  1RFQ A;  4GVE A;  1QQN A;  4HWI A;  1BI4 B;  3CJ7 A;  4CJU A;  3VEW A;  5MLC Q;  3CFO A;  1IKW A;  1VSK A;  2FSK A;  3PO5 A;  4CD1 A;  4ZTJ A;  1NGA A;  1NJZ A;  4JKD A;  2IGI A;  4CZH A;  3PIO L;  2YKM A;  4IOC L;  1X9S A;  4G9Z A;  2KFN A;  1IO2 A;  1HNI A;  5CHI A;  3CPW M;  4LF5 K;  4YOY A;  3K59 A;  2VWK A;  3AVN A;  3RSE A;  3SUN A;  3CCE N;  1L3S A;  5C42 A;  3CI5 A;  3EL2 A;  2G8V A;  1RIL A;  3FZF A;  4CZM A;  3VQP A;  1KFD A;  3KIO A;  4FJH A;  2HMP A;  5FDL A;  3EN9 A;  4W5Q A;  4JKA A;  2OZM A;  4KPY A;  4CHN A;  4NB4 A;  4CEA A;  5C24 A;  4MDA A;  2P51 A;  3H3N O;  1X9W A;  1BGX T;  2IVP A;  1JCF A;  1J54 A;  4IG3 A;  1K8K A;  4KB0 A;  1D4X A;  1J5E K;  4CER A;  3OS0 A;  3KLE A;  4LF9 K;  2D0B A;  4FJI A;  4JKF A;  4B08 A;  1YJW N;  3C7N B;  1F21 A;  2G8I A;  1B9F A;  4Z0U A;  1RBR A;  1U2V B;  2P5G A;  3BZK A;  4CZL A;  2NRX A;  4X65 K;  3EE9 A;  1Q82 O;  3CJC A;  1C1C A;  4BRL A;  4CFA A;  3G25 A;  4C1N I;  5AQS A;  3CFP A;  1ASW A;  1K73 O;  3RVC A;  3AVB A;  2OPR A;  2DFF A;  3LWM A;  2PBD A;  3WXM B;  3SUP A;  4RG8 A;  2Q0R A;  3LDS A;  2RHK A;  3NFA A;  1R59 O;  3VF4 A;  2XY7 A;  2FXU A;  3AA2 A;  2I5J A;  5F0X A;  3O3G A;  5HRS A;  4U67 L;  2HNY A;  2IC3 A;  1SAZ A;  2I7P A;  4BRF A;  4IKF A;  3HSC A;  4QS7 A;  2XY8 A;  2XY5 A;  3CG7 A;  1QQC A;  4Z4H A;  1ZBU A;  4BGA A;  3TAP A;  3VEV A;  2BE2 A;  3VTI A;  1FKO A;  1I39 A;  3VEY A;  1TYQ A;  4C8L A;  4M3U A;  2P9K A;  4K0K K;  4PA1 A;  4DF8 A;  4KHY A;  4UY8 O;  4E7J A;  2P9S A;  4FW2 A;  4DSL A;  1BOT O;  3CCU N;  3TR8 A;  1RT6 A;  2IAJ A;  2OA8 A;  4BVP A;  2P9K B;  4NYF A;  2E88 A;  4JK7 A;  4OKE A;  3TSP A;  4CK3 A;  3SAG A;  3TWH A;  3NF7 A;  1E4F T;  5AR0 A;  1VQO N;  5LJW A;  4BR5 A;  4EZ6 A;  4DQP A;  4XH1 A;  1YHQ N;  1KVA A;  4BR0 A;  4R5P A;  4BRA A;  3EZ5 A;  4K42 A;  3MEE A;  2KFZ A;  4ISE A;  3RR8 A;  3THW A;  4LFC K;  5ELZ A;  4DSJ A;  4OLB A;  4JI1 K;  3SMP A;  1ZXO A;  1TAQ A;  3W0L A;  3MXM A;  3THW B;  3DLH A;  2YCH A;  3MED A;  5M1N A;  4HVJ A;  3G4S N;  1N32 K;  3LP0 A;  4RW7 A;  4BG9 A;  3KWI A;  4HTL A;  4HHT A;  1TV6 A;  3ZLJ A;  2KTQ A;  1WLJ A;  1U45 A;  4BR2 A;  3HVR A;  4B9N A;  2H3G X;  2E2P A;  3OYA A;  3OYB A;  1A5X A;  1XUP O;  3DI6 A;  3FZH A;  2X6S A;  3V9S A;  5F2R A;  3IUC A;  2JLE A;  1JCG A;  3CXC M;  3I8B A;  1HKC A;  1Q81 O;  3QBX A;  1KRP A;  1NK6 A;  3A5M C;  4KTQ A;  4O55 A;  4OPA A;  4DLE A;  4BRG A;  4DV5 K;  4DFM A;  4X62 K;  2QWQ A;  4W5N A;  4CJ5 A;  2ZM6 K;  2QI2 A;  3O8M A;  4M3T A;  5AQV A;  2EWS A;  4KFB A;  1NBW A;  2P9N B;  2I7N A;  1JLQ A;  3SLC A;  3NH0 A;  3QIC A;  4DS4 A;  2RN2 A;  4CFB A;  1HKG A;  5AQJ A;  3V9W A;  3QEV A;  1IBK K;  2KLA A;  3KLF A;  1IBM K;  4OPK A;  2X6N A;  1QZ6 A;  4JI7 K;  3ZSO A;  1E4G T;  3ZSZ A;  3QB0 A;  1V4T A;  2YJF A;  2QWO A;  3QNN A;  3NMU A;  1JLF A;  4F4K A;  5J1E A;  2UUC K;  1NKC A;  4JKE A;  4CGD A;  4FK4 A;  2GUP A;  4DUY K;  1DTQ A;  2P9L A;  1VRT A;  1KAX A;  3BF1 A;  3NGY A;  3CM6 A;  3VQ6 A;  1IKV A;  5J2P A;  4DSI A;  2BDP A;  3H45 C;  2FSN A;  4O8K A;  3ID6 A;  4FO0 A;  1KTQ A;  5F1X A;  4M42 A;  2P9L B;  4JHD A;  3NVK A;  2XRI A;  2B5J A;  3HVT A;  1Q7Y O;  2HHW A;  3B6O A;  2J4R A;  1NGD A;  3AVH A;  2F7T A;  3V9X A;  4NCB A;  1QTM A;  2QTD A;  4JHD B;  3HT3 A;  1NK4 A;  1L3V A;  4V19 S;  4YFU A;  1XMQ K;  2KZZ A;  4B9L A;  2NRH A;  4ZHR A;  1O1W A;  2X74 A;  3MXJ A;  4LY7 A;  4B9Q A;  5BR9 A;  1HNX K;  1VAZ A;  1YI2 N;  1VQ5 N;  4IXC A;  1NGF A;  4FJJ A;  3BZC A;  5B8H A;  3M8R A;  1ZBL A;  3NH2 A;  4E7K A;  2O8C B;  4CJS A;  3H3O B;  4MO5 A;  1EO1 A;  1DKG D;  4K43 A;  3OYH A;  4OPH A;  3P38 A;  4I7F A;  4DTN A;  2V7Z A;  4E89 A;  1L3U A;  4DQR A;  1VSI A;  3MAQ A;  3ZSR A;  3O4N A;  4OPJ A;  5KPR A;  3AA3 A;  3ZT3 A;  4NXM K;  3I0R A;  2QK9 A;  4BY9 C;  1E3M A;  1UOC A;  1U47 A;  1WSE A;  2CGK A;  4O5F A;  4F8R A;  3MMV A;  4B1U B;  3WXI A;  1WSG A;  2YNG A;  3U3Y A;  4KHN A;  4DTO A;  1WSF A;  2A40 A;  2D0A A;  4I2P A;  4EFH A;  4FWP A;  4CZG A;  4YOV A;  3JXU A;  4OGE A;  1XC3 A;  1ZC6 A;  3KK3 A;  4GY2 B;  2VG6 A;  5LL6 Z;  1KSP A;  1REV A;  2QXL A;  5C0Y A;  3CER A;  1XHX A;  1WN7 A;  2NNW A;  2UYT A;  2IS3 A;  2E6L A;  1D9D A;  3AGK A;  1QHA A;  1RDA A;  4A57 A;  3C95 A;  3OYI A;  2D1K A;  4CZJ A;  2UUA K;  4IFE A;  3HJF A;  3O9Q A;  3QDK A;  3ZX0 A;  1T6D A;  4DU3 A;  5BPM A;  3AAQ A;  3QNO A;  3VQQ A;  5CY4 A;  1C1A A;  1GLE G;  2P9I B;  3PUF A;  1SV5 A;  4KB1 A;  2GWJ A;  1S9G A;  4NLB A;  5DMR A;  2YI1 A;  4B1Y B;  3E9L A;  2FSJ A;  2AA4 A;  3B6P A;  4CIE A;  2XY6 A;  1RTI A;  4R79 A;  3VEO A;  1VQ9 N;  3VET A;  4CHO A;  1Q9Y A;  3OA9 A;  5LJV A;  2O8D B;  3OS1 A;  3HM8 A;  5GAD P;  3AVI A;  2DFH A;  4KHS A;  1S1X A;  3VQ9 A;  1HRH A;  4H5R A;  4LSN A;  4GV6 A;  3ATU A;  4MQ3 A;  4A5A A;  2F8S A;  3HPH A;  4DR3 K;  4DTX A;  2GV9 A;  3ZET A;  3SBT A;  2PY5 A;  4M3Z A;  5J2Q A;  4JV5 K;  4CCH A;  3ITH A;  1LV5 A;  4BRI A;  2QEX N;  3LZJ A;  1JLA A;  2KZM A;  2YV0 X;  3O9S A;  1RCH A;  4KHP K;  4FWR A;  4LH4 A;  3ULE A;  4IDK A;  4DKW A;  1BIU A;  2HBK A;  3PX0 A;  5HP1 A;  5LMU K;  3M5R A;  1ILY A;  4AF1 A;  1IJJ A;  1KCF A;  4C8N A;  3TTC A;  3ULE B;  1SKR A;  4B3S K;  4ILG B;  1S6Q A;  4CJQ A;  4GNI A;  3CQX A;  3MX5 A;  3V4I A;  3UE5 A;  5TKY A;  5AQM A;  4BG8 A;  3MEG A;  3OYF A;  4YDU A;  3RR7 A;  4MDB A;  3DM2 A;  5E84 A;  3V81 A;  3LP3 A;  3SQ2 A;  1EWQ A;  2IDO A;  4OO1 J;  1SKW A;  3CJ9 A;  3C6A A;  3NHG A;  1G99 A;  3MN6 A;  3CC2 N;  3K58 A;  1NJX A;  1RBT A;  4DR6 K;  2QWM A;  1HR0 K;  4JRQ A;  4CZE A;  4Z94 A;  3ZX2 A;  2RKI A;  1RBU A;  4PY5 A;  3M6G A;  3WT0 A;  2HF3 A;  4AM6 A;  3FZM A;  3S3N A;  1N34 K;  4CJ7 A;  3KD1 E;  3FR0 A;  4HTU A;  1SL1 A;  4OVL A;  4JI6 K;  3VGK A;  2FC0 A;  4EIA A;  4O8U A;  4CIG A;  3A8Y A;  4KI4 A;  4I9Q A;  1N36 K;  3NGI A;  2O8F A;  3PY8 A;  5BN8 A;  4KRF A;  1LWF A;  2F9W A;  2WON A;  3AO3 A;  2Q2R A;  2O8F B;  2R7Y A;  4BWJ A;  3D0P A;  3UKU A;  3L4I A;  5KGX A;  3CHW A;  1HX1 A;  3NF6 A;  1W97 L;  3QO9 A;  4BWM A;  3CCL N;  3AVA A;  2YHB A;  2YHW A;  4KAZ A;  3DXK A;  3O9R A;  1LW2 A;  1DTT A;  3UKU B;  3T1Y K;  1GLB G;  1Y97 A;  3T3F A;  1Z6R A;  3N4P A;  1BL3 A;  3PIP L;  1VQ6 N;  2E8A A;  3VQB A;  5JLF A;  1NGE A;  4DF4 A;  2NRT A;  3DXK B;  4FLX A;  1SL0 A;  1RT3 A;  5AQG A;  4LF7 K;  3F2K A;  1NGC A;  3M8Q A;  4YOT A;  1NK0 A;  4RW9 A;  1GLA G;  4J2A A;  3G71 N;  5FRN A;  4PL8 A;  3O6W A;  5FPE A;  1GLD G;  3TAG A;  1MU2 A;  1O13 A;  3H1Q A;  2D5R A;  1BDG A;  3VGM A;  1JJ2 M;  4JNE A;  5KTQ A;  3TTD A;  2Q3S A;  4DHY A;  3K5L A;  3L6Q A;  4CF9 A;  4W5T A;  4B9U A;  4OKK A;  3RMD A;  1JXE A;  1RTJ A;  4DV7 K;  3QEP A;  1W0H A;  1ATN A;  2V7Y A;  2ZQB A;  1TAU A;  5FPN A;  3MEC A;  4IDH A;  2BUP A;  1X1P A;  4C1N K;  4CEO A;  3GE1 A;  4ISG A;  4YOU A;  1S72 N;  1J9A A;  1BA1 A;  2B4J A;  2HB5 A;  3FFK B;  2Z1J A;  3T1H K;  2F4V K;  1Y64 A;  3DJC A;  3HYF A;  1GOB A;  2E2N A;  4X64 K;  1RGI A;  4JS5 A;  4JD2 A;  1VSL A;  3TAM A;  2VQF K;  3RSE B;  3OYN A;  4FL9 A;  1TVR A;  1JLC A;  3J7Z O;  5LMN K;  3HO1 A;  3IAY A;  5JMV A;  1QVG M;  2HHX A;  3S41 A;  1LAV A;  4W5R A;  4FVU A;  5M1K A;  3IRX A;  4O0J A;  1XNQ K;  1C0M A;  2DTU A;  3V9U A;  4FSV A;  1TUU A;  4LSL A;  4Z4G A;  4BDY A;  3AA5 X;  4ILH A;  3HK2 A;  4AIL C;  4BC3 A;  3TAB A;  2HBJ A;  1CZ9 A;  4GVM A;  3A5L C;  1RT4 A;  3FFI A;  3K57 A;  1UA1 A;  5BN9 A;  4I9L A;  3B8A X;  1K8K B;  1KVC A;  3Q7C A;  2VCP A;  4FPB A;  4YNQ A;  2O8E A;  3LDL A;  1S1U A;  2RF2 A;  4PUO A;  3TPQ A;  3L2U A;  2BAN A;  3KWG A;  1XWL A;  2QWN A;  4M3Y A;  3ENO A;  5HLF A;  4E19 A;  1W2B M;  2WOM A;  1TUY A;  2O8E B;  4WQ5 A;  4FJN A;  1GLC G;  1LWC A;  4PWD A;  3PSI A;  4CBW A;  1QVF M;  3AGR A;  1YIT N;  1EET A;  3MWP A;  2NZT A;  3ATV A;  4FZX C;  3H46 O;  4AHR A;  3CQ8 A;  1RBS A;  1HQU A;  3QIO A;  3SCX A;  2AJQ A;  5CYQ A;  1HNW K;  3OTO K;  3WQU A;  3E9P A;  4BAC A;  4FK2 A;  2GEL A;  2ITM A;  4ID1 A;  5DK5 A;  1ZBH A;  3QBW A;  1BQN A;  3DYA A;  4BVO A;  4FLV A;  4L8R B;  4BRE A;  4OX9 K;  2CGJ A;  4CHP A;  3LDN A;  1KD1 O;  4JS4 A;  3PX6 A;  5IT9 O;  4M41 A;  4CEC A;  1WSJ A;  4JI8 K;  5SWM A;  2Z1I A;  1IKY A;  4UQG A;  3JSM A;  3G6E N;  3AV9 A;  1P90 A;  4JEP A;  3KK7 A;  4B3O A;  1HLU A;  3KJV A;  1TKX A;  3NBP A;  2QXF A;  2AP1 A;  3G0Z A;  3U8X A;  4HCC A;  2NRZ A;  4AHT A;  5E26 A;  2NRR A;  4CIF A;  5BRE A;  2ITG A;  1TYQ B;  2DY4 A;  3KLI A;  4FLT A;  1DGK N;  3IS9 A;  3MK6 A;  3IMX A;  3V9Z A;  1WAF A;  3JS6 A;  2P9S B;  4IFV A;  3EKU A;  1D5A A;  1DT9 A;  1QHT A;  4IZ9 A;  4CJE A;  3CCV N;  1NKE A;  4JK9 A;  5KQD A;  5K14 A;  2W40 A;  5DM6 L;  4B3T K;  1WBD A;  4O5B A;  3A5N C;  4WF9 L;  3TSU A;  4CEQ A;  5BRF A;  1ATR A;  2W6K A;  3CJA A;  4A2B A;  4Z4C A;  3KK2 A;  5C2F A;  2JGU A;  2D0O A;  4H0X B;  1T03 A;  1QZ5 A;  4RWT A;  2Z1G A;  1WAJ A;  2E2Q A;  4DSK A;  2QA4 N;  4I6M A;  2HBM A;  2E6M A;  3HOS A;  3G10 A;  2PYL A;  1Q86 O;  5SZT A;  4I6M B;  2Q1N A;  2ZWH A;  3CC7 N;  4FZZ A;  1IV0 A;  3Q7B A;  4FWS A;  3K2P A;  1UAX A;  1LW0 A;  3HPG A;  4Y1C A;  1X3N A;  4EP5 A;  1KFS A;  1NM1 A;  4B3M K;  3H08 A;  4H4M A;  3VQE A; 
#chains in the Genus database with same CATH homology
 3BZC A;  1OVQ A;  3BZK A;  1NU0 A;  1IV0 A;  1NMN A;  2OCE A;  3PSF A;  1VHX A;  3PSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...