1NU0A

Structure of the double mutant (l6m; f134m, semet form) of yqgf from escherichia coli, a hypothetical protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
131
Chain Sequence
MSGTLMAFDFGTKSIGVAVGQRITGTARPLPAIKAQDGTPDWNIIERLLKEWQPDEIIVGLPLNMDGTEQPLTARARKFANRIHGRFGVEVKLHDERLSTVEAGGYRALNKGKVDSASAVIILESYMEQGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yqgF
publication title Structure of yqgF from Escherichia coli, a hypothetical protein
rcsb
source organism Escherichia coli
molecule tags Structural genomics, unknown function
total genus 35
structure length 131
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03652 RuvX Holliday junction resolvase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.140 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 YqgF/RNase H-like domain 1nu0A00
2OCEA 1NMNA 1OVQA 3BZKA 1NU0A 3PSIA 3BZCA 1VHXA 1IV0A 3PSFA
chains in the Genus database with same CATH superfamily
3V1OA 3D45A 3O9RA 3OYCA 3OS2A 5FRMA 4CZHA 1A5VA 3I8BA 4BRFA 1HNXK 4CZGA 2B4JA 4DTUA 1I39A 2ZJQL 1EWQA 2PYLA 3BZKA 3VEXA 4IOAL 3NH1A 1ZBUA 4DTRA 2XY6A 3O4NA 3RMDA 3VQ8A 3N4QA 5CR4A 2NRZA 3I0RA 4OPKA 2NRHA 2QI2A 1XI1A 2UXBK 3VF4A 3DJCA 1QQOA 2XY7A 4Z4IA 1CLQA 4CIEA 3B6OA 4IDHA 4EZ6A 1XUPO 4JI7K 1VSFA 3FZLA 4CD1A 1TUYA 3NBPA 4DR2K 2ZWHA 4FWNA 1ZC6A 5DM6L 2O8EA 1ITGA 1JXBA 4HVJA 3LZIA 1FK9A 3R3LA 3THXB 4LFAK 1TV6A 1NK0A 1S5JA 1S1XA 2VG5A 2HMIA 2NUBA 3NGYA 4ELTA 1CXQA 4BRAA 5M1KA 4CJEA 3HYFA 3D2EB 4BR2A 1RT4A 1XMQK 4V19S 2RKIA 3L3VA 4K8ZA 3O9SA 4K43A 4YFUA 2E8AA 2Y1IA 4ISGA 3AVNA 4BRIA 1RTIA 4BRQA 1NGHA 3O9TA 4PHTX 2P9NB 1T6CA 4CGHA 2RPIA 3IDHA 3LAKA 2P1JA 4O0JA 3UE5A 1BIZA 2GELA 4IEIA 4E1NA 1VQ4N 3VA0A 4DQQA 3WEEA 4BC3A 3MDQA 2ZJRL 5CYQA 4FYDA 5CHIA 3KLHA 4IG0A 1KLNA 3CPWM 3V1QA 4JKGB 4I7FA 2WBNA 3UKRB 3F2KA 4BC5A 4GKKK 1HPMA 3IRXA 1TL3A 1S1UA 5CZ2A 5AQPA 3FLCO 3Q7BA 3QNOA 4OKKA 4BR5A 4AQYK 3L6QA 2D0CA 3VPZA 4H5VA 2HBMA 3QLHA 4B1WB 3OY9A 1NK8A 3QEPA 1VSLA 3KK1A 3CM6A 2UUAK 4M3WA 1QHAA 1RDCA 3SV4A 1ZBFA 2CGLA 1JCGA 1GLDG 3OHRA 4Z4FA 1X9SA 5CY4A 3P4IA 1TK0A 4CGDA 4DMNA 3NGIA 4KTQA 4YOXA 5JMVA 3KWGA 1EX4A 3LM2A 2HNZA 2QXLA 4JI0K 5D3GA 2A3ZA 1D5AA 5SZTA 3NCIA 2FBTA 4A62A 3BZCA 3ZSZA 2VG7A 1Q18A 1MU2A 3MCAB 4CFDA 4DFKA 3LDPA 1EO1A 5J2PA 4K0KK 2ASPA 2HW3A 4BG8A 4QS9A 4RG8A 2O4GA 4JKEA 4JYAK 3CI5A 1GOCA 3AA3A 1EQYA 4DF4A 2YJEA 3OYEA 4IJNA 3WNHA 2YHAA 5C2DA 4RWTA 3FE1A 3ZSOA 2G8UA 1JLBA 3J7AP 1JLAA 4ELVA 4KI4A 3FR0A 4IXCA 1Q7YO 1FW6A 1RDBA 2QWOA 1L5UA 3A8YA 3CPEA 3AVBA 2IVOA 3MXIA 5AQXA 5AQSA 4Z4HA 4XH4A 4FJIA 4WFNL 5AQUA 3THYB 3L4IA 1T03A 3RRGA 4N41A 5F1XA 4B3TK 4ZHRA 1HRHA 2ITMA 2Q97A 4M63C 4BRPA 1TYQB 1HPZA 1I94K 3L0QA 2P9SB 1HX1A 5KPZA 3O3GA 3THXA 4B1YB 4HUEA 1IBMK 2W6LA 3BF3A 1QSLA 3D2EA 4CGJA 1QVGM 4G9ZA 1HLUA 5E84A 5J2QA 4DV5K 3WT0A 3PX0A 1JJ2M 1NGGA 4O4GA 3CXCM 1C0FA 1C0TA 1GOBA 4JKDA 3EKSA 4PA1A 3CF5L 1OH7A 3OYGA 2P9NA 2JWKA 4A61A 4CHZA 3QBXA 1X1PA 3G0ZA 3OBWA 1C1AA 1U45A 2QK9A 1NKEA 5K14A 4B9SA 3L8BA 1VSEA 1TK8A 4DTOA 5J2NA 3VEZA 3FFKB 2A1RA 4JHDB 3JSMA 5FROA 2NRVA 1J53A 2E2QA 3A5NC 3AGKA 4JKGA 2H3GX 3UKRA 1T44A 3CC2N 2E6MA 3SAGA 4ISFA 3PIPL 3K5MA 4KB1A 4M7XA 3SUNA 1QZ6A 2E1YA 4N76A 3DLRA 3SJJA 4A2AA 1IBKK 2HVHA 4PKIA 3E01A 4AILC 5AZIA 3DI6A 1LAVA 2J4RA 1E4GT 4JK7A 1VRTA 2AP1A 3VQ6A 1YJNN 2YNIA 3OYLA 2P9KB 1GLBG 3LL3A 4CEEA 1NU0A 3IMXA 1ZBLA 4JKAA 4E7JA 1NOYA 3AAPA 1VSMA 3ZSWA 3QINA 1BHLA 1OH8A 4DSFA 3PX4A 4BRLA 3S3OA 3HJFA 4GNIA 4F4KA 4EFHA 4L8RB 2IIRA 4CESA 3C94A 3WQTA 4ZTFA 1KVCA 3J80O 4IO9L 1P90A 3ULEB 2UU9K 3V6DA 4CEDA 1HR0K 4J8FA 1GOAA 3MX2A 1CZBA 3KJVA 2WONA 4CJ7A 1NGAA 1KC8O 3DRSA 2P9LB 1HYSA 3MK6A 1WUAA 4FL9A 5LJVA 3SCXA 2B6AA 5EOYA 1SKSA 4J2BA 3NGZA 3NH2A 2VWKA 4JI8K 4OPJA 4FM0A 3T1YK 3O4WA 2GWKA 4MQ3A 1WSGA 4FWKA 4W5RA 4IOXA 3OJSA 3K5LA 1HNZK 1N36K 4JS5A 1SS6A 2YHBA 3K57A 3O6WA 4FVMA 1TYQA 3A5LC 1DTTA 3T3FA 1BO5O 4I2QA 4Z0UA 2OPQA 3D2FB 3H08A 3QEIA 1TGOA 2P9SA 4R5PA 3VTHA 5CYMA 3OJUA 3KK2A 4KV8A 2NNWA 2NZTA 4CJ3A 3NF7A 1NWKA 4DLGA 4YORA 3GG4A 3DAWA 2FC0A 4FLZA 3R8EA 2E20A 4F3OA 4OGEA 3O80A 3SLCA 1D9FA 2QWMA 1JCFA 3LZJA 2WOMA 1CZ9A 1KFDA 2I5JA 2XHBA 4CGIA 3E9OA 2VQEK 4H0VB 4A5AA 4KKOA 1LOTB 4CZEA 2WC9A 5AR0A 3HP6A 5F2RA 4JHDA 2HF3A 1RT7A 3HPGA 4G1QA 4MLEA 4DUYK 4B3SK 3CCJN 1IBLK 5AQKA 3ZEUB 4NXMK 5KQ8A 3HZ6A 1YUWA 1J9AA 4IFYA 3KIOA 2RE2A 3R9PA 1N33K 4CEOA 4OLAA 4DR5K 3HVRA 4JLHA 3KD5E 2KQ2A 1IG8A 4GV3A 1YITN 3EE9A 3EKUA 4KPYA 3AO5A 1Z6RA 1XC3A 2IGIA 2YKMA 5KRTA 2KHOA 2ZGYA 2OTLN 4O5FA 1DEJA 4ILJA 2YV0X 2O8EB 3ZSXA 2OA8A 4HCBA 3K58A 2ASOA 3HP9A 4B9UA 4ICLA 1BQMA 3L2RA 4DV6K 3PY8A 3SQ1A 1RBVA 4E89A 3KTQA 1T7PA 4FWRA 3TSPA 3K5NA 4KHUA 5HROA 1VHXA 1ESVA 4R79A 2B5JA 4FJLA 1S6QA 2HBLA 3EZWA 3VF6A 4BVPA 4YOWA 2YHYA 3EN9A 1Z25A 3MXMA 1GLFO 4BR7A 3WNEA 4M3UA 3ULEA 5AQTA 2QWPA 3TSQA 4C8LA 1REVA 2HHQA 3VQAA 4YY3K 2ZE2A 4CD3A 4KH6A 4H0OA 1YTAA 2E1ZA 2P9LA 1FKOA 3HSCA 2IC3A 4FJXA 4JI1K 2P51A 5SWMA 4B9VA 5KPTA 1WNSA 3MN7A 3C7NB 3CCSN 1K8KB 4CZKA 3A5MC 1RT6A 4UQGA 2RN2A 3OS1A 4BR9A 3O1WA 3VESA 3P83D 4FLTA 4E1JA 2XO7A 3ZT4A 4EAHD 4X66K 3BY5A 2Q0RA 4NO7A 4RW6A 3D2FA 1HKGA 4NXNK 4IO8A 4JI2K 4AHTA 3PIOL 4A57A 4FK2A 4W5OA 4C8OA 3FZMA 1BGXT 3CQYA 2YKNA 2GUIA 4NYFA 2UYTA 1Q82O 1YTUA 3DOLA 4CZMA 4ID5A 3F9MA 3H3NO 4C1NK 1JLCA 5AQZA 1F21A 2CH5A 4JS4A 1S22A 5BRHA 1LW2A 4CW7B 1OH5A 3S41A 3AAQA 3AVAA 4YOTA 3LWLA 4BGBA 3V9ZA 3QDKA 3CJBA 1XWLA 5BRFA 2EX3A 4HCCA 3EEQA 4GV9A 5FPDA 1VSHA 5KGXA 1TUUA 3KLIA 5EX5A 4QCLA 1KXPA 3NH0A 5KRSA 4LD0A 3OYIA 3OS0A 3THWB 3AO4A 5BRDA 3S9HA 1YXQA 3TANA 4JKFA 3ATVA 3IUCA 1JLEA 2XY8A 4GVMA 3WXJA 2A1SA 1KRPA 3AA5X 1XHXA 1BDGA 3ZEUA 1KFSA 4CZIA 4DSKA 3QEVA 4J2EA 1GLAG 2IVNA 4FWMA 3WQUA 2JLEA 4GW6A 4NYNA 1FKPA 3KKSA 3TARA 1BCMA 3OTOK 3H46O 1QVFM 5KPRA 3UIQA 4UY8O 3J81O 3HPOA 3D7EO 4DSLA 4O5BA 3EL2A 5AQNA 4RTFD 3H45C 4XIUA 4KH4A 1FXXA 4C8KA 4K42A 3P31A 4DQRA 5JS2A 4CF1A 4AF1A 4OX9K 1SV5A 1QS4A 3HBTA 1KQSM 5FPMA 2FSJA 4JN4A 5FRNA 4FJKA 3VQ4A 4H0YB 2FBVA 5AZJB 4LF8K 1TVRA 3CM5A 3LDLA 4MLHA 4DG1A 4CHYA 3AVLA 1Q8IA 3K9KA 3ENHA 3RRHA 3TABA 3VETA 2EWSA 1VRUA 5T7BA 2XY5A 1SAZA 4CHPA 4FWQA 3CC7N 3VEVA 3RMCA 2D5RA 1KD1O 3SJHA 3PO4A 4LFCK 3SBGA 5KTQA 1VQ9N 3NMUA 3O5BA 2QW9A 1KAYA 3CYMA 3RTVA 3SQ0A 3JS6A 2NRRA 4Y0WA 3CMAN 1LWCA 4FWOA 4EIAA 3ZX3A 1S3XA 2QWQA 3DWLA 1U6ZA 1MA9B 3LPTA 3TTFA 4KHQA 1WBBA 3C7NA 5CZ1A 2HHTA 1Z26A 4CFCA 1IV0A 1K8KA 4B1XB 3VQ5A 1BCOA 3T1AA 2F7TA 1RTDA 4CHNA 4CEFA 5TKYA 2PZSA 2D0PA 3HM9A 3LP1A 2XRIA 5EY4A 3WNFA 4YOYA 4JRPA 3TI0A 4FM2A 4M3ZA 5KI6A 3MWPA 4CFAA 1L3TA 1V4SA 2BDPA 2G8IA 3VGKA 3WXMB 1BIUA 3CCUN 2CGKA 3VQ9A 1JLFA 3VQBA 3E1YA 4GKJK 3H3OB 2W42A 1D4XA 5AZIB 4CEQA 2LSNA 4FVUA 3JYTA 4IOCL 2BH1A 5ADXH 3EE8A 5AQLA 4YOUA 4DQPA 2WUSA 4GY2B 3CG7A 3SNNA 3I0SA 4KHYA 3CCQN 3J7ZO 3GOIA 2FBYA 3UKUB 1SL2A 3OYHA 4WQ4A 5AQHA 2P9PB 4B9MA 3IS9A 5M1QA 2HHHK 4EZ9A 4CJQA 3U6FA 1S9EA 2IS3A 3OA9A 3THWA 5LL6Z 3A0IX 2HHUA 2GTDA 4FO0A 2OTJN 1SL0A 1EETA 4Q5VA 4FLYA 2NRTA 1W2BM 1GLCG 1SL1A 3TTDA 2GX9A 3MX5A 4FOIA 4YDUA 3OYDA 2BUPA 1NJZA 4FOEA 3O9UA 5AFUA 4DTMA 4KHPK 1XNQK 3AVMA 4H5WA 5DK5A 5F0XA 1L3SA 5M1PA 3BDPA 2E2PA 2FSKA 5HRRA 3G10A 1CZAN 2GV9A 2YX6A 3CCMN 1KAZA 5EVZA 3DLEA 3QIOA 2YHWA 2NRWA 3M8SA 3SQ4A 5EU7A 5BPNA 2X74A 4KO0A 1VQ6N 4W5TA 5AQGA 4DQ8A 5I3UA 4Z4EA 4FJ5A 4DTXA 4MO4A 1LCUA 5LY3A 1U2VB 3HO1A 3A5OC 4LF6K 1RT3A 4JI5K 3ITHA 5AZJA 2GUPA 4ZTJA 4JI4K 3KVGA 4B3OA 2UUCK 2WTUA 4BG9A 2VCPA 3VQCA 4E1MA 1S6PA 3IKMA 4Z4CA 3LP2A 3SUQA 2PFUA 1VSJA 1KSPA 4JAXA 3V4IA 3OVNA 5GAEP 1NGEA 3AVIA 3RWUA 4FJNA 3HL8A 4XH5A 3QICA 4C8NA 1DTQA 1YVNA 1DKGD 1BOTO 4GVEA 5BR8K 3G4SN 1DT9A 4KTWA 4BWJA 4HWIA 2FF6A 5BN9A 5AQYA 3EYZA 4DR3K 4NLCA 4E7HA 1BA0A 2HMPA 4HUGA 3C95A 3OYNA 5IWAK 3QMLA 4RW7A 3B8AX 4HTLA 3ZSVA 4J2AA 1G99A 4PUOA 5GAGP 3T1HK 1Z05A 4RCHA 3TR8A 2HNDA 3RR8A 3V9XA 1N5YA 1NGCA 3WNGA 3CFPA 4LFBK 2ZQBA 4NCAA 3EO3A 2O8DA 3ZCMA 1YF5L 3VQQA 3HM8A 2QM1A 1NMDA 3FZFA 3I8DA 5C15A 1EP4A 1U4BA 1IKXA 1VSKA 4IZ9A 2HNYA 1EWRA 2QWRA 5HL7L 1YHQN 1VQ7N 1I3AA 1NMNA 4DR1K 3SMPA 2Z1JA 3GE1A 3QB0A 4K41A 1SQKA 4FWLA 1S72N 1YVUA 3VEYA 4B3RK 3T19A 4AH9A 1L3VA 1GLLO 1WSFA 3MMVA 3ZT3A 2V7ZA 1RDWX 4B9TA 3DLGA 5HLFA 1RT5A 3UKUA 3ATUA 3NDKA 1BA1A 1BI4B 1X9WA 4E7LA 1Q9XA 2P9PA 1WSIA 3CJ1A 1N8RO 2X6SA 3MEGA 2ZJPL 3J8AA 1U47A 1WOQA 3RSEB 4IKFA 4KBOA 4H5TA 1M1KO 4B1ZA 3HRGA 2HHSA 3RVCA 4DR7K 2E4LA 4DHYA 3EY1A 1LWFA 3SYZA 1MWMA 1J6ZA 4OPAA 3VQDA 1T6DA 4GMJB 4QS7A 5C12A 5JVGL 3RR7A 1XNRK 1R59O 2W41A 5GINA 2HHVA 2VG6A 1E3MA 3LP0A 4F9OA 3AV9A 3HXMA 4CI6A 3ZETA 2HOEA 2V51B 1HYVA 1NLVA 4DSJA 5AQVA 4FJ9A 3TAFA 2Q1NA 4BQZA 1U2VA 5JICA 1BWFO 4DR6K 4CEAA 4XEIA 1RDDA 5LJWA 1HJOA 3NHGA 4WQ5A 3MXJA 4DV0K 5ADXA 4JD2B 2KFNA 4OKJA 5MLCQ 3DLKA 4QAGA 5C24A 5HBMA 2A42A 2O8FB 3L4QA 3NF9A 4JEPA 4BRHA 1WBDA 1D8YA 5I42A 3DLBA 4MO5A 1U48A 4CJLA 1Q81O 1NBWA 1VK0A 4IBNA 4Y1DA 4CK2A 3BP8A 4LF7K 2KW4A 2QKKA 2O4IA 4ELUA 2YI1A 4FW2A 1GLEG 4B8AB 4WYBA 4J2DA 3K9JA 3AO1A 1S1WA 3HK2A 4YHHK 3ULDA 5JVHL 3KZBA 4BRGA 3AA4A 3PO5A 3SV3A 1HNVA 1OKJA 1QSSA 4BRMA 4AHUA 3NE6A 3M6GA 4PKHA 2FXUA 4FLUA 4CJVA 1D9DA 2BE2A 4DQIA 4CF9A 2G8FA 3MEDA 3O9QA 2I7PA 3LM9A 3PSFA 1NJIO 1C1BA 1NM1A 1UA1A 4U67L 3P39A 3CQXA 1NK4A 2E6LA 1MDUB 4DS4A 4B1VA 3FFIA 3C6HA 1MWKA 4CF0A 2G8HA 4DWIA 2OPRA 4HUFA 4H0TB 4BVOA 4O44A 3UB5A 1JLQA 1ASUA 4A2BA 4CZFA 4H4MA 4E19A 3LDSA 3GBTA 4FJHA 2V7YA 4JK9A 3ZSYA 3D6RA 5DM7L 4B9QA 4LSLA 4FCYA 1W97L 5HP1A 1YT3A 1NNEA 2YHXA 1BI4A 3MECA 4U7BA 4DV7K 5I9EB 2D0OA 1WB9A 4YNQA 2Q31A 1NKCA 2I7NA 1QTMA 3RSEA 4OVLA 2X78A 3CETA 3KK3A 1FJGK 4KRFA 3BGRA 4JRQA 1SKRA 1IKVA 1XQSC 1VQMN 4F3TA 4PY5A 4I6MB 4B8CA 1RT2A 1J54A 1TKDA 3NVKA 2JWLA 3HI0A 4CGFA 1HNIA 4FWPA 4M7YA 2HB5A 4AHRA 4LH4A 1RBSA 2ATQA 3PSIA 2P9IA 5LMUK 4DUZK 1ZBIA 2PYJA 2GWJA 4X65K 3F9KA 1OH6A 1RBRA 3C6TA 5AQJA 4JNEA 5FPNA 4N5SA 3QFPA 4M42A 3OBYA 1NGIA 3K5OA 4CEZA 5BPLA 5C10A 1ZXOA 4WCEL 3OW2M 3VERA 3OYJA 3G71N 3LDNA 4H0XB 1KAXA 1RNHA 4PKGA 4WQ4C 1U49A 2OPPA 3VGMA 4JD2A 3AVCA 4BC4A 4BROA 4EHTA 3ZSQA 1BU6O 3U4LA 2PAVA 3CJ9A 3D0PA 1QQMA 3M5RA 1NGDA 2ETJA 3SI6A 4FJ7A 1M90O 3CQ8A 2O8FA 2ZM6K 4BC2A 3VTIA 4E7IA 4OKEA 5TKWA 4KAZA 1DGKN 1TL1A 4CJSA 3M3ZA 2IDOA 1B9FA 4BGAA 3F73A 4YDUC 2BTFA 3LANA 5EXWA 3DLHA 4C23A 4Z4GA 3C6UA 5JS1A 4LF4K 4CEBA 3DM2A 3T7ZA 1HNWK 3TTCA 1HUXA 3QFUA 2HHWA 3RMAA 4DV2K 2O8CA 3CHWA 3L2WA 3CJCA 3KK7A 3AGRA 4JK8A 1UAXA 4AM6A 4CJWA 1YJ9N 3ZX0A 3CFRA 1S1TA 1W0HA 4KFBA 2F8TA 2E2OA 2A6AA 1C0GA 4MDAA 2O8BB 3K2PA 1IH7A 2P5OA 1KTQA 3ZX2A 5ELZA 4H0PA 4O0IA 4BRKA 2IVPA 3SAHA 3OYAA 4H03B 4FSVA 4O8KA 1NGJA 3QEWA 2E5LK 1OVYA 2HHXA 3DYAA 1LWEA 4BRCA 5AQRA 4F2SA 2FBXA 2VGMA 4QS8A 4TSXA 4DQSA 3F5TA 1ATRA 4CVNE 1NK7A 2F9TA 4DF8A 4FZXC 3V81A 2A5XA 4CJTA 1WAFA 1NOZA 3PUFA 2KLAA 4XH1A 4YOVA 3IG1A 4CK1A 3QNNA 4DR4K 4FM1A 4AM7A 3H1VX 4C1NI 3NAEA 3PLAA 1VSDA 5AQMA 1NK9A 3O4QA 4KREA 3SPYA 3AVKA 3P5JA 3JXUA 1P8ZA 1WSHA 3SBTA 2FF3B 4OJRA 3K0SA 4HHTA 1TKXA 1EKEA 4B3MK 4DCHA 1HQEA 1XHZA 1RT1A 1K73O 1LW0A 2KTQA 3TSUA 4I6MA 4CF8A 4E0DA 4HTUA 2ITGA 3V9SA 1IKWA 4DFMA 4LF5K 3NFAA 4M41A 3QO9A 1IKYA 3I33A 4BWMA 3M8PA 3AVGA 1Q86O 3WXKA 5J2MA 1LAWA 1SKWA 3O3HA 3L2UA 1IO2A 2VWJA 4FJ8A 2F8SA 3CC4N 2DPNA 2G8VA 3AO2A 1T8EA 3DRRA 4E7KA 4NCBA 2O8DB 4DFPA 3CFOA 2ZF5O 2QWLA 4B1UB 3SAFA 3RMBA 3P1GA 5BR9A 4CZLA 1BQNA 3LALA 5AQIA 4FLWA 4DV1K 2QXFA 2OANA 3HTVA 4EP5A 3ZT2A 2AJQA 4FLXA 4BY9C 4DSIA 4DSEA 2DTUA 2QKBA 4M3RA 2EHGA 3CJ7A 1T3VA 3U9DA 4CE9A 4W5NA 1QSYA 1NJXA 1C0UA 3U3YA 3SQ2A 3AVFA 4AHSA 1ZYQA 4KHSA 3P38A 4A5BA 4KB0A 3VEOA 4IDKA 1HQUA 4FPBA 4X64K 2IAJA 4CJKA 1L3UA 2PBDA 3VMFB 4QOZB 2OPSA 3AARA 3JAMO 2HSTA 5JLHA 5KGWA 3ENOA 4DV4K 3S3NA 3OYFA 2Q0UA 3PX6A 4K8XA 1X9MA 4CBXA 2O8BA 2OYQA 3IAYA 3MCPA 1HKCA 4WQ5C 1N6QA 3LWMA 2KZZA 4DTSA 2DFEA 4FZZA 2KFZA 1YIJN 1ATNA 1XC9A 3MN6A 4FLVA 1UA0A 4NB4A 2UXCK 3ASMA 2OZMA 4DU4A 4KTZA 2Q3SA 3QESA 4OLBA 5C0YA 1WAJA 3ZETB 1VQLN 2Z1GA 4B9LA 3DOKA 1ASWA 3L2QA 5LMNK 1QE1A 1HJRA 3BUZB 3M8QA 2D1KA 3CCEN 4KI6A 3ISNC 1KVBA 4H5RA 2Y1JA 4IWVA 3R1XA 3LDOA 5B8HA 5HOOA 4FK0A 3KLEA 5GIOA 2YJFA 1GLJO 4FZYA 3CCVN 3AA2A 3QERA 3ZSRA 3CD6N 3TU5A 4DU3A 3OYKA 3CIPA 5A2QO 4O8UA 1C1CA 3O1BA 2D0AA 2Z1IA 3VF2A 4LH5A 2DY4A 1WSEA 4JKHA 3U8XA 2Q36A 3K59A 1A5XA 4CJ4A 1CXUA 3TWHA 1S1VA 2W40A 4CBWA 4DTPA 3J7YP 2P9UB 1BG3A 4H8KA 5E41A 1ASVA 1Y64A 3CJAA 1TAQA 5FDLA 2X6NA 4W5QA 2Q2RA 4BDPA 4ILHA 4EP4A 1NJYA 2UUBK 1WLJA 1IG9A 2GBZA 4M45A 2YNGA 2DFHA 3HPHA 1O1WA 2E2NA 4JI6K 4O55A 3KWIA 1B9DA 4CJRA 4DB3A 1RTHA 5AQQA 4BR0A 3U3GA 2ASMA 4AHCA 1NK5A 2VWBA 1JL2A 4JI3K 3EZ5A 3KKRA 4Q0BA 5AJ3K 3DMJA 1IJJA 4PL8A 4GV6A 4CZJA 1K9MO 3CMEN 4H4OA 3L3UA 4I9LA 4CJFA 3TAPA 3MWTA 4KH5A 5AQWA 3SPZA 3TPQA 4BE0A 1RBTA 4CF2A 3C6AA 2RHKA 4FXDA 4FJJA 1WSJA 4C8MA 3LPUA 3HOSA 1KVAA 1VQ5N 3MN5A 1X9JA 3AVJA 1NKBA 1BUPA 1JLGA 1QZ5A 3KLGA 2G8WA 1NGFA 3C0BA 3M8RA 1VQKN 4WFAL 1KCFA 2NLXA 1VQON 2BGGA 1C6VA 1N32K 4E3SA 4DKWA 2YNFA 1RBUA 1YAGA 3L2VA 1NG9A 4M3YA 3KHYA 1O13A 4CCHA 5GADP 5C25A 4KHWA 1X3MA 2IOCA 2FLOA 3HSTB 3B6PA 4CERA 5KQDA 5J1EA 5BN8A 3ZLJA 1HKBA 3V9WA 3TAMA 2KZMA 3LDQA 4KHNA 3O08A 4BDYA 3O3FA 3G25A 3VENA 1ZBSA 2W6KA 5CE3A 3HVTA 1VQ8N 3SZ2A 1YI2N 3H6EA 3H1QA 3W0LA 4BREA 2P9IB 1H1VA 4RW9A 2ZGZA 4M3TA 4FWSA 5M1FA 1JL1A 4DTJA 1A5WA 3U9ZA 2CH6A 2JGUA 4N47A 4Z94A 1RFQA 4BRNA 1VAZA 4BDZA 2FSNA 1BISA 4CJ5A 4CBUA 4OPHA 3E9LA 1OVQA 4WE1A 3TAGA 2HF4A 4CGGA 1TKZA 5FPEA 4BRDA 3TAEA 3QBWA 3AY9A 2DFFA 2OCEA 4FPAA 4JKCA 4AHVA 3THYA 4CJUA 2WFBA 3LAMA 1J5OA 3VN5A 1ATSA 1SZ2A 2D0BA 3SUOA 1Q9YA 1NK6A 1TAUA 2OZSA 4BACA 3HOTA 4IG3A 2AA4A 4LY7A 3SK3A 2Z1HA 4BQLA 4BE1A 1QHTA 3M1FA 5M1NA 4JV5K 3WUHA 3I56N 2HVIA 4RW8A 2P9UA 5HRSA 1JKHA 1DLOA 3Q7CA 4DV3K 3DXMB 5JLFA 3ID6A 2YCHA 3VOVA 4DS5A 3THVA 1J5EK 2O8CB 3G6EN 1NJWA 3I55N 4RW4A 4DU1A 4NLBA 2VGNA 1Y97A 2HBJA 3LP3A 4LSNA 2RF2A 1E4FT 1RCHA 1VQPN 4I2PA 1TK5A 1UWBA 3QIPA 4PQUA 4DLEA 3VGLA 4M3XA 3DXKB 1T05A 1LV5A 4CJPA 4LC9B 2G8KA 3IFRA 4WFBL 3VQEA 1G15A 3VQPA 2UXDK 4Y1CA 3KLFA 4H5NA 4LF9K 5GIPA 3CCRN 4F2RA 2PY5A 3OYMA 3FGUA 3VQ7A 3BF1A 3OYBA 4ILGB 4CHOA 3WXLA 3ENBA 4MFBA 3CERA 3HT3A 3ID8A 2E88A 4IJAA 2QA4N 3V1RA 1RTJA 1ZBHA 1HMVA 3E9PA 3VA3A 1YJWN 1VQNN 4ISEA 3NVMA 4F8RA 4CIGA 3W3DA 4CHQA 3QETA 3WXIA 2V52B 3E66A 2HBKA 4IEEA 5FLXO 4B08A 1W7AA 2F9WA 3NF8A 4FJGA 3GDQA 4N56A 1RDAA 1ILYA 4FK4A 3S3MA 3SUPA 1N34K 5BREA 2P9KA 2F96A 3N4PA 1R0AA 4FJMA 1B92A 2CGJA 5H1SQ 4DFJA 3ZYYX 3V9UA 4CIFA 5AQFA 1BL3A 1TKTA 1RGIA 1S9GA 5IT9O 3T69A 1QQCA 2KKZA 1RILA 3CCLN 5BPMA 3SMSA 4DTNA 3NF6A 3TAQA 5C42A 4OGCA 4FW1A 3ZT1A 2R7YA 3BEXA 1V4TA 1SUQA 3C65A 4CK3A 1RDUA 4EHUA 3AO3A 5DMRA 1KLMA 1QQNA 4JKBA 4I9QA 1W9HA 3GL1A 5C2FA 3WEEB 4IFEA 2D4WA 1NGBA 2QTDA 5HRNA 5AFUH 3VEWA 3FZKA 2F4VK 1C0MA 3MAQA 2NRXA 3ZT0A 1HYZA 3MEEA 3PV8A 2BANA 4ID1A 2VQFK 4NCGA 3AVHA 4BE2A 4OO1J 3O8MA 5AQOA 4PL7A 3DRPA 3QEXA 2A41A 2A40A 4L3QA 4A59A 1XMOK 1U04A 1EXQA 3DLLL 3R6MA 3A2FA 5M1OA 4BR4A 1X3NA 2GEMA 3DXMA 1K8AO 2ZD1A 1UOCA 4X62K 5E26A 1K6YA 2YNHA 1VSIA 4PWDA 1JCEA 4B9NA 3ALYA 1JXEA 4MDBA 2VYPA 4CFBA 4WF9L 2QWNA 1WN7A 3KD1E 3FZHA 5GAHP 2QEXN 4IFVA 3DXKA 4CECA 4K25A 5HRPA 3MN9A 2P5GA
chains in the Genus database with same CATH topology
2OCEA 1NMNA 1OVQA 3BZKA 1NU0A 3PSIA 3BZCA 1VHXA 1IV0A 3PSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCE A;  1NMN A;  1OVQ A;  3BZK A;  1NU0 A;  3PSI A;  3BZC A;  1VHX A;  1IV0 A;  3PSF A; 
#chains in the Genus database with same CATH topology
 3V1O A;  3D45 A;  3O9R A;  3OYC A;  3OS2 A;  5FRM A;  4CZH A;  1A5V A;  3I8B A;  4BRF A;  1HNX K;  4CZG A;  2B4J A;  4DTU A;  1I39 A;  2ZJQ L;  1EWQ A;  2PYL A;  3BZK A;  3VEX A;  4IOA L;  3NH1 A;  1ZBU A;  4DTR A;  2XY6 A;  3O4N A;  3RMD A;  3VQ8 A;  3N4Q A;  5CR4 A;  2NRZ A;  3I0R A;  4OPK A;  2NRH A;  2QI2 A;  1XI1 A;  2UXB K;  3VF4 A;  3DJC A;  1QQO A;  2XY7 A;  4Z4I A;  1CLQ A;  4CIE A;  3B6O A;  4IDH A;  4EZ6 A;  1XUP O;  4JI7 K;  1VSF A;  3FZL A;  4CD1 A;  1TUY A;  3NBP A;  4DR2 K;  2ZWH A;  4FWN A;  1ZC6 A;  5DM6 L;  2O8E A;  1ITG A;  1JXB A;  4HVJ A;  3LZI A;  1FK9 A;  3R3L A;  3THX B;  4LFA K;  1TV6 A;  1NK0 A;  1S5J A;  1S1X A;  2VG5 A;  2HMI A;  2NUB A;  3NGY A;  4ELT A;  1CXQ A;  4BRA A;  5M1K A;  4CJE A;  3HYF A;  3D2E B;  4BR2 A;  1RT4 A;  1XMQ K;  4V19 S;  2RKI A;  3L3V A;  4K8Z A;  3O9S A;  4K43 A;  4YFU A;  2E8A A;  2Y1I A;  4ISG A;  3AVN A;  4BRI A;  1RTI A;  4BRQ A;  1NGH A;  3O9T A;  4PHT X;  2P9N B;  1T6C A;  4CGH A;  2RPI A;  3IDH A;  3LAK A;  2P1J A;  4O0J A;  3UE5 A;  1BIZ A;  2GEL A;  4IEI A;  4E1N A;  1VQ4 N;  3VA0 A;  4DQQ A;  3WEE A;  4BC3 A;  3MDQ A;  2ZJR L;  5CYQ A;  4FYD A;  5CHI A;  3KLH A;  4IG0 A;  1KLN A;  3CPW M;  3V1Q A;  4JKG B;  4I7F A;  2WBN A;  3UKR B;  3F2K A;  4BC5 A;  4GKK K;  1HPM A;  3IRX A;  1TL3 A;  1S1U A;  5CZ2 A;  5AQP A;  3FLC O;  3Q7B A;  3QNO A;  4OKK A;  4BR5 A;  4AQY K;  3L6Q A;  2D0C A;  3VPZ A;  4H5V A;  2HBM A;  3QLH A;  4B1W B;  3OY9 A;  1NK8 A;  3QEP A;  1VSL A;  3KK1 A;  3CM6 A;  2UUA K;  4M3W A;  1QHA A;  1RDC A;  3SV4 A;  1ZBF A;  2CGL A;  1JCG A;  1GLD G;  3OHR A;  4Z4F A;  1X9S A;  5CY4 A;  3P4I A;  1TK0 A;  4CGD A;  4DMN A;  3NGI A;  4KTQ A;  4YOX A;  5JMV A;  3KWG A;  1EX4 A;  3LM2 A;  2HNZ A;  2QXL A;  4JI0 K;  5D3G A;  2A3Z A;  1D5A A;  5SZT A;  3NCI A;  2FBT A;  4A62 A;  3BZC A;  3ZSZ A;  2VG7 A;  1Q18 A;  1MU2 A;  3MCA B;  4CFD A;  4DFK A;  3LDP A;  1EO1 A;  5J2P A;  4K0K K;  2ASP A;  2HW3 A;  4BG8 A;  4QS9 A;  4RG8 A;  2O4G A;  4JKE A;  4JYA K;  3CI5 A;  1GOC A;  3AA3 A;  1EQY A;  4DF4 A;  2YJE A;  3OYE A;  4IJN A;  3WNH A;  2YHA A;  5C2D A;  4RWT A;  3FE1 A;  3ZSO A;  2G8U A;  1JLB A;  3J7A P;  1JLA A;  4ELV A;  4KI4 A;  3FR0 A;  4IXC A;  1Q7Y O;  1FW6 A;  1RDB A;  2QWO A;  1L5U A;  3A8Y A;  3CPE A;  3AVB A;  2IVO A;  3MXI A;  5AQX A;  5AQS A;  4Z4H A;  4XH4 A;  4FJI A;  4WFN L;  5AQU A;  3THY B;  3L4I A;  1T03 A;  3RRG A;  4N41 A;  5F1X A;  4B3T K;  4ZHR A;  1HRH A;  2ITM A;  2Q97 A;  4M63 C;  4BRP A;  1TYQ B;  1HPZ A;  1I94 K;  3L0Q A;  2P9S B;  1HX1 A;  5KPZ A;  3O3G A;  3THX A;  4B1Y B;  4HUE A;  1IBM K;  2W6L A;  3BF3 A;  1QSL A;  3D2E A;  4CGJ A;  1QVG M;  4G9Z A;  1HLU A;  5E84 A;  5J2Q A;  4DV5 K;  3WT0 A;  3PX0 A;  1JJ2 M;  1NGG A;  4O4G A;  3CXC M;  1C0F A;  1C0T A;  1GOB A;  4JKD A;  3EKS A;  4PA1 A;  3CF5 L;  1OH7 A;  3OYG A;  2P9N A;  2JWK A;  4A61 A;  4CHZ A;  3QBX A;  1X1P A;  3G0Z A;  3OBW A;  1C1A A;  1U45 A;  2QK9 A;  1NKE A;  5K14 A;  4B9S A;  3L8B A;  1VSE A;  1TK8 A;  4DTO A;  5J2N A;  3VEZ A;  3FFK B;  2A1R A;  4JHD B;  3JSM A;  5FRO A;  2NRV A;  1J53 A;  2E2Q A;  3A5N C;  3AGK A;  4JKG A;  2H3G X;  3UKR A;  1T44 A;  3CC2 N;  2E6M A;  3SAG A;  4ISF A;  3PIP L;  3K5M A;  4KB1 A;  4M7X A;  3SUN A;  1QZ6 A;  2E1Y A;  4N76 A;  3DLR A;  3SJJ A;  4A2A A;  1IBK K;  2HVH A;  4PKI A;  3E01 A;  4AIL C;  5AZI A;  3DI6 A;  1LAV A;  2J4R A;  1E4G T;  4JK7 A;  1VRT A;  2AP1 A;  3VQ6 A;  1YJN N;  2YNI A;  3OYL A;  2P9K B;  1GLB G;  3LL3 A;  4CEE A;  1NU0 A;  3IMX A;  1ZBL A;  4JKA A;  4E7J A;  1NOY A;  3AAP A;  1VSM A;  3ZSW A;  3QIN A;  1BHL A;  1OH8 A;  4DSF A;  3PX4 A;  4BRL A;  3S3O A;  3HJF A;  4GNI A;  4F4K A;  4EFH A;  4L8R B;  2IIR A;  4CES A;  3C94 A;  3WQT A;  4ZTF A;  1KVC A;  3J80 O;  4IO9 L;  1P90 A;  3ULE B;  2UU9 K;  3V6D A;  4CED A;  1HR0 K;  4J8F A;  1GOA A;  3MX2 A;  1CZB A;  3KJV A;  2WON A;  4CJ7 A;  1NGA A;  1KC8 O;  3DRS A;  2P9L B;  1HYS A;  3MK6 A;  1WUA A;  4FL9 A;  5LJV A;  3SCX A;  2B6A A;  5EOY A;  1SKS A;  4J2B A;  3NGZ A;  3NH2 A;  2VWK A;  4JI8 K;  4OPJ A;  4FM0 A;  3T1Y K;  3O4W A;  2GWK A;  4MQ3 A;  1WSG A;  4FWK A;  4W5R A;  4IOX A;  3OJS A;  3K5L A;  1HNZ K;  1N36 K;  4JS5 A;  1SS6 A;  2YHB A;  3K57 A;  3O6W A;  4FVM A;  1TYQ A;  3A5L C;  1DTT A;  3T3F A;  1BO5 O;  4I2Q A;  4Z0U A;  2OPQ A;  3D2F B;  3H08 A;  3QEI A;  1TGO A;  2P9S A;  4R5P A;  3VTH A;  5CYM A;  3OJU A;  3KK2 A;  4KV8 A;  2NNW A;  2NZT A;  4CJ3 A;  3NF7 A;  1NWK A;  4DLG A;  4YOR A;  3GG4 A;  3DAW A;  2FC0 A;  4FLZ A;  3R8E A;  2E20 A;  4F3O A;  4OGE A;  3O80 A;  3SLC A;  1D9F A;  2QWM A;  1JCF A;  3LZJ A;  2WOM A;  1CZ9 A;  1KFD A;  2I5J A;  2XHB A;  4CGI A;  3E9O A;  2VQE K;  4H0V B;  4A5A A;  4KKO A;  1LOT B;  4CZE A;  2WC9 A;  5AR0 A;  3HP6 A;  5F2R A;  4JHD A;  2HF3 A;  1RT7 A;  3HPG A;  4G1Q A;  4MLE A;  4DUY K;  4B3S K;  3CCJ N;  1IBL K;  5AQK A;  3ZEU B;  4NXM K;  5KQ8 A;  3HZ6 A;  1YUW A;  1J9A A;  4IFY A;  3KIO A;  2RE2 A;  3R9P A;  1N33 K;  4CEO A;  4OLA A;  4DR5 K;  3HVR A;  4JLH A;  3KD5 E;  2KQ2 A;  1IG8 A;  4GV3 A;  1YIT N;  3EE9 A;  3EKU A;  4KPY A;  3AO5 A;  1Z6R A;  1XC3 A;  2IGI A;  2YKM A;  5KRT A;  2KHO A;  2ZGY A;  2OTL N;  4O5F A;  1DEJ A;  4ILJ A;  2YV0 X;  2O8E B;  3ZSX A;  2OA8 A;  4HCB A;  3K58 A;  2ASO A;  3HP9 A;  4B9U A;  4ICL A;  1BQM A;  3L2R A;  4DV6 K;  3PY8 A;  3SQ1 A;  1RBV A;  4E89 A;  3KTQ A;  1T7P A;  4FWR A;  3TSP A;  3K5N A;  4KHU A;  5HRO A;  1VHX A;  1ESV A;  4R79 A;  2B5J A;  4FJL A;  1S6Q A;  2HBL A;  3EZW A;  3VF6 A;  4BVP A;  4YOW A;  2YHY A;  3EN9 A;  1Z25 A;  3MXM A;  1GLF O;  4BR7 A;  3WNE A;  4M3U A;  3ULE A;  5AQT A;  2QWP A;  3TSQ A;  4C8L A;  1REV A;  2HHQ A;  3VQA A;  4YY3 K;  2ZE2 A;  4CD3 A;  4KH6 A;  4H0O A;  1YTA A;  2E1Z A;  2P9L A;  1FKO A;  3HSC A;  2IC3 A;  4FJX A;  4JI1 K;  2P51 A;  5SWM A;  4B9V A;  5KPT A;  1WNS A;  3MN7 A;  3C7N B;  3CCS N;  1K8K B;  4CZK A;  3A5M C;  1RT6 A;  4UQG A;  2RN2 A;  3OS1 A;  4BR9 A;  3O1W A;  3VES A;  3P83 D;  4FLT A;  4E1J A;  2XO7 A;  3ZT4 A;  4EAH D;  4X66 K;  3BY5 A;  2Q0R A;  4NO7 A;  4RW6 A;  3D2F A;  1HKG A;  4NXN K;  4IO8 A;  4JI2 K;  4AHT A;  3PIO L;  4A57 A;  4FK2 A;  4W5O A;  4C8O A;  3FZM A;  1BGX T;  3CQY A;  2YKN A;  2GUI A;  4NYF A;  2UYT A;  1Q82 O;  1YTU A;  3DOL A;  4CZM A;  4ID5 A;  3F9M A;  3H3N O;  4C1N K;  1JLC A;  5AQZ A;  1F21 A;  2CH5 A;  4JS4 A;  1S22 A;  5BRH A;  1LW2 A;  4CW7 B;  1OH5 A;  3S41 A;  3AAQ A;  3AVA A;  4YOT A;  3LWL A;  4BGB A;  3V9Z A;  3QDK A;  3CJB A;  1XWL A;  5BRF A;  2EX3 A;  4HCC A;  3EEQ A;  4GV9 A;  5FPD A;  1VSH A;  5KGX A;  1TUU A;  3KLI A;  5EX5 A;  4QCL A;  1KXP A;  3NH0 A;  5KRS A;  4LD0 A;  3OYI A;  3OS0 A;  3THW B;  3AO4 A;  5BRD A;  3S9H A;  1YXQ A;  3TAN A;  4JKF A;  3ATV A;  3IUC A;  1JLE A;  2XY8 A;  4GVM A;  3WXJ A;  2A1S A;  1KRP A;  3AA5 X;  1XHX A;  1BDG A;  3ZEU A;  1KFS A;  4CZI A;  4DSK A;  3QEV A;  4J2E A;  1GLA G;  2IVN A;  4FWM A;  3WQU A;  2JLE A;  4GW6 A;  4NYN A;  1FKP A;  3KKS A;  3TAR A;  1BCM A;  3OTO K;  3H46 O;  1QVF M;  5KPR A;  3UIQ A;  4UY8 O;  3J81 O;  3HPO A;  3D7E O;  4DSL A;  4O5B A;  3EL2 A;  5AQN A;  4RTF D;  3H45 C;  4XIU A;  4KH4 A;  1FXX A;  4C8K A;  4K42 A;  3P31 A;  4DQR A;  5JS2 A;  4CF1 A;  4AF1 A;  4OX9 K;  1SV5 A;  1QS4 A;  3HBT A;  1KQS M;  5FPM A;  2FSJ A;  4JN4 A;  5FRN A;  4FJK A;  3VQ4 A;  4H0Y B;  2FBV A;  5AZJ B;  4LF8 K;  1TVR A;  3CM5 A;  3LDL A;  4MLH A;  4DG1 A;  4CHY A;  3AVL A;  1Q8I A;  3K9K A;  3ENH A;  3RRH A;  3TAB A;  3VET A;  2EWS A;  1VRU A;  5T7B A;  2XY5 A;  1SAZ A;  4CHP A;  4FWQ A;  3CC7 N;  3VEV A;  3RMC A;  2D5R A;  1KD1 O;  3SJH A;  3PO4 A;  4LFC K;  3SBG A;  5KTQ A;  1VQ9 N;  3NMU A;  3O5B A;  2QW9 A;  1KAY A;  3CYM A;  3RTV A;  3SQ0 A;  3JS6 A;  2NRR A;  4Y0W A;  3CMA N;  1LWC A;  4FWO A;  4EIA A;  3ZX3 A;  1S3X A;  2QWQ A;  3DWL A;  1U6Z A;  1MA9 B;  3LPT A;  3TTF A;  4KHQ A;  1WBB A;  3C7N A;  5CZ1 A;  2HHT A;  1Z26 A;  4CFC A;  1IV0 A;  1K8K A;  4B1X B;  3VQ5 A;  1BCO A;  3T1A A;  2F7T A;  1RTD A;  4CHN A;  4CEF A;  5TKY A;  2PZS A;  2D0P A;  3HM9 A;  3LP1 A;  2XRI A;  5EY4 A;  3WNF A;  4YOY A;  4JRP A;  3TI0 A;  4FM2 A;  4M3Z A;  5KI6 A;  3MWP A;  4CFA A;  1L3T A;  1V4S A;  2BDP A;  2G8I A;  3VGK A;  3WXM B;  1BIU A;  3CCU N;  2CGK A;  3VQ9 A;  1JLF A;  3VQB A;  3E1Y A;  4GKJ K;  3H3O B;  2W42 A;  1D4X A;  5AZI B;  4CEQ A;  2LSN A;  4FVU A;  3JYT A;  4IOC L;  2BH1 A;  5ADX H;  3EE8 A;  5AQL A;  4YOU A;  4DQP A;  2WUS A;  4GY2 B;  3CG7 A;  3SNN A;  3I0S A;  4KHY A;  3CCQ N;  3J7Z O;  3GOI A;  2FBY A;  3UKU B;  1SL2 A;  3OYH A;  4WQ4 A;  5AQH A;  2P9P B;  4B9M A;  3IS9 A;  5M1Q A;  2HHH K;  4EZ9 A;  4CJQ A;  3U6F A;  1S9E A;  2IS3 A;  3OA9 A;  3THW A;  5LL6 Z;  3A0I X;  2HHU A;  2GTD A;  4FO0 A;  2OTJ N;  1SL0 A;  1EET A;  4Q5V A;  4FLY A;  2NRT A;  1W2B M;  1GLC G;  1SL1 A;  3TTD A;  2GX9 A;  3MX5 A;  4FOI A;  4YDU A;  3OYD A;  2BUP A;  1NJZ A;  4FOE A;  3O9U A;  5AFU A;  4DTM A;  4KHP K;  1XNQ K;  3AVM A;  4H5W A;  5DK5 A;  5F0X A;  1L3S A;  5M1P A;  3BDP A;  2E2P A;  2FSK A;  5HRR A;  3G10 A;  1CZA N;  2GV9 A;  2YX6 A;  3CCM N;  1KAZ A;  5EVZ A;  3DLE A;  3QIO A;  2YHW A;  2NRW A;  3M8S A;  3SQ4 A;  5EU7 A;  5BPN A;  2X74 A;  4KO0 A;  1VQ6 N;  4W5T A;  5AQG A;  4DQ8 A;  5I3U A;  4Z4E A;  4FJ5 A;  4DTX A;  4MO4 A;  1LCU A;  5LY3 A;  1U2V B;  3HO1 A;  3A5O C;  4LF6 K;  1RT3 A;  4JI5 K;  3ITH A;  5AZJ A;  2GUP A;  4ZTJ A;  4JI4 K;  3KVG A;  4B3O A;  2UUC K;  2WTU A;  4BG9 A;  2VCP A;  3VQC A;  4E1M A;  1S6P A;  3IKM A;  4Z4C A;  3LP2 A;  3SUQ A;  2PFU A;  1VSJ A;  1KSP A;  4JAX A;  3V4I A;  3OVN A;  5GAE P;  1NGE A;  3AVI A;  3RWU A;  4FJN A;  3HL8 A;  4XH5 A;  3QIC A;  4C8N A;  1DTQ A;  1YVN A;  1DKG D;  1BOT O;  4GVE A;  5BR8 K;  3G4S N;  1DT9 A;  4KTW A;  4BWJ A;  4HWI A;  2FF6 A;  5BN9 A;  5AQY A;  3EYZ A;  4DR3 K;  4NLC A;  4E7H A;  1BA0 A;  2HMP A;  4HUG A;  3C95 A;  3OYN A;  5IWA K;  3QML A;  4RW7 A;  3B8A X;  4HTL A;  3ZSV A;  4J2A A;  1G99 A;  4PUO A;  5GAG P;  3T1H K;  1Z05 A;  4RCH A;  3TR8 A;  2HND A;  3RR8 A;  3V9X A;  1N5Y A;  1NGC A;  3WNG A;  3CFP A;  4LFB K;  2ZQB A;  4NCA A;  3EO3 A;  2O8D A;  3ZCM A;  1YF5 L;  3VQQ A;  3HM8 A;  2QM1 A;  1NMD A;  3FZF A;  3I8D A;  5C15 A;  1EP4 A;  1U4B A;  1IKX A;  1VSK A;  4IZ9 A;  2HNY A;  1EWR A;  2QWR A;  5HL7 L;  1YHQ N;  1VQ7 N;  1I3A A;  1NMN A;  4DR1 K;  3SMP A;  2Z1J A;  3GE1 A;  3QB0 A;  4K41 A;  1SQK A;  4FWL A;  1S72 N;  1YVU A;  3VEY A;  4B3R K;  3T19 A;  4AH9 A;  1L3V A;  1GLL O;  1WSF A;  3MMV A;  3ZT3 A;  2V7Z A;  1RDW X;  4B9T A;  3DLG A;  5HLF A;  1RT5 A;  3UKU A;  3ATU A;  3NDK A;  1BA1 A;  1BI4 B;  1X9W A;  4E7L A;  1Q9X A;  2P9P A;  1WSI A;  3CJ1 A;  1N8R O;  2X6S A;  3MEG A;  2ZJP L;  3J8A A;  1U47 A;  1WOQ A;  3RSE B;  4IKF A;  4KBO A;  4H5T A;  1M1K O;  4B1Z A;  3HRG A;  2HHS A;  3RVC A;  4DR7 K;  2E4L A;  4DHY A;  3EY1 A;  1LWF A;  3SYZ A;  1MWM A;  1J6Z A;  4OPA A;  3VQD A;  1T6D A;  4GMJ B;  4QS7 A;  5C12 A;  5JVG L;  3RR7 A;  1XNR K;  1R59 O;  2W41 A;  5GIN A;  2HHV A;  2VG6 A;  1E3M A;  3LP0 A;  4F9O A;  3AV9 A;  3HXM A;  4CI6 A;  3ZET A;  2HOE A;  2V51 B;  1HYV A;  1NLV A;  4DSJ A;  5AQV A;  4FJ9 A;  3TAF A;  2Q1N A;  4BQZ A;  1U2V A;  5JIC A;  1BWF O;  4DR6 K;  4CEA A;  4XEI A;  1RDD A;  5LJW A;  1HJO A;  3NHG A;  4WQ5 A;  3MXJ A;  4DV0 K;  5ADX A;  4JD2 B;  2KFN A;  4OKJ A;  5MLC Q;  3DLK A;  4QAG A;  5C24 A;  5HBM A;  2A42 A;  2O8F B;  3L4Q A;  3NF9 A;  4JEP A;  4BRH A;  1WBD A;  1D8Y A;  5I42 A;  3DLB A;  4MO5 A;  1U48 A;  4CJL A;  1Q81 O;  1NBW A;  1VK0 A;  4IBN A;  4Y1D A;  4CK2 A;  3BP8 A;  4LF7 K;  2KW4 A;  2QKK A;  2O4I A;  4ELU A;  2YI1 A;  4FW2 A;  1GLE G;  4B8A B;  4WYB A;  4J2D A;  3K9J A;  3AO1 A;  1S1W A;  3HK2 A;  4YHH K;  3ULD A;  5JVH L;  3KZB A;  4BRG A;  3AA4 A;  3PO5 A;  3SV3 A;  1HNV A;  1OKJ A;  1QSS A;  4BRM A;  4AHU A;  3NE6 A;  3M6G A;  4PKH A;  2FXU A;  4FLU A;  4CJV A;  1D9D A;  2BE2 A;  4DQI A;  4CF9 A;  2G8F A;  3MED A;  3O9Q A;  2I7P A;  3LM9 A;  3PSF A;  1NJI O;  1C1B A;  1NM1 A;  1UA1 A;  4U67 L;  3P39 A;  3CQX A;  1NK4 A;  2E6L A;  1MDU B;  4DS4 A;  4B1V A;  3FFI A;  3C6H A;  1MWK A;  4CF0 A;  2G8H A;  4DWI A;  2OPR A;  4HUF A;  4H0T B;  4BVO A;  4O44 A;  3UB5 A;  1JLQ A;  1ASU A;  4A2B A;  4CZF A;  4H4M A;  4E19 A;  3LDS A;  3GBT A;  4FJH A;  2V7Y A;  4JK9 A;  3ZSY A;  3D6R A;  5DM7 L;  4B9Q A;  4LSL A;  4FCY A;  1W97 L;  5HP1 A;  1YT3 A;  1NNE A;  2YHX A;  1BI4 A;  3MEC A;  4U7B A;  4DV7 K;  5I9E B;  2D0O A;  1WB9 A;  4YNQ A;  2Q31 A;  1NKC A;  2I7N A;  1QTM A;  3RSE A;  4OVL A;  2X78 A;  3CET A;  3KK3 A;  1FJG K;  4KRF A;  3BGR A;  4JRQ A;  1SKR A;  1IKV A;  1XQS C;  1VQM N;  4F3T A;  4PY5 A;  4I6M B;  4B8C A;  1RT2 A;  1J54 A;  1TKD A;  3NVK A;  2JWL A;  3HI0 A;  4CGF A;  1HNI A;  4FWP A;  4M7Y A;  2HB5 A;  4AHR A;  4LH4 A;  1RBS A;  2ATQ A;  3PSI A;  2P9I A;  5LMU K;  4DUZ K;  1ZBI A;  2PYJ A;  2GWJ A;  4X65 K;  3F9K A;  1OH6 A;  1RBR A;  3C6T A;  5AQJ A;  4JNE A;  5FPN A;  4N5S A;  3QFP A;  4M42 A;  3OBY A;  1NGI A;  3K5O A;  4CEZ A;  5BPL A;  5C10 A;  1ZXO A;  4WCE L;  3OW2 M;  3VER A;  3OYJ A;  3G71 N;  3LDN A;  4H0X B;  1KAX A;  1RNH A;  4PKG A;  4WQ4 C;  1U49 A;  2OPP A;  3VGM A;  4JD2 A;  3AVC A;  4BC4 A;  4BRO A;  4EHT A;  3ZSQ A;  1BU6 O;  3U4L A;  2PAV A;  3CJ9 A;  3D0P A;  1QQM A;  3M5R A;  1NGD A;  2ETJ A;  3SI6 A;  4FJ7 A;  1M90 O;  3CQ8 A;  2O8F A;  2ZM6 K;  4BC2 A;  3VTI A;  4E7I A;  4OKE A;  5TKW A;  4KAZ A;  1DGK N;  1TL1 A;  4CJS A;  3M3Z A;  2IDO A;  1B9F A;  4BGA A;  3F73 A;  4YDU C;  2BTF A;  3LAN A;  5EXW A;  3DLH A;  4C23 A;  4Z4G A;  3C6U A;  5JS1 A;  4LF4 K;  4CEB A;  3DM2 A;  3T7Z A;  1HNW K;  3TTC A;  1HUX A;  3QFU A;  2HHW A;  3RMA A;  4DV2 K;  2O8C A;  3CHW A;  3L2W A;  3CJC A;  3KK7 A;  3AGR A;  4JK8 A;  1UAX A;  4AM6 A;  4CJW A;  1YJ9 N;  3ZX0 A;  3CFR A;  1S1T A;  1W0H A;  4KFB A;  2F8T A;  2E2O A;  2A6A A;  1C0G A;  4MDA A;  2O8B B;  3K2P A;  1IH7 A;  2P5O A;  1KTQ A;  3ZX2 A;  5ELZ A;  4H0P A;  4O0I A;  4BRK A;  2IVP A;  3SAH A;  3OYA A;  4H03 B;  4FSV A;  4O8K A;  1NGJ A;  3QEW A;  2E5L K;  1OVY A;  2HHX A;  3DYA A;  1LWE A;  4BRC A;  5AQR A;  4F2S A;  2FBX A;  2VGM A;  4QS8 A;  4TSX A;  4DQS A;  3F5T A;  1ATR A;  4CVN E;  1NK7 A;  2F9T A;  4DF8 A;  4FZX C;  3V81 A;  2A5X A;  4CJT A;  1WAF A;  1NOZ A;  3PUF A;  2KLA A;  4XH1 A;  4YOV A;  3IG1 A;  4CK1 A;  3QNN A;  4DR4 K;  4FM1 A;  4AM7 A;  3H1V X;  4C1N I;  3NAE A;  3PLA A;  1VSD A;  5AQM A;  1NK9 A;  3O4Q A;  4KRE A;  3SPY A;  3AVK A;  3P5J A;  3JXU A;  1P8Z A;  1WSH A;  3SBT A;  2FF3 B;  4OJR A;  3K0S A;  4HHT A;  1TKX A;  1EKE A;  4B3M K;  4DCH A;  1HQE A;  1XHZ A;  1RT1 A;  1K73 O;  1LW0 A;  2KTQ A;  3TSU A;  4I6M A;  4CF8 A;  4E0D A;  4HTU A;  2ITG A;  3V9S A;  1IKW A;  4DFM A;  4LF5 K;  3NFA A;  4M41 A;  3QO9 A;  1IKY A;  3I33 A;  4BWM A;  3M8P A;  3AVG A;  1Q86 O;  3WXK A;  5J2M A;  1LAW A;  1SKW A;  3O3H A;  3L2U A;  1IO2 A;  2VWJ A;  4FJ8 A;  2F8S A;  3CC4 N;  2DPN A;  2G8V A;  3AO2 A;  1T8E A;  3DRR A;  4E7K A;  4NCB A;  2O8D B;  4DFP A;  3CFO A;  2ZF5 O;  2QWL A;  4B1U B;  3SAF A;  3RMB A;  3P1G A;  5BR9 A;  4CZL A;  1BQN A;  3LAL A;  5AQI A;  4FLW A;  4DV1 K;  2QXF A;  2OAN A;  3HTV A;  4EP5 A;  3ZT2 A;  2AJQ A;  4FLX A;  4BY9 C;  4DSI A;  4DSE A;  2DTU A;  2QKB A;  4M3R A;  2EHG A;  3CJ7 A;  1T3V A;  3U9D A;  4CE9 A;  4W5N A;  1QSY A;  1NJX A;  1C0U A;  3U3Y A;  3SQ2 A;  3AVF A;  4AHS A;  1ZYQ A;  4KHS A;  3P38 A;  4A5B A;  4KB0 A;  3VEO A;  4IDK A;  1HQU A;  4FPB A;  4X64 K;  2IAJ A;  4CJK A;  1L3U A;  2PBD A;  3VMF B;  4QOZ B;  2OPS A;  3AAR A;  3JAM O;  2HST A;  5JLH A;  5KGW A;  3ENO A;  4DV4 K;  3S3N A;  3OYF A;  2Q0U A;  3PX6 A;  4K8X A;  1X9M A;  4CBX A;  2O8B A;  2OYQ A;  3IAY A;  3MCP A;  1HKC A;  4WQ5 C;  1N6Q A;  3LWM A;  2KZZ A;  4DTS A;  2DFE A;  4FZZ A;  2KFZ A;  1YIJ N;  1ATN A;  1XC9 A;  3MN6 A;  4FLV A;  1UA0 A;  4NB4 A;  2UXC K;  3ASM A;  2OZM A;  4DU4 A;  4KTZ A;  2Q3S A;  3QES A;  4OLB A;  5C0Y A;  1WAJ A;  3ZET B;  1VQL N;  2Z1G A;  4B9L A;  3DOK A;  1ASW A;  3L2Q A;  5LMN K;  1QE1 A;  1HJR A;  3BUZ B;  3M8Q A;  2D1K A;  3CCE N;  4KI6 A;  3ISN C;  1KVB A;  4H5R A;  2Y1J A;  4IWV A;  3R1X A;  3LDO A;  5B8H A;  5HOO A;  4FK0 A;  3KLE A;  5GIO A;  2YJF A;  1GLJ O;  4FZY A;  3CCV N;  3AA2 A;  3QER A;  3ZSR A;  3CD6 N;  3TU5 A;  4DU3 A;  3OYK A;  3CIP A;  5A2Q O;  4O8U A;  1C1C A;  3O1B A;  2D0A A;  2Z1I A;  3VF2 A;  4LH5 A;  2DY4 A;  1WSE A;  4JKH A;  3U8X A;  2Q36 A;  3K59 A;  1A5X A;  4CJ4 A;  1CXU A;  3TWH A;  1S1V A;  2W40 A;  4CBW A;  4DTP A;  3J7Y P;  2P9U B;  1BG3 A;  4H8K A;  5E41 A;  1ASV A;  1Y64 A;  3CJA A;  1TAQ A;  5FDL A;  2X6N A;  4W5Q A;  2Q2R A;  4BDP A;  4ILH A;  4EP4 A;  1NJY A;  2UUB K;  1WLJ A;  1IG9 A;  2GBZ A;  4M45 A;  2YNG A;  2DFH A;  3HPH A;  1O1W A;  2E2N A;  4JI6 K;  4O55 A;  3KWI A;  1B9D A;  4CJR A;  4DB3 A;  1RTH A;  5AQQ A;  4BR0 A;  3U3G A;  2ASM A;  4AHC A;  1NK5 A;  2VWB A;  1JL2 A;  4JI3 K;  3EZ5 A;  3KKR A;  4Q0B A;  5AJ3 K;  3DMJ A;  1IJJ A;  4PL8 A;  4GV6 A;  4CZJ A;  1K9M O;  3CME N;  4H4O A;  3L3U A;  4I9L A;  4CJF A;  3TAP A;  3MWT A;  4KH5 A;  5AQW A;  3SPZ A;  3TPQ A;  4BE0 A;  1RBT A;  4CF2 A;  3C6A A;  2RHK A;  4FXD A;  4FJJ A;  1WSJ A;  4C8M A;  3LPU A;  3HOS A;  1KVA A;  1VQ5 N;  3MN5 A;  1X9J A;  3AVJ A;  1NKB A;  1BUP A;  1JLG A;  1QZ5 A;  3KLG A;  2G8W A;  1NGF A;  3C0B A;  3M8R A;  1VQK N;  4WFA L;  1KCF A;  2NLX A;  1VQO N;  2BGG A;  1C6V A;  1N32 K;  4E3S A;  4DKW A;  2YNF A;  1RBU A;  1YAG A;  3L2V A;  1NG9 A;  4M3Y A;  3KHY A;  1O13 A;  4CCH A;  5GAD P;  5C25 A;  4KHW A;  1X3M A;  2IOC A;  2FLO A;  3HST B;  3B6P A;  4CER A;  5KQD A;  5J1E A;  5BN8 A;  3ZLJ A;  1HKB A;  3V9W A;  3TAM A;  2KZM A;  3LDQ A;  4KHN A;  3O08 A;  4BDY A;  3O3F A;  3G25 A;  3VEN A;  1ZBS A;  2W6K A;  5CE3 A;  3HVT A;  1VQ8 N;  3SZ2 A;  1YI2 N;  3H6E A;  3H1Q A;  3W0L A;  4BRE A;  2P9I B;  1H1V A;  4RW9 A;  2ZGZ A;  4M3T A;  4FWS A;  5M1F A;  1JL1 A;  4DTJ A;  1A5W A;  3U9Z A;  2CH6 A;  2JGU A;  4N47 A;  4Z94 A;  1RFQ A;  4BRN A;  1VAZ A;  4BDZ A;  2FSN A;  1BIS A;  4CJ5 A;  4CBU A;  4OPH A;  3E9L A;  1OVQ A;  4WE1 A;  3TAG A;  2HF4 A;  4CGG A;  1TKZ A;  5FPE A;  4BRD A;  3TAE A;  3QBW A;  3AY9 A;  2DFF A;  2OCE A;  4FPA A;  4JKC A;  4AHV A;  3THY A;  4CJU A;  2WFB A;  3LAM A;  1J5O A;  3VN5 A;  1ATS A;  1SZ2 A;  2D0B A;  3SUO A;  1Q9Y A;  1NK6 A;  1TAU A;  2OZS A;  4BAC A;  3HOT A;  4IG3 A;  2AA4 A;  4LY7 A;  3SK3 A;  2Z1H A;  4BQL A;  4BE1 A;  1QHT A;  3M1F A;  5M1N A;  4JV5 K;  3WUH A;  3I56 N;  2HVI A;  4RW8 A;  2P9U A;  5HRS A;  1JKH A;  1DLO A;  3Q7C A;  4DV3 K;  3DXM B;  5JLF A;  3ID6 A;  2YCH A;  3VOV A;  4DS5 A;  3THV A;  1J5E K;  2O8C B;  3G6E N;  1NJW A;  3I55 N;  4RW4 A;  4DU1 A;  4NLB A;  2VGN A;  1Y97 A;  2HBJ A;  3LP3 A;  4LSN A;  2RF2 A;  1E4F T;  1RCH A;  1VQP N;  4I2P A;  1TK5 A;  1UWB A;  3QIP A;  4PQU A;  4DLE A;  3VGL A;  4M3X A;  3DXK B;  1T05 A;  1LV5 A;  4CJP A;  4LC9 B;  2G8K A;  3IFR A;  4WFB L;  3VQE A;  1G15 A;  3VQP A;  2UXD K;  4Y1C A;  3KLF A;  4H5N A;  4LF9 K;  5GIP A;  3CCR N;  4F2R A;  2PY5 A;  3OYM A;  3FGU A;  3VQ7 A;  3BF1 A;  3OYB A;  4ILG B;  4CHO A;  3WXL A;  3ENB A;  4MFB A;  3CER A;  3HT3 A;  3ID8 A;  2E88 A;  4IJA A;  2QA4 N;  3V1R A;  1RTJ A;  1ZBH A;  1HMV A;  3E9P A;  3VA3 A;  1YJW N;  1VQN N;  4ISE A;  3NVM A;  4F8R A;  4CIG A;  3W3D A;  4CHQ A;  3QET A;  3WXI A;  2V52 B;  3E66 A;  2HBK A;  4IEE A;  5FLX O;  4B08 A;  1W7A A;  2F9W A;  3NF8 A;  4FJG A;  3GDQ A;  4N56 A;  1RDA A;  1ILY A;  4FK4 A;  3S3M A;  3SUP A;  1N34 K;  5BRE A;  2P9K A;  2F96 A;  3N4P A;  1R0A A;  4FJM A;  1B92 A;  2CGJ A;  5H1S Q;  4DFJ A;  3ZYY X;  3V9U A;  4CIF A;  5AQF A;  1BL3 A;  1TKT A;  1RGI A;  1S9G A;  5IT9 O;  3T69 A;  1QQC A;  2KKZ A;  1RIL A;  3CCL N;  5BPM A;  3SMS A;  4DTN A;  3NF6 A;  3TAQ A;  5C42 A;  4OGC A;  4FW1 A;  3ZT1 A;  2R7Y A;  3BEX A;  1V4T A;  1SUQ A;  3C65 A;  4CK3 A;  1RDU A;  4EHU A;  3AO3 A;  5DMR A;  1KLM A;  1QQN A;  4JKB A;  4I9Q A;  1W9H A;  3GL1 A;  5C2F A;  3WEE B;  4IFE A;  2D4W A;  1NGB A;  2QTD A;  5HRN A;  5AFU H;  3VEW A;  3FZK A;  2F4V K;  1C0M A;  3MAQ A;  2NRX A;  3ZT0 A;  1HYZ A;  3MEE A;  3PV8 A;  2BAN A;  4ID1 A;  2VQF K;  4NCG A;  3AVH A;  4BE2 A;  4OO1 J;  3O8M A;  5AQO A;  4PL7 A;  3DRP A;  3QEX A;  2A41 A;  2A40 A;  4L3Q A;  4A59 A;  1XMO K;  1U04 A;  1EXQ A;  3DLL L;  3R6M A;  3A2F A;  5M1O A;  4BR4 A;  1X3N A;  2GEM A;  3DXM A;  1K8A O;  2ZD1 A;  1UOC A;  4X62 K;  5E26 A;  1K6Y A;  2YNH A;  1VSI A;  4PWD A;  1JCE A;  4B9N A;  3ALY A;  1JXE A;  4MDB A;  2VYP A;  4CFB A;  4WF9 L;  2QWN A;  1WN7 A;  3KD1 E;  3FZH A;  5GAH P;  2QEX N;  4IFV A;  3DXK A;  4CEC A;  4K25 A;  5HRP A;  3MN9 A;  2P5G A; 
#chains in the Genus database with same CATH homology
 2OCE A;  1NMN A;  1OVQ A;  3BZK A;  1NU0 A;  3PSI A;  3BZC A;  1VHX A;  1IV0 A;  3PSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...