1NU1G

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1nu1G00
1L0LG 1L0NG 3L70G 3H1IG 1SQBG 2FYUG 3CX5H 3H1HG 3L74G 1SQQG 2IBZG 1NTMG 2BCCG 1BCCG 3H1KG 3L71G 3H1JG 3L75G 1KYOH 1PPJG 1SQXG 1SQPG 3L72G 2A06G 1BE3G 1PP9G 3H1LG 3TGUG 3CWBG 1NTZG 3BCCG 1P84H 4U3FG 5KLVG 1EZVG 3L73G 4D6TG 1SQVG 1BGYG 3CXHH 1NTKG 4PD4H 1KB9H 1NU1G
chains in the Genus database with same CATH superfamily
2QA4P 3VMAA 1X8YA 1SQBG 3W68A 1Q90D 2Y9ZA 1JMBA 3AE3C 1GZLA 3L71D 3L74G 1KQSO 3BASA 1R8EA 1HJ0A 3RK2C 3RK3E 1OMIA 2WSFH 4DT0A 1WT6A 1YITP 1JCDA 3L73J 2E75B 2QE7H 1BCCD 1ZLLA 1KYOH 3AEBC 3B5ND 3CX5D 1HGVA 3E1RA 1G1JA 1P84D 3GG2A 2YNYA 1LT1A 1E79H 3E1IA 2R3SA 3KZIE 1SS1A 1T8ZA 1IK7A 2H8PD 2ZXXA 5TISH 1HF9A 3AEDC 3G4SP 2ZVOB 4EOTA 2KSEA 4HKZH 2IDBA 3O6QB 1NWQA 4YTPC 3B5NA 3M9BA 1SQVD 3T97B 3H1LE 3H1IE 4GT1A 3EFGA 1BGYG 4C46A 2O1JA 1R5SA 1U57A 4DJGA 3M91A 1L4AB 1EZVE 1L0LK 5KJ7D 2R5DA 2KP8A 3TNUA 5GTIE 1HBWA 1LTJB 2R32A 2C0XA 1M1JB 2D2CD 2E74D 4H0LD 4BRYB 3H1HG 5DJTB 3I55P 3CCJP 1CI6B 1IFDA 1IFMA 1S3JA 1SQVJ 1FDOA 2IBZG 2WSCJ 4K3AA 4WBAA 2K9JB 5KJ7C 1KN7A 3G9RA 1DEEG 3JCUE 1YJNP 3V6IA 3L74E 1G2CB 3HE5A 3L72D 3SWYA 1MZ9A 5GTHE 3H1HE 1FDIA 1T6AA 2K37A 4OGQB 5CJ4A 1SQVE 1T3UA 2Y0EA 5KAFH 3WMM0 1OFCX 3PTZA 3U1AA 2MJZA 2POHA 3ABVC 3P8CE 1OVRA 1PPJE 3HTKA 5EFWB 1FOSF 2ZJSE 1J1DC 3RK3B 1IFJA 2W90A 1SQVG 2KLUA 2QRXA 3KXDA 3QH9A 5AW2B 3Q2YA 3IN6A 3FWLA 1YQ3C 4D6TJ 5KLIB 2KZJA 3CMEP 1N73C 4DOJA 1NKZB 2O3JA 1IFIA 2WMMA 2ZT9B 2K9JA 4W80A 1L0LG 5AW1B 5CBOA 1A02F 3NXSA 2WSEH 1SQQD 4NPDA 3VTPC 1Q86Q 1VF5B 4GKGA 1ZRTE 4N78D 3M0AA 2FXMA 1J1EB 3L37A 1HTLC 1QEXA 1QLED 4XFJA 3H1JJ 1GD2E 5E79E 2Z5IA 2P1JA 4PD4I 1VQPP 3AEFC 3E7KA 3S4RA 3VP9A 2V7QJ 3WU2H 5CCGA 2FYZA 1GK4A 1N7SD 1BE3D 2N9YB 1LT9A 1U7JA 1USEA 2I8DA 2WPVB 1YQ4C 2XNXA 2ZT9C 1N73B 5TJHA 4U3FG 2N9BA 2JP3A 3K5BA 1M8OB 3V2PA 1ZN5A 1LWUC 1EXIA 1QGKB 2WT7B 3GW6A 4N3YB 1L4AD 4DZOA 2K88A 1RQUA 3OW2O 1URQD 1BCCE 1HH0A 2HODB 4HH2A 2W6JH 2M3BA 4RESB 3V4WA 3VYIA 4DCKA 1GU4A 1VQ7P 1L0NG 5B5EH 4PV1B 1NH4A 5DJUB 2QEXP 2ZVNB 3AE2C 1NTZJ 5H2FH 1SQQG 3D70A 1HGZA 1HUCA 5APWA 5AW8B 1CSBA 2BCCG 2E75C 1BCCJ 3Q1MA 2B89A 5AVYB 3CMAP 1IC2A 1L0NE 2FXOA 3TSIA 2JDIH 1ZR4A 4LLHA 4PJ0H 4ZMDA 1OXZA 3H1LJ 4I1LA 1SQPG 1NVOA 3ZDMA 2Z5HA 3P7KA 1JY3O 2E75D 2P58A 2IFMA 2NPSD 2OTKE 2WSEJ 3EQ2A 3II6A 3L36A 3CCVP 1VQOP 3A2AA 3F89A 3S1KA 1VQNP 2B87A 1TU3F 1NJIQ 3EWKA 3WUVA 4WB4A 2K1AA 4H44C 1P84I 1RE4C 1Q7YQ 4K35A 2YMKA 1NTKG 1VQ6P 1M1KQ 1N2DC 1KB9H 1X0TA 4RO0A 1RF1C 1N7SB 2R5BA 3P8CD 3BATA 1LGHB 4KHXA 1M1JC 3RGUA 1NU1D 3RL0g 2R3CA 3USSA 1W5CE 1AFOA 5APTA 3CCMP 1G1IA 1S5LE 3L35A 3Q3DA 3H1KJ 1KTMA 5CMZA 2OYOA 2YO2A 1SP4A 2NPSB 2WPSA 1SQXD 2WT7A 4JYBA 2YKQA 3IR9A 3SFEC 1NOHA 1RE4A 1BDDA 1KYOI 1SQQE 2XNDH 4RKUJ 4C7NB 5KAFE 2BCCE 3TGUJ 1NO4A 3A7OA 1ZR2A 1GU5A 3TYYA 1QL2A 1PGPA 2JR8A 4L73A 4YPCA 2PP6A 3Q5SA 1K8AQ 4UB6E 1ZV8A 2N1TD 1KILC 1SFCB 2HFED 1LWUA 3A0HH 4H13B 1FZCC 1CI6A 1P84H 2YXQB 5CJ0A 1JY2N 3CC2P 1SQVK 3AEAC 2KS1B 4W7YA 2PGDA 1IO4A 1EDJA 1EZVD 1U7MA 1VPCA 2Q1KA 2IYOA 4W7ZA 1RHZB 2B88A 2BASA 5APYA 4N6JA 3U1CA 5AVXB 2FFDC 3M9HA 2H89C 3AE6C 3AECC 5KLVE 1KB9I 1PZQA 2Q6QA 4KJMA 5APVA 1OWAA 1JOCA 3H1HJ 4IFMA 1LTIC 3SWKA 5KKZB 5L8RJ 1Y8AA 3GF3A 1FZAA 4IL6X 2OYIA 1KQGB 3L71G 4H44B 5AW5B 2JKVA 3GHGA 2KNCB 2M5AB 1H0TA 1RE3A 3H32A 4H13C 5B66H 2IPPA 4U7JA 1FZCB 2OARA 2WSFJ 1PPJG 2A06D 2PRRA 2FFDA 3H1IJ 2D2CB 1LP1B 2E74B 4H0LB 3D6YA 3L71E 2RN0A 1YIJP 5AVVB 3C8VA 4D6TE 3LW5J 4U3FD 1IK9A 1NTZG 1L0NJ 3M0DA 2QJKB 1S1CX 3SWFA 1ZMEC 1KQLA 1LWUB 2FXPA 1L0LE 1MKMA 2NPSC 2WPRA 5AVQB 2Z4EA 5GTHH 3KPEA 5KKZC 5B66E 2HLOA 5CCGD 1Q81Q 3VMZA 3CC4P 1L0ND 2OQQA 2K9YA 2SPZA 3T97A 5KAIE 1LTBC 4Y99B 5KTBA 4IL6E 2M5AA 2R44A 1AJYA 1PGQA 2G3AA 1SFCA 2O1KA 3H1ID 2OYIB 1SQBJ 5GTIH 1L4AA 1URQC 2GUSA 3MGNA 2WTYA 1NTMG 3CCSP 4RJTA 2WWWA 1KMIZ 4BWNA 3H32B 5AVRB 1ZP0C 3CC7P 2A45H 3RL0D 1FS0E 2KNCA 1NTKJ 1SQPD 1PIXA 3H1JG 3A5TA 1S9KD 3PRJA 4U3FE 2H43A 1MUUA 1GTWA 1FJPA 1SQXK 3BCCE 3V2RA 5B5EE 1NTME 1BE3J 1GL2B 1Y47A 2GUVA 3CXHD 3HRNA 3VN0A 1EZVI 3H1JE 3SFDC 4JYCA 1JO5A 2Q3EA 2LR2A 5K5GB 1YBKA 4KT0J 3IAOA 2AEFA 4QMAA 2Q7CA 1X9VA 1N7LA 4OH8B 2YIUC 1PL5A 4NPFX 4B86A 1IFPA 1SVFA 3V4QA 1BSNA 1S5LX 1SQQJ 2OYHB 1M56D 2WVRA 3A0BE 3GHGC 1DX7A 3B8EB 2FKWB 2NRGA 3GMAA 3U59A 3Q5RA 2OTJP 3LW5H 1GL2D 2WZ7A 3LIDA 1J1EC 3VOPA 1MFZA 2KLVA 2LXBA 2YMYA 3B71A 4Z1MH 2WITA 2PFXA 1Z56A 1PP9G 2HR3A 1NKNA 2WPQA 1X22A 1NU1J 3JSVC 3MUDA 3VMYA 1GL2A 5AVSB 1LTJC 1OVVA 1P84E 5BU5A 3PHLA 2Q3IA 1LNQA 2YKOA 3HD7B 4WVZA 2QJYC 2W27A 4ZKUA 2JEEA 3MP7B 4XE5B 1QL1A 3M06A 3MUDC 2FFDB 1PFIA 2E5TA 5AVWB 2E42A 1FDMA 1FZBA 1SQXJ 4OGQC 5CCHC 1AV1A 1HVVA 4UB8H 3WUUA 1L0NK 2IBZD 4JF7A 3HUSB 3H1KD 1M1JA 1LTSC 3CCQP 1GW4A 3G6EP 2HODA 1FOSE 1KB9D 2E76B 2HYNA 1XTCC 2ZYAA 1H8AA 1OVUA 3HE4A 2Y0DA 5APXA 2AXTE 2E76D 3CI9A 2C9LY 1KV4A 4JPZB 5CCHA 1S4XA 5KLIC 1NYHA 1PGJA 3HD7A 3L72J 2QSIA 1PP9J 3PLNA 2G8YA 2ZXEB 1R5LA 3RL0B 1N8RQ 4IOIH 1GK6A 1PP9D 3HTKB 2KUBA 1AVYA 1SQPE 1JNMA 2NZ2A 5KLVG 2QM8A 1CZQA 3L4FA 2WQYC 2OGUA 4O9BA 1JB0J 3HD7D 2KXPB 2IYPA 1HJBA 1KZUB 2DW3A 3L73D 4PV1C 2FYUE 1ZW0A 2YKPA 5AW3B 4TT3H 2Q9IA 1JY3P 3MHVA 1YTZT 2LXCB 3FGAD 1LTTC 3IFMA 4PD4E 1N7SC 4EDFA 1K04A 1DD4A 1SQQK 1NTMD 3ITKA 2JWAA 2WSSH 3O8ZA 2RH0A 4LC1A 3CX5E 5APSA 3RBZA 1NGMB 1AQ5A 2M3EA 1VQ4P 2M0BA 3H1JD 3AE5C 3IF4A 3V2QA 3KDPB 2IX7C 2KSJA 4N78E 2I1JA 1BGYJ 3B4SA 1DD3A 1SLQA 3B5NB 1T2KD 1GL2C 1DIPA 3OJAB 3R2PA 1NAYA 2O01H 4R4MA 1DH3A 1CW5A 3CWBG 4ASVA 2P67A 3CX5I 1KYOD 3HUSA 3L70J 2RKLA 3RK2B 3I56P 4D6TD 3O6QA 1SQXE 2IFNA 4OVNF 4UB6H 4ZKPA 1T2KC 4PJ0E 1JMMA 3BCCJ 2BEQD 3AE8C 3M0DC 5KLVK 2VRSA 4Y28J 1EDLA 3VMXA 2KYVA 1NTKK 1VQ8P 3L70D 1YI2P 2OTLP 1EDKA 4GIFA 5APQA 4BRYA 1J2JB 2XKMA 1EQ7A 3A0BH 2OYHC 1FU1A 1OIPA 5AW9B 1SQBK 4EYYQ 2B87B 2H88C 2BCCD 1AA0A 1YTZI 2CPBA 3L72E 4C7RA 4OGQD 2GA1A 3H6PA 4I6MC 5CCHD 1OW7A 1D7MA 2QG4A 3N7NA 3MIWA 2RMZA 4L75A 1UIIA 1SQPK 3P32A 3SSUA 3C9IA 4H0LC 1M90Q 3CXHE 3CWBJ 3L72G 3PP5A 1PPJD 2A06G 2P10A 2P7JA 1MV8A 1RF0A 1FAVA 2AXCA 2D2CC 2E74C 2J5UA 1NAFA 3BCCD 1RQVA 1PV3A 3AE1C 4ASWA 2XDJA 3CD6P 4GOFA 4HB1A 1LT9C 1OX3A 5CBNA 2KB7P 3AE4C 1JY2P 1NTKD 3CWBE 2A06E 3GLMA 5H2FE 3RK3D 4CPGA 3CL3D 1NTZE 1WMKA 4LGDE 2QIWA 1G2CA 1OW6A 1SQBD 1FJKA 5AW6B 1RE3C 2N1TC 1N86A 1LTAC 3KZIH 4Y99C 2J59M 3S9OA 5KAIH 4D6TG 1NTMJ 1PP9E 1YYCA 1NU1E 3PH0A 2CPSA 1NTMK 1YJ9P 3QWOC 5KLVJ 2NPSA 3L75G 3AEGC 4JBZA 3VP8A 3BRTB 1ZXGA 2LKMA 3FXEA 1ZOYC 4GODA 1VF5D 1EC5A 3H25A 1KILD 4PD4D 1S2EA 3L75E 1OZHA 3BCCG 2ZT9D 2H7HA 3G71P 1VDFA 1BSHA 1FC2C 1XTGB 2ITAA 1LTJA 2Y9YA 3I5CA 4JQ0D 1EXJA 1H0TB 1L4AC 2V4HA 1H89A 4H13D 1K05A 1X79B 1K9MQ 1KYOE 1SFCC 2OYIC 5CHXA 3AE7C 3H1HD 2YIUB 4IFDK 1MFTA 3F5HA 2QJPB 2O01J 1E5WA 4GDOA 1K73Q 3CCLP 1AQTA 1LT9B 2FYUK 5AW0B 1N73A 1IFNA 1WRGA 3TF5A 1L2PA 1RH5B 2ZYGA 3L71J 2E43A 3CCUP 1S72P 4I7ZB 2P2UA 1N7SA 3GF7A 2KIKA 2JJLA 3Q5PA 1VF5C 5APUA 3PJSK 2ZFCA 2FYNC 1Q2NA 3B5NC 4XA4A 2W6AA 1FZCA 2E5YA 1JY3N 4MN4C 1JUNA 4OWFA 1FZEA 1KILA 2L91A 3V2NA 2B9BA 4YXWH 3L74J 1KFMA 4IFFA 3CLQA 4WY4D 4R4LA 1NHLA 1JY2O 3BRVB 3HD7C 3FX0A 3RBXA 2QJYB 5CCGC 1KD1Q 4PD4H 3NTNA 1VQKP 1L0LD 3RK2D 4EIJA 3GHGB 1FZGA 2J58A 2QJKC 3FWNA 2FYUD 4YXDC 3H1IG 4L76A 2FYNB 2O01N 1BGYE 2IZ0A 4HYTB 3M9QA 3P8MC 2FY8A 1M57D 2KOGA 1BE3E 1VL2A 3H1KG 3L74D 4NPEA 5E79H 3MZWB 1RF1A 3CCEP 1KILB 1QX8A 2BEZF 2Q5UA 3L75J 3AEEC 2V7QH 3KHUA 3MD0A 3EFFK 1LTGC 4H44D 1M7LA 1PGOA 1SQXG 2K3RA 3WU2E 4EI2A 3CPWO 3TGUD 1YJWP 3TGUG 2IBZE 2JO1A 2KZIA 1BE3G 2JWDA 3H1KE 4WY4C 3HE4B 1GDTA 3CCRP 4C7NA 1KB9E 3C1LA 3D6ZA 4AQRD 3LIEA 1QVFO 5AVTB 1RF0C 1BDCA 5KLVD 2W6BA 1KQFB 3WUTA 3HE5B 4IL6H 4WY4A 1W2EA 4AYCA 2IBZI 5AW4B 1SQPJ 2N1TB 4L74A 3AE9C 4M3LA 1ZRTD 4AUWA 2FYUG 1VQ9P 1DEBA 1URQA 1FBMA 4ZNCA 2FBWC 3BVHA 2OYHA 2KK7A 1OW8A 1RF1B 2XV5A 3W67A 1W2BO 1JTHB 1KILE 2AEJA 1LP1A 2QVAA 3L75D 3TNUB 3D71A 2N1TA 1Q82Q 2HPCB 3A3YB 1VQMP 4A7PA 1IJDB 2UWJE 1RY3A 1UIXA 3MTUE 1T3JA 3H1LD 2KS1A 2XU6A 2Y0CA 3KYQA 3TDKA 3TK1A 1USDA 2YO3A 1GW3A 2MKVA 2GM4A 2IZ1A 3L73E 2FYUJ 2HPCA 3FXDA 1JEKA 1NTKE 1FE6A 2WSCH 3CWBD 3R4YA 5M1BA 4U3FJ 1NTZD 3KQGA 2AEMA 2E76C 1J1DB 3RK3C 2ZYDA 1SQBE 5BVZA 4BXLA 1NU1G 2PAJA 2QM7A 4WY4B 5AW7B 4TLFA 5BU8B 2QJPC 3L70G 3OAKA 3G3ZA 5TISE 3OA7A 1VQ5P 4HJGH 2YXRB 3CX5H 2C9NY 1JM0A 4GOEA 5KJ7A 1EDIA 1SFCD 2HG5D 2L5GB 3NMDA 4I7ZC 3V5BA 1BCCG 1S9KE 1LJ2A 3A0HE 2CK3H 3L70E 1H88A 1A02J 2KI7B 2I1KA 1Y9BA 1L0LJ 2ZAEB 2A45I 3HUSC 5AVUB 3CXHI 5C39A 1QVGO 1KC8Q 2M8RA 5AVZB 3H1LG 1YHQP 4WWIA 1NTZK 3JC22 1VQLP 1URQB 3UIAA 2A45G 1BGYD 1IZNB 2W83C 2BCCJ 1S5LH 1EZVG 3TGUE 3L73G 1AVOA 2XZRA 1KORA 1HWTC 3N4XA 1JCCA 2W8ZA 3CXHH 4PV1D 2C0WA 3JCUH 4UB8E 3RL0C 1FZFA 1JTHA 3NFQA 1KFNA 2AXTH 4I2LC 1NU1K 1GMJA
chains in the Genus database with same CATH topology
1L0LG 1L0NG 3L70G 3H1IG 1SQBG 2FYUG 3CX5H 3H1HG 3L74G 1SQQG 2IBZG 1NTMG 2BCCG 1BCCG 3H1KG 3L71G 3H1JG 3L75G 1KYOH 1PPJG 1SQXG 1SQPG 3L72G 2A06G 1BE3G 1PP9G 3H1LG 3TGUG 3CWBG 1NTZG 3BCCG 1P84H 4U3FG 5KLVG 1EZVG 3L73G 4D6TG 1SQVG 1BGYG 3CXHH 1NTKG 4PD4H 1KB9H 1NU1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0L G;  1L0N G;  3L70 G;  3H1I G;  1SQB G;  2FYU G;  3CX5 H;  3H1H G;  3L74 G;  1SQQ G;  2IBZ G;  1NTM G;  2BCC G;  1BCC G;  3H1K G;  3L71 G;  3H1J G;  3L75 G;  1KYO H;  1PPJ G;  1SQX G;  1SQP G;  3L72 G;  2A06 G;  1BE3 G;  1PP9 G;  3H1L G;  3TGU G;  3CWB G;  1NTZ G;  3BCC G;  1P84 H;  4U3F G;  5KLV G;  1EZV G;  3L73 G;  4D6T G;  1SQV G;  1BGY G;  3CXH H;  1NTK G;  4PD4 H;  1KB9 H;  1NU1 G; 
#chains in the Genus database with same CATH topology
 2QA4 P;  3VMA A;  1X8Y A;  1SQB G;  3W68 A;  1Q90 D;  2Y9Z A;  1JMB A;  3AE3 C;  1GZL A;  3L71 D;  3L74 G;  1KQS O;  3BAS A;  1R8E A;  1HJ0 A;  3RK2 C;  3RK3 E;  1OMI A;  2WSF H;  4DT0 A;  1WT6 A;  1YIT P;  1JCD A;  3L73 J;  2E75 B;  2QE7 H;  1BCC D;  1ZLL A;  1KYO H;  3AEB C;  3B5N D;  3CX5 D;  1HGV A;  3E1R A;  1G1J A;  1P84 D;  3GG2 A;  2YNY A;  1LT1 A;  1E79 H;  3E1I A;  2R3S A;  3KZI E;  1SS1 A;  1T8Z A;  1IK7 A;  2H8P D;  2ZXX A;  5TIS H;  1HF9 A;  3AED C;  3G4S P;  2ZVO B;  4EOT A;  2KSE A;  4HKZ H;  2IDB A;  3O6Q B;  1NWQ A;  4YTP C;  3B5N A;  3M9B A;  1SQV D;  3T97 B;  3H1L E;  3H1I E;  4GT1 A;  3EFG A;  1BGY G;  4C46 A;  2O1J A;  1R5S A;  1U57 A;  4DJG A;  3M91 A;  1L4A B;  1EZV E;  1L0L K;  5KJ7 D;  2R5D A;  2KP8 A;  3TNU A;  5GTI E;  1HBW A;  1LTJ B;  2R32 A;  2C0X A;  1M1J B;  2D2C D;  2E74 D;  4H0L D;  4BRY B;  3H1H G;  5DJT B;  3I55 P;  3CCJ P;  1CI6 B;  1IFD A;  1IFM A;  1S3J A;  1SQV J;  1FDO A;  2IBZ G;  2WSC J;  4K3A A;  4WBA A;  2K9J B;  5KJ7 C;  1KN7 A;  3G9R A;  1DEE G;  3JCU E;  1YJN P;  3V6I A;  3L74 E;  1G2C B;  3HE5 A;  3L72 D;  3SWY A;  1MZ9 A;  5GTH E;  3H1H E;  1FDI A;  1T6A A;  2K37 A;  4OGQ B;  5CJ4 A;  1SQV E;  1T3U A;  2Y0E A;  5KAF H;  3WMM 0;  1OFC X;  3PTZ A;  3U1A A;  2MJZ A;  2POH A;  3ABV C;  3P8C E;  1OVR A;  1PPJ E;  3HTK A;  5EFW B;  1FOS F;  2ZJS E;  1J1D C;  3RK3 B;  1IFJ A;  2W90 A;  1SQV G;  2KLU A;  2QRX A;  3KXD A;  3QH9 A;  5AW2 B;  3Q2Y A;  3IN6 A;  3FWL A;  1YQ3 C;  4D6T J;  5KLI B;  2KZJ A;  3CME P;  1N73 C;  4DOJ A;  1NKZ B;  2O3J A;  1IFI A;  2WMM A;  2ZT9 B;  2K9J A;  4W80 A;  1L0L G;  5AW1 B;  5CBO A;  1A02 F;  3NXS A;  2WSE H;  1SQQ D;  4NPD A;  3VTP C;  1Q86 Q;  1VF5 B;  4GKG A;  1ZRT E;  4N78 D;  3M0A A;  2FXM A;  1J1E B;  3L37 A;  1HTL C;  1QEX A;  1QLE D;  4XFJ A;  3H1J J;  1GD2 E;  5E79 E;  2Z5I A;  2P1J A;  4PD4 I;  1VQP P;  3AEF C;  3E7K A;  3S4R A;  3VP9 A;  2V7Q J;  3WU2 H;  5CCG A;  2FYZ A;  1GK4 A;  1N7S D;  1BE3 D;  2N9Y B;  1LT9 A;  1U7J A;  1USE A;  2I8D A;  2WPV B;  1YQ4 C;  2XNX A;  2ZT9 C;  1N73 B;  5TJH A;  4U3F G;  2N9B A;  2JP3 A;  3K5B A;  1M8O B;  3V2P A;  1ZN5 A;  1LWU C;  1EXI A;  1QGK B;  2WT7 B;  3GW6 A;  4N3Y B;  1L4A D;  4DZO A;  2K88 A;  1RQU A;  3OW2 O;  1URQ D;  1BCC E;  1HH0 A;  2HOD B;  4HH2 A;  2W6J H;  2M3B A;  4RES B;  3V4W A;  3VYI A;  4DCK A;  1GU4 A;  1VQ7 P;  1L0N G;  5B5E H;  4PV1 B;  1NH4 A;  5DJU B;  2QEX P;  2ZVN B;  3AE2 C;  1NTZ J;  5H2F H;  1SQQ G;  3D70 A;  1HGZ A;  1HUC A;  5APW A;  5AW8 B;  1CSB A;  2BCC G;  2E75 C;  1BCC J;  3Q1M A;  2B89 A;  5AVY B;  3CMA P;  1IC2 A;  1L0N E;  2FXO A;  3TSI A;  2JDI H;  1ZR4 A;  4LLH A;  4PJ0 H;  4ZMD A;  1OXZ A;  3H1L J;  4I1L A;  1SQP G;  1NVO A;  3ZDM A;  2Z5H A;  3P7K A;  1JY3 O;  2E75 D;  2P58 A;  2IFM A;  2NPS D;  2OTK E;  2WSE J;  3EQ2 A;  3II6 A;  3L36 A;  3CCV P;  1VQO P;  3A2A A;  3F89 A;  3S1K A;  1VQN P;  2B87 A;  1TU3 F;  1NJI Q;  3EWK A;  3WUV A;  4WB4 A;  2K1A A;  4H44 C;  1P84 I;  1RE4 C;  1Q7Y Q;  4K35 A;  2YMK A;  1NTK G;  1VQ6 P;  1M1K Q;  1N2D C;  1KB9 H;  1X0T A;  4RO0 A;  1RF1 C;  1N7S B;  2R5B A;  3P8C D;  3BAT A;  1LGH B;  4KHX A;  1M1J C;  3RGU A;  1NU1 D;  3RL0 g;  2R3C A;  3USS A;  1W5C E;  1AFO A;  5APT A;  3CCM P;  1G1I A;  1S5L E;  3L35 A;  3Q3D A;  3H1K J;  1KTM A;  5CMZ A;  2OYO A;  2YO2 A;  1SP4 A;  2NPS B;  2WPS A;  1SQX D;  2WT7 A;  4JYB A;  2YKQ A;  3IR9 A;  3SFE C;  1NOH A;  1RE4 A;  1BDD A;  1KYO I;  1SQQ E;  2XND H;  4RKU J;  4C7N B;  5KAF E;  2BCC E;  3TGU J;  1NO4 A;  3A7O A;  1ZR2 A;  1GU5 A;  3TYY A;  1QL2 A;  1PGP A;  2JR8 A;  4L73 A;  4YPC A;  2PP6 A;  3Q5S A;  1K8A Q;  4UB6 E;  1ZV8 A;  2N1T D;  1KIL C;  1SFC B;  2HFE D;  1LWU A;  3A0H H;  4H13 B;  1FZC C;  1CI6 A;  1P84 H;  2YXQ B;  5CJ0 A;  1JY2 N;  3CC2 P;  1SQV K;  3AEA C;  2KS1 B;  4W7Y A;  2PGD A;  1IO4 A;  1EDJ A;  1EZV D;  1U7M A;  1VPC A;  2Q1K A;  2IYO A;  4W7Z A;  1RHZ B;  2B88 A;  2BAS A;  5APY A;  4N6J A;  3U1C A;  5AVX B;  2FFD C;  3M9H A;  2H89 C;  3AE6 C;  3AEC C;  5KLV E;  1KB9 I;  1PZQ A;  2Q6Q A;  4KJM A;  5APV A;  1OWA A;  1JOC A;  3H1H J;  4IFM A;  1LTI C;  3SWK A;  5KKZ B;  5L8R J;  1Y8A A;  3GF3 A;  1FZA A;  4IL6 X;  2OYI A;  1KQG B;  3L71 G;  4H44 B;  5AW5 B;  2JKV A;  3GHG A;  2KNC B;  2M5A B;  1H0T A;  1RE3 A;  3H32 A;  4H13 C;  5B66 H;  2IPP A;  4U7J A;  1FZC B;  2OAR A;  2WSF J;  1PPJ G;  2A06 D;  2PRR A;  2FFD A;  3H1I J;  2D2C B;  1LP1 B;  2E74 B;  4H0L B;  3D6Y A;  3L71 E;  2RN0 A;  1YIJ P;  5AVV B;  3C8V A;  4D6T E;  3LW5 J;  4U3F D;  1IK9 A;  1NTZ G;  1L0N J;  3M0D A;  2QJK B;  1S1C X;  3SWF A;  1ZME C;  1KQL A;  1LWU B;  2FXP A;  1L0L E;  1MKM A;  2NPS C;  2WPR A;  5AVQ B;  2Z4E A;  5GTH H;  3KPE A;  5KKZ C;  5B66 E;  2HLO A;  5CCG D;  1Q81 Q;  3VMZ A;  3CC4 P;  1L0N D;  2OQQ A;  2K9Y A;  2SPZ A;  3T97 A;  5KAI E;  1LTB C;  4Y99 B;  5KTB A;  4IL6 E;  2M5A A;  2R44 A;  1AJY A;  1PGQ A;  2G3A A;  1SFC A;  2O1K A;  3H1I D;  2OYI B;  1SQB J;  5GTI H;  1L4A A;  1URQ C;  2GUS A;  3MGN A;  2WTY A;  1NTM G;  3CCS P;  4RJT A;  2WWW A;  1KMI Z;  4BWN A;  3H32 B;  5AVR B;  1ZP0 C;  3CC7 P;  2A45 H;  3RL0 D;  1FS0 E;  2KNC A;  1NTK J;  1SQP D;  1PIX A;  3H1J G;  3A5T A;  1S9K D;  3PRJ A;  4U3F E;  2H43 A;  1MUU A;  1GTW A;  1FJP A;  1SQX K;  3BCC E;  3V2R A;  5B5E E;  1NTM E;  1BE3 J;  1GL2 B;  1Y47 A;  2GUV A;  3CXH D;  3HRN A;  3VN0 A;  1EZV I;  3H1J E;  3SFD C;  4JYC A;  1JO5 A;  2Q3E A;  2LR2 A;  5K5G B;  1YBK A;  4KT0 J;  3IAO A;  2AEF A;  4QMA A;  2Q7C A;  1X9V A;  1N7L A;  4OH8 B;  2YIU C;  1PL5 A;  4NPF X;  4B86 A;  1IFP A;  1SVF A;  3V4Q A;  1BSN A;  1S5L X;  1SQQ J;  2OYH B;  1M56 D;  2WVR A;  3A0B E;  3GHG C;  1DX7 A;  3B8E B;  2FKW B;  2NRG A;  3GMA A;  3U59 A;  3Q5R A;  2OTJ P;  3LW5 H;  1GL2 D;  2WZ7 A;  3LID A;  1J1E C;  3VOP A;  1MFZ A;  2KLV A;  2LXB A;  2YMY A;  3B71 A;  4Z1M H;  2WIT A;  2PFX A;  1Z56 A;  1PP9 G;  2HR3 A;  1NKN A;  2WPQ A;  1X22 A;  1NU1 J;  3JSV C;  3MUD A;  3VMY A;  1GL2 A;  5AVS B;  1LTJ C;  1OVV A;  1P84 E;  5BU5 A;  3PHL A;  2Q3I A;  1LNQ A;  2YKO A;  3HD7 B;  4WVZ A;  2QJY C;  2W27 A;  4ZKU A;  2JEE A;  3MP7 B;  4XE5 B;  1QL1 A;  3M06 A;  3MUD C;  2FFD B;  1PFI A;  2E5T A;  5AVW B;  2E42 A;  1FDM A;  1FZB A;  1SQX J;  4OGQ C;  5CCH C;  1AV1 A;  1HVV A;  4UB8 H;  3WUU A;  1L0N K;  2IBZ D;  4JF7 A;  3HUS B;  3H1K D;  1M1J A;  1LTS C;  3CCQ P;  1GW4 A;  3G6E P;  2HOD A;  1FOS E;  1KB9 D;  2E76 B;  2HYN A;  1XTC C;  2ZYA A;  1H8A A;  1OVU A;  3HE4 A;  2Y0D A;  5APX A;  2AXT E;  2E76 D;  3CI9 A;  2C9L Y;  1KV4 A;  4JPZ B;  5CCH A;  1S4X A;  5KLI C;  1NYH A;  1PGJ A;  3HD7 A;  3L72 J;  2QSI A;  1PP9 J;  3PLN A;  2G8Y A;  2ZXE B;  1R5L A;  3RL0 B;  1N8R Q;  4IOI H;  1GK6 A;  1PP9 D;  3HTK B;  2KUB A;  1AVY A;  1SQP E;  1JNM A;  2NZ2 A;  5KLV G;  2QM8 A;  1CZQ A;  3L4F A;  2WQY C;  2OGU A;  4O9B A;  1JB0 J;  3HD7 D;  2KXP B;  2IYP A;  1HJB A;  1KZU B;  2DW3 A;  3L73 D;  4PV1 C;  2FYU E;  1ZW0 A;  2YKP A;  5AW3 B;  4TT3 H;  2Q9I A;  1JY3 P;  3MHV A;  1YTZ T;  2LXC B;  3FGA D;  1LTT C;  3IFM A;  4PD4 E;  1N7S C;  4EDF A;  1K04 A;  1DD4 A;  1SQQ K;  1NTM D;  3ITK A;  2JWA A;  2WSS H;  3O8Z A;  2RH0 A;  4LC1 A;  3CX5 E;  5APS A;  3RBZ A;  1NGM B;  1AQ5 A;  2M3E A;  1VQ4 P;  2M0B A;  3H1J D;  3AE5 C;  3IF4 A;  3V2Q A;  3KDP B;  2IX7 C;  2KSJ A;  4N78 E;  2I1J A;  1BGY J;  3B4S A;  1DD3 A;  1SLQ A;  3B5N B;  1T2K D;  1GL2 C;  1DIP A;  3OJA B;  3R2P A;  1NAY A;  2O01 H;  4R4M A;  1DH3 A;  1CW5 A;  3CWB G;  4ASV A;  2P67 A;  3CX5 I;  1KYO D;  3HUS A;  3L70 J;  2RKL A;  3RK2 B;  3I56 P;  4D6T D;  3O6Q A;  1SQX E;  2IFN A;  4OVN F;  4UB6 H;  4ZKP A;  1T2K C;  4PJ0 E;  1JMM A;  3BCC J;  2BEQ D;  3AE8 C;  3M0D C;  5KLV K;  2VRS A;  4Y28 J;  1EDL A;  3VMX A;  2KYV A;  1NTK K;  1VQ8 P;  3L70 D;  1YI2 P;  2OTL P;  1EDK A;  4GIF A;  5APQ A;  4BRY A;  1J2J B;  2XKM A;  1EQ7 A;  3A0B H;  2OYH C;  1FU1 A;  1OIP A;  5AW9 B;  1SQB K;  4EYY Q;  2B87 B;  2H88 C;  2BCC D;  1AA0 A;  1YTZ I;  2CPB A;  3L72 E;  4C7R A;  4OGQ D;  2GA1 A;  3H6P A;  4I6M C;  5CCH D;  1OW7 A;  1D7M A;  2QG4 A;  3N7N A;  3MIW A;  2RMZ A;  4L75 A;  1UII A;  1SQP K;  3P32 A;  3SSU A;  3C9I A;  4H0L C;  1M90 Q;  3CXH E;  3CWB J;  3L72 G;  3PP5 A;  1PPJ D;  2A06 G;  2P10 A;  2P7J A;  1MV8 A;  1RF0 A;  1FAV A;  2AXC A;  2D2C C;  2E74 C;  2J5U A;  1NAF A;  3BCC D;  1RQV A;  1PV3 A;  3AE1 C;  4ASW A;  2XDJ A;  3CD6 P;  4GOF A;  4HB1 A;  1LT9 C;  1OX3 A;  5CBN A;  2KB7 P;  3AE4 C;  1JY2 P;  1NTK D;  3CWB E;  2A06 E;  3GLM A;  5H2F E;  3RK3 D;  4CPG A;  3CL3 D;  1NTZ E;  1WMK A;  4LGD E;  2QIW A;  1G2C A;  1OW6 A;  1SQB D;  1FJK A;  5AW6 B;  1RE3 C;  2N1T C;  1N86 A;  1LTA C;  3KZI H;  4Y99 C;  2J59 M;  3S9O A;  5KAI H;  4D6T G;  1NTM J;  1PP9 E;  1YYC A;  1NU1 E;  3PH0 A;  2CPS A;  1NTM K;  1YJ9 P;  3QWO C;  5KLV J;  2NPS A;  3L75 G;  3AEG C;  4JBZ A;  3VP8 A;  3BRT B;  1ZXG A;  2LKM A;  3FXE A;  1ZOY C;  4GOD A;  1VF5 D;  1EC5 A;  3H25 A;  1KIL D;  4PD4 D;  1S2E A;  3L75 E;  1OZH A;  3BCC G;  2ZT9 D;  2H7H A;  3G71 P;  1VDF A;  1BSH A;  1FC2 C;  1XTG B;  2ITA A;  1LTJ A;  2Y9Y A;  3I5C A;  4JQ0 D;  1EXJ A;  1H0T B;  1L4A C;  2V4H A;  1H89 A;  4H13 D;  1K05 A;  1X79 B;  1K9M Q;  1KYO E;  1SFC C;  2OYI C;  5CHX A;  3AE7 C;  3H1H D;  2YIU B;  4IFD K;  1MFT A;  3F5H A;  2QJP B;  2O01 J;  1E5W A;  4GDO A;  1K73 Q;  3CCL P;  1AQT A;  1LT9 B;  2FYU K;  5AW0 B;  1N73 A;  1IFN A;  1WRG A;  3TF5 A;  1L2P A;  1RH5 B;  2ZYG A;  3L71 J;  2E43 A;  3CCU P;  1S72 P;  4I7Z B;  2P2U A;  1N7S A;  3GF7 A;  2KIK A;  2JJL A;  3Q5P A;  1VF5 C;  5APU A;  3PJS K;  2ZFC A;  2FYN C;  1Q2N A;  3B5N C;  4XA4 A;  2W6A A;  1FZC A;  2E5Y A;  1JY3 N;  4MN4 C;  1JUN A;  4OWF A;  1FZE A;  1KIL A;  2L91 A;  3V2N A;  2B9B A;  4YXW H;  3L74 J;  1KFM A;  4IFF A;  3CLQ A;  4WY4 D;  4R4L A;  1NHL A;  1JY2 O;  3BRV B;  3HD7 C;  3FX0 A;  3RBX A;  2QJY B;  5CCG C;  1KD1 Q;  4PD4 H;  3NTN A;  1VQK P;  1L0L D;  3RK2 D;  4EIJ A;  3GHG B;  1FZG A;  2J58 A;  2QJK C;  3FWN A;  2FYU D;  4YXD C;  3H1I G;  4L76 A;  2FYN B;  2O01 N;  1BGY E;  2IZ0 A;  4HYT B;  3M9Q A;  3P8M C;  2FY8 A;  1M57 D;  2KOG A;  1BE3 E;  1VL2 A;  3H1K G;  3L74 D;  4NPE A;  5E79 H;  3MZW B;  1RF1 A;  3CCE P;  1KIL B;  1QX8 A;  2BEZ F;  2Q5U A;  3L75 J;  3AEE C;  2V7Q H;  3KHU A;  3MD0 A;  3EFF K;  1LTG C;  4H44 D;  1M7L A;  1PGO A;  1SQX G;  2K3R A;  3WU2 E;  4EI2 A;  3CPW O;  3TGU D;  1YJW P;  3TGU G;  2IBZ E;  2JO1 A;  2KZI A;  1BE3 G;  2JWD A;  3H1K E;  4WY4 C;  3HE4 B;  1GDT A;  3CCR P;  4C7N A;  1KB9 E;  3C1L A;  3D6Z A;  4AQR D;  3LIE A;  1QVF O;  5AVT B;  1RF0 C;  1BDC A;  5KLV D;  2W6B A;  1KQF B;  3WUT A;  3HE5 B;  4IL6 H;  4WY4 A;  1W2E A;  4AYC A;  2IBZ I;  5AW4 B;  1SQP J;  2N1T B;  4L74 A;  3AE9 C;  4M3L A;  1ZRT D;  4AUW A;  2FYU G;  1VQ9 P;  1DEB A;  1URQ A;  1FBM A;  4ZNC A;  2FBW C;  3BVH A;  2OYH A;  2KK7 A;  1OW8 A;  1RF1 B;  2XV5 A;  3W67 A;  1W2B O;  1JTH B;  1KIL E;  2AEJ A;  1LP1 A;  2QVA A;  3L75 D;  3TNU B;  3D71 A;  2N1T A;  1Q82 Q;  2HPC B;  3A3Y B;  1VQM P;  4A7P A;  1IJD B;  2UWJ E;  1RY3 A;  1UIX A;  3MTU E;  1T3J A;  3H1L D;  2KS1 A;  2XU6 A;  2Y0C A;  3KYQ A;  3TDK A;  3TK1 A;  1USD A;  2YO3 A;  1GW3 A;  2MKV A;  2GM4 A;  2IZ1 A;  3L73 E;  2FYU J;  2HPC A;  3FXD A;  1JEK A;  1NTK E;  1FE6 A;  2WSC H;  3CWB D;  3R4Y A;  5M1B A;  4U3F J;  1NTZ D;  3KQG A;  2AEM A;  2E76 C;  1J1D B;  3RK3 C;  2ZYD A;  1SQB E;  5BVZ A;  4BXL A;  1NU1 G;  2PAJ A;  2QM7 A;  4WY4 B;  5AW7 B;  4TLF A;  5BU8 B;  2QJP C;  3L70 G;  3OAK A;  3G3Z A;  5TIS E;  3OA7 A;  1VQ5 P;  4HJG H;  2YXR B;  3CX5 H;  2C9N Y;  1JM0 A;  4GOE A;  5KJ7 A;  1EDI A;  1SFC D;  2HG5 D;  2L5G B;  3NMD A;  4I7Z C;  3V5B A;  1BCC G;  1S9K E;  1LJ2 A;  3A0H E;  2CK3 H;  3L70 E;  1H88 A;  1A02 J;  2KI7 B;  2I1K A;  1Y9B A;  1L0L J;  2ZAE B;  2A45 I;  3HUS C;  5AVU B;  3CXH I;  5C39 A;  1QVG O;  1KC8 Q;  2M8R A;  5AVZ B;  3H1L G;  1YHQ P;  4WWI A;  1NTZ K;  3JC2 2;  1VQL P;  1URQ B;  3UIA A;  2A45 G;  1BGY D;  1IZN B;  2W83 C;  2BCC J;  1S5L H;  1EZV G;  3TGU E;  3L73 G;  1AVO A;  2XZR A;  1KOR A;  1HWT C;  3N4X A;  1JCC A;  2W8Z A;  3CXH H;  4PV1 D;  2C0W A;  3JCU H;  4UB8 E;  3RL0 C;  1FZF A;  1JTH A;  3NFQ A;  1KFN A;  2AXT H;  4I2L C;  1NU1 K;  1GMJ A; 
#chains in the Genus database with same CATH homology
 1L0L G;  1L0N G;  3L70 G;  3H1I G;  1SQB G;  2FYU G;  3CX5 H;  3H1H G;  3L74 G;  1SQQ G;  2IBZ G;  1NTM G;  2BCC G;  1BCC G;  3H1K G;  3L71 G;  3H1J G;  3L75 G;  1KYO H;  1PPJ G;  1SQX G;  1SQP G;  3L72 G;  2A06 G;  1BE3 G;  1PP9 G;  3H1L G;  3TGU G;  3CWB G;  1NTZ G;  3BCC G;  1P84 H;  4U3F G;  5KLV G;  1EZV G;  3L73 G;  4D6T G;  1SQV G;  1BGY G;  3CXH H;  1NTK G;  4PD4 H;  1KB9 H;  1NU1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...