1NU1G

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1nu1G00
3H1HG 3L74G 2IBZG 1NTKG 1BCCG 1SQVG 4PD4H 3H1IG 2FYUG 1SQXG 3CWBG 4U3FG 1KYOH 1L0LG 1EZVG 1KB9H 3L75G 1PPJG 3L71G 1PP9G 3CX5H 1NU1G 3H1JG 3H1KG 1BE3G 1P84H 1NTZG 2BCCG 3TGUG 2A06G 1SQBG 3L70G 1SQPG 5KLVG 3CXHH 1NTMG 3L73G 1L0NG 3L72G 4D6TG 3H1LG 1BGYG 1SQQG 3BCCG
chains in the Genus database with same CATH superfamily
4U3FE 1JY2O 3CLQA 1SLQA 1TU3F 4RESB 1HJBA 1YJWP 2KSEA 1T6AA 1H88A 1GK6A 3CCMP 1GW4A 5AVYB 2K3RA 1PPJE 2W27A 1FOSF 1L0LG 1PFIA 3BATA 1VQNP 5CCHA 3AECC 1JY3O 2KI7B 3M91A 4EYYQ 1MZ9A 2WZ7A 2LXBA 5KLVD 3H1LJ 1Q81Q 1PL5A 2YIUC 1KFMA 2R5DA 4LGDE 3M9QA 2JP3A 4BXLA 1DIPA 2I1KA 2HLOA 3RK2D 1GU4A 2ZVNB 3BRTB 1NU1D 2FFDA 3RK2C 3L70J 3ZDMA 4DZOA 4H44D 1FZCB 2IFNA 1M1JA 4H44C 4GKGA 1N7SA 3CX5I 2E75D 2KS1B 4AYCA 3RBXA 1LNQA 3SFEC 2E75C 3MUDC 1SQXJ 5DJTB 4D6TE 1RE3C 2O1KA 2IX7C 4U3FD 3OA7A 2BCCJ 3L74E 5E79E 1FE6A 1SQQD 3CC2P 2D2CD 1JCDA 1G2CB 2B87B 2WSCH 1KFNA 1FZAA 2D2CC 2FYUD 1PPJD 3CCRP 1M57D 5KLVK 1SQVE 4JF7A 5GTIE 4K35A 3USSA 2V4HA 2K88A 1IC2A 1NU1K 1VQ9P 1FU1A 2MKVA 1ZRTE 1KILB 3Q1MA 1FOSE 3IFMA 5TJHA 1U7MA 2QE7H 2WPQA 2HYNA 4EDFA 5KLVG 3S4RA 2KNCA 3HUSB 2M5AA 1AVYA 1X0TA 3G3ZA 4W7ZA 4IL6X 1SQQK 2PFXA 1DD4A 2NRGA 2WPSA 1USEA 5KAIE 1FJKA 1NU1G 1BE3G 1OX3A 2FYUK 2WWWA 3H1KD 2V7QH 2GM4A 3G71P 2N1TB 3VP8A 1JTHB 1RE3A 3EQ2A 3A0HH 1HWTC 1M90Q 1ZXGA 2OYHB 1LT1A 1HBWA 4WVZA 3CI9A 2YKQA 3H1LE 2JWAA 2IYOA 3G9RA 1SQQG 1LWUB 1Y8AA 1FZCC 5AVUB 3V2RA 1IFPA 3H1HD 3CMEP 3TNUB 4KJMA 2K1AA 1VQLP 3L70E 3OJAB 4JYCA 4JYBA 1GU5A 1VQ8P 1G1JA 5CCGD 1MV8A 1T3JA 1ZN5A 5CCGC 4OWFA 1SQXE 1U57A 1YJ9P 1EQ7A 1FAVA 4NPEA 2BCCE 2YMYA 5BU5A 4UB6H 3L4FA 2QEXP 3CCSP 4NPFX 2G8YA 3ABVC 3EFFK 1GW3A 3II6A 1KV4A 2AEMA 4DCKA 2R3CA 1FDMA 2A06E 1HH0A 2E76B 4I7ZB 4JBZA 2XU6A 5B5EH 1E5WA 1LTJB 4ASWA 2CK3H 4N6JA 1KILD 3V2PA 3AEEC 1KILC 2HODB 3UIAA 4PD4H 1KB9H 3FXDA 3MD0A 3QWOC 5B66H 1KC8Q 4W80A 2Q3EA 2QG4A 4UB8H 3HE4B 5CJ4A 1RF0C 2KZIA 5AVZB 1KD1Q 5KLVJ 2B89A 3HUSC 2J58A 1NTMD 1VQ7P 3CX5E 2JKVA 4PV1B 1FZCA 1EDJA 2E74B 2FYNB 1SQXD 1NU1J 3HE5B 1BE3J 1M8OB 2ZVOB 1Q2NA 2BCCD 2N1TD 3EWKA 3H1HG 3V6IA 2IZ0A 1HF9A 2N1TC 1KYOE 1S3JA 3BCCD 4DOJA 2OYHC 1Q86Q 1E79H 2LR2A 1YJNP 1PP9D 2IBZE 4PD4I 1LJ2A 1LWUC 3PP5A 1EXIA 1KB9I 1SQQJ 3B71A 4ZKPA 3D6ZA 3TSIA 1H8AA 2FYUJ 3T97B 2WSSH 3AE8C 1VQMP 2ZAEB 3GF3A 1NTMK 3L73D 1K73Q 2JWDA 4H0LB 1FZFA 2GUSA 2Q6QA 2QSIA 1FDOA 3CX5D 4XA4A 2WSFH 5KJ7A 1N86A 1R5SA 1FZBA 1RF0A 1RF1B 2HPCB 1AJYA 2E76D 2IZ1A 3KPEA 2E76C 5APWA 4I7ZC 1ZR2A 1L0LD 1MFTA 1ZOYC 5DJUB 1LTJC 3O8ZA 3A5TA 3R2PA 3I5CA 1VPCA 3M9BA 1YQ4C 2N1TA 1PV3A 2KLUA 2B9BA 2CPBA 3H1KJ 4BRYB 3BCCG 5AW8B 1BCCG 4L76A 4PV1D 4MN4C 2O01J 4PV1C 5KLVE 1PP9G 2YMKA 2A45H 2RN0A 2I1JA 1A02J 2E74D 3SFDC 4YPCA 1J2JB 2E74C 2FYNC 3GF7A 3JC22 4PJ0E 1PGOA 3H1HJ 1NU1E 1BE3E 3LIDA 2SPZA 4H13B 4JPZB 3V5BA 4K3AA 3RK3B 1HVVA 1YBKA 2FXOA 1L0LK 3TK1A 2C9NY 1NKZB 1MKMA 1NGMB 1A02F 4BWNA 3BASA 1NHLA 3SWKA 1SP4A 3KZIE 4N3YB 1XTCC 2Y9YA 1SQQE 2JDIH 2W6AA 2IYPA 1BSHA 4L75A 2GA1A 3IF4A 1JMMA 1W2EA 1EDIA 4EIJA 2FYUE 5AVQB 2A45I 1KZUB 1URQA 1GL2A 1P84E 1LTJA 2RH0A 3VTPC 1X9VA 2OTKE 3FXEA 1VQKP 4H0LD 3U1CA 2H88C 3CXHH 3CWBD 4H0LC 3TF5A 2H8PD 2ZXEB 3Q5PA 1FZGA 3RK3E 2E5TA 2P58A 1QGKB 2HFED 2OTLP 5KKZB 1YYCA 2H7HA 4C7NA 2ZT9B 1RF1C 4RJTA 4JQ0D 2CPSA 3AE2C 4RO0A 4YTPC 3A0BE 3G6EP 2KIKA 1EXJA 1W2BO 1BE3D 1G1IA 1IFIA 1NTMJ 1YI2P 3E1RA 3HE5A 4XFJA 1NTKK 1RQVA 1GMJA 2YO3A 1RE4C 1YTZI 2Q5UA 1QL1A 1NJIQ 1DX7A 5BVZA 3VMXA 1KB9E 1XTGB 3BCCJ 2YXRB 4QMAA 3LW5H 4OGQB 1LT9A 3CXHI 3H1KE 1GD2E 1BCCJ 2HR3A 4GIFA 1BDCA 1S4XA 1PGPA 1PP9J 4A7PA 5L8RJ 3Q5SA 2WT7B 1P84D 1SQBD 1KMIZ 1NTKG 1Y47A 3T97A 1VQ6P 1NH4A 3VMZA 5H2FE 5EFWB 2PGDA 4H13D 3RK3D 4H13C 4HH2A 3RK3C 5GTHE 3KXDA 3H1HE 3L72G 1X8YA 1S1CX 3L37A 1S5LH 4Z1MH 3L73J 1QLED 2KOGA 1CI6B 1Y9BA 3CWBG 1EZVG 1NAFA 2JR8A 4GOFA 2JO1A 3BRVB 2HPCA 1RH5B 5AW4B 3PJSK 1MFZA 4N78E 4YXWH 4CPGA 1KQLA 1IFMA 2HG5D 2R44A 4PD4D 2YO2A 3PHLA 1L0LJ 2OYIB 1KB9D 3OW2O 1CSBA 3TYYA 1KQFB 1SQBK 3B5NB 3MUDA 5AW9B 1VQPP 3VOPA 3NXSA 3KQGA 3A3YB 3JCUE 2ZT9D 3H1IG 5KKZC 1J1EB 2ZT9C 3TDKA 2R3SA 1KILE 3IAOA 1VF5B 5KAFE 2WSEH 3FWNA 3P8CD 3TGUD 1OMIA 4C7RA 3C9IA 1IFDA 1EZVI 2W90A 2C9LY 3B8EB 3IN6A 2GUVA 1NTME 2L5GB 3MZWB 1SQBG 3G4SP 4I6MC 1M7LA 1BDDA 3CL3D 1RHZB 2Z5IA 1JB0J 1N8RQ 5BU8B 4OH8B 4C46A 4OGQD 1Q82Q 4OGQC 2XDJA 4ZMDA 2W6BA 5M1BA 2QIWA 4WWIA 1MUUA 4KHXA 3BCCE 4IL6E 1DH3A 2WSCJ 4N78D 2Z4EA 2OARA 1BCCE 3QH9A 4GOEA 2P1JA 1W5CE 1PP9E 4HB1A 1NTKJ 1SFCC 3V4QA 3WUUA 3AEBC 5AVXB 4LLHA 1GZLA 1R8EA 2I8DA 1HTLC 2QJPB 1LTAC 1OZHA 1OVVA 2W83C 2E43A 2P7JA 2FKWB 2XNDH 2K9JB 3NTNA 1ZW0A 3PH0A 4DJGA 1QL2A 1OXZA 3L73E 3CWBJ 3AE7C 2FBWC 3O6QB 4D6TG 5AW1B 1GTWA 3L74G 1K8AQ 1UIIA 3D70A 5E79H 3FWLA 3TGUG 2OYIC 2YKPA 2KS1A 3B5ND 2WPVB 1N2DC 1N7LA 2M8RA 3B5NC 1L0ND 2PAJA 3P8MC 2V7QJ 1SQVG 1L0LE 1T2KD 5CCGA 1T2KC 1J1EC 1VF5D 1BCCD 3H1IJ 1M1JB 3SWYA 1VF5C 1N7SB 2OQQA 1OFCX 2MJZA 3E7KA 1IO4A 3C1LA 1NVOA 1G2CA 2B87A 2XZRA 1H0TB 1S5LX 2AEJA 2FY8A 2WT7A 3HTKB 2VRSA 1Z56A 2W8ZA 1M1KQ 1LTBC 2ZYDA 1RY3A 4IOIH 1SQBJ 1BSNA 2RMZA 1IFNA 3Q5RA 1N73B 2B88A 3NMDA 3F5HA 2ZXXA 5KAIH 1KILA 1CI6A 3CCQP 1SQPD 2UWJE 2Z5HA 3RL0B 1L0NK 1L2PA 1PGJA 1WRGA 3L75G 3HUSA 3VP9A 1DEBA 1K9MQ 3AE6C 1CW5A 1HUCA 2WPRA 3GHGB 2ZJSE 1Q90D 1NTKE 2N9YB 3AEAC 3I56P 2QJPC 2KNCB 1GK4A 3N4XA 2J5UA 1JTHA 3L70G 1L0NG 1IK7A 2POHA 2OYHA 3CWBE 1EZVE 2WVRA 3R4YA 4ZKUA 1LWUA 2A45G 3H1JG 3Q3DA 1NAYA 1KQGB 3PRJA 3TGUJ 3L35A 3TNUA 2QM7A 1SQPK 5AVVB 2FYZA 3VN0A 1PGQA 3HD7B 4WB4A 4HKZH 3L71G 1N7SD 3S9OA 1M1JC 2WMMA 4B86A 3KYQA 1N7SC 2WTYA 2L91A 1OIPA 1JY2P 3P7KA 3A0HE 2O1JA 3H1IE 5CJ0A 4AUWA 1BGYD 3H32B 2NPSB 5AW6B 1KN7A 1WMKA 1NTKD 2ZYGA 1Q7YQ 1JEKA 3MTUE 1SQPG 2IDBA 1NKNA 3SSUA 1OVRA 3AE4C 2QJYB 1AFOA 1NWQA 2KYVA 3M06A 3L72D 1ZR4A 2BEZF 1S72P 2P2UA 1K04A 1PIXA 3FX0A 1JY3P 1SQBE 1RQUA 1N73C 2JEEA 3CX5H 3JSVC 2O3JA 5CHXA 1FC2C 2HODA 1EZVD 4XE5B 1R5LA 2K9JA 2R32A 3RL0D 3CCUP 3RL0C 1EDLA 2WSFJ 3KDPB 3O6QA 4Y28J 3WMM0 3HE4A 4UB6E 1KYOH 2E5YA 2WITA 2W6JH 5AVSB 4I2LC 3AEFC 3L75J 4WBAA 4AQRD 3H25A 2PRRA 3GHGC 1YQ3C 3H6PA 1VDFA 2IBZG 2KLVA 5C39A 1X22A 5B5EE 1LTTC 3CC7P 2M3BA 2E42A 3H1ID 1M56D 1ZLLA 1NTZD 1H89A 5APVA 3M9HA 1L0NJ 4PD4E 4IFFA 2QJKB 5APTA 4YXDC 4HYTB 5B66E 1AA0A 4UB8E 1H0TA 1HGVA 3H1JJ 4WY4B 1U7JA 1BGYG 3CD6P 1KTMA 3HTKA 3P32A 4IFMA 1KYOI 3EFGA 3A2AA 2K37A 2N9BA 3P8CE 3HD7D 1SFCB 3TGUE 5APXA 3HD7C 5AW0B 2Q1KA 2KXPB 3SWFA 1IK9A 3L71J 1FBMA 1CZQA 1WT6A 2IBZI 1N73A 2RKLA 3WUVA 1K05A 3A7OA 1JOCA 2NPSD 2ZFCA 2XKMA 2BEQD 3W67A 2NPSC 1UIXA 4Y99C 5APSA 2H89C 2XNXA 2AXTH 3MIWA 3CCEP 2QM8A 1RF1A 2Q3IA 1L4AB 1NTZK 1SQPJ 3WU2H 4NPDA 2QJYC 1LTSC 1SVFA 3GHGA 3V2QA 4U7JA 3KHUA 1JCCA 2G3AA 1AVOA 2IFMA 3GG2A 4I1LA 1LGHB 1RE4A 3M0DC 4PJ0H 4D6TD 3AE9C 4O9BA 4R4MA 1PZQA 3WUTA 5APQA 3L74D 1FZEA 4BRYA 5TISH 1HGZA 1NTZG 5KLIB 4EOTA 3FGAD 3IR9A 3V2NA 3M0AA 1FDIA 2J59M 3C8VA 1ZMEC 3AEGC 2O01N 3L75E 3VMYA 3OAKA 3RL0g 3B4SA 4U3FG 1OW8A 1SQVD 3HRNA 2OGUA 1LP1B 2KSJA 3KZIH 3HD7A 4R4LA 2M0BA 2R5BA 1NYHA 2Y0EA 2QJKC 2AEFA 3PTZA 2FYUG 3ITKA 2JJLA 2Q7CA 5CBOA 1PPJG 4GT1A 1ZRTD 3LW5J 1P84H 1L0NE 4WY4D 1USDA 3H32A 2NPSA 4WY4C 4HJGH 3E1IA 5CMZA 1BGYJ 1IFJA 1SFCD 3H1JE 2QVAA 2BASA 3GLMA 3RBZA 1S2EA 1VQ4P 3A0BH 4L73A 2ITAA 1SS1A 2C0WA 3L72J 2WQYC 3L71E 1VQ5P 3CCJP 4LC1A 1DD3A 3M0DA 1SQVK 1YHQP 3D6YA 1URQB 1GL2B 1L4AD 3L75D 2ZYAA 1L4AC 2KP8A 3H1LD 1P84I 1YTZT 5KJ7D 1SQPE 3MP7B 1AV1A 3H1KG 5KJ7C 4IFDK 3CCVP 4C7NB 1NOHA 2KZJA 4KT0J 2QRXA 1OW6A 2XV5A 3L70D 1OWAA 1T8ZA 4GODA 5AVRB 5APYA 2O01H 2Y0DA 1GDTA 3AE1C 5AVTB 5AW3B 1T3UA 1ZP0C 3RGUA 3CPWO 2FFDB 2KK7A 5GTIH 3GMAA 3CXHE 4ASVA 5H2FH 2DW3A 5KLIC 3BVHA 3MGNA 3CCLP 1NTZJ 2WSEJ 3H1JD 1NO4A 1QX8A 5GTHH 1YITP 4M3LA 2KB7P 2AXCA 1LTGC 1FJPA 4WY4A 1OVUA 1J1DB 2C0XA 4DT0A 1JO5A 4W7YA 4U3FJ 3I55P 1KQSO 5AW7B 1LT9B 2Y9ZA 4EI2A 1SFCA 3L71D 1S9KE 2A06D 3W68A 5K5GB 1JM0A 1X79B 3V4WA 1VL2A 1HJ0A 2P10A 1JMBA 4L74A 3AE3C 1FS0E 3LIEA 1OW7A 2KUBA 1EDKA 4ZNCA 3GW6A 1JY2N 2YXQB 2Q9IA 2LKMA 5CBNA 1IJDB 1L4AA 3JCUH 2P67A 1KORA 2H43A 1SQXK 1BGYE 3Q2YA 2PP6A 3F89A 1EC5A 3H1LG 5KAFH 2NZ2A 3CXHD 3PLNA 2YIUB 2OTJP 2OYIA 1JUNA 5APUA 2M5AB 1JY3N 3B5NA 3D71A 3AEDC 3NFQA 3L72E 1URQD 1GL2D 1KYOD 1NTMG 3AE5C 1S5LE 2K9YA 3RK2B 1URQC 1GL2C 2OYOA 4OVNF 5CCHD 1D7MA 2M3EA 1AQTA 3U1AA 5CCHC 4H44B 4D6TJ 3S1KA 3L74J 1SQXG 2E75B 2QA4P 2AXTE 5AW5B 2IBZD 1S9KD 3N7NA 2BCCG 2FXPA 5AVWB 5AW2B 1QVFO 3WU2E 4TLFA 1QEXA 1JNMA 2Y0CA 4IL6H 3VMAA 2IPPA 4TT3H 2LXCB 1ZV8A 3CC4P 1LTIC 4RKUJ 3K5BA 1LP1A 5KTBA 3CMAP 2FFDC 1SQVJ 2D2CB 1AQ5A 2A06G 2YKOA 2YNYA 2FXMA 3U59A 1YIJP 3VYIA 5TISE 3MHVA 1IZNB 4GDOA 1NTZE 1QVGO 1J1DC 4Y99B 3L36A 1VQOP 3L73G 1DEEG 1LT9C
chains in the Genus database with same CATH topology
3H1HG 3L74G 2IBZG 1NTKG 1BCCG 1SQVG 4PD4H 3H1IG 2FYUG 1SQXG 3CWBG 4U3FG 1KYOH 1L0LG 1EZVG 1KB9H 3L75G 1PPJG 3L71G 1PP9G 3CX5H 1NU1G 3H1JG 3H1KG 1BE3G 1P84H 1NTZG 2BCCG 3TGUG 2A06G 1SQBG 3L70G 1SQPG 5KLVG 3CXHH 1NTMG 3L73G 1L0NG 3L72G 4D6TG 3H1LG 1BGYG 1SQQG 3BCCG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1H G;  3L74 G;  2IBZ G;  1NTK G;  1BCC G;  1SQV G;  4PD4 H;  3H1I G;  2FYU G;  1SQX G;  3CWB G;  4U3F G;  1KYO H;  1L0L G;  1EZV G;  1KB9 H;  3L75 G;  1PPJ G;  3L71 G;  1PP9 G;  3CX5 H;  1NU1 G;  3H1J G;  3H1K G;  1BE3 G;  1P84 H;  1NTZ G;  2BCC G;  3TGU G;  2A06 G;  1SQB G;  3L70 G;  1SQP G;  5KLV G;  3CXH H;  1NTM G;  3L73 G;  1L0N G;  3L72 G;  4D6T G;  3H1L G;  1BGY G;  1SQQ G;  3BCC G; 
#chains in the Genus database with same CATH topology
 4U3F E;  1JY2 O;  3CLQ A;  1SLQ A;  1TU3 F;  4RES B;  1HJB A;  1YJW P;  2KSE A;  1T6A A;  1H88 A;  1GK6 A;  3CCM P;  1GW4 A;  5AVY B;  2K3R A;  1PPJ E;  2W27 A;  1FOS F;  1L0L G;  1PFI A;  3BAT A;  1VQN P;  5CCH A;  3AEC C;  1JY3 O;  2KI7 B;  3M91 A;  4EYY Q;  1MZ9 A;  2WZ7 A;  2LXB A;  5KLV D;  3H1L J;  1Q81 Q;  1PL5 A;  2YIU C;  1KFM A;  2R5D A;  4LGD E;  3M9Q A;  2JP3 A;  4BXL A;  1DIP A;  2I1K A;  2HLO A;  3RK2 D;  1GU4 A;  2ZVN B;  3BRT B;  1NU1 D;  2FFD A;  3RK2 C;  3L70 J;  3ZDM A;  4DZO A;  4H44 D;  1FZC B;  2IFN A;  1M1J A;  4H44 C;  4GKG A;  1N7S A;  3CX5 I;  2E75 D;  2KS1 B;  4AYC A;  3RBX A;  1LNQ A;  3SFE C;  2E75 C;  3MUD C;  1SQX J;  5DJT B;  4D6T E;  1RE3 C;  2O1K A;  2IX7 C;  4U3F D;  3OA7 A;  2BCC J;  3L74 E;  5E79 E;  1FE6 A;  1SQQ D;  3CC2 P;  2D2C D;  1JCD A;  1G2C B;  2B87 B;  2WSC H;  1KFN A;  1FZA A;  2D2C C;  2FYU D;  1PPJ D;  3CCR P;  1M57 D;  5KLV K;  1SQV E;  4JF7 A;  5GTI E;  4K35 A;  3USS A;  2V4H A;  2K88 A;  1IC2 A;  1NU1 K;  1VQ9 P;  1FU1 A;  2MKV A;  1ZRT E;  1KIL B;  3Q1M A;  1FOS E;  3IFM A;  5TJH A;  1U7M A;  2QE7 H;  2WPQ A;  2HYN A;  4EDF A;  5KLV G;  3S4R A;  2KNC A;  3HUS B;  2M5A A;  1AVY A;  1X0T A;  3G3Z A;  4W7Z A;  4IL6 X;  1SQQ K;  2PFX A;  1DD4 A;  2NRG A;  2WPS A;  1USE A;  5KAI E;  1FJK A;  1NU1 G;  1BE3 G;  1OX3 A;  2FYU K;  2WWW A;  3H1K D;  2V7Q H;  2GM4 A;  3G71 P;  2N1T B;  3VP8 A;  1JTH B;  1RE3 A;  3EQ2 A;  3A0H H;  1HWT C;  1M90 Q;  1ZXG A;  2OYH B;  1LT1 A;  1HBW A;  4WVZ A;  3CI9 A;  2YKQ A;  3H1L E;  2JWA A;  2IYO A;  3G9R A;  1SQQ G;  1LWU B;  1Y8A A;  1FZC C;  5AVU B;  3V2R A;  1IFP A;  3H1H D;  3CME P;  3TNU B;  4KJM A;  2K1A A;  1VQL P;  3L70 E;  3OJA B;  4JYC A;  4JYB A;  1GU5 A;  1VQ8 P;  1G1J A;  5CCG D;  1MV8 A;  1T3J A;  1ZN5 A;  5CCG C;  4OWF A;  1SQX E;  1U57 A;  1YJ9 P;  1EQ7 A;  1FAV A;  4NPE A;  2BCC E;  2YMY A;  5BU5 A;  4UB6 H;  3L4F A;  2QEX P;  3CCS P;  4NPF X;  2G8Y A;  3ABV C;  3EFF K;  1GW3 A;  3II6 A;  1KV4 A;  2AEM A;  4DCK A;  2R3C A;  1FDM A;  2A06 E;  1HH0 A;  2E76 B;  4I7Z B;  4JBZ A;  2XU6 A;  5B5E H;  1E5W A;  1LTJ B;  4ASW A;  2CK3 H;  4N6J A;  1KIL D;  3V2P A;  3AEE C;  1KIL C;  2HOD B;  3UIA A;  4PD4 H;  1KB9 H;  3FXD A;  3MD0 A;  3QWO C;  5B66 H;  1KC8 Q;  4W80 A;  2Q3E A;  2QG4 A;  4UB8 H;  3HE4 B;  5CJ4 A;  1RF0 C;  2KZI A;  5AVZ B;  1KD1 Q;  5KLV J;  2B89 A;  3HUS C;  2J58 A;  1NTM D;  1VQ7 P;  3CX5 E;  2JKV A;  4PV1 B;  1FZC A;  1EDJ A;  2E74 B;  2FYN B;  1SQX D;  1NU1 J;  3HE5 B;  1BE3 J;  1M8O B;  2ZVO B;  1Q2N A;  2BCC D;  2N1T D;  3EWK A;  3H1H G;  3V6I A;  2IZ0 A;  1HF9 A;  2N1T C;  1KYO E;  1S3J A;  3BCC D;  4DOJ A;  2OYH C;  1Q86 Q;  1E79 H;  2LR2 A;  1YJN P;  1PP9 D;  2IBZ E;  4PD4 I;  1LJ2 A;  1LWU C;  3PP5 A;  1EXI A;  1KB9 I;  1SQQ J;  3B71 A;  4ZKP A;  3D6Z A;  3TSI A;  1H8A A;  2FYU J;  3T97 B;  2WSS H;  3AE8 C;  1VQM P;  2ZAE B;  3GF3 A;  1NTM K;  3L73 D;  1K73 Q;  2JWD A;  4H0L B;  1FZF A;  2GUS A;  2Q6Q A;  2QSI A;  1FDO A;  3CX5 D;  4XA4 A;  2WSF H;  5KJ7 A;  1N86 A;  1R5S A;  1FZB A;  1RF0 A;  1RF1 B;  2HPC B;  1AJY A;  2E76 D;  2IZ1 A;  3KPE A;  2E76 C;  5APW A;  4I7Z C;  1ZR2 A;  1L0L D;  1MFT A;  1ZOY C;  5DJU B;  1LTJ C;  3O8Z A;  3A5T A;  3R2P A;  3I5C A;  1VPC A;  3M9B A;  1YQ4 C;  2N1T A;  1PV3 A;  2KLU A;  2B9B A;  2CPB A;  3H1K J;  4BRY B;  3BCC G;  5AW8 B;  1BCC G;  4L76 A;  4PV1 D;  4MN4 C;  2O01 J;  4PV1 C;  5KLV E;  1PP9 G;  2YMK A;  2A45 H;  2RN0 A;  2I1J A;  1A02 J;  2E74 D;  3SFD C;  4YPC A;  1J2J B;  2E74 C;  2FYN C;  3GF7 A;  3JC2 2;  4PJ0 E;  1PGO A;  3H1H J;  1NU1 E;  1BE3 E;  3LID A;  2SPZ A;  4H13 B;  4JPZ B;  3V5B A;  4K3A A;  3RK3 B;  1HVV A;  1YBK A;  2FXO A;  1L0L K;  3TK1 A;  2C9N Y;  1NKZ B;  1MKM A;  1NGM B;  1A02 F;  4BWN A;  3BAS A;  1NHL A;  3SWK A;  1SP4 A;  3KZI E;  4N3Y B;  1XTC C;  2Y9Y A;  1SQQ E;  2JDI H;  2W6A A;  2IYP A;  1BSH A;  4L75 A;  2GA1 A;  3IF4 A;  1JMM A;  1W2E A;  1EDI A;  4EIJ A;  2FYU E;  5AVQ B;  2A45 I;  1KZU B;  1URQ A;  1GL2 A;  1P84 E;  1LTJ A;  2RH0 A;  3VTP C;  1X9V A;  2OTK E;  3FXE A;  1VQK P;  4H0L D;  3U1C A;  2H88 C;  3CXH H;  3CWB D;  4H0L C;  3TF5 A;  2H8P D;  2ZXE B;  3Q5P A;  1FZG A;  3RK3 E;  2E5T A;  2P58 A;  1QGK B;  2HFE D;  2OTL P;  5KKZ B;  1YYC A;  2H7H A;  4C7N A;  2ZT9 B;  1RF1 C;  4RJT A;  4JQ0 D;  2CPS A;  3AE2 C;  4RO0 A;  4YTP C;  3A0B E;  3G6E P;  2KIK A;  1EXJ A;  1W2B O;  1BE3 D;  1G1I A;  1IFI A;  1NTM J;  1YI2 P;  3E1R A;  3HE5 A;  4XFJ A;  1NTK K;  1RQV A;  1GMJ A;  2YO3 A;  1RE4 C;  1YTZ I;  2Q5U A;  1QL1 A;  1NJI Q;  1DX7 A;  5BVZ A;  3VMX A;  1KB9 E;  1XTG B;  3BCC J;  2YXR B;  4QMA A;  3LW5 H;  4OGQ B;  1LT9 A;  3CXH I;  3H1K E;  1GD2 E;  1BCC J;  2HR3 A;  4GIF A;  1BDC A;  1S4X A;  1PGP A;  1PP9 J;  4A7P A;  5L8R J;  3Q5S A;  2WT7 B;  1P84 D;  1SQB D;  1KMI Z;  1NTK G;  1Y47 A;  3T97 A;  1VQ6 P;  1NH4 A;  3VMZ A;  5H2F E;  5EFW B;  2PGD A;  4H13 D;  3RK3 D;  4H13 C;  4HH2 A;  3RK3 C;  5GTH E;  3KXD A;  3H1H E;  3L72 G;  1X8Y A;  1S1C X;  3L37 A;  1S5L H;  4Z1M H;  3L73 J;  1QLE D;  2KOG A;  1CI6 B;  1Y9B A;  3CWB G;  1EZV G;  1NAF A;  2JR8 A;  4GOF A;  2JO1 A;  3BRV B;  2HPC A;  1RH5 B;  5AW4 B;  3PJS K;  1MFZ A;  4N78 E;  4YXW H;  4CPG A;  1KQL A;  1IFM A;  2HG5 D;  2R44 A;  4PD4 D;  2YO2 A;  3PHL A;  1L0L J;  2OYI B;  1KB9 D;  3OW2 O;  1CSB A;  3TYY A;  1KQF B;  1SQB K;  3B5N B;  3MUD A;  5AW9 B;  1VQP P;  3VOP A;  3NXS A;  3KQG A;  3A3Y B;  3JCU E;  2ZT9 D;  3H1I G;  5KKZ C;  1J1E B;  2ZT9 C;  3TDK A;  2R3S A;  1KIL E;  3IAO A;  1VF5 B;  5KAF E;  2WSE H;  3FWN A;  3P8C D;  3TGU D;  1OMI A;  4C7R A;  3C9I A;  1IFD A;  1EZV I;  2W90 A;  2C9L Y;  3B8E B;  3IN6 A;  2GUV A;  1NTM E;  2L5G B;  3MZW B;  1SQB G;  3G4S P;  4I6M C;  1M7L A;  1BDD A;  3CL3 D;  1RHZ B;  2Z5I A;  1JB0 J;  1N8R Q;  5BU8 B;  4OH8 B;  4C46 A;  4OGQ D;  1Q82 Q;  4OGQ C;  2XDJ A;  4ZMD A;  2W6B A;  5M1B A;  2QIW A;  4WWI A;  1MUU A;  4KHX A;  3BCC E;  4IL6 E;  1DH3 A;  2WSC J;  4N78 D;  2Z4E A;  2OAR A;  1BCC E;  3QH9 A;  4GOE A;  2P1J A;  1W5C E;  1PP9 E;  4HB1 A;  1NTK J;  1SFC C;  3V4Q A;  3WUU A;  3AEB C;  5AVX B;  4LLH A;  1GZL A;  1R8E A;  2I8D A;  1HTL C;  2QJP B;  1LTA C;  1OZH A;  1OVV A;  2W83 C;  2E43 A;  2P7J A;  2FKW B;  2XND H;  2K9J B;  3NTN A;  1ZW0 A;  3PH0 A;  4DJG A;  1QL2 A;  1OXZ A;  3L73 E;  3CWB J;  3AE7 C;  2FBW C;  3O6Q B;  4D6T G;  5AW1 B;  1GTW A;  3L74 G;  1K8A Q;  1UII A;  3D70 A;  5E79 H;  3FWL A;  3TGU G;  2OYI C;  2YKP A;  2KS1 A;  3B5N D;  2WPV B;  1N2D C;  1N7L A;  2M8R A;  3B5N C;  1L0N D;  2PAJ A;  3P8M C;  2V7Q J;  1SQV G;  1L0L E;  1T2K D;  5CCG A;  1T2K C;  1J1E C;  1VF5 D;  1BCC D;  3H1I J;  1M1J B;  3SWY A;  1VF5 C;  1N7S B;  2OQQ A;  1OFC X;  2MJZ A;  3E7K A;  1IO4 A;  3C1L A;  1NVO A;  1G2C A;  2B87 A;  2XZR A;  1H0T B;  1S5L X;  2AEJ A;  2FY8 A;  2WT7 A;  3HTK B;  2VRS A;  1Z56 A;  2W8Z A;  1M1K Q;  1LTB C;  2ZYD A;  1RY3 A;  4IOI H;  1SQB J;  1BSN A;  2RMZ A;  1IFN A;  3Q5R A;  1N73 B;  2B88 A;  3NMD A;  3F5H A;  2ZXX A;  5KAI H;  1KIL A;  1CI6 A;  3CCQ P;  1SQP D;  2UWJ E;  2Z5H A;  3RL0 B;  1L0N K;  1L2P A;  1PGJ A;  1WRG A;  3L75 G;  3HUS A;  3VP9 A;  1DEB A;  1K9M Q;  3AE6 C;  1CW5 A;  1HUC A;  2WPR A;  3GHG B;  2ZJS E;  1Q90 D;  1NTK E;  2N9Y B;  3AEA C;  3I56 P;  2QJP C;  2KNC B;  1GK4 A;  3N4X A;  2J5U A;  1JTH A;  3L70 G;  1L0N G;  1IK7 A;  2POH A;  2OYH A;  3CWB E;  1EZV E;  2WVR A;  3R4Y A;  4ZKU A;  1LWU A;  2A45 G;  3H1J G;  3Q3D A;  1NAY A;  1KQG B;  3PRJ A;  3TGU J;  3L35 A;  3TNU A;  2QM7 A;  1SQP K;  5AVV B;  2FYZ A;  3VN0 A;  1PGQ A;  3HD7 B;  4WB4 A;  4HKZ H;  3L71 G;  1N7S D;  3S9O A;  1M1J C;  2WMM A;  4B86 A;  3KYQ A;  1N7S C;  2WTY A;  2L91 A;  1OIP A;  1JY2 P;  3P7K A;  3A0H E;  2O1J A;  3H1I E;  5CJ0 A;  4AUW A;  1BGY D;  3H32 B;  2NPS B;  5AW6 B;  1KN7 A;  1WMK A;  1NTK D;  2ZYG A;  1Q7Y Q;  1JEK A;  3MTU E;  1SQP G;  2IDB A;  1NKN A;  3SSU A;  1OVR A;  3AE4 C;  2QJY B;  1AFO A;  1NWQ A;  2KYV A;  3M06 A;  3L72 D;  1ZR4 A;  2BEZ F;  1S72 P;  2P2U A;  1K04 A;  1PIX A;  3FX0 A;  1JY3 P;  1SQB E;  1RQU A;  1N73 C;  2JEE A;  3CX5 H;  3JSV C;  2O3J A;  5CHX A;  1FC2 C;  2HOD A;  1EZV D;  4XE5 B;  1R5L A;  2K9J A;  2R32 A;  3RL0 D;  3CCU P;  3RL0 C;  1EDL A;  2WSF J;  3KDP B;  3O6Q A;  4Y28 J;  3WMM 0;  3HE4 A;  4UB6 E;  1KYO H;  2E5Y A;  2WIT A;  2W6J H;  5AVS B;  4I2L C;  3AEF C;  3L75 J;  4WBA A;  4AQR D;  3H25 A;  2PRR A;  3GHG C;  1YQ3 C;  3H6P A;  1VDF A;  2IBZ G;  2KLV A;  5C39 A;  1X22 A;  5B5E E;  1LTT C;  3CC7 P;  2M3B A;  2E42 A;  3H1I D;  1M56 D;  1ZLL A;  1NTZ D;  1H89 A;  5APV A;  3M9H A;  1L0N J;  4PD4 E;  4IFF A;  2QJK B;  5APT A;  4YXD C;  4HYT B;  5B66 E;  1AA0 A;  4UB8 E;  1H0T A;  1HGV A;  3H1J J;  4WY4 B;  1U7J A;  1BGY G;  3CD6 P;  1KTM A;  3HTK A;  3P32 A;  4IFM A;  1KYO I;  3EFG A;  3A2A A;  2K37 A;  2N9B A;  3P8C E;  3HD7 D;  1SFC B;  3TGU E;  5APX A;  3HD7 C;  5AW0 B;  2Q1K A;  2KXP B;  3SWF A;  1IK9 A;  3L71 J;  1FBM A;  1CZQ A;  1WT6 A;  2IBZ I;  1N73 A;  2RKL A;  3WUV A;  1K05 A;  3A7O A;  1JOC A;  2NPS D;  2ZFC A;  2XKM A;  2BEQ D;  3W67 A;  2NPS C;  1UIX A;  4Y99 C;  5APS A;  2H89 C;  2XNX A;  2AXT H;  3MIW A;  3CCE P;  2QM8 A;  1RF1 A;  2Q3I A;  1L4A B;  1NTZ K;  1SQP J;  3WU2 H;  4NPD A;  2QJY C;  1LTS C;  1SVF A;  3GHG A;  3V2Q A;  4U7J A;  3KHU A;  1JCC A;  2G3A A;  1AVO A;  2IFM A;  3GG2 A;  4I1L A;  1LGH B;  1RE4 A;  3M0D C;  4PJ0 H;  4D6T D;  3AE9 C;  4O9B A;  4R4M A;  1PZQ A;  3WUT A;  5APQ A;  3L74 D;  1FZE A;  4BRY A;  5TIS H;  1HGZ A;  1NTZ G;  5KLI B;  4EOT A;  3FGA D;  3IR9 A;  3V2N A;  3M0A A;  1FDI A;  2J59 M;  3C8V A;  1ZME C;  3AEG C;  2O01 N;  3L75 E;  3VMY A;  3OAK A;  3RL0 g;  3B4S A;  4U3F G;  1OW8 A;  1SQV D;  3HRN A;  2OGU A;  1LP1 B;  2KSJ A;  3KZI H;  3HD7 A;  4R4L A;  2M0B A;  2R5B A;  1NYH A;  2Y0E A;  2QJK C;  2AEF A;  3PTZ A;  2FYU G;  3ITK A;  2JJL A;  2Q7C A;  5CBO A;  1PPJ G;  4GT1 A;  1ZRT D;  3LW5 J;  1P84 H;  1L0N E;  4WY4 D;  1USD A;  3H32 A;  2NPS A;  4WY4 C;  4HJG H;  3E1I A;  5CMZ A;  1BGY J;  1IFJ A;  1SFC D;  3H1J E;  2QVA A;  2BAS A;  3GLM A;  3RBZ A;  1S2E A;  1VQ4 P;  3A0B H;  4L73 A;  2ITA A;  1SS1 A;  2C0W A;  3L72 J;  2WQY C;  3L71 E;  1VQ5 P;  3CCJ P;  4LC1 A;  1DD3 A;  3M0D A;  1SQV K;  1YHQ P;  3D6Y A;  1URQ B;  1GL2 B;  1L4A D;  3L75 D;  2ZYA A;  1L4A C;  2KP8 A;  3H1L D;  1P84 I;  1YTZ T;  5KJ7 D;  1SQP E;  3MP7 B;  1AV1 A;  3H1K G;  5KJ7 C;  4IFD K;  3CCV P;  4C7N B;  1NOH A;  2KZJ A;  4KT0 J;  2QRX A;  1OW6 A;  2XV5 A;  3L70 D;  1OWA A;  1T8Z A;  4GOD A;  5AVR B;  5APY A;  2O01 H;  2Y0D A;  1GDT A;  3AE1 C;  5AVT B;  5AW3 B;  1T3U A;  1ZP0 C;  3RGU A;  3CPW O;  2FFD B;  2KK7 A;  5GTI H;  3GMA A;  3CXH E;  4ASV A;  5H2F H;  2DW3 A;  5KLI C;  3BVH A;  3MGN A;  3CCL P;  1NTZ J;  2WSE J;  3H1J D;  1NO4 A;  1QX8 A;  5GTH H;  1YIT P;  4M3L A;  2KB7 P;  2AXC A;  1LTG C;  1FJP A;  4WY4 A;  1OVU A;  1J1D B;  2C0X A;  4DT0 A;  1JO5 A;  4W7Y A;  4U3F J;  3I55 P;  1KQS O;  5AW7 B;  1LT9 B;  2Y9Z A;  4EI2 A;  1SFC A;  3L71 D;  1S9K E;  2A06 D;  3W68 A;  5K5G B;  1JM0 A;  1X79 B;  3V4W A;  1VL2 A;  1HJ0 A;  2P10 A;  1JMB A;  4L74 A;  3AE3 C;  1FS0 E;  3LIE A;  1OW7 A;  2KUB A;  1EDK A;  4ZNC A;  3GW6 A;  1JY2 N;  2YXQ B;  2Q9I A;  2LKM A;  5CBN A;  1IJD B;  1L4A A;  3JCU H;  2P67 A;  1KOR A;  2H43 A;  1SQX K;  1BGY E;  3Q2Y A;  2PP6 A;  3F89 A;  1EC5 A;  3H1L G;  5KAF H;  2NZ2 A;  3CXH D;  3PLN A;  2YIU B;  2OTJ P;  2OYI A;  1JUN A;  5APU A;  2M5A B;  1JY3 N;  3B5N A;  3D71 A;  3AED C;  3NFQ A;  3L72 E;  1URQ D;  1GL2 D;  1KYO D;  1NTM G;  3AE5 C;  1S5L E;  2K9Y A;  3RK2 B;  1URQ C;  1GL2 C;  2OYO A;  4OVN F;  5CCH D;  1D7M A;  2M3E A;  1AQT A;  3U1A A;  5CCH C;  4H44 B;  4D6T J;  3S1K A;  3L74 J;  1SQX G;  2E75 B;  2QA4 P;  2AXT E;  5AW5 B;  2IBZ D;  1S9K D;  3N7N A;  2BCC G;  2FXP A;  5AVW B;  5AW2 B;  1QVF O;  3WU2 E;  4TLF A;  1QEX A;  1JNM A;  2Y0C A;  4IL6 H;  3VMA A;  2IPP A;  4TT3 H;  2LXC B;  1ZV8 A;  3CC4 P;  1LTI C;  4RKU J;  3K5B A;  1LP1 A;  5KTB A;  3CMA P;  2FFD C;  1SQV J;  2D2C B;  1AQ5 A;  2A06 G;  2YKO A;  2YNY A;  2FXM A;  3U59 A;  1YIJ P;  3VYI A;  5TIS E;  3MHV A;  1IZN B;  4GDO A;  1NTZ E;  1QVG O;  1J1D C;  4Y99 B;  3L36 A;  1VQO P;  3L73 G;  1DEE G;  1LT9 C; 
#chains in the Genus database with same CATH homology
 3H1H G;  3L74 G;  2IBZ G;  1NTK G;  1BCC G;  1SQV G;  4PD4 H;  3H1I G;  2FYU G;  1SQX G;  3CWB G;  4U3F G;  1KYO H;  1L0L G;  1EZV G;  1KB9 H;  3L75 G;  1PPJ G;  3L71 G;  1PP9 G;  3CX5 H;  1NU1 G;  3H1J G;  3H1K G;  1BE3 G;  1P84 H;  1NTZ G;  2BCC G;  3TGU G;  2A06 G;  1SQB G;  3L70 G;  1SQP G;  5KLV G;  3CXH H;  1NTM G;  3L73 G;  1L0N G;  3L72 G;  4D6T G;  3H1L G;  1BGY G;  1SQQ G;  3BCC G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...