1NU1G

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1nu1G00
1NTMG 3CXHH 1L0NG 1L0LG 5KLVG 3L74G 3L75G 2FYUG 1KYOH 4U3FG 1SQBG 1BE3G 3H1LG 3BCCG 1NU1G 3H1HG 3L70G 3L72G 3CWBG 1NTZG 3L73G 1P84H 4PD4H 3CX5H 2BCCG 1EZVG 2A06G 3H1IG 1SQVG 3H1KG 1BGYG 3H1JG 3TGUG 1SQXG 2IBZG 1KB9H 4D6TG 1PP9G 1BCCG 3L71G 1PPJG 1SQQG 1NTKG 1SQPG
chains in the Genus database with same CATH superfamily
3L73J 2OTJP 4LC1A 4ASWA 2W90A 3CI9A 1EDLA 3CWBG 1LP1B 4H0LC 1Q2NA 2M5AB 1SQVE 4CPGA 1X79B 1PIXA 2QM7A 1W2EA 1LP1A 1JM0A 1SQBD 2M5AA 2QM8A 3EWKA 2ZYAA 3H1ID 2WSCH 1S5LH 3ITKA 1ZR4A 1XTGB 4DT0A 2IFMA 2Q6QA 1LTGC 3FGAD 1LWUC 1KFNA 1ZR2A 2JDIH 3KPEA 2C9NY 1LTBC 3L75D 2WSEJ 3FX0A 1S5LX 3TNUA 4EOTA 1T8ZA 3MGNA 2H8PD 3JCUH 1YTZI 4U3FG 2M3BA 3PHLA 3D6ZA 2V4HA 2H43A 2ZT9D 2QJKC 2R3SA 3H1JG 2K1AA 3CXHE 4A7PA 1FDIA 2ZYDA 4H13D 1L4AC 3H1LE 2ZVOB 1RF1A 1T2KC 1NTKK 2WTYA 1HGZA 5TISH 2IBZG 2LXCB 4BRYA 1MFZA 4H44D 3EFFK 1SFCB 1MV8A 2RKLA 1L0NE 3O6QB 2E76B 1S3JA 3V2RA 2ZFCA 1SFCA 1GK4A 1MFTA 2GM4A 3O6QA 1SQQJ 1VQNP 3H1KG 2WPQA 1KILB 3CCRP 2BASA 1KILA 2WT7B 2CK3H 1YTZT 3Q5RA 1GMJA 5TJHA 2WT7A 4IFMA 2W6BA 1QVGO 4GT1A 4DZOA 4OGQB 3GLMA 1LTJB 1IFDA 3AE7C 3KZIE 2OTKE 5CMZA 4YXWH 1LT1A 1T3UA 1IK7A 3A0HE 1IFNA 5B66H 4EI2A 2YKPA 1WMKA 1EDJA 1YIJP 2HR3A 1EXIA 4KHXA 3HD7B 2FYUJ 1OZHA 3PJSK 1YITP 3V2NA 1A02J 3KHUA 1IFMA 1HH0A 4IL6E 1NTKJ 2YMYA 5AW2B 2YO2A 4WY4A 3G71P 3GG2A 1JY3N 3OW2O 2SPZA 1NGMB 1LTTC 1PGJA 2BCCE 1BSNA 1H8AA 1CW5A 1P84I 1WT6A 2KNCB 3O8ZA 2WZ7A 4O9BA 2QIWA 1IFPA 3LIEA 1SQQD 2QVAA 1N7SD 1Q82Q 3KQGA 4L75A 1SQXG 1FZGA 1RF0C 2M8RA 1FS0E 1AVOA 1GK6A 2VRSA 3OA7A 1DEEG 1GL2C 1JY3P 4OWFA 5KLIC 2Q3IA 1SQBG 3CCJP 1OVVA 2ZT9B 3L71J 4H44C 4YTPC 2KSJA 5L8RJ 4JYCA 3IFMA 4C7RA 2PRRA 1H88A 3RK3C 1G2CB 3S1KA 4H13B 4AYCA 2KYVA 3MTUE 3CXHH 4PV1D 1D7MA 1EZVI 1KFMA 1G2CA 3SWFA 1BE3G 4LGDE 2IYOA 1NHLA 1KTMA 1RF0A 1SQXE 2FYNC 3G6EP 2FYUD 2K3RA 3OAKA 2KSEA 3D70A 5APVA 3L70E 1VPCA 1VQPP 2DW3A 1U57A 1NTKD 1NTMD 3CLQA 2N1TC 3FWNA 1NU1J 2KLVA 1EDKA 1SQBK 3TYYA 3HUSB 4HH2A 1OW8A 1W2BO 5APXA 1KB9I 3CCSP 1USEA 3HUSA 2QEXP 4I1LA 4DJGA 5GTIE 3CCLP 2JO1A 3H1LD 3VMYA 5AVZB 1HJ0A 1OFCX 3KZIH 1BGYD 3SWKA 1LTSC 3H1HE 4IFFA 1NTZE 3A0HH 3L73G 5KKZB 5AVXB 1HTLC 1WRGA 3HE5B 1VL2A 3MP7B 2FFDC 4UB6E 2K88A 4H0LD 3HE5A 5KLVE 1FZEA 3V2QA 3AE5C 3W67A 3AE2C 1PPJD 5AW8B 2A06E 4IL6H 1JCCA 3CC7P 2V7QH 2WPSA 2YIUB 3L74J 1VQ8P 4JBZA 5BU5A 2J5UA 1RH5B 4IL6X 1M7LA 4ASVA 3QH9A 3L73E 1J1DB 2FFDA 1P84E 4D6TJ 2ZXEB 5H2FE 2Z4EA 1YQ3C 3PP5A 2KIKA 2CPBA 1VQ9P 1URQD 1BDCA 3USSA 4RO0A 3ABVC 4RKUJ 3H1IJ 2NPSC 1EDIA 1QVFO 1N7SB 1QX8A 3AEAC 1BDDA 2IFNA 1OVRA 1Q81Q 2I1JA 1K73Q 1L4AD 1N7SA 2JKVA 3L75J 2QJYC 2E74B 1NU1D 2XDJA 5BU8B 3CX5I 3V6IA 1VQ4P 1JY2P 1VQKP 2Y0CA 1SLQA 4NPEA 1EZVE 1LNQA 3AE6C 4UB8E 1FJKA 5CCGC 1SQQG 2W6JH 3AEGC 4PV1B 1RE4C 2M0BA 1VF5D 5EFWB 2WSSH 2BCCD 1N8RQ 2IBZI 3M9HA 4XA4A 2WSCJ 3CMEP 3WUUA 3I5CA 2KP8A 1PV3A 3LIDA 3VTPC 3C1LA 2R5BA 1TU3F 3L4FA 1FZCB 1U7MA 2QJPB 3TGUJ 5KJ7D 3B71A 1FZCA 4MN4C 4Y99C 2WPRA 1KB9E 1RE4A 1X22A 1FBMA 1KYOD 4ZKUA 1JY3O 4GIFA 2YXRB 2OYIB 2FYUG 3A0BE 1KZUB 1OXZA 4D6TD 1G1IA 1Q86Q 2OYIA 4IFDK 3II6A 1SQQK 3VMAA 3GF7A 5GTIH 1X0TA 1OMIA 1NTKG 4K35A 3VP8A 3D6YA 3B4SA 3CCQP 2N9YB 3E1RA 3M9BA 1ZW0A 1NAYA 2E5YA 3TNUB 4C46A 1NJIQ 1SP4A 3IAOA 3BCCD 4UB6H 3U1CA 1S1CX 1ZV8A 3L72J 4PD4I 3G9RA 1IC2A 3WUTA 1S4XA 1JTHB 1SQVK 4ZNCA 3CWBE 1URQC 1M57D 1JTHA 1K05A 1BGYG 2KZIA 4HJGH 2Q1KA 1YJWP 4OVNF 1L0LJ 1LWUB 4I7ZC 2MJZA 2FYUK 2HLOA 4M3LA 1ZOYC 3WMM0 1SVFA 2IZ0A 3AE9C 3NTNA 1LWUA 1LTAC 1RF1B 2L91A 3RBXA 3B5NC 3CD6P 1P84H 4EYYQ 4BRYB 5CCHD 5H2FH 1NTMK 1GL2D 1ZRTE 2XNDH 3D71A 3L71G 1CSBA 1NTZD 2C9LY 2QJKB 2XU6A 4B86A 3BRTB 2WSFH 3G4SP 2AEJA 4U3FE 1S2EA 2Q5UA 3TGUD 2KOGA 2JR8A 3RK3D 2ZAEB 3CX5E 1PP9J 1BCCJ 2W8ZA 1K8AQ 1LJ2A 3L37A 1L4AB 1VF5C 3H1JE 2Y9YA 3P8MC 3ZDMA 1VQ6P 1R5SA 1M90Q 1L4AA 3Q5SA 2FXOA 2WSEH 3TF5A 3N4XA 1LTJC 4JPZB 2IBZE 3Q3DA 2A45G 4N3YB 4LLHA 4UB8H 1MKMA 3R2PA 5KJ7C 3B8EB 2GUVA 3K5BA 2FYZA 3MUDC 2Z5IA 3E1IA 2KUBA 1SQVJ 1NU1G 2N1TD 5B5EE 3H1KE 3AEFC 2OGUA 2RH0A 5DJUB 3SFDC 2ZJSE 1JUNA 3L72D 1T3JA 1FZFA 3C8VA 1FOSF 3CPWO 3IN6A 3M9QA 1GU5A 1AVYA 1QL1A 4WY4B 1NTMJ 1L0LD 2AEFA 1KB9H 2H7HA 2R5DA 2O1JA 3Q2YA 1N2DC 1JY2O 1KILE 1CI6B 3NMDA 4GODA 3A0BH 2QSIA 3MHVA 3RBZA 1SQPD 1CI6A 1Y9BA 1KV4A 1J1EC 1AA0A 3P8CD 5CJ0A 3HE4B 3H1LJ 1M8OB 3GHGC 2O1KA 1NU1K 2PGDA 3RL0D 4C7NB 3L74G 3RL0g 3HE4A 4GOFA 4N78E 1BGYJ 3U1AA 1PP9D 4PD4E 1BCCD 1FJPA 2KZJA 4C7NA 1SS1A 4GKGA 3P7KA 2HODB 1VQLP 3I56P 1DH3A 1KQLA 5AW4B 1N86A 5AW9B 1L0NJ 4D6TG 3F5HA 2HYNA 2HODA 2QA4P 3F89A 3BATA 4U7JA 5CCHC 1KB9D 1OW6A 3M06A 3UIAA 2H89C 2PP6A 1VDFA 5GTHE 3H1IG 2NPSD 2W27A 3FWLA 3H25A 3TDKA 5APQA 4L73A 3L74E 2L5GB 3L75G 1SQVD 2J59M 2RMZA 1N7LA 4W7YA 4AQRD 1NVOA 1FDOA 4R4LA 1GL2B 2W83C 5KLIB 5CCHA 2D2CC 4WWIA 4H44B 1GL2A 3V2PA 2C0WA 2JJLA 3RK3B 1SQBE 5CCGD 5APYA 4XFJA 2E75D 3CX5H 1HF9A 2YXQB 2ZXXA 2WWWA 3PLNA 1UIXA 1IFJA 2O01N 2JWAA 2FYNB 1PGQA 3L75E 2V7QJ 2ZYGA 1BE3E 2KI7B 4JQ0D 1DEBA 2KXPB 1NKNA 3CXHD 1QEXA 3TGUG 1G1JA 4XE5B 1LGHB 3RK2D 4W7ZA 2OYOA 2O01H 1KORA 2BCCJ 1OVUA 2N1TB 3LW5H 1OX3A 1ZRTD 2IDBA 2ITAA 5B5EH 2N1TA 3L36A 4DOJA 1L0ND 1U7JA 3CC4P 1VQ5P 3H1JD 4GDOA 4DCKA 2WITA 2YNYA 2IPPA 3RL0C 2FXPA 1AQ5A 2AXTE 2POHA 1RY3A 2FFDB 1NTZK 1JY2N 3VP9A 3A5TA 1LT9C 2IBZD 1AFOA 1QLED 1HWTC 3L72G 1Y8AA 1OW7A 1N73C 2BEZF 1KC8Q 1BSHA 1RHZB 2YO3A 1L0LG 3H1KD 3GF3A 2OYHC 1M56D 3KXDA 1ZLLA 4PD4H 1A02F 2WMMA 4I6MC 1M1JC 1RQVA 5APWA 3B5ND 1UIIA 1RE3C 3BCCJ 3L70J 5AW3B 2E76D 3SSUA 3EFGA 2CPSA 2AXCA 1KMIZ 2NPSB 1HJBA 2YKOA 5GTHH 5APSA 3M0DC 5AW1B 1PP9G 1BCCG 1AJYA 2NPSA 2E75C 1S9KE 4WBAA 1Z56A 2QJYB 2G8YA 4TT3H 3A2AA 1FZAA 3G3ZA 1FE6A 4L74A 2I1KA 3EQ2A 4OGQD 1L0LK 1FAVA 3H1HJ 3GW6A 1NTZJ 1HGVA 1OIPA 1QGKB 1KQGB 2W6AA 1JCDA 3RK2C 5CCGA 3L35A 1SQVG 1SQPK 2IYPA 5KLVJ 4NPFX 3HD7D 1SQQE 2QE7H 1NAFA 2J58A 2Q7CA 1S72P 2R44A 2A45I 1DD4A 3AE8C 1GD2E 5AW5B 2BEQD 2OTLP 4Y99B 2LR2A 2HFED 1IO4A 3PH0A 1NTMG 4JF7A 1GW4A 5KAIE 1JEKA 1SQXD 3C9IA 3M91A 3FXDA 1ZXGA 3MIWA 5APUA 4JYBA 3V4QA 2IX7C 4I2LC 4KJMA 2WSFJ 2JWDA 1KQSO 4H0LB 2Y0DA 2KLUA 1GU4A 4WVZA 3L70D 5KTBA 3NFQA 4RJTA 1VQ7P 2LXBA 2FYUE 3BVHA 3AE4C 3CCEP 3H1LG 1M1KQ 2WPVB 2KK7A 1RF1C 1BE3D 1NTKE 1NTME 2AXTH 2HPCB 1L0NG 1GTWA 2HPCA 1K9MQ 2HG5D 2B88A 1SQPJ 1SFCC 1URQB 1KYOI 2C0XA 3H32B 1PGOA 2E76C 1PPJG 3H1HD 1E79H 1L2PA 1URQA 2K9JB 2M3EA 1R5LA 3H32A 4I7ZB 2JP3A 3U59A 4Z1MH 1FU1A 1KILC 2K9YA 2K9JA 3H6PA 1MZ9A 4N6JA 1BGYE 1JMMA 3B5NB 5KAFE 5KLVD 4BXLA 1OWAA 3E7KA 3B5NA 1Y47A 2H88C 2A06D 4AUWA 5AVYB 2D2CD 1ZP0C 4YPCA 4OGQC 2RN0A 3AE3C 1FDMA 1KN7A 3PRJA 3CMAP 1PPJE 3L71E 1FZBA 1L0NK 2KS1B 1VF5B 3L73D 1YBKA 1P84D 2LKMA 1LTIC 3VOPA 3VYIA 5K5GB 3VMXA 2KS1A 4RESB 1USDA 3HD7C 2B9BA 1X8YA 1NYHA 3WU2E 3CL3D 1KD1Q 3M0AA 2Z5HA 4KT0J 3MD0A 1LTJA 4WY4C 2Y9ZA 2G3AA 4GOEA 1YQ4C 2BCCG 5KJ7A 1JNMA 1DX7A 3SFEC 3MUDA 5AVTB 2Q3EA 2O3JA 3CWBJ 2IZ1A 3HD7A 2P2UA 1EZVD 4BWNA 1NU1E 2P1JA 5CHXA 1X9VA 3V4WA 1YJNP 3PTZA 3TK1A 2YKQA 1IFIA 1S9KD 1J2JB 2YMKA 5APTA 3VMZA 4IOIH 3RGUA 5KAIH 1EC5A 3MZWB 1NOHA 3OJAB 2K37A 1HVVA 2XV5A 2AEMA 4U3FJ 1EQ7A 1J1EB 2ZT9C 2E5TA 3CCMP 5DJTB 3AEDC 3H1JJ 4OH8B 2KNCA 1YHQP 3GHGB 1T6AA 2B87B 1NH4A 2NZ2A 3TSIA 2QG4A 4H13C 1W5CE 3BRVB 3GHGA 5AVRB 1HUCA 2B87A 2E74D 1ZMEC 3CCVP 1JB0J 1KYOE 1RQUA 4ZMDA 1PL5A 2NRGA 3Q5PA 2WVRA 2WQYC 3BCCG 3L70G 2OQQA 1EXJA 1Q90D 2O01J 4D6TE 3LW5J 4NPDA 3CCUP 1DD3A 3S9OA 1JO5A 1Q7YQ 3A7OA 3H1KJ 3HTKB 2E43A 1H89A 3H1IE 2KB7P 3HUSC 3FXEA 3HTKA 5KAFH 4ZKPA 1FOSE 3CWBD 2JEEA 5E79E 3KYQA 2D2CB 4QMAA 3BCCE 3H1HG 1SQXK 1NTZG 4W80A 1AV1A 1JMBA 2PFXA 4PJ0E 5AVVB 1YYCA 3QWOC 2PAJA 4Y28J 3BASA 4R4MA 3T97B 1DIPA 4EIJA 2R3CA 5KKZC 5KLVG 2P10A 3S4RA 2GA1A 3T97A 3KDPB 2A06G 3IR9A 1VQMP 2XKMA 4U3FD 3WU2H 5AVUB 3WUVA 1XTCC 3CX5D 1S5LE 2FY8A 3HRNA 3GMAA 2I8DA 1PZQA 3I55P 3JSVC 1PGPA 2YIUC 2Y0EA 1ZN5A 1R8EA 3TGUE 3RK3E 2A45H 1GZLA 1J1DC 1PFIA 3JCUE 1HBWA 3CC2P 4L76A 2MKVA 3L71D 5CBOA 1JOCA 4WB4A 3AEEC 5AW0B 1E5WA 5KLVK 4EDFA 1H0TB 3RL0B 1N7SC 1FC2C 5AVQB 2P67A 2R32A 1H0TA 1SQXJ 3JC22 2XZRA 3P32A 3CXHI 2E74C 1EZVG 5TISE 1LT9B 5AW7B 3AE1C 2OARA 5C39A 1IK9A 1SQBJ 1LT9A 1SQPG 1N73B 1SFCD 4K3AA 2E42A 3L72E 3N7NA 2FXMA 1N73A 5AW6B 4PV1C 2OYHB 1YJ9P 4HYTB 1NWQA 1KILD 1BE3J 2OYHA 1T2KD 1L0LE 2FKWB 1M1JB 2UWJE 1KYOH 3R4YA 2QRXA 5CBNA 2XNXA 4YXDC 1M1JA 2ZVNB 1VQOP 1RE3A 3NXSA 2B89A 3W68A 1GDTA 1FZCC 2FBWC 4HB1A 2GUSA 1SQPE 4N78D 2QJPC 3SWYA 4HKZH 4PD4D 3IF4A 3AECC 5CJ4A 2P7JA 3P8CE 1KQFB 5B66E 1IJDB 2E75B 1QL2A 1NKZB 3VN0A 3M0DA 1CZQA 3Q1MA 1GW3A 2N9BA 5AVSB 1IZNB 1YI2P 1PP9E 1BCCE 2OYIC 1NO4A 1K04A 1MUUA 5E79H 1AQTA 3V5BA 3AEBC 5BVZA 5AVWB 2Q9IA 4WY4D 3L74D 5M1BA 3A3YB 4TLFA 3RK2B 4PJ0H 2P58A
chains in the Genus database with same CATH topology
1NTMG 3CXHH 1L0NG 1L0LG 5KLVG 3L74G 3L75G 2FYUG 1KYOH 4U3FG 1SQBG 1BE3G 3H1LG 3BCCG 1NU1G 3H1HG 3L70G 3L72G 3CWBG 1NTZG 3L73G 1P84H 4PD4H 3CX5H 2BCCG 1EZVG 2A06G 3H1IG 1SQVG 3H1KG 1BGYG 3H1JG 3TGUG 1SQXG 2IBZG 1KB9H 4D6TG 1PP9G 1BCCG 3L71G 1PPJG 1SQQG 1NTKG 1SQPG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM G;  3CXH H;  1L0N G;  1L0L G;  5KLV G;  3L74 G;  3L75 G;  2FYU G;  1KYO H;  4U3F G;  1SQB G;  1BE3 G;  3H1L G;  3BCC G;  1NU1 G;  3H1H G;  3L70 G;  3L72 G;  3CWB G;  1NTZ G;  3L73 G;  1P84 H;  4PD4 H;  3CX5 H;  2BCC G;  1EZV G;  2A06 G;  3H1I G;  1SQV G;  3H1K G;  1BGY G;  3H1J G;  3TGU G;  1SQX G;  2IBZ G;  1KB9 H;  4D6T G;  1PP9 G;  1BCC G;  3L71 G;  1PPJ G;  1SQQ G;  1NTK G;  1SQP G; 
#chains in the Genus database with same CATH topology
 3L73 J;  2OTJ P;  4LC1 A;  4ASW A;  2W90 A;  3CI9 A;  1EDL A;  3CWB G;  1LP1 B;  4H0L C;  1Q2N A;  2M5A B;  1SQV E;  4CPG A;  1X79 B;  1PIX A;  2QM7 A;  1W2E A;  1LP1 A;  1JM0 A;  1SQB D;  2M5A A;  2QM8 A;  3EWK A;  2ZYA A;  3H1I D;  2WSC H;  1S5L H;  3ITK A;  1ZR4 A;  1XTG B;  4DT0 A;  2IFM A;  2Q6Q A;  1LTG C;  3FGA D;  1LWU C;  1KFN A;  1ZR2 A;  2JDI H;  3KPE A;  2C9N Y;  1LTB C;  3L75 D;  2WSE J;  3FX0 A;  1S5L X;  3TNU A;  4EOT A;  1T8Z A;  3MGN A;  2H8P D;  3JCU H;  1YTZ I;  4U3F G;  2M3B A;  3PHL A;  3D6Z A;  2V4H A;  2H43 A;  2ZT9 D;  2QJK C;  2R3S A;  3H1J G;  2K1A A;  3CXH E;  4A7P A;  1FDI A;  2ZYD A;  4H13 D;  1L4A C;  3H1L E;  2ZVO B;  1RF1 A;  1T2K C;  1NTK K;  2WTY A;  1HGZ A;  5TIS H;  2IBZ G;  2LXC B;  4BRY A;  1MFZ A;  4H44 D;  3EFF K;  1SFC B;  1MV8 A;  2RKL A;  1L0N E;  3O6Q B;  2E76 B;  1S3J A;  3V2R A;  2ZFC A;  1SFC A;  1GK4 A;  1MFT A;  2GM4 A;  3O6Q A;  1SQQ J;  1VQN P;  3H1K G;  2WPQ A;  1KIL B;  3CCR P;  2BAS A;  1KIL A;  2WT7 B;  2CK3 H;  1YTZ T;  3Q5R A;  1GMJ A;  5TJH A;  2WT7 A;  4IFM A;  2W6B A;  1QVG O;  4GT1 A;  4DZO A;  4OGQ B;  3GLM A;  1LTJ B;  1IFD A;  3AE7 C;  3KZI E;  2OTK E;  5CMZ A;  4YXW H;  1LT1 A;  1T3U A;  1IK7 A;  3A0H E;  1IFN A;  5B66 H;  4EI2 A;  2YKP A;  1WMK A;  1EDJ A;  1YIJ P;  2HR3 A;  1EXI A;  4KHX A;  3HD7 B;  2FYU J;  1OZH A;  3PJS K;  1YIT P;  3V2N A;  1A02 J;  3KHU A;  1IFM A;  1HH0 A;  4IL6 E;  1NTK J;  2YMY A;  5AW2 B;  2YO2 A;  4WY4 A;  3G71 P;  3GG2 A;  1JY3 N;  3OW2 O;  2SPZ A;  1NGM B;  1LTT C;  1PGJ A;  2BCC E;  1BSN A;  1H8A A;  1CW5 A;  1P84 I;  1WT6 A;  2KNC B;  3O8Z A;  2WZ7 A;  4O9B A;  2QIW A;  1IFP A;  3LIE A;  1SQQ D;  2QVA A;  1N7S D;  1Q82 Q;  3KQG A;  4L75 A;  1SQX G;  1FZG A;  1RF0 C;  2M8R A;  1FS0 E;  1AVO A;  1GK6 A;  2VRS A;  3OA7 A;  1DEE G;  1GL2 C;  1JY3 P;  4OWF A;  5KLI C;  2Q3I A;  1SQB G;  3CCJ P;  1OVV A;  2ZT9 B;  3L71 J;  4H44 C;  4YTP C;  2KSJ A;  5L8R J;  4JYC A;  3IFM A;  4C7R A;  2PRR A;  1H88 A;  3RK3 C;  1G2C B;  3S1K A;  4H13 B;  4AYC A;  2KYV A;  3MTU E;  3CXH H;  4PV1 D;  1D7M A;  1EZV I;  1KFM A;  1G2C A;  3SWF A;  1BE3 G;  4LGD E;  2IYO A;  1NHL A;  1KTM A;  1RF0 A;  1SQX E;  2FYN C;  3G6E P;  2FYU D;  2K3R A;  3OAK A;  2KSE A;  3D70 A;  5APV A;  3L70 E;  1VPC A;  1VQP P;  2DW3 A;  1U57 A;  1NTK D;  1NTM D;  3CLQ A;  2N1T C;  3FWN A;  1NU1 J;  2KLV A;  1EDK A;  1SQB K;  3TYY A;  3HUS B;  4HH2 A;  1OW8 A;  1W2B O;  5APX A;  1KB9 I;  3CCS P;  1USE A;  3HUS A;  2QEX P;  4I1L A;  4DJG A;  5GTI E;  3CCL P;  2JO1 A;  3H1L D;  3VMY A;  5AVZ B;  1HJ0 A;  1OFC X;  3KZI H;  1BGY D;  3SWK A;  1LTS C;  3H1H E;  4IFF A;  1NTZ E;  3A0H H;  3L73 G;  5KKZ B;  5AVX B;  1HTL C;  1WRG A;  3HE5 B;  1VL2 A;  3MP7 B;  2FFD C;  4UB6 E;  2K88 A;  4H0L D;  3HE5 A;  5KLV E;  1FZE A;  3V2Q A;  3AE5 C;  3W67 A;  3AE2 C;  1PPJ D;  5AW8 B;  2A06 E;  4IL6 H;  1JCC A;  3CC7 P;  2V7Q H;  2WPS A;  2YIU B;  3L74 J;  1VQ8 P;  4JBZ A;  5BU5 A;  2J5U A;  1RH5 B;  4IL6 X;  1M7L A;  4ASV A;  3QH9 A;  3L73 E;  1J1D B;  2FFD A;  1P84 E;  4D6T J;  2ZXE B;  5H2F E;  2Z4E A;  1YQ3 C;  3PP5 A;  2KIK A;  2CPB A;  1VQ9 P;  1URQ D;  1BDC A;  3USS A;  4RO0 A;  3ABV C;  4RKU J;  3H1I J;  2NPS C;  1EDI A;  1QVF O;  1N7S B;  1QX8 A;  3AEA C;  1BDD A;  2IFN A;  1OVR A;  1Q81 Q;  2I1J A;  1K73 Q;  1L4A D;  1N7S A;  2JKV A;  3L75 J;  2QJY C;  2E74 B;  1NU1 D;  2XDJ A;  5BU8 B;  3CX5 I;  3V6I A;  1VQ4 P;  1JY2 P;  1VQK P;  2Y0C A;  1SLQ A;  4NPE A;  1EZV E;  1LNQ A;  3AE6 C;  4UB8 E;  1FJK A;  5CCG C;  1SQQ G;  2W6J H;  3AEG C;  4PV1 B;  1RE4 C;  2M0B A;  1VF5 D;  5EFW B;  2WSS H;  2BCC D;  1N8R Q;  2IBZ I;  3M9H A;  4XA4 A;  2WSC J;  3CME P;  3WUU A;  3I5C A;  2KP8 A;  1PV3 A;  3LID A;  3VTP C;  3C1L A;  2R5B A;  1TU3 F;  3L4F A;  1FZC B;  1U7M A;  2QJP B;  3TGU J;  5KJ7 D;  3B71 A;  1FZC A;  4MN4 C;  4Y99 C;  2WPR A;  1KB9 E;  1RE4 A;  1X22 A;  1FBM A;  1KYO D;  4ZKU A;  1JY3 O;  4GIF A;  2YXR B;  2OYI B;  2FYU G;  3A0B E;  1KZU B;  1OXZ A;  4D6T D;  1G1I A;  1Q86 Q;  2OYI A;  4IFD K;  3II6 A;  1SQQ K;  3VMA A;  3GF7 A;  5GTI H;  1X0T A;  1OMI A;  1NTK G;  4K35 A;  3VP8 A;  3D6Y A;  3B4S A;  3CCQ P;  2N9Y B;  3E1R A;  3M9B A;  1ZW0 A;  1NAY A;  2E5Y A;  3TNU B;  4C46 A;  1NJI Q;  1SP4 A;  3IAO A;  3BCC D;  4UB6 H;  3U1C A;  1S1C X;  1ZV8 A;  3L72 J;  4PD4 I;  3G9R A;  1IC2 A;  3WUT A;  1S4X A;  1JTH B;  1SQV K;  4ZNC A;  3CWB E;  1URQ C;  1M57 D;  1JTH A;  1K05 A;  1BGY G;  2KZI A;  4HJG H;  2Q1K A;  1YJW P;  4OVN F;  1L0L J;  1LWU B;  4I7Z C;  2MJZ A;  2FYU K;  2HLO A;  4M3L A;  1ZOY C;  3WMM 0;  1SVF A;  2IZ0 A;  3AE9 C;  3NTN A;  1LWU A;  1LTA C;  1RF1 B;  2L91 A;  3RBX A;  3B5N C;  3CD6 P;  1P84 H;  4EYY Q;  4BRY B;  5CCH D;  5H2F H;  1NTM K;  1GL2 D;  1ZRT E;  2XND H;  3D71 A;  3L71 G;  1CSB A;  1NTZ D;  2C9L Y;  2QJK B;  2XU6 A;  4B86 A;  3BRT B;  2WSF H;  3G4S P;  2AEJ A;  4U3F E;  1S2E A;  2Q5U A;  3TGU D;  2KOG A;  2JR8 A;  3RK3 D;  2ZAE B;  3CX5 E;  1PP9 J;  1BCC J;  2W8Z A;  1K8A Q;  1LJ2 A;  3L37 A;  1L4A B;  1VF5 C;  3H1J E;  2Y9Y A;  3P8M C;  3ZDM A;  1VQ6 P;  1R5S A;  1M90 Q;  1L4A A;  3Q5S A;  2FXO A;  2WSE H;  3TF5 A;  3N4X A;  1LTJ C;  4JPZ B;  2IBZ E;  3Q3D A;  2A45 G;  4N3Y B;  4LLH A;  4UB8 H;  1MKM A;  3R2P A;  5KJ7 C;  3B8E B;  2GUV A;  3K5B A;  2FYZ A;  3MUD C;  2Z5I A;  3E1I A;  2KUB A;  1SQV J;  1NU1 G;  2N1T D;  5B5E E;  3H1K E;  3AEF C;  2OGU A;  2RH0 A;  5DJU B;  3SFD C;  2ZJS E;  1JUN A;  3L72 D;  1T3J A;  1FZF A;  3C8V A;  1FOS F;  3CPW O;  3IN6 A;  3M9Q A;  1GU5 A;  1AVY A;  1QL1 A;  4WY4 B;  1NTM J;  1L0L D;  2AEF A;  1KB9 H;  2H7H A;  2R5D A;  2O1J A;  3Q2Y A;  1N2D C;  1JY2 O;  1KIL E;  1CI6 B;  3NMD A;  4GOD A;  3A0B H;  2QSI A;  3MHV A;  3RBZ A;  1SQP D;  1CI6 A;  1Y9B A;  1KV4 A;  1J1E C;  1AA0 A;  3P8C D;  5CJ0 A;  3HE4 B;  3H1L J;  1M8O B;  3GHG C;  2O1K A;  1NU1 K;  2PGD A;  3RL0 D;  4C7N B;  3L74 G;  3RL0 g;  3HE4 A;  4GOF A;  4N78 E;  1BGY J;  3U1A A;  1PP9 D;  4PD4 E;  1BCC D;  1FJP A;  2KZJ A;  4C7N A;  1SS1 A;  4GKG A;  3P7K A;  2HOD B;  1VQL P;  3I56 P;  1DH3 A;  1KQL A;  5AW4 B;  1N86 A;  5AW9 B;  1L0N J;  4D6T G;  3F5H A;  2HYN A;  2HOD A;  2QA4 P;  3F89 A;  3BAT A;  4U7J A;  5CCH C;  1KB9 D;  1OW6 A;  3M06 A;  3UIA A;  2H89 C;  2PP6 A;  1VDF A;  5GTH E;  3H1I G;  2NPS D;  2W27 A;  3FWL A;  3H25 A;  3TDK A;  5APQ A;  4L73 A;  3L74 E;  2L5G B;  3L75 G;  1SQV D;  2J59 M;  2RMZ A;  1N7L A;  4W7Y A;  4AQR D;  1NVO A;  1FDO A;  4R4L A;  1GL2 B;  2W83 C;  5KLI B;  5CCH A;  2D2C C;  4WWI A;  4H44 B;  1GL2 A;  3V2P A;  2C0W A;  2JJL A;  3RK3 B;  1SQB E;  5CCG D;  5APY A;  4XFJ A;  2E75 D;  3CX5 H;  1HF9 A;  2YXQ B;  2ZXX A;  2WWW A;  3PLN A;  1UIX A;  1IFJ A;  2O01 N;  2JWA A;  2FYN B;  1PGQ A;  3L75 E;  2V7Q J;  2ZYG A;  1BE3 E;  2KI7 B;  4JQ0 D;  1DEB A;  2KXP B;  1NKN A;  3CXH D;  1QEX A;  3TGU G;  1G1J A;  4XE5 B;  1LGH B;  3RK2 D;  4W7Z A;  2OYO A;  2O01 H;  1KOR A;  2BCC J;  1OVU A;  2N1T B;  3LW5 H;  1OX3 A;  1ZRT D;  2IDB A;  2ITA A;  5B5E H;  2N1T A;  3L36 A;  4DOJ A;  1L0N D;  1U7J A;  3CC4 P;  1VQ5 P;  3H1J D;  4GDO A;  4DCK A;  2WIT A;  2YNY A;  2IPP A;  3RL0 C;  2FXP A;  1AQ5 A;  2AXT E;  2POH A;  1RY3 A;  2FFD B;  1NTZ K;  1JY2 N;  3VP9 A;  3A5T A;  1LT9 C;  2IBZ D;  1AFO A;  1QLE D;  1HWT C;  3L72 G;  1Y8A A;  1OW7 A;  1N73 C;  2BEZ F;  1KC8 Q;  1BSH A;  1RHZ B;  2YO3 A;  1L0L G;  3H1K D;  3GF3 A;  2OYH C;  1M56 D;  3KXD A;  1ZLL A;  4PD4 H;  1A02 F;  2WMM A;  4I6M C;  1M1J C;  1RQV A;  5APW A;  3B5N D;  1UII A;  1RE3 C;  3BCC J;  3L70 J;  5AW3 B;  2E76 D;  3SSU A;  3EFG A;  2CPS A;  2AXC A;  1KMI Z;  2NPS B;  1HJB A;  2YKO A;  5GTH H;  5APS A;  3M0D C;  5AW1 B;  1PP9 G;  1BCC G;  1AJY A;  2NPS A;  2E75 C;  1S9K E;  4WBA A;  1Z56 A;  2QJY B;  2G8Y A;  4TT3 H;  3A2A A;  1FZA A;  3G3Z A;  1FE6 A;  4L74 A;  2I1K A;  3EQ2 A;  4OGQ D;  1L0L K;  1FAV A;  3H1H J;  3GW6 A;  1NTZ J;  1HGV A;  1OIP A;  1QGK B;  1KQG B;  2W6A A;  1JCD A;  3RK2 C;  5CCG A;  3L35 A;  1SQV G;  1SQP K;  2IYP A;  5KLV J;  4NPF X;  3HD7 D;  1SQQ E;  2QE7 H;  1NAF A;  2J58 A;  2Q7C A;  1S72 P;  2R44 A;  2A45 I;  1DD4 A;  3AE8 C;  1GD2 E;  5AW5 B;  2BEQ D;  2OTL P;  4Y99 B;  2LR2 A;  2HFE D;  1IO4 A;  3PH0 A;  1NTM G;  4JF7 A;  1GW4 A;  5KAI E;  1JEK A;  1SQX D;  3C9I A;  3M91 A;  3FXD A;  1ZXG A;  3MIW A;  5APU A;  4JYB A;  3V4Q A;  2IX7 C;  4I2L C;  4KJM A;  2WSF J;  2JWD A;  1KQS O;  4H0L B;  2Y0D A;  2KLU A;  1GU4 A;  4WVZ A;  3L70 D;  5KTB A;  3NFQ A;  4RJT A;  1VQ7 P;  2LXB A;  2FYU E;  3BVH A;  3AE4 C;  3CCE P;  3H1L G;  1M1K Q;  2WPV B;  2KK7 A;  1RF1 C;  1BE3 D;  1NTK E;  1NTM E;  2AXT H;  2HPC B;  1L0N G;  1GTW A;  2HPC A;  1K9M Q;  2HG5 D;  2B88 A;  1SQP J;  1SFC C;  1URQ B;  1KYO I;  2C0X A;  3H32 B;  1PGO A;  2E76 C;  1PPJ G;  3H1H D;  1E79 H;  1L2P A;  1URQ A;  2K9J B;  2M3E A;  1R5L A;  3H32 A;  4I7Z B;  2JP3 A;  3U59 A;  4Z1M H;  1FU1 A;  1KIL C;  2K9Y A;  2K9J A;  3H6P A;  1MZ9 A;  4N6J A;  1BGY E;  1JMM A;  3B5N B;  5KAF E;  5KLV D;  4BXL A;  1OWA A;  3E7K A;  3B5N A;  1Y47 A;  2H88 C;  2A06 D;  4AUW A;  5AVY B;  2D2C D;  1ZP0 C;  4YPC A;  4OGQ C;  2RN0 A;  3AE3 C;  1FDM A;  1KN7 A;  3PRJ A;  3CMA P;  1PPJ E;  3L71 E;  1FZB A;  1L0N K;  2KS1 B;  1VF5 B;  3L73 D;  1YBK A;  1P84 D;  2LKM A;  1LTI C;  3VOP A;  3VYI A;  5K5G B;  3VMX A;  2KS1 A;  4RES B;  1USD A;  3HD7 C;  2B9B A;  1X8Y A;  1NYH A;  3WU2 E;  3CL3 D;  1KD1 Q;  3M0A A;  2Z5H A;  4KT0 J;  3MD0 A;  1LTJ A;  4WY4 C;  2Y9Z A;  2G3A A;  4GOE A;  1YQ4 C;  2BCC G;  5KJ7 A;  1JNM A;  1DX7 A;  3SFE C;  3MUD A;  5AVT B;  2Q3E A;  2O3J A;  3CWB J;  2IZ1 A;  3HD7 A;  2P2U A;  1EZV D;  4BWN A;  1NU1 E;  2P1J A;  5CHX A;  1X9V A;  3V4W A;  1YJN P;  3PTZ A;  3TK1 A;  2YKQ A;  1IFI A;  1S9K D;  1J2J B;  2YMK A;  5APT A;  3VMZ A;  4IOI H;  3RGU A;  5KAI H;  1EC5 A;  3MZW B;  1NOH A;  3OJA B;  2K37 A;  1HVV A;  2XV5 A;  2AEM A;  4U3F J;  1EQ7 A;  1J1E B;  2ZT9 C;  2E5T A;  3CCM P;  5DJT B;  3AED C;  3H1J J;  4OH8 B;  2KNC A;  1YHQ P;  3GHG B;  1T6A A;  2B87 B;  1NH4 A;  2NZ2 A;  3TSI A;  2QG4 A;  4H13 C;  1W5C E;  3BRV B;  3GHG A;  5AVR B;  1HUC A;  2B87 A;  2E74 D;  1ZME C;  3CCV P;  1JB0 J;  1KYO E;  1RQU A;  4ZMD A;  1PL5 A;  2NRG A;  3Q5P A;  2WVR A;  2WQY C;  3BCC G;  3L70 G;  2OQQ A;  1EXJ A;  1Q90 D;  2O01 J;  4D6T E;  3LW5 J;  4NPD A;  3CCU P;  1DD3 A;  3S9O A;  1JO5 A;  1Q7Y Q;  3A7O A;  3H1K J;  3HTK B;  2E43 A;  1H89 A;  3H1I E;  2KB7 P;  3HUS C;  3FXE A;  3HTK A;  5KAF H;  4ZKP A;  1FOS E;  3CWB D;  2JEE A;  5E79 E;  3KYQ A;  2D2C B;  4QMA A;  3BCC E;  3H1H G;  1SQX K;  1NTZ G;  4W80 A;  1AV1 A;  1JMB A;  2PFX A;  4PJ0 E;  5AVV B;  1YYC A;  3QWO C;  2PAJ A;  4Y28 J;  3BAS A;  4R4M A;  3T97 B;  1DIP A;  4EIJ A;  2R3C A;  5KKZ C;  5KLV G;  2P10 A;  3S4R A;  2GA1 A;  3T97 A;  3KDP B;  2A06 G;  3IR9 A;  1VQM P;  2XKM A;  4U3F D;  3WU2 H;  5AVU B;  3WUV A;  1XTC C;  3CX5 D;  1S5L E;  2FY8 A;  3HRN A;  3GMA A;  2I8D A;  1PZQ A;  3I55 P;  3JSV C;  1PGP A;  2YIU C;  2Y0E A;  1ZN5 A;  1R8E A;  3TGU E;  3RK3 E;  2A45 H;  1GZL A;  1J1D C;  1PFI A;  3JCU E;  1HBW A;  3CC2 P;  4L76 A;  2MKV A;  3L71 D;  5CBO A;  1JOC A;  4WB4 A;  3AEE C;  5AW0 B;  1E5W A;  5KLV K;  4EDF A;  1H0T B;  3RL0 B;  1N7S C;  1FC2 C;  5AVQ B;  2P67 A;  2R32 A;  1H0T A;  1SQX J;  3JC2 2;  2XZR A;  3P32 A;  3CXH I;  2E74 C;  1EZV G;  5TIS E;  1LT9 B;  5AW7 B;  3AE1 C;  2OAR A;  5C39 A;  1IK9 A;  1SQB J;  1LT9 A;  1SQP G;  1N73 B;  1SFC D;  4K3A A;  2E42 A;  3L72 E;  3N7N A;  2FXM A;  1N73 A;  5AW6 B;  4PV1 C;  2OYH B;  1YJ9 P;  4HYT B;  1NWQ A;  1KIL D;  1BE3 J;  2OYH A;  1T2K D;  1L0L E;  2FKW B;  1M1J B;  2UWJ E;  1KYO H;  3R4Y A;  2QRX A;  5CBN A;  2XNX A;  4YXD C;  1M1J A;  2ZVN B;  1VQO P;  1RE3 A;  3NXS A;  2B89 A;  3W68 A;  1GDT A;  1FZC C;  2FBW C;  4HB1 A;  2GUS A;  1SQP E;  4N78 D;  2QJP C;  3SWY A;  4HKZ H;  4PD4 D;  3IF4 A;  3AEC C;  5CJ4 A;  2P7J A;  3P8C E;  1KQF B;  5B66 E;  1IJD B;  2E75 B;  1QL2 A;  1NKZ B;  3VN0 A;  3M0D A;  1CZQ A;  3Q1M A;  1GW3 A;  2N9B A;  5AVS B;  1IZN B;  1YI2 P;  1PP9 E;  1BCC E;  2OYI C;  1NO4 A;  1K04 A;  1MUU A;  5E79 H;  1AQT A;  3V5B A;  3AEB C;  5BVZ A;  5AVW B;  2Q9I A;  4WY4 D;  3L74 D;  5M1B A;  3A3Y B;  4TLF A;  3RK2 B;  4PJ0 H;  2P58 A; 
#chains in the Genus database with same CATH homology
 1NTM G;  3CXH H;  1L0N G;  1L0L G;  5KLV G;  3L74 G;  3L75 G;  2FYU G;  1KYO H;  4U3F G;  1SQB G;  1BE3 G;  3H1L G;  3BCC G;  1NU1 G;  3H1H G;  3L70 G;  3L72 G;  3CWB G;  1NTZ G;  3L73 G;  1P84 H;  4PD4 H;  3CX5 H;  2BCC G;  1EZV G;  2A06 G;  3H1I G;  1SQV G;  3H1K G;  1BGY G;  3H1J G;  3TGU G;  1SQX G;  2IBZ G;  1KB9 H;  4D6T G;  1PP9 G;  1BCC G;  3L71 G;  1PPJ G;  1SQQ G;  1NTK G;  1SQP G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...