1NU1G

Crystal structure of mitochondrial cytochrome bc1 complexed with 2-nonyl-4-hydroxyquinoline n-oxide (nqno)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
b'GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Structural basis for the quinone reduction in the bc(1) complex: a comparative analysis of crystal structures of mitochondrial cytochrome bc(1) with bound substrate and inhibitors at the Q(i) site
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1nu1G00
3L74G 1EZVG 2A06G 2FYUG 1BE3G 1PPJG 1SQQG 4PD4H 3CX5H 1PP9G 1BGYG 3L71G 4D6TG 1P84H 1NTMG 3H1KG 1SQBG 5KLVG 1L0LG 3L73G 1SQVG 1L0NG 3BCCG 1SQPG 1SQXG 1KB9H 3TGUG 3L75G 2IBZG 3L70G 3L72G 1BCCG 3CXHH 2BCCG 3CWBG 1KYOH 3H1LG 3H1JG 3H1IG 1NU1G 1NTKG 3H1HG 4U3FG 1NTZG
chains in the Genus database with same CATH superfamily
3USSA 2E76B 2OYIB 1NOHA 1SQVD 1LT9A 2Y0EA 1VQ4P 1PGJA 1QGKB 1NTKE 3TF5A 2BCCD 3WU2E 1EZVE 1GL2A 5AW6B 3WUTA 3L36A 4IOIH 1IJDB 2Y9ZA 2OTKE 1PP9D 2RN0A 4D6TJ 1KD1Q 2PP6A 4N3YB 3HUSB 3HD7C 3CCSP 2RKLA 4RESB 1P84D 1GL2D 1PPJE 3CMAP 4OWFA 3AE9C 3GHGC 4ZMDA 4HH2A 2E74D 3RK3C 2FFDB 1KILC 4W7YA 2Q7CA 2NPSB 5CCGC 4HKZH 2E5TA 1QL2A 2E43A 3HTKA 2KP8A 1NU1D 1KFNA 5AW0B 4XFJA 1S4XA 4YXWH 2WPQA 3HRNA 1ZP0C 3VP9A 1SQQD 1EDLA 1AV1A 2PRRA 1S5LE 2OYHB 3H6PA 3B4SA 3L75D 4PD4D 3WMM0 1PGOA 3LIDA 2V4HA 2N1TA 2P58A 3M0DA 4JYBA 1EXIA 2H88C 4D6TE 2WMMA 3FGAD 2M0BA 2HPCB 2V7QH 3ZDMA 3KDPB 2IYOA 3O6QA 3H1KD 5AVVB 3PRJA 2GUSA 3KHUA 3ABVC 3EFFK 3RL0g 2N1TD 1M90Q 1VQ9P 5KAFE 2YIUB 1VDFA 1MKMA 3HE5A 2H8PD 1LWUC 1URQA 3FWNA 3TK1A 2RH0A 4ZNCA 1PIXA 2QJKB 5DJUB 3WUVA 3RK3B 2O1KA 1VQ6P 2ZXXA 1YYCA 2Q3IA 2FYNC 4Z1MH 1X9VA 1OVRA 1NTZG 4WY4A 2WSCH 1LP1B 2YMYA 1KILE 4EIJA 1Q90D 2AEJA 1P84E 3MZWB 3RL0D 2KS1B 1URQD 4H0LB 4WBAA 3AEEC 2MJZA 2Q3EA 1FOSE 4WY4D 2M5AA 4KJMA 1ZR4A 1AVOA 1RE4A 3VMYA 2XV5A 3MHVA 4QMAA 2KIKA 1HTLC 1AQTA 3G3ZA 4YPCA 2QRXA 3CWBD 3H1ID 1JY3O 1H88A 2AEMA 1CI6B 3H32A 1DEBA 2LXCB 3RK2C 2HR3A 1BE3J 1FS0E 1J1EB 4PD4E 1G2CB 4PV1B 1NJIQ 1AFOA 3IF4A 3L70G 4JQ0D 4MN4C 1ZN5A 3H1KE 1PGPA 3M91A 1SFCA 1L0LD 2OQQA 2FXOA 5H2FE 2IBZD 1L0LK 1RE3C 4H44C 2YMKA 1NAFA 5AVSB 2KZJA 4GKGA 2KUBA 3TNUA 4HJGH 1HUCA 4IL6X 1VPCA 1W5CE 3FXDA 2D2CB 2JDIH 3SWKA 1DH3A 2PAJA 3H1LG 1OZHA 1NO4A 1QEXA 4UB6E 3EFGA 5AW1B 1FZGA 1M7LA 5AVTB 5M1BA 4WVZA 4DZOA 5AW4B 1L0LJ 3BCCJ 1T8ZA 3TGUD 2P7JA 4DCKA 3W67A 4DJGA 1GW3A 2O01H 2I1KA 2W6BA 1KYOI 5AW3B 3CWBE 2WVRA 3M9BA 2Q1KA 2POHA 4U3FJ 1LTAC 5EFWB 3H25A 4PJ0E 3P8CE 1NVOA 1YQ3C 4A7PA 2H43A 1SQPD 1NTMK 1L4AA 3TYYA 2E75D 2WSEJ 4Y99C 3D6YA 2BEQD 2UWJE 1M1KQ 4OGQC 3GMAA 4JPZB 1M1JC 3E7KA 1ZV8A 1FZAA 3A7OA 3Q1MA 1BE3G 1JTHB 1L0LE 4M3LA 3BCCE 1GD2E 1L0ND 4WB4A 1L4AD 3VMAA 5K5GB 2IBZI 1KYOH 2AXTH 4EI2A 1H0TB 5KLVG 1LTBC 3E1RA 3L74G 1FZFA 1S5LX 1NTMJ 5KLIC 1HJ0A 3CI9A 4U3FE 3AE3C 1N86A 1RF0A 3BASA 2ZT9D 1JY2O 2GUVA 1A02J 1T2KD 2FYUK 3TGUE 1JY2N 1OW7A 1FU1A 3VOPA 1IFNA 3ITKA 1SLQA 3GLMA 2OYIA 1DIPA 2P1JA 1ZW0A 2KNCA 2KXPB 1IFMA 3OJAB 5AW5B 2K37A 3U1AA 3I56P 1NTKK 3L35A 4L73A 5CCHC 2JKVA 2YNYA 1BGYJ 4Y99B 4OGQB 3JC22 1J1DC 1S72P 5APTA 1M1JB 2E76D 1JMMA 1VF5B 4JBZA 3H1HJ 3HUSA 3Q5RA 3B5NA 3OAKA 3AEFC 3TDKA 2FYUJ 3IN6A 2A45G 4N78D 5CBNA 1SQPE 3HE4B 1KQSO 2K3RA 1SQBD 3VYIA 5KJ7A 3VMZA 2FFDA 1NTKJ 1KQGB 5AW2B 3TSIA 2NPSA 1G1JA 2ZJSE 3U1CA 4U3FG 2ZYGA 2QVAA 2W90A 2KZIA 1L0NE 2FYZA 5AW7B 3MUDC 4RJTA 1E79H 4C7NB 1J2JB 1S3JA 5KJ7D 1K04A 2OYHA 1N7SC 2HYNA 2NPSD 1NTZD 4LLHA 1JB0J 1X22A 3A5TA 5APSA 3KZIH 2M3EA 3L71D 3CXHI 2IPPA 3GW6A 1K73Q 2HPCA 3H1HE 1Q2NA 3H1JG 4W80A 4OH8B 3V5BA 4I2LC 2HG5D 2IFNA 1IC2A 2WSCJ 4IFFA 1LGHB 1NTMG 3V2PA 1SQVK 2IDBA 2GM4A 4N6JA 4C46A 1DEEG 1Q7YQ 1KN7A 4K35A 2Q5UA 3L70D 5AVYB 3VTPC 2IX7C 1LP1A 1EXJA 3MIWA 3CXHH 4AUWA 4N78E 1NKZB 3V2NA 3A0HH 3RK3D 1YIJP 1HJBA 1SQVJ 1GW4A 1LT9C 1BGYG 1SQXD 2WQYC 1SQXK 2BCCJ 1H8AA 3VMXA 1GL2C 2MKVA 2WPRA 2YO3A 1WT6A 1NU1K 1LTJC 4NPDA 4H0LD 1FZCA 2FYUG 2E74C 2J5UA 1PP9J 1SQQK 4H13B 1CI6A 1ZMEC 1RF1A 2YKPA 1JNMA 3CCMP 1GDTA 3H1LD 3RGUA 3NFQA 2R5DA 1G2CA 1GK4A 1EDKA 1NTKG 1Y8AA 3L71E 2FBWC 1EZVG 1SQXJ 5B5EE 5AVZB 1OWAA 2JR8A 1NYHA 1NU1J 5APWA 1HBWA 2JJLA 5KAIH 3AE5C 4PV1D 3CCEP 3EQ2A 1SQQJ 3HD7B 2QJYC 2B88A 1SQVE 1PPJG 1PV3A 1ZR2A 1R8EA 3RBZA 3L75J 2BCCE 2WSFH 4TLFA 2N1TC 3GHGB 2CK3H 5BU5A 1T3JA 1ZRTD 3M0DC 3SFEC 2W83C 1KILB 1PP9E 3SFDC 3QWOC 2P2UA 2QSIA 3H1KJ 3OW2O 1Y47A 5CJ4A 1U7MA 4B86A 1LTJB 3FWLA 3L72D 2K88A 2P10A 1VQOP 1X0TA 1KFMA 2KK7A 2ITAA 1YJWP 1PGQA 5KTBA 1KYOD 2FY8A 1IO4A 3AE2C 2D2CD 2XNXA 5GTHH 1S5LH 2WT7B 2OTLP 1VQKP 1GMJA 1SQXE 1VQLP 1K05A 4D6TG 1URQC 1NU1E 2KLUA 2LXBA 5KLVD 3L74D 1SQQE 3MP7B 3CCVP 4WY4C 1N73C 1JY3N 2B87B 3LIEA 4NPFX 2ZVNB 3L75E 5CJ0A 1E5WA 2XDJA 3Q5SA 5APXA 2WITA 2QJYB 1FZBA 3KPEA 3CCJP 4DOJA 2KSEA 3Q5PA 2A06D 2H89C 1USEA 3OA7A 1LWUB 1RE4C 1SP4A 4GOFA 4XA4A 1IZNB 1RHZB 1QX8A 2FYNB 2L91A 3CWBJ 3H1IJ 3CC2P 2KI7B 2CPSA 3O6QB 3VP8A 1JEKA 2YO2A 2ZYAA 3G6EP 2JO1A 3CC7P 1OW6A 1BCCD 2I1JA 1KC8Q 4L75A 2Z5IA 2JEEA 3FX0A 1SFCC 4I7ZC 1KORA 4Y28J 1Q86Q 1N73B 3L75G 2M3BA 3RK2B 5APQA 1QVGO 5DJTB 1S9KD 1KTMA 1KYOE 2AXTE 3CPWO 2HLOA 1YITP 2B9BA 1KB9I 3NXSA 1PFIA 2ZVOB 3VN0A 1H89A 3L73D 5AVQB 3H1KG 3H1IE 2M5AB 4TT3H 2HODB 2XZRA 4DT0A 4C7RA 1M1JA 2C9LY 5AVRB 2QG4A 4H44B 3A0BE 3TGUJ 1GTWA 3T97B 3LW5J 1FDMA 1KV4A 1SQPK 2Q6QA 3H1JD 3HE4A 1M57D 2H7HA 4OGQD 2ZYDA 3AE6C 3GF3A 1IFJA 3Q2YA 5CBOA 3V2QA 1JO5A 1VF5D 2QJPC 1FOSF 2IBZE 5B66H 1RQUA 1UIXA 1CW5A 1JOCA 2R3SA 1JM0A 2E75C 2ZXEB 2FXMA 1L0NK 1KB9H 1DX7A 4JYCA 3R2PA 4C7NA 3B8EB 1Q82Q 3V4WA 1SFCB 1GZLA 4I7ZB 3CXHD 2WWWA 3C8VA 4BWNA 2QIWA 1LTGC 1BCCE 1L4AC 3JCUH 1SQPJ 3SWFA 2P67A 4BRYB 3CWBG 5APVA 3CX5I 3KYQA 1NHLA 2KOGA 1RY3A 5TISH 1OX3A 2A45I 2QM7A 1L0NJ 2LKMA 3JSVC 4W7ZA 2WPSA 3CLQA 2RMZA 2ZT9C 1G1IA 1LNQA 2JWDA 2YKQA 3V4QA 5CCHD 1OW8A 2Y0CA 3KZIE 4PJ0H 1Q81Q 4LGDE 1L0LG 3BCCG 4R4LA 1FDOA 3CCRP 1RF0C 4UB8H 4KT0J 1NGMB 1EZVD 1BSHA 3S4RA 1YBKA 3BRTB 3CX5H 3CCLP 2C9NY 1EDIA 1SQBK 5TJHA 2E76C 2OYIC 1YHQP 2A45H 2KSJA 3II6A 3AECC 4IFMA 4I1LA 1PPJD 5KLIB 3MD0A 2OGUA 1M8OB 3L37A 2V7QJ 5APYA 1USDA 5AVWB 3IFMA 3SWYA 3TGUG 1EQ7A 3HUSC 4I6MC 3AE1C 2K9YA 3B5NC 3CXHE 4GODA 1AQ5A 1MUUA 4HB1A 1NTZK 3A0HE 3E1IA 1JCCA 2W6JH 1SQBJ 2G3AA 1RQVA 5APUA 5KJ7C 2FFDC 1VL2A 2WSFJ 4H13D 2NPSC 1AA0A 1JY2P 2E42A 1BDCA 1HGVA 3U59A 3AEBC 4D6TD 1J1DB 1MZ9A 2WTYA 3HD7A 2OYHC 1UIIA 1SVFA 1YTZT 1SQPG 2OYOA 1K8AQ 1LT1A 3V2RA 1YJNP 5AVXB 1NTZJ 1CZQA 1AVYA 3GHGA 5GTIH 3Q3DA 1ZOYC 3L71J 2KNCB 1KMIZ 1KILA 1LTIC 2K9JB 2WZ7A 3RBXA 1FJKA 3HD7D 1S2EA 1L0NG 5CCGA 2ZFCA 1JMBA 1VQ7P 5KAIE 2PFXA 4L74A 1LTJA 2KS1A 1MFZA 4LC1A 2Z5HA 1SQBE 1LTSC 1OIPA 1EZVI 1NKNA 3B71A 2C0XA 1KILD 3B5NB 2W6AA 4IL6H 1N7SB 5L8RJ 2YIUC 5CCGD 2WT7A 1N2DC 2IZ1A 1BSNA 3AEAC 5AW9B 3H1HG 5E79H 2QJKC 3PTZA 2FKWB 2IZ0A 2QM8A 2YKOA 1VQPP 2B87A 3L70J 3KQGA 3M9HA 1NTZE 2R5BA 1XTCC 2XNDH 3CL3D 4H0LC 4AYCA 1IK7A 1NWQA 3AE7C 1ZLLA 5GTHE 3IR9A 2O01N 1IFIA 3EWKA 1MFTA 4IFDK 1LWUA 1BDDA 3WU2H 4O9BA 1GU5A 2VRSA 3C9IA 3CD6P 1FZCC 1YQ4C 1IK9A 1U57A 1W2BO 1A02F 2NRGA 1RF1C 3IAOA 5CMZA 1J1EC 3D71A 1SQBG 3V6IA 3H1LJ 1FJPA 2AXCA 1L2PA 4PV1C 2GA1A 1LT9B 3R4YA 4XE5B 4R4MA 2L5GB 2OTJP 3M9QA 2O01J 3PLNA 3L70E 1GL2B 3PJSK 3SSUA 3KXDA 3P32A 1KQLA 2E74B 1KB9D 1BE3D 1N73A 4ZKPA 3RK3E 3BRVB 3CCQP 3L71G 1OMIA 3RL0C 1GK6A 4ZKUA 3NMDA 1DD3A 3UIAA 1T3UA 3MTUE 1YTZI 1LJ2A 3P8MC 1P84I 2Y9YA 2D2CC 3RK2D 5KLVK 4BXLA 1AJYA 3HTKB 2HODA 4JF7A 5B5EH 2Y0DA 3H1LE 1SQVG 1FZCB 3L72J 1HVVA 1RE3A 1HF9A 2ZAEB 2BCCG 1YI2P 1Z56A 3T97A 1RF1B 5KAFH 3D6ZA 3M0AA 2N1TB 2BEZF 2I8DA 1PP9G 4YTPC 3O8ZA 4WWIA 3P8CD 2QEXP 1VQ8P 1JTHA 1MV8A 4H44D 4PD4I 5KLVJ 3K5BA 3L74J 1GU4A 1CSBA 2YXQB 3G71P 2WSSH 4HYTB 3AE8C 3PP5A 3D70A 1NAYA 1FE6A 3AEDC 3BCCD 1LTTC 1H0TA 1P84H 1FZEA 1SS1A 1FBMA 3CX5D 2B89A 1ZRTE 1SQXG 1Y9BA 5KKZC 3C1LA 1NU1G 3I55P 3HE5B 2O1JA 3RL0B 1URQB 2DW3A 4BRYA 1SQQG 4ASVA 5B66E 1SFCD 2BASA 3L72E 1QL1A 1KB9E 2HFED 1YJ9P 3PH0A 4WY4B 1QVFO 1BE3E 4U3FD 4RO0A 1EC5A 2LR2A 3PHLA 4EOTA 4PD4H 1XTGB 4GT1A 2N9YB 3JCUE 4ASWA 3G4SP 1D7MA 3FXEA 3CMEP 1BCCJ 1JY3P 1HH0A 5KLVE 3L74E 3G9RA 5AW8B 2OARA 3BATA 1EDJA 5TISE 3F5HA 1RH5B 3WUUA 3S9OA 4YXDC 5H2FH 2R32A 3H32B 2JWAA 4GDOA 2A06E 4L76A 1IFPA 3M06A 2J58A 3F89A 2YXRB 1S1CX 2WPVB 5KKZB 1NTMD 4OVNF 3L73J 3NTNA 2Z4EA 1T6AA 1OVUA 1JCDA 1FC2C 3AE4C 3L72G 3CC4P 4UB8E 3N7NA 4UB6H 3A2AA 1OFCX 1VF5C 4EDFA 4AQRD 2Q9IA 3CX5E 2W8ZA 1R5SA 3AEGC 2JP3A 3H1JJ 2R44A 1FAVA 3QH9A 3TNUB 1VQMP 3H1IG 1OXZA 1PZQA 3L4FA 5CCHA 2K1AA 1IFDA 5BU8B 5AVUB 1BGYD 2J59M 1HWTC 1N7LA 2AEFA 2XU6A 1S9KE 2G8YA 1WMKA 3H1HD 2FYUD 1T2KC 3N4XA 2A06G 1KZUB 3L73E 3A0BH 3W68A 1N8RQ 1TU3F 2PGDA 3I5CA 3CCUP 2IYPA 3P7KA 2IBZG 3GF7A 3MGNA 1NTKD 1JUNA 2K9JA 2QJPB 2O3JA 1NH4A 1QLED 2E75B 5C39A 3S1KA 3MUDA 1PL5A 2E5YA 3H1JE 2QA4P 1K9MQ 2KLVA 1WRGA 3GG2A 1BCCG 2R3CA 4NPEA 1M56D 1N7SA 1ZXGA 1VQ5P 1L4AB 5GTIE 1NTME 5CHXA 3BVHA 2CPBA 1R5LA 4EYYQ 2N9BA 1HGZA 3A3YB 1X8YA 2M8RA 3B5ND 1N7SD 4GOEA 5BVZA 2NZ2A 2IFMA 3LW5H 4CPGA 4IL6E 2WSEH 4GIFA 3L73G 2ZT9B 2QE7H 2W27A 1VQNP 1FDIA 1W2EA 4K3AA 2KYVA 4U7JA 1BGYE 5E79E 1OVVA 4KHXA 2C0WA 2FXPA 4RKUJ 2XKMA 4H13C 2SPZA 2KB7P 2FYUE 1KQFB 1X79B 1U7JA 1DD4A
chains in the Genus database with same CATH topology
3L74G 1EZVG 2A06G 2FYUG 1BE3G 1PPJG 1SQQG 4PD4H 3CX5H 1PP9G 1BGYG 3L71G 4D6TG 1P84H 1NTMG 3H1KG 1SQBG 5KLVG 1L0LG 3L73G 1SQVG 1L0NG 3BCCG 1SQPG 1SQXG 1KB9H 3TGUG 3L75G 2IBZG 3L70G 3L72G 1BCCG 3CXHH 2BCCG 3CWBG 1KYOH 3H1LG 3H1JG 3H1IG 1NU1G 1NTKG 3H1HG 4U3FG 1NTZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L74 G;  1EZV G;  2A06 G;  2FYU G;  1BE3 G;  1PPJ G;  1SQQ G;  4PD4 H;  3CX5 H;  1PP9 G;  1BGY G;  3L71 G;  4D6T G;  1P84 H;  1NTM G;  3H1K G;  1SQB G;  5KLV G;  1L0L G;  3L73 G;  1SQV G;  1L0N G;  3BCC G;  1SQP G;  1SQX G;  1KB9 H;  3TGU G;  3L75 G;  2IBZ G;  3L70 G;  3L72 G;  1BCC G;  3CXH H;  2BCC G;  3CWB G;  1KYO H;  3H1L G;  3H1J G;  3H1I G;  1NU1 G;  1NTK G;  3H1H G;  4U3F G;  1NTZ G; 
#chains in the Genus database with same CATH topology
 3USS A;  2E76 B;  2OYI B;  1NOH A;  1SQV D;  1LT9 A;  2Y0E A;  1VQ4 P;  1PGJ A;  1QGK B;  1NTK E;  3TF5 A;  2BCC D;  3WU2 E;  1EZV E;  1GL2 A;  5AW6 B;  3WUT A;  3L36 A;  4IOI H;  1IJD B;  2Y9Z A;  2OTK E;  1PP9 D;  2RN0 A;  4D6T J;  1KD1 Q;  2PP6 A;  4N3Y B;  3HUS B;  3HD7 C;  3CCS P;  2RKL A;  4RES B;  1P84 D;  1GL2 D;  1PPJ E;  3CMA P;  4OWF A;  3AE9 C;  3GHG C;  4ZMD A;  4HH2 A;  2E74 D;  3RK3 C;  2FFD B;  1KIL C;  4W7Y A;  2Q7C A;  2NPS B;  5CCG C;  4HKZ H;  2E5T A;  1QL2 A;  2E43 A;  3HTK A;  2KP8 A;  1NU1 D;  1KFN A;  5AW0 B;  4XFJ A;  1S4X A;  4YXW H;  2WPQ A;  3HRN A;  1ZP0 C;  3VP9 A;  1SQQ D;  1EDL A;  1AV1 A;  2PRR A;  1S5L E;  2OYH B;  3H6P A;  3B4S A;  3L75 D;  4PD4 D;  3WMM 0;  1PGO A;  3LID A;  2V4H A;  2N1T A;  2P58 A;  3M0D A;  4JYB A;  1EXI A;  2H88 C;  4D6T E;  2WMM A;  3FGA D;  2M0B A;  2HPC B;  2V7Q H;  3ZDM A;  3KDP B;  2IYO A;  3O6Q A;  3H1K D;  5AVV B;  3PRJ A;  2GUS A;  3KHU A;  3ABV C;  3EFF K;  3RL0 g;  2N1T D;  1M90 Q;  1VQ9 P;  5KAF E;  2YIU B;  1VDF A;  1MKM A;  3HE5 A;  2H8P D;  1LWU C;  1URQ A;  3FWN A;  3TK1 A;  2RH0 A;  4ZNC A;  1PIX A;  2QJK B;  5DJU B;  3WUV A;  3RK3 B;  2O1K A;  1VQ6 P;  2ZXX A;  1YYC A;  2Q3I A;  2FYN C;  4Z1M H;  1X9V A;  1OVR A;  1NTZ G;  4WY4 A;  2WSC H;  1LP1 B;  2YMY A;  1KIL E;  4EIJ A;  1Q90 D;  2AEJ A;  1P84 E;  3MZW B;  3RL0 D;  2KS1 B;  1URQ D;  4H0L B;  4WBA A;  3AEE C;  2MJZ A;  2Q3E A;  1FOS E;  4WY4 D;  2M5A A;  4KJM A;  1ZR4 A;  1AVO A;  1RE4 A;  3VMY A;  2XV5 A;  3MHV A;  4QMA A;  2KIK A;  1HTL C;  1AQT A;  3G3Z A;  4YPC A;  2QRX A;  3CWB D;  3H1I D;  1JY3 O;  1H88 A;  2AEM A;  1CI6 B;  3H32 A;  1DEB A;  2LXC B;  3RK2 C;  2HR3 A;  1BE3 J;  1FS0 E;  1J1E B;  4PD4 E;  1G2C B;  4PV1 B;  1NJI Q;  1AFO A;  3IF4 A;  3L70 G;  4JQ0 D;  4MN4 C;  1ZN5 A;  3H1K E;  1PGP A;  3M91 A;  1SFC A;  1L0L D;  2OQQ A;  2FXO A;  5H2F E;  2IBZ D;  1L0L K;  1RE3 C;  4H44 C;  2YMK A;  1NAF A;  5AVS B;  2KZJ A;  4GKG A;  2KUB A;  3TNU A;  4HJG H;  1HUC A;  4IL6 X;  1VPC A;  1W5C E;  3FXD A;  2D2C B;  2JDI H;  3SWK A;  1DH3 A;  2PAJ A;  3H1L G;  1OZH A;  1NO4 A;  1QEX A;  4UB6 E;  3EFG A;  5AW1 B;  1FZG A;  1M7L A;  5AVT B;  5M1B A;  4WVZ A;  4DZO A;  5AW4 B;  1L0L J;  3BCC J;  1T8Z A;  3TGU D;  2P7J A;  4DCK A;  3W67 A;  4DJG A;  1GW3 A;  2O01 H;  2I1K A;  2W6B A;  1KYO I;  5AW3 B;  3CWB E;  2WVR A;  3M9B A;  2Q1K A;  2POH A;  4U3F J;  1LTA C;  5EFW B;  3H25 A;  4PJ0 E;  3P8C E;  1NVO A;  1YQ3 C;  4A7P A;  2H43 A;  1SQP D;  1NTM K;  1L4A A;  3TYY A;  2E75 D;  2WSE J;  4Y99 C;  3D6Y A;  2BEQ D;  2UWJ E;  1M1K Q;  4OGQ C;  3GMA A;  4JPZ B;  1M1J C;  3E7K A;  1ZV8 A;  1FZA A;  3A7O A;  3Q1M A;  1BE3 G;  1JTH B;  1L0L E;  4M3L A;  3BCC E;  1GD2 E;  1L0N D;  4WB4 A;  1L4A D;  3VMA A;  5K5G B;  2IBZ I;  1KYO H;  2AXT H;  4EI2 A;  1H0T B;  5KLV G;  1LTB C;  3E1R A;  3L74 G;  1FZF A;  1S5L X;  1NTM J;  5KLI C;  1HJ0 A;  3CI9 A;  4U3F E;  3AE3 C;  1N86 A;  1RF0 A;  3BAS A;  2ZT9 D;  1JY2 O;  2GUV A;  1A02 J;  1T2K D;  2FYU K;  3TGU E;  1JY2 N;  1OW7 A;  1FU1 A;  3VOP A;  1IFN A;  3ITK A;  1SLQ A;  3GLM A;  2OYI A;  1DIP A;  2P1J A;  1ZW0 A;  2KNC A;  2KXP B;  1IFM A;  3OJA B;  5AW5 B;  2K37 A;  3U1A A;  3I56 P;  1NTK K;  3L35 A;  4L73 A;  5CCH C;  2JKV A;  2YNY A;  1BGY J;  4Y99 B;  4OGQ B;  3JC2 2;  1J1D C;  1S72 P;  5APT A;  1M1J B;  2E76 D;  1JMM A;  1VF5 B;  4JBZ A;  3H1H J;  3HUS A;  3Q5R A;  3B5N A;  3OAK A;  3AEF C;  3TDK A;  2FYU J;  3IN6 A;  2A45 G;  4N78 D;  5CBN A;  1SQP E;  3HE4 B;  1KQS O;  2K3R A;  1SQB D;  3VYI A;  5KJ7 A;  3VMZ A;  2FFD A;  1NTK J;  1KQG B;  5AW2 B;  3TSI A;  2NPS A;  1G1J A;  2ZJS E;  3U1C A;  4U3F G;  2ZYG A;  2QVA A;  2W90 A;  2KZI A;  1L0N E;  2FYZ A;  5AW7 B;  3MUD C;  4RJT A;  1E79 H;  4C7N B;  1J2J B;  1S3J A;  5KJ7 D;  1K04 A;  2OYH A;  1N7S C;  2HYN A;  2NPS D;  1NTZ D;  4LLH A;  1JB0 J;  1X22 A;  3A5T A;  5APS A;  3KZI H;  2M3E A;  3L71 D;  3CXH I;  2IPP A;  3GW6 A;  1K73 Q;  2HPC A;  3H1H E;  1Q2N A;  3H1J G;  4W80 A;  4OH8 B;  3V5B A;  4I2L C;  2HG5 D;  2IFN A;  1IC2 A;  2WSC J;  4IFF A;  1LGH B;  1NTM G;  3V2P A;  1SQV K;  2IDB A;  2GM4 A;  4N6J A;  4C46 A;  1DEE G;  1Q7Y Q;  1KN7 A;  4K35 A;  2Q5U A;  3L70 D;  5AVY B;  3VTP C;  2IX7 C;  1LP1 A;  1EXJ A;  3MIW A;  3CXH H;  4AUW A;  4N78 E;  1NKZ B;  3V2N A;  3A0H H;  3RK3 D;  1YIJ P;  1HJB A;  1SQV J;  1GW4 A;  1LT9 C;  1BGY G;  1SQX D;  2WQY C;  1SQX K;  2BCC J;  1H8A A;  3VMX A;  1GL2 C;  2MKV A;  2WPR A;  2YO3 A;  1WT6 A;  1NU1 K;  1LTJ C;  4NPD A;  4H0L D;  1FZC A;  2FYU G;  2E74 C;  2J5U A;  1PP9 J;  1SQQ K;  4H13 B;  1CI6 A;  1ZME C;  1RF1 A;  2YKP A;  1JNM A;  3CCM P;  1GDT A;  3H1L D;  3RGU A;  3NFQ A;  2R5D A;  1G2C A;  1GK4 A;  1EDK A;  1NTK G;  1Y8A A;  3L71 E;  2FBW C;  1EZV G;  1SQX J;  5B5E E;  5AVZ B;  1OWA A;  2JR8 A;  1NYH A;  1NU1 J;  5APW A;  1HBW A;  2JJL A;  5KAI H;  3AE5 C;  4PV1 D;  3CCE P;  3EQ2 A;  1SQQ J;  3HD7 B;  2QJY C;  2B88 A;  1SQV E;  1PPJ G;  1PV3 A;  1ZR2 A;  1R8E A;  3RBZ A;  3L75 J;  2BCC E;  2WSF H;  4TLF A;  2N1T C;  3GHG B;  2CK3 H;  5BU5 A;  1T3J A;  1ZRT D;  3M0D C;  3SFE C;  2W83 C;  1KIL B;  1PP9 E;  3SFD C;  3QWO C;  2P2U A;  2QSI A;  3H1K J;  3OW2 O;  1Y47 A;  5CJ4 A;  1U7M A;  4B86 A;  1LTJ B;  3FWL A;  3L72 D;  2K88 A;  2P10 A;  1VQO P;  1X0T A;  1KFM A;  2KK7 A;  2ITA A;  1YJW P;  1PGQ A;  5KTB A;  1KYO D;  2FY8 A;  1IO4 A;  3AE2 C;  2D2C D;  2XNX A;  5GTH H;  1S5L H;  2WT7 B;  2OTL P;  1VQK P;  1GMJ A;  1SQX E;  1VQL P;  1K05 A;  4D6T G;  1URQ C;  1NU1 E;  2KLU A;  2LXB A;  5KLV D;  3L74 D;  1SQQ E;  3MP7 B;  3CCV P;  4WY4 C;  1N73 C;  1JY3 N;  2B87 B;  3LIE A;  4NPF X;  2ZVN B;  3L75 E;  5CJ0 A;  1E5W A;  2XDJ A;  3Q5S A;  5APX A;  2WIT A;  2QJY B;  1FZB A;  3KPE A;  3CCJ P;  4DOJ A;  2KSE A;  3Q5P A;  2A06 D;  2H89 C;  1USE A;  3OA7 A;  1LWU B;  1RE4 C;  1SP4 A;  4GOF A;  4XA4 A;  1IZN B;  1RHZ B;  1QX8 A;  2FYN B;  2L91 A;  3CWB J;  3H1I J;  3CC2 P;  2KI7 B;  2CPS A;  3O6Q B;  3VP8 A;  1JEK A;  2YO2 A;  2ZYA A;  3G6E P;  2JO1 A;  3CC7 P;  1OW6 A;  1BCC D;  2I1J A;  1KC8 Q;  4L75 A;  2Z5I A;  2JEE A;  3FX0 A;  1SFC C;  4I7Z C;  1KOR A;  4Y28 J;  1Q86 Q;  1N73 B;  3L75 G;  2M3B A;  3RK2 B;  5APQ A;  1QVG O;  5DJT B;  1S9K D;  1KTM A;  1KYO E;  2AXT E;  3CPW O;  2HLO A;  1YIT P;  2B9B A;  1KB9 I;  3NXS A;  1PFI A;  2ZVO B;  3VN0 A;  1H89 A;  3L73 D;  5AVQ B;  3H1K G;  3H1I E;  2M5A B;  4TT3 H;  2HOD B;  2XZR A;  4DT0 A;  4C7R A;  1M1J A;  2C9L Y;  5AVR B;  2QG4 A;  4H44 B;  3A0B E;  3TGU J;  1GTW A;  3T97 B;  3LW5 J;  1FDM A;  1KV4 A;  1SQP K;  2Q6Q A;  3H1J D;  3HE4 A;  1M57 D;  2H7H A;  4OGQ D;  2ZYD A;  3AE6 C;  3GF3 A;  1IFJ A;  3Q2Y A;  5CBO A;  3V2Q A;  1JO5 A;  1VF5 D;  2QJP C;  1FOS F;  2IBZ E;  5B66 H;  1RQU A;  1UIX A;  1CW5 A;  1JOC A;  2R3S A;  1JM0 A;  2E75 C;  2ZXE B;  2FXM A;  1L0N K;  1KB9 H;  1DX7 A;  4JYC A;  3R2P A;  4C7N A;  3B8E B;  1Q82 Q;  3V4W A;  1SFC B;  1GZL A;  4I7Z B;  3CXH D;  2WWW A;  3C8V A;  4BWN A;  2QIW A;  1LTG C;  1BCC E;  1L4A C;  3JCU H;  1SQP J;  3SWF A;  2P67 A;  4BRY B;  3CWB G;  5APV A;  3CX5 I;  3KYQ A;  1NHL A;  2KOG A;  1RY3 A;  5TIS H;  1OX3 A;  2A45 I;  2QM7 A;  1L0N J;  2LKM A;  3JSV C;  4W7Z A;  2WPS A;  3CLQ A;  2RMZ A;  2ZT9 C;  1G1I A;  1LNQ A;  2JWD A;  2YKQ A;  3V4Q A;  5CCH D;  1OW8 A;  2Y0C A;  3KZI E;  4PJ0 H;  1Q81 Q;  4LGD E;  1L0L G;  3BCC G;  4R4L A;  1FDO A;  3CCR P;  1RF0 C;  4UB8 H;  4KT0 J;  1NGM B;  1EZV D;  1BSH A;  3S4R A;  1YBK A;  3BRT B;  3CX5 H;  3CCL P;  2C9N Y;  1EDI A;  1SQB K;  5TJH A;  2E76 C;  2OYI C;  1YHQ P;  2A45 H;  2KSJ A;  3II6 A;  3AEC C;  4IFM A;  4I1L A;  1PPJ D;  5KLI B;  3MD0 A;  2OGU A;  1M8O B;  3L37 A;  2V7Q J;  5APY A;  1USD A;  5AVW B;  3IFM A;  3SWY A;  3TGU G;  1EQ7 A;  3HUS C;  4I6M C;  3AE1 C;  2K9Y A;  3B5N C;  3CXH E;  4GOD A;  1AQ5 A;  1MUU A;  4HB1 A;  1NTZ K;  3A0H E;  3E1I A;  1JCC A;  2W6J H;  1SQB J;  2G3A A;  1RQV A;  5APU A;  5KJ7 C;  2FFD C;  1VL2 A;  2WSF J;  4H13 D;  2NPS C;  1AA0 A;  1JY2 P;  2E42 A;  1BDC A;  1HGV A;  3U59 A;  3AEB C;  4D6T D;  1J1D B;  1MZ9 A;  2WTY A;  3HD7 A;  2OYH C;  1UII A;  1SVF A;  1YTZ T;  1SQP G;  2OYO A;  1K8A Q;  1LT1 A;  3V2R A;  1YJN P;  5AVX B;  1NTZ J;  1CZQ A;  1AVY A;  3GHG A;  5GTI H;  3Q3D A;  1ZOY C;  3L71 J;  2KNC B;  1KMI Z;  1KIL A;  1LTI C;  2K9J B;  2WZ7 A;  3RBX A;  1FJK A;  3HD7 D;  1S2E A;  1L0N G;  5CCG A;  2ZFC A;  1JMB A;  1VQ7 P;  5KAI E;  2PFX A;  4L74 A;  1LTJ A;  2KS1 A;  1MFZ A;  4LC1 A;  2Z5H A;  1SQB E;  1LTS C;  1OIP A;  1EZV I;  1NKN A;  3B71 A;  2C0X A;  1KIL D;  3B5N B;  2W6A A;  4IL6 H;  1N7S B;  5L8R J;  2YIU C;  5CCG D;  2WT7 A;  1N2D C;  2IZ1 A;  1BSN A;  3AEA C;  5AW9 B;  3H1H G;  5E79 H;  2QJK C;  3PTZ A;  2FKW B;  2IZ0 A;  2QM8 A;  2YKO A;  1VQP P;  2B87 A;  3L70 J;  3KQG A;  3M9H A;  1NTZ E;  2R5B A;  1XTC C;  2XND H;  3CL3 D;  4H0L C;  4AYC A;  1IK7 A;  1NWQ A;  3AE7 C;  1ZLL A;  5GTH E;  3IR9 A;  2O01 N;  1IFI A;  3EWK A;  1MFT A;  4IFD K;  1LWU A;  1BDD A;  3WU2 H;  4O9B A;  1GU5 A;  2VRS A;  3C9I A;  3CD6 P;  1FZC C;  1YQ4 C;  1IK9 A;  1U57 A;  1W2B O;  1A02 F;  2NRG A;  1RF1 C;  3IAO A;  5CMZ A;  1J1E C;  3D71 A;  1SQB G;  3V6I A;  3H1L J;  1FJP A;  2AXC A;  1L2P A;  4PV1 C;  2GA1 A;  1LT9 B;  3R4Y A;  4XE5 B;  4R4M A;  2L5G B;  2OTJ P;  3M9Q A;  2O01 J;  3PLN A;  3L70 E;  1GL2 B;  3PJS K;  3SSU A;  3KXD A;  3P32 A;  1KQL A;  2E74 B;  1KB9 D;  1BE3 D;  1N73 A;  4ZKP A;  3RK3 E;  3BRV B;  3CCQ P;  3L71 G;  1OMI A;  3RL0 C;  1GK6 A;  4ZKU A;  3NMD A;  1DD3 A;  3UIA A;  1T3U A;  3MTU E;  1YTZ I;  1LJ2 A;  3P8M C;  1P84 I;  2Y9Y A;  2D2C C;  3RK2 D;  5KLV K;  4BXL A;  1AJY A;  3HTK B;  2HOD A;  4JF7 A;  5B5E H;  2Y0D A;  3H1L E;  1SQV G;  1FZC B;  3L72 J;  1HVV A;  1RE3 A;  1HF9 A;  2ZAE B;  2BCC G;  1YI2 P;  1Z56 A;  3T97 A;  1RF1 B;  5KAF H;  3D6Z A;  3M0A A;  2N1T B;  2BEZ F;  2I8D A;  1PP9 G;  4YTP C;  3O8Z A;  4WWI A;  3P8C D;  2QEX P;  1VQ8 P;  1JTH A;  1MV8 A;  4H44 D;  4PD4 I;  5KLV J;  3K5B A;  3L74 J;  1GU4 A;  1CSB A;  2YXQ B;  3G71 P;  2WSS H;  4HYT B;  3AE8 C;  3PP5 A;  3D70 A;  1NAY A;  1FE6 A;  3AED C;  3BCC D;  1LTT C;  1H0T A;  1P84 H;  1FZE A;  1SS1 A;  1FBM A;  3CX5 D;  2B89 A;  1ZRT E;  1SQX G;  1Y9B A;  5KKZ C;  3C1L A;  1NU1 G;  3I55 P;  3HE5 B;  2O1J A;  3RL0 B;  1URQ B;  2DW3 A;  4BRY A;  1SQQ G;  4ASV A;  5B66 E;  1SFC D;  2BAS A;  3L72 E;  1QL1 A;  1KB9 E;  2HFE D;  1YJ9 P;  3PH0 A;  4WY4 B;  1QVF O;  1BE3 E;  4U3F D;  4RO0 A;  1EC5 A;  2LR2 A;  3PHL A;  4EOT A;  4PD4 H;  1XTG B;  4GT1 A;  2N9Y B;  3JCU E;  4ASW A;  3G4S P;  1D7M A;  3FXE A;  3CME P;  1BCC J;  1JY3 P;  1HH0 A;  5KLV E;  3L74 E;  3G9R A;  5AW8 B;  2OAR A;  3BAT A;  1EDJ A;  5TIS E;  3F5H A;  1RH5 B;  3WUU A;  3S9O A;  4YXD C;  5H2F H;  2R32 A;  3H32 B;  2JWA A;  4GDO A;  2A06 E;  4L76 A;  1IFP A;  3M06 A;  2J58 A;  3F89 A;  2YXR B;  1S1C X;  2WPV B;  5KKZ B;  1NTM D;  4OVN F;  3L73 J;  3NTN A;  2Z4E A;  1T6A A;  1OVU A;  1JCD A;  1FC2 C;  3AE4 C;  3L72 G;  3CC4 P;  4UB8 E;  3N7N A;  4UB6 H;  3A2A A;  1OFC X;  1VF5 C;  4EDF A;  4AQR D;  2Q9I A;  3CX5 E;  2W8Z A;  1R5S A;  3AEG C;  2JP3 A;  3H1J J;  2R44 A;  1FAV A;  3QH9 A;  3TNU B;  1VQM P;  3H1I G;  1OXZ A;  1PZQ A;  3L4F A;  5CCH A;  2K1A A;  1IFD A;  5BU8 B;  5AVU B;  1BGY D;  2J59 M;  1HWT C;  1N7L A;  2AEF A;  2XU6 A;  1S9K E;  2G8Y A;  1WMK A;  3H1H D;  2FYU D;  1T2K C;  3N4X A;  2A06 G;  1KZU B;  3L73 E;  3A0B H;  3W68 A;  1N8R Q;  1TU3 F;  2PGD A;  3I5C A;  3CCU P;  2IYP A;  3P7K A;  2IBZ G;  3GF7 A;  3MGN A;  1NTK D;  1JUN A;  2K9J A;  2QJP B;  2O3J A;  1NH4 A;  1QLE D;  2E75 B;  5C39 A;  3S1K A;  3MUD A;  1PL5 A;  2E5Y A;  3H1J E;  2QA4 P;  1K9M Q;  2KLV A;  1WRG A;  3GG2 A;  1BCC G;  2R3C A;  4NPE A;  1M56 D;  1N7S A;  1ZXG A;  1VQ5 P;  1L4A B;  5GTI E;  1NTM E;  5CHX A;  3BVH A;  2CPB A;  1R5L A;  4EYY Q;  2N9B A;  1HGZ A;  3A3Y B;  1X8Y A;  2M8R A;  3B5N D;  1N7S D;  4GOE A;  5BVZ A;  2NZ2 A;  2IFM A;  3LW5 H;  4CPG A;  4IL6 E;  2WSE H;  4GIF A;  3L73 G;  2ZT9 B;  2QE7 H;  2W27 A;  1VQN P;  1FDI A;  1W2E A;  4K3A A;  2KYV A;  4U7J A;  1BGY E;  5E79 E;  1OVV A;  4KHX A;  2C0W A;  2FXP A;  4RKU J;  2XKM A;  4H13 C;  2SPZ A;  2KB7 P;  2FYU E;  1KQF B;  1X79 B;  1U7J A;  1DD4 A; 
#chains in the Genus database with same CATH homology
 3L74 G;  1EZV G;  2A06 G;  2FYU G;  1BE3 G;  1PPJ G;  1SQQ G;  4PD4 H;  3CX5 H;  1PP9 G;  1BGY G;  3L71 G;  4D6T G;  1P84 H;  1NTM G;  3H1K G;  1SQB G;  5KLV G;  1L0L G;  3L73 G;  1SQV G;  1L0N G;  3BCC G;  1SQP G;  1SQX G;  1KB9 H;  3TGU G;  3L75 G;  2IBZ G;  3L70 G;  3L72 G;  1BCC G;  3CXH H;  2BCC G;  3CWB G;  1KYO H;  3H1L G;  3H1J G;  3H1I G;  1NU1 G;  1NTK G;  3H1H G;  4U3F G;  1NTZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...