1NU4A

U1a rna binding domain at 1.8 angstrom resolution reveals a pre-organized c-terminal helix
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
91
structure length
91
Chain Sequence
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U1A RNA-binding domain at 1.8 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords U1A RNA binding domain
total genus 28
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nu4A00
3MUVP 2D9PA 3FEXB 3CCVS 3THPA 2N7CA 1VQ6S 3ZZYA 2DITA 2UP1A 4Z2XA 3VALA 1JJ4A 4OZ0A 4W90B 2MXYA 2X1AA 1FJCA 3BO2A 1H2VZ 2ERRA 3MOJB 2WBRA 2MQQA 5GAEU 4YUDA 3JB9k 2L9WA 2ZJQQ 3HI9A 3H2UB 1X4GA 2F9JA 1ZZNA 1U1MA 4BS2A 4QU6A 2MKKA 2MY8A 2K3KA 3MDFA 2CQ2A 2J76E 2J0SD 3CF5Q 2DH9A 3CC4S 2E5HA 4UQTA 2HGLA 2L08A 2KU7A 1S79A 1DRZA 2DGWA 3NS5A 2KYXA 1KOHA 5LXYA 3UE2A 2MY7A 1VQMS 2XS2A 3BEGB 1VQ7S 4U67Q 2OIHA 3EGZA 3Q2SC 2G4BA 5LSLA 3CC7S 2LMIA 1U1OA 2QA4S 4LMZA 2DNYA 2MZSA 5IM0B 2HGNA 2DNKA 2RNEA 1X5TA 2NLWA 5IM0A 1PO6A 1K9MT 2LKZA 2DNPA 5D77A 2KN4A 1WEYA 1WHVA 2KVIA 2CQGA 2U2FA 2ZJRQ 2LYVA 3G71S 2J0QD 1JMTA 4UY8T 2RS8A 2MZRA 1X0FA 1WEXA 2DH8A 2MQNA 3U1MA 1WHYA 2MJNA 1Q82T 4J5OA 1HD0A 4ERDA 1R8PA 3BO3A 3G9CA 2G0CA 2KT5A 3CULA 2PE8A 5DETA 1WI6A 2JVOA 1QVFR 2KM8B 3B4MA 3MUTP 1M5PC 1JJ2R 3SDEA 2I2YA 1VQNS 3VAJA 1WG4A 5FJ4A 2DHAA 2DO0A 4RU2A 2U1AA 4V19X 2RRAA 2D3OR 1HL6A 3CCQS 3G8SA 2MQLA 1FJEB 2CPYA 1D9AA 2DNHA 2LECA 4ED5A 2L41A 2KRRA 1M5KC 2CPJA 2MKHA 2MGZB 2DNNA 1B7FA 1OIAA 4WF9Q 2MSSA 2ZJPQ 2KXHA 3NNCA 2CPIA 3MURP 5LJ3Y 1D8ZA 3G8TA 3CCES 5GAGU 3CUNA 3R1LA 3K0JA 1WI8A 1CVJA 3MUMP 2RT3A 3NMRA 2V94A 2DGQA 4C7QA 3CCJS 2KXFA 4WFAQ 4TU9A 3SDEB 2K8GA 1FXLA 2AYGA 2XNQA 3MXHP 4FXVA 3H2VE 3VAGA 4WCEQ 2HYIB 1YJ9S 2E44A 2M7SA 1VC6A 1H2TZ 3J7YU 2MZ1A 1U1KA 2RS2A 2CPDA 2BOPA 1YIJS 4FXWA 3N9UC 3CC2S 2AYMA 2CQBA 2KH9A 3ZZZA 1HA1A 1W2BR 1KD1T 2DISA 2DIUA 2M9KA 1URNA 4C4WA 2CPFA 3P5TL 1U6BA 3VAMA 2MZQA 1KQSR 3TO8A 2LEBA 2BZ2A 1PGZA 2CJKA 2CQ0A 2LXUA 3UCGA 1YTYA 2M4MA 3I56S 1SJQA 4Y00A 4QU7A 2GHPA 2N3OA 1G2EA 3U1LA 2E5GA 2M2BA 1OPIA 1OWXA 1P27B 4W92B 2XSFA 4LIRA 2J8AA 2GO9A 4EGLA 2RVJA 2DHGA 4IOCQ 3S6EA 1N8RT 2DIVA 3EX7B 3V4MA 1X5PA 3SMZA 2LEAA 2DGOA 3CMAS 3FEYB 5CA5A 3P6YC 3RW7A 1U1QA 2CQ3A 1VQ9S 4WFBQ 1FT8A 2CQPA 5H1SV 3J7ZT 3CPWR 2DGVA 1VQ8S 1H2UX 5DM6Q 5EN1A 3P3DA 1VBZA 2LA6A 3UCUP 5HL7Q 2X1GA 1FNXH 2MB0B 2DGUA 1L3KA 1AUDA 3BO4A 2KRBA 2MSTA 4QPTA 3UWTA 2RQCA 1DZ5A 1X4HA 5LJ5Y 3S7RA 2VONA 5BJRA 1YI2S 2DNZA 5IFMA 5GADU 4QQBA 2FY1A 3DXBA 1U6FA 1KC8T 3PIOQ 2CPHA 2EVZA 1JJHA 1A9NB 1WF0A 2JRSA 4PKDB 1U1PA 2YWKA 1U1RA 5CXTA 1WEZA 2QFJA 1M5VC 5ITHA 2MMYA 2FHOB 2XS5A 2DNOA 3PIPQ 2OSRA 1BY9A 1WF2A 2HVZA 3MD1A 4CH1A 1X4BA 3UCZP 1X5OA 5MLCV 1WTBA 1ZH5A 1NO8A 2MHNA 3THTA 1X5SA 4WFNQ 2VODA 1SJRA 1ZZFA 2HZCA 2ADBA 2LA4A 4TLQA 1DHMA 1M5OC 1WHWA 4F25A 3S01A 2CPZA 3RW6A 1FHTA 4WKRA 2XNRA 5GMKa 2CPXA 2OTJS 4CH0S 2AYBA 1HD1A 4C0OC 2AD9A 2XB2D 2D9OA 1QM9A 4WIIA 2FC9A 4F02A 3CCSS 2DGXA 2MKCA 1YJNS 1NJIT 4OZ1A 1VBYA 2MQPA 2DNQA 4CQ1A 3UD3P 2FC8A 5DDOC 2EK6A 1X4EA 3CCUS 1K8AT 1X4CA 2MQOA 1X4DA 2CQ4A 1VC5A 2KG0A 5LXRA 2YTCA 2MZTA 1WG5A 1UW4A 5GVQA 1OO0B 1SJ4P 1N52B 2DNMA 5DM7Q 1SJ3P 1IQTA 1VQLS 2DHXA 4PRFA 3HHNB 1VQPS 2CQHA 3UD4P 1FJ7A 3VAHA 2X1FA 2RU3A 2CQIA 2ADCA 1SXLA 4TU8A 4IUFA 2O3DA 2F9DA 1N88A 2MKJA 1A7GE 1P1TA 2RQ4A 2NZ4A 3B4DA 2DNGA 2DNLA 5D78A 4IO9Q 2MZJA 1WWHA 1NU4A 2M8DB 1YHQS 2M52A 2DH7A 3ULHA 3NNHA 1UP1A 2DHSA 1X4AA 3CXCR 3R1HA 2OTLS 1RKJA 1X4FA 2CQDA 2B0GA 1RK8A 4P6QA 2XS7A 2KI2A 2M70A 1K73T 3NS6A 2N3LA 4A8XA 2MKSA 5JVHQ 1F9FA 3VAFA 3EGNA 2HGMA 3LPYA 1U1LA 1Q86T 2KG1A 2MKIA 2A3JA 1VC0A 2G1DA 1R8HA 1WF1A 3G4SS 2OSQA 2DO4A 2AYEA 5DDRC 1Q7YT 1VBXA 1VQKS 2E5IA 2DB1A 4F26A 3OW2R 1VQ4S 2YH1A 1WG1A 3P49B 4TU7A 1U2FA 3CTRA 2FPHX 2DK2A 3US5A 4YOEA 2JX2A 2MYFA 5DDQC 1UFWA 2RUGA 3VF0B 3CCMS 1YJWS 3IRWP 5LSOA 2MJUA 3NNAA 3VAKA 2VOPA 5CYJA 1UAWA 3IWNC 3I55S 3S8SA 2I38A 1O0PA 3TP2A 2M88A 2MPUA 2M0GB 2LCWA 1QVGR 1M1KT 3CD6S 4LJMA 1N54B 2N82B 2E5JA 2YKAA 2QEXS 4M5DB 2OJ3A 1M90T 3D2WA 3DLLQ 4Y0FA 2F3JA 3CCRS 5JVGQ 2CQ1A 2KM8C 1VQ5S 2YH0A 2EK1A 2DGSA 1YITS 1SJFA 2CQCA 3TYTA 1FO1A 3R27A 3LQVA 2X1BA 2SXLA 2DGTA 4ZKAA 2PEHA 4IOAQ 1Q81T 1XN9A 3SXLA 3MD3A 2M8HA 1YWXA 3VAIA 2JVRA 1VQOS 2MGZA 3L3CA 3CMES 1DBDA 2KFYA 5DDPC 1KOOA 2CPEA 2VOOA 5GAHU 4PR6A 3G96A 2MQMA 2LQ5A 2RRBA 1S72S 1WELA 1WHXA 2KHCA 2Q79A 2LXIA 2DNRA 3G6ES 1U1NA 1H6KX 2JWNA 4YB1P 5IQQA 3CCLS 4CIOA 3Q2TC 3MI7X 2KXNB 3BS9A 5HO4A
chains in the Genus database with same CATH superfamily
3GR0A 2B51A 1LQ9A 2EFPA 4OYOA 3OL7A 1J5OB 1WOPA 1NZAA 1U24A 3TZWA 5DGAA 1VQ6S 3ZZYA 5FDLB 1TL1A 2DITA 4DS4A 2LQ9A 1HPZA 5KTQA 1ZBTA 1S48A 3KHLA 1RU1A 2I0XA 2K3IA 3DFEA 2DRBA 4ZVGA 4RW4B 2RDIA 3VALA 2WONA 4W90B 1YJTA 4USTA 4AQYF 2IIHA 2X1AA 3GFHA 4UZBA 2ZH8A 4DSEA 4QYZK 4KSEB 3PNIA 1RYSA 2GW8A 2OELA 3HSDA 4I68A 4ZIWA 1CC8A 2ZUAA 3D68A 3GSDA 3MFIA 1X8DA 2XHCA 1NZ8A 2DT9A 4JV0A 2WSCC 1EHWA 2XBPA 2ALZA 1JKHB 1KFDA 2M8DB 2BX6A 4DPTA 2MQQA 3EZ5A 3HSGA 3CJ5A 1UVMA 2QRRA 1RQ0A 2L9WA 2Y1IA 1TL4A 2ZJQQ 2APOA 1L3VA 3H2UB 5D8HB 1X4GA 3K89A 1NHKL 1NJWA 3MHYA 2GVDA 3OLAA 1YKWA 4DR5J 5HANA 5A6WA 5KFHA 4LR9A 3ZC4A 1X9MA 3CNQP 4PPZA 2CNKB 2GJFA 3D66A 1XNQJ 3AA8A 2V8GA 3CF5Q 4ED2A 4K4WA 1TL3A 1TVRB 4N5SA 1QLNA 2BRLA 1NAQA 4YDDB 4NL5A 4C0HA 4MT1A 2IM3A 2DXDA 2UXDF 2GJ2A 2F8MA 2H51B 3OV7A 2QLBB 3BGFA 4QIFA 1VJQA 3NS5A 1XC9A 1KOHA 3Q8VA 5LXYA 3OHAA 1W7WA 1SUQA 3CCTA 1VQMS 2D69A 3BEGB 5C25A 2OIHA 1UVIA 4KKOB 3MM7A 4CO0A 4JOUA 3Q2SC 4JI7F 4B3TJ 2VQEJ 2EFVA 3MFHA 4OYXA 4U7CA 2ZOFA 4J9SA 2GS8A 3R3TA 2K2PA 5D4OA 4LMZA 4ZCKA 5IM0B 1TL7B 5A8RB 3FJ2A 5CABA 1JLAB 1K9MT 4F36A 2UUBJ 3MCNA 2FVPA 2IYIA 4FNHA 1CJUB 4CZCA 2NXJA 1S49A 2KVIA 1WEYA 2PGCA 3CJ4A 3OUYB 2ZOGA 2CQGA 1XMOF 4DQIA 5GMDA 2U2FA 4BHQA 1IVZA 1KKHA 4LQ9A 3GG1A 4CNYA 4OHZA 3IXQA 3T1YJ 2QYCA 1I94F 2V50A 1CG2A 2HNYB 4DXLA 2GC8A 1WEXA 1RTZA 2MQNA 8ATCB 1X0FA 3MEKA 3LANA 4ZVQB 1QSLA 3OXGA 2QMWA 1Y7PA 3HFKA 3CT9A 4J5OA 2KDOA 1GX6A 5KG1A 1HD0A 2A1BA 3IG1B 3PEJA 3QZ8A 2ZHAA 2VIHA 3DRPB 1CJKB 1R8PA 3BO3A 4RWWA 3G9CA 3ENQA 3NBPA 1X9SA 3R9LA 4HLBA 3T1AA 4ANCA 9RUBA 3Q8SB 1PBUA 1RISA 2PE8A 3DU6A 4RU9A 5C24B 2BV3A 3ZXWA 4AFFA 1Y4ZB 3FMWA 1T8EA 4JV1A 2FJAB 4X4OA 3B4MA 3F0NA 3MUTP 3PDNA 3QFHA 3C6TA 3SDEA 3VVTA 4J9QA 4O3OA 1M5PC 3IGNA 2DHAA 4ZLPA 1N36J 3KHRA 3M8PB 2B8PA 3O44A 1VS3A 2EC0A 2MLZA 3K8VA 3L7UA 1VMBA 1R31A 2VA2A 1KQGB 1UFLA 2V4RA 2OEJA 2MEWA 4DL0C 4UOCA 3CCQS 4GKJF 3V6DA 1KVJA 1FJEB 3PRVA 4IOBA 4X4QA 3PVXA 4X62F 3LP2B 2CPJA 2MKHA 3C8YA 3HDSA 4S0MA 2DNNA 5IV3A 2C3MA 2MTLA 2NR0A 1CULB 4V1Ak 3HVAA 3HHLA 2CKWA 2MSSA 1RGVA 1HNIB 4F67A 5A8WB 2MKYA 3MURP 3IR6B 2ACMA 2WSFC 3G8TA 1F9EB 1ZAVA 1LWFB 3ADAC 3DHWC 3H90A 3I82A 4ZP8A 3CCES 1U4BA 3D3BJ 3ILOA 3K0JA 3NBPB 2OPSB 5IXUA 2KJVA 2RT3A 3IP0A 1R0CB 3N5FA 4C98A 1SC4B 4WKYA 3RR8A 2V94A 2DGQA 1BUXA 2NXUA 4RBUA 5K20B 3CCJS 2FVSA 2AJ0A 4FP9A 2UUCF 5HROB 1GFWB 1LWCA 1VRUA 2ASYA 3C66A 2ZNZA 2QMXA 3SDEB 4X65J 2QA4G 2IMOA 2JHEA 2XNQA 5L8RC 4FXVA 3T9NA 5K8PA 4DV5J 1WUUA 3H2VE 5C7PA 2BR0A 3LP1A 4RUAA 5EWFA 2FZGB 2JH3A 2JNJA 2XMMA 4O3QA 2E7XA 4DFJA 4PXBA 1WOSA 5F9NA 1YJ9S 3P8BB 3FSXA 3RTVA 2FLLA 3BGRB 3HHLC 5D0HA 1U1KA 2GJIA 5KFAA 2MZ1A 4TN2A 4YHHJ 2VJUA 2IMWP 1N36F 3IS9B 5AXMA 5RUBA 1KQFB 3QIPA 2Y1RI 3G6YA 3BQ2A 3KMQA 1YIJS 5F8LA 3CO0P 1HNZF 2BA9A 2Y9HA 4FXWA 1T05B 4JI0J 2UXBF 4QIVA 3UNYA 1R7IA 5KT7A 2AMCB 3ZZZA 4DV1F 2OPSA 5KFIA 2VPXB 2V4QA 4OJHA 3BQ0A 1IBMJ 4ED8A 1FEEA 3HKWA 1RT5A 2GV1A 3NS7B 4B9LA 3I32A 4PAAA 1UVLA 1FKOB 3OQ2A 3BREA 2RB7A 3O1LA 2F8HA 3OTOJ 4HACB 3EDRB 3IMQJ 3KFWX 3M2RB 2KJWA 2AGPA 4OX9J 2HBZB 1MWZA 1LK5A 4RL1A 3R97A 4X4PA 4BDPA 3H42A 4F04B 3PYDA 3G87A 4J91A 1D9DA 1U09A 4P9SA 1R27B 2LXUA 3JSRA 5DQIA 4FF4A 4I6WA 2UUAF 4ZHRB 3BGRA 2B9YA 5D0GA 1KONA 2QX0A 4DR7J 3DC2A 4NASA 5HI7A 4Y00A 2MHEA 1KR4A 1S6QB 5ETNA 2HWTA 3SQGA 4G1IA 2LU1A 2V4JA 2BJ7A 1RT7B 2BJEA 5H9FJ 4DG1A 2ZH2A 2M2BA 1G2EA 3DRRA 1FD8A 1HBOA 1LWXA 1OPIA 1U25A 2R42A 3IBFB 3L7OA 4OLPA 3NRBA 4QR0A 3MWBA 5F8MA 4JI5F 3E3XA 2PD1A 2YX4A 2EBGA 1ZA1B 1HNWF 1YQHA 3GCWP 2PN6A 1AW0A 1FRJA 4MFBA 1J2VA 1JXEA 1Q8IA 5KFJA 2LDYA 3NY0A 1B0VA 1FRKA 2J7KA 4HHHA 4UOFA 1E6YA 3TA1A 4ES3A 1N6QB 1HNZJ 4WZQA 3PZPA 2BUNA 4KH1B 4KTQA 2A0FB 1JLFA 2DGOA 2B56A 2J7UA 3FKBA 3BSOA 2RQMA 5HSPA 3M30B 3RW7A 4WFBQ 5D4NA 3HSJA 2OP5A 3CPWR 1UFKA 5ETMA 4DX6A 1R89A 5EN1A 3P3DA 1VBZA 2W4DA 5KOXA 1Q5YA 2X1GA 2V5HG 2WVBA 3D6HB 1BGXT 3GCXP 4QPTA 2OPRB 4DDFA 2IAJB 2CVEA 1LXJA 2AZ3A 1HMVB 2RQCA 4LF6J 2RF2A 4X66J 2J7WA 3ENWA 2GQCA 3I31A 2R8GA 1VYAA 4K4VA 1B4SA 1Y3JA 2K7KA 2FVCA 5DGBA 4EBCA 2X51A 3DRPA 4EWTA 3W60A 3KJVA 2CIMA 1KC8T 1N5YB 4LREA 3LOUA 2AW0A 4DF4A 5HJXA 4ECRA 2AX0A 2EVZA 1HKAA 1PC4A 1U2CA 2J8SA 3DLEA 4NEZA 1A9NB 3SIPB 3IO1A 4PKDB 3KK2B 5B0EA 1RA7A 4DOZA 2R4FA 5CXTA 4OX6A 2YPZA 1M5VC 1RHMB 5ITHA 2J5AA 4CH7A 1ZOTA 2DNOA 4IQMA 4ELVA 1SC1B 2IDEA 4H4OB 5HMZA 2OSRA 2YWWA 1BY9A 1WF2A 2W9BA 1ZM4A 3D6FB 2FB0A 3RUBL 3P4UB 4WYWA 5MLCV 2MHNA 2VODA 4F4WA 3VV2B 4FXDA 2HZCA 4Q5VA 2KFZA 4TKTA 3M2VB 4TLQA 2R8KA 1HQEB 4M5LA 4DSFA 3AJ2A 1RWOB 2HNZA 1M5OC 1GMWD 1OQ6A 2Q6BA 2QC3A 4R0JA 2DYAA 2I8EA 4P74A 5I42B 5C25B 1FHTA 1JLGB 3MM8A 2XNRA 2PEBA 4CH0S 3SI8A 5HROA 1IKVB 2AYBA 2OPPA 3UR3C 4KGVB 3AXKA 1QM9A 3CCWA 5B08A 4CDIA 4J9RA 1FESA 4WIIA 1RTHB 1HLWA 1I94J 1XMBA 2DGXA 1R0BG 3DRSA 2MKCA 4FKYA 2F8EX 2RKIA 2WVFA 1K44A 2GIQA 3H4DA 3IAM9 4UT4A 4F50A 4TYAA 1C4AA 1VJWA 1YRXA 3IGVA 2XO6A 2CJYB 3KLVA 4DFMA 5I3UA 5DLFA 2K1RA 1T02A 1R6YA 2HHHJ 1S76D 1RBOB 1FTRA 1AZSB 4CLTA 4J9LA 2CJQA 2XYHB 1F60B 2V69A 2RE1A 3VGVA 4ZDNA 2BJ1A 1MLAA 1X4EA 2JEIA 3CCUS 3JSMA 4DLEA 1X4DA 4KFBB 3PRBA 4FBUA 4ECQA 3ZTOA 3QYYA 2B5JB 3GJRB 4LFBJ 2PO4A 3D7SB 3JQMA 3V81B 1NJYA 1S77D 5CYQA 4C97A 2V2QA 3HZEA 2RHSB 4PG4A 2NSBA 3UD5A 3PR5B 2XI3A 3AOCA 1NK9A 2KFNA 5D3GA 3FVYA 4DPWA 5A8KB 4GKKF 3DRXA 3CJSA 1WG5A 3QGGA 4EUVA 2E1RA 3MTKA 4QIWD 5GVQA 2XY6A 1OO0B 4ZPDA 3MAHA 2GIRA 1TV6B 5AXLA 3LGMA 5ETTA 5J2NB 2DHXA 2F1FA 2FQQB 4X84A 3KLIA 3HHNB 4X62J 4IDKA 4DWIA 2IJRA 4ECSA 2AJQA 2YNHB 4L73A 4Q7AA 1P9YA 2F63A 2FY8A 3DRSB 3FZBA 1AROP 2BQRA 4LFCJ 4HT7A 4YEAA 4ED4A 5HJYA 4MKAA 4H4MA 2GHVC 2RU3A 4UW2A 4DV4J 3TAQA 1T03B 3W64A 2W1BA 4TU8A 1WOOA 4FKXA 3TR5A 5FLXU 2HMIB 4Q0BA 1GH8A 2ZUGA 4IG0A 1NSKL 2F65A 3N79A 4RPFA 2HHXA 5DZ7A 3BKUA 1FFGB 2HK2A 1A7GE 1P1TA 1RT7A 1S1XA 2A6MA 3B4DA 5D4LA 3OJUA 1RTDA 2CRLA 4ID5B 2R7VA 3GJQB 5IT9U 2B7BB 1PIEA 2LXFA 2VPWB 2ZD1B 3DGPB 5E7OB 3G82B 4EBDA 3M8SA 2H4WB 2AIRB 5KFYA 1RABB 1YVFA 4B17A 2M52A 3N4WA 1YHQS 3CDBA 3OD2A 1JLBA 3POTB 3C6UA 3NNHA 2RDJA 4J9NA 5L39A 1FK9B 3CB4A 3HMJG 4N56A 1UP1A 3JYTB 3ONQA 4EBEA 1E6YB 1HNVA 1PJ7A 3FNNA 3W62A 4NA1A 3IBCB 1RKJA 4DR7F 4NZ6A 3UO0A 1XR7A 4M1KA 1MW7A 2YVSA 4P6QA 4C11B 4DUYJ 5E3PA 4ALZA 4ZMMA 1K73T 3B54A 3QIDA 4GO5X 4G3IA 3HZGA 4J7CA 4X4UA 4Y2KA 2ZZTA 4A8XA 5AXKA 2MKSA 2FIUA 3O2IA 1F9FA 3EGNA 2HGMA 1YJRA 2XQCA 4NMXA 4M5NA 2KG1A 3FEZA 4ZVHA 2A3JA 5CZXA 3B6BA 2ZM6J 3Q8YA 4C8OA 2AF6A 3AA9A 4PPDA 2R8HA 4FYDA 1N0UA 1R8HA 2AJ1A 2HLTA 4NLVA 1KRPA 1C1BB 1UW9A 4F0HA 4HDHA 3J7AN 4PQUB 1NH7A 1WC5A 2NCKL 1FK9A 4QWCA 1WNEA 4A48A 3G4SS 3R8YA 2ZE2A 3LA0A 3W65A 1OY6A 5K14A 4NLSA 1P1LA 1VIXA 1ZM3A 1TK5A 1Q7YT 4JI8F 3QJLA 1VQKS 4JI3J 1TUWA 2XMKA 1HIYA 4Y3CA 1UVKA 2LU2A 3CJ2A 2NSCA 1RBLA 3NGUA 3W5ZA 4EYHB 1IKYB 2CAJA 1TL1B 2V9WA 3FRYA 2ROPA 3O6QA 3KLHA 4M8LA 1TKZB 1L3SA 5KFSA 4I6AA 1FE4A 1HYSB 1Q53A 1YJWS 1GAOA 3CCMS 1PJ5A 4HYKA 3FSIA 3H5UA 1HQUA 4IUFA 2UU9F 1HNWJ 3VAKA 3R2CJ 2CG8A 3OFGA 3HLUA 3I5CA 1RTJB 1S6QA 2Y1LB 4TY9A 3R7NB 2KHDA 2MPUA 2QL7B 2AKWB 5G4DA 4LF4J 4YFUA 2JLEA 4JI4F 4DJBA 2LCWA 4IRKA 4RR5A 3CD6S 3EGWB 5DRKA 2E5JA 2VFSA 3ZNJ1 4EO8A 2N82B 2KKHA 4L3KA 2XMAA 1RAJA 1N0VC 2QEXS 4IRDA 1F2GA 2NQPA 3N28A 3PX6A 2F3JA 3FGVA 5JVGQ 5LL6d 2CQ1A 4IR9A 1SQFA 1VQ5S 2HRTA 4WPAA 3RU0A 1UPPA 5HMYA 3CE8A 4HI1A 4M5IA 5KT2A 4GC7A 4B9MA 2HBRB 4CLWA 2SXLA 4I7FA 3ZTQA 4IOAQ 1KBRA 3K58A 4RNNA 1Q81T 3BDEA 3C16B 4J90A 1TKZA 1IKWB 1RJJA 1RT2B 2EW9A 2M8HA 2W2PP 3AHPA 3BV8A 1YWXA 3ILLA 4OYPA 1GK8A 3ETMA 4Q44A 1T9WA 4IH7A 1VQOS 1QAJA 3HX9A 1NPPA 1Q78A 4PZVA 3D28A 1ZYQA 4JI3F 3J81U 2WSEC 1Q5VA 1ZAWA 2MGZA 1TU0B 5A8KA 2UVVA 1DBDA 4GC6A 3HT0A 2VDIA 4AXJA 2VOOA 1Y00A 1T11A 3L4BC 4ECYA 3NKYA 1S6PA 2MQMA 5M2RA 4URQU 1IJFB 1WSVA 1FTCA 1FXDA 3RRKA 5DO2A 3N01A 4WFYA 4X4TA 1S72S 1SI9A 4MKBA 3QT7A 4TLRA 4USJC 4CCHA 2Q79A 2EI5A 1H6KX 3NLCA 4LFAF 3M6VA 5IQQA 1KTQA 3T5KA 4B3MJ 4CIOA 2XZTB 3MI7X 4IFYA 4CLYA 3ISNC 2DEJA 2R7XA 1VRTB 3THVA 3AD9C 4UTGA 1UJ5A 2R8JA 3QLHA 4I1TA 2N7CA 4YB7A 3OJSA 4WTOB 4WXWA 4DZDA 2JSXA 4P71A 3R6LB 5HATA 2HVEA 4A8OA 2E9TA 3RAXA 4X4NA 3WZ0A 2C2KB 3BZQA 3HCXA 2F40A 2V0NA 1FKAF 4MK9A 2MXYA 2ZC3A 2E5LJ 2H5EA 4DQPA 3IS9A 4P7VA 3EGVA 4YY3J 1FJCA 3BN7A 1H72C 3QT8A 3K57A 3LP0A 3MPYA 3I0RA 5L9XA 1SL0A 4ED6A 4A8QA 4XIUA 5E3RA 1RZMA 2DY1A 3T5JA 2XSJB 3IAS9 2ZFHA 4KBIA 4ZIVA 2DVIA 2EFOA 3MM8B 3RBEA 4RX6A 2HHHF 5E3CA 4KHPJ 2E1PA 3KG1A 1I1GA 2YKNB 5GAEU 2AQ4A 3RGIA 3MAAB 1MNEA 2Y8WA 3HI9A 2AJ4A 4N8NA 3AFGA 3MEDA 1NUEA 2ZBQA 3GR1A 2HHWA 4CNZA 4KY3A 4ZVTB 2IC3A 3AB2B 4LFBF 1PYOB 4QW9A 4Y2IA 1U1MA 2QE5A 1T94A 3CW2C 1FRXA 4E2FB 5KFDA 3T6BA 3MDFA 2B43A 4EO6A 2CQ2A 5HN0A 3ETOA 2J0SD 3PX4A 2DH9A 4DS5A 3KOAA 4CI0B 3JQJA 1NK6A 2DXFA 1S59A 1RT3B 4UQTA 1K0TA 2J0XA 2NZCA 3EMTA 4IKAA 5GMEA 2J6SA 2JFKA 1QE1A 2RDDA 1NKEA 4RUCA 3HVWA 5FLXY 1T95A 5B0DA 1FF2A 2KYXA 4CTAA 2FTRA 4DV2J 4GO7X 2MY7A 4YR0A 2VQEF 1UZHA 3OR2A 2XYPB 3JQKA 1R6VA 3GV8B 1WC0A 3DMJA 3TEGA 1S6UA 4WFZA 4F2RA 4LF7F 2BE9B 4XK8C 4YN3B 5D0EA 4ZN1A 3B78A 5LSLA 3CC7S 2G4BA 2E5LF 1S1VB 4HT5A 3KTQA 1TQLA 4LBHA 2YQ3A 3EYZA 3TJ9A 2GX8A 1U1OA 3ISND 5D4PA 2YNHA 2FJBB 4HDGA 4YQWA 3B82A 3UDLA 1ZPVA 7AT1B 2DNKA 5IM0A 1RAEB 1X5TA 3WIUA 1RE1B 1NPKA 3QNWB 4P73A 4C3LA 3D6MB 1CEZA 2DNPA 4ZJLA 1NJZA 2KN4A 3OBIA 6FDRA 4DR6J 3SCLE 2HNDA 3NAHA 1Z2ZA 4ZLJA 2IA6A 3FDSA 1T0TV 2ZWOA 3LP1B 2ZJRQ 5I3PA 2AEMA 1JLCB 1VBKA 2LYVA 4GVBA 2J0QD 4AUKA 2W9CB 4UY8T 2WOMA 3RB3A 2MZRA 2CUYA 4ZP7A 1NDCA 1VIOA 2DH8A 1P6TA 3LUYA 4WYLA 4FF1A 1BWEA 1DTQA 5EWGA 2HPUA 2X7IA 2FGOA 2XWXA 1DQ8A 2A2DA 4CT9A 2R7TA 3OTEA 3ZTSA 1ITPA 2J9DA 5KFWA 3H2LA 3VGUA 2V2VA 2PFFB 1TFYA 4H54A 1T05A 3UDCA 2B6AA 1RT5B 3PKYA 5DETA 1GT8A 4W98A 3D4JA 4QR2A 4ETZA 1U02A 4RW8A 2J6TA 3HD2A 3HD1A 3VZIA 3CCZA 2XMWA 1JJ2R 3I5AA 3QAEA 2BMBA 3CVKA 4RU2A 1VDHA 2L9DA 3GIJA 2D3OR 3M1VB 1Q1KA 1WC1A 5J2QB 2G9OA 2L3MA 4HTIA 2WVDA 4PXDA 3V4IA 4LF4F 4U8VA 2CPYA 5KFEA 3MM6A 1D9AA 4ES2A 4ED5A 4LF9J 1NLKL 2OPQB 4OHXA 3CJ0A 2MGZB 3T5LA 4NLUA 5AE3A 1FKPB 2I1RA 1IBCB 3BYPA 1JIHA 2HLUA 1V3ZA 3DCAA 5KT3A 1OIAA 4ZP9A 4A4JA 1SVDA 3A8JA 2ZJPQ 4KV8A 3PW0A 4WF9Q 1N5QA 4RO0A 1XTZA 2BEFA 5LJ3Y 1D8ZA 5GAHI 4PG8A 1RXOB 1N5VA 5GAGU 1JLGA 1KS2A 3CD0A 2IVFB 5KFFA 4Y2AA 3HULA 2HS0A 1HBOB 2H4YB 3T6JA 4CYUA 4DV6F 1JK9B 1ACMB 1SIWB 2F7VA 4MFBB 3SSSA 4MYUA 5F8GA 4AQYJ 1HWKA 4P2XA 1D1UA 3K5MA 1FD2A 3F56A 3QATA 1UA1A 5T7LB 4WFAQ 4TNOA 2UU9J 2CNNB 2FHJA 3R7BB 1OPZA 1SL1A 1R8AA 2AYGA 2VFVA 4L74A 1OYEA 1RHKB 4LRFA 5BXIA 4NXNJ 3GFYA 3CJKA 1MWYA 1B0TA 3GV7B 1N5SA 1HW8A 3R5AA 2HVHA 3TUJC 1U0HA 4B9SA 1NSAA 2HYIB 1B64A 3H20A 2KT2A 4LSLA 2E44A 1N34J 3LP2A 1H2TZ 4I2PB 2VV5A 1KVIA 2RS2A 2UXCF 1HMVA 4RNOA 3GSIA 2KT3A 3SCIE 4D3GA 4BCAA 3A12A 4J9UE 3GIMA 5HP1B 5HLFA 4H4KA 1S0NA 2CPDA 2OD4A 4JI6J 2GMHA 4NX9A 3HT3A 1E6VB 4DUZJ 1N32J 4B3OB 5THWA 2CQBA 4NEYA 3KJVB 2VJVA 2ZBRA 2KH9A 2HS3A 4NLDA 2BKNA 4KKOA 4HEA9 2Q3PA 2MLXA 1KD1T 3X1LB 5DZ6A 4ENOA 2C3UA 3MEGA 2DIUA 2QSWA 1URNA 2HQDA 3MZIA 2CNLB 2FZKB 2LP4A 2OAUA 5EDWA 4OJ1A 1DQAA 1FFWB 2HHTA 4RW7B 5DJBA 2FHMA 1M1HA 3FSYA 4N47A 3TO8A 1CJUA 3SV4A 1YJUA 1GMWA 2B9XA 3CD7A 2YWFA 4LVNP 1AT1B 2LQ8A 1DARA 4DPOA 5DG8A 3LALA 4DCJB 3VWSA 2H54B 3FBCA 1CJVB 2C2NA 3NEKA 4DX8H 3QFWA 5JXSA 3TA2A 3MR3A 2ATLA 5J1PA 4PXCA 2V34A 4U6PA 2R7OA 4FF2A 3KUGA 3ENAA 4LFAJ 5K8OA 2E5GA 3IG1A 4OI2A 2IBOA 3FRZA 2HVDA 2B7CB 3I0SB 3R5GA 2DR8A 2BDPA 1OWXA 3CMQA 2V6AA 4M5DA 1P27B 4W92B 4OYWA 3T3FA 2QA2A 4DX5A 3T1YF 3G6VA 1T9YA 2GO9A 2ZKTA 3CDAA 3SFGA 1O8BA 2VH7A 1HBNB 3LTOA 3KLEA 2RVJA 4B3RJ 5KFXA 2EPIA 3IWLA 3TAMA 1S9FA 3MEEA 2Q6CA 4O4RA 2DHGA 2OPPB 3UN3A 4C0BA 4KIAA 3S6EA 2EWHA 4NLTA 2N4CA 5J1NA 3SMZA 2LEAA 2JL9A 3G86A 1T9TA 3LAKA 1HPZB 3MPDA 3OFEA 2CVIA 3F41A 2ACYA 4MH8A 1HHSA 4M5JA 5IC4B 4EMDA 1HW9A 3EDQB 4DSLA 2Q66A 4QWBA 1SKWA 2XI2A 3GJTB 1VQ8S 1EAYC 4RW9B 5B7WA 5D6GA 5HL7Q 4R5PB 3FCVA 3GYGA 1S0OA 2JEGA 4LFCF 5CYQB 4NMLA 1RWVB 1PYTA 1Y5LB 4LF5F 2X3DA 3UWTA 3ET6A 4O4GA 4KFBA 1RWPB 5LJ5Y 3D54A 4OI6A 1XR6A 3SBMA 4AL6A 1QAYA 2ZKUA 4N41A 2B6AB 4F3MA 2CWXA 5HVFA 2DNZA 5EHHA 5IFMA 2XSJA 5GADU 2WRMA 2FY1A 4NLGA 3D1OA 2ALYB 1U6FA 1APSA 1IR1A 3EUNA 3WDOA 4ECXA 3KXDA 4IRCA 1JKHA 4OYAA 2QO3A 3GP9A 2OEKA 1VRQC 1WF0A 2QFIA 2YNGA 3GIRA 3KLIB 3MM5A 3PHTA 4PABA 1NPRA 4I64A 4O44A 3UVJB 4USMA 3EPIA 1U1RA 1U1PA 2XLKA 1IKYA 1FDBA 5ETLA 1WEZA 4K4YA 2VASA 1W2IA 1TL3B 1TVRA 1FVSA 2FHOB 3MR2A 2VKRA 1U45A 3TAPA 2RSQA 3PIPQ 1HARA 1RI7A 2IRXA 4IFVB 1WTBA 4CH1A 1X4BA 3UCZP 1NO8A 4X65F 3THTA 2QYGA 1SJRA 2ADBA 4WE1B 5H9EJ 3PV8A 1RHRB 1LXNA 1WHWA 3TVKA 1KP6A 2CPZA 3NOCA 3QRPA 1IN0A 4OIXA 2BJ3A 1S9GA 4WKRA 1WDTA 3DLKA 2WCXA 3W2WA 3WX8A 1SUQB 5GMKa 1FWLA 5C24A 3RRHA 4DR6F 3M6XA 1RT4A 4C0OC 1LW2A 1KLNA 5KOWA 1CJTB 3M9OB 3PW4A 2OMOA 1YSJA 3TEHB 4MJKA 1U48A 3D1QA 2HHVA 1RTHA 2HAFA 4F02A 3DU5A 3JTOA 3ZZPA 3M8QB 1C1CA 4QPXA 3MR7A 1N48A 2EFQA 3BBCA 1QSSA 1BMQB 1F5CA 4OZ1A 3FK4A 3MECA 1F3FA 1MU2A 1BE4A 5CZVA 2MQPA 4FYYB 1L5UA 1XEZA 2QLWA 2QV6A 4K5SA 2JFDA 5CYMA 4MIBA 4CLKA 1X9WA 3D0HE 3R6GB 1T9UA 4GMKA 2EK6A 3MR6A 3GFXA 3WIVA 1S6OA 4RBVA 2CQ4A 1TAUA 1DLOA 4B08A 4KQZA 1VISA 3NCRA 2B5JA 4K50A 3NWGA 2YWHA 5LXRA 4IG3A 1UTAA 5F8IA 2YTCA 4CLUA 3E51A 1C1BA 3H59A 3RYLA 2UUBF 1UVNA 4JYAF 2ZBIA 2MZTA 3DHXA 4PQUA 1UW4A 5KG0A 1RA6A 2GGPA 1CJKA 4LT6A 2R8IA 5EGYA 4RNMA 2DNMA 4PCQA 1IQTA 3KK1A 3FBBA 2I6WA 1VQLS 1BLUA 1CJTA 1G1XA 4PRFA 1SIZA 3NP5A 3NGRA 1XIQA 2FHJD 3LF0A 1S1WB 2I5JA 1G3OA 4KYZA 3IA0A 3CO9A 3M8QA 4CRJA 3VAHA 3M8ZA 2AGQA 1FE0A 1RAIB 2ZHBA 2PSZA 1C0TB 5F3TA 2DRDA 2CJBA 4RKUC 1S0MA 2CQIA 2DKOB 1U47A 3IR7B 3NCQA 2WW4A 1O5JA 5KFBA 2Q43A 4TVAB 4DUZF 2F9DA 2PFDA 4U8YA 5E3QA 1N88A 1CS4B 2MKJA 3K59A 3MOZA 3EE3A 4ATNA 4ICLA 2RUSA 3KJFB 2EG2A 5ETOA 2NZ4A 1NKBA 1T9VA 2DNLA 1DLOB 3CDUA 3PM9A 4OZ3A 4NZ7A 3K2YA 4ZCIA 3NAIA 1HWUA 1WWHA 5L1IA 4DSKA 3PO4A 4FYVB 3QWUA 3TI0A 2DH7A 5H9EK 5GAEI 3A8IA 2VZ9A 3OTCA 4N77A 1XMQJ 4OI3A 5LM7E 1EIYB 1VRUB 2W01A 3DOKA 5ETKA 4ECTA 3BGLA 2HWHA 1F5BA 2DHSA 2Z8QA 3OR1A 5AJ3J 4HACA 4NYPA 4WFXA 1NSQA 1HBUA 4CYUB 4ZPAA 2VQFF 4A8SA 3R1HA 3RR7A 4DR2J 4UY85 2CQDA 1TFWA 4X4RA 4WBFA 5HVGA 5C42B 4ECVA 3SYZA 3BH7B 4K2JA 4DL5A 3EJMA 2M70A 1Q8LA 2VFRA 1HBMB 2XULA 2N3LA 5E2QA 4Y6IA 4ID8A 3VAFA 3L95X 1LFPA 1VQYA 4ID5A 3LPYA 4Q8EA 3D3CJ 2BE2A 1VLOA 2B4PA 1S6PB 4KGKA 4P2SA 3CD5A 4MAKA 4QZVB 2YPYA 3CGIA 3MMCA 2QN6B 2HFSA 2Z2MA 1FRLA 2C3YA 1FWPA 3ILIA 1VC0A 4B3SJ 2G1DA 4HVZA 4NCBA 4O0IA 1C0UB 4NWBA 2D3UA 4YR2A 3H4BA 3W5YA 1NHVA 4LR8A 1VK3A 3MM5B 2VBXA 4WIQA 3UVJA 3E01B 3EVOA 3M32A 4OI1A 3CSKA 5DDRC 5KFLA 1FVQA 2E5IA 3PX0A 2HFVA 2PT0A 2AZ1A 2XMUA 4ED3A 5G0RA 1FDDA 1VQ4S 3SEOA 1JX4A 3P49B 4TU7A 4KE5A 1U2FA 2HKEA 3GYXB 5EX0A 1ZS6A 3GZ7A 3H5SA 4YOEA 2RHQB 2H65B 3QSIA 4DV0J 4RZRA 1UFWA 1EKRA 2R9LA 3IRWP 5LSOA 5AJ3F 2VQFJ 4QYRA 1ZTTA 2KL8A 2HIQA 2MJUA 3NNAA 4LF2A 2CADA 4DG1B 5CYJA 3AQOA 4RUHA 2UUCJ 2I38A 2QLXA 2EXUA 1NEEA 3TP2A 1QDUB 4FS2A 1ICEB 1GMUA 2FJXA 1K1SA 2M0GB 1EJ7L 5KFNA 5D3GB 1QVGR 3K5LA 1N54B 4QJVA 3W9IA 2YKAA 1RWKB 3EVWA 3DLJA 3PYEA 4M5DB 3KLGB 2OJ3A 2N7YA 4LBIA 1W26A 2IPOB 2G0JA 3EM1A 3I87A 3D2WA 3DLLQ 1OSDA 2POKA 4Y0FA 3CCRS 2KM8C 3H7HB 2EK1A 4UUWA 1JB0C 1YITS 1SJFA 4YHHF 1Q0NA 3MAAA 4U7UK 5CYMB 1JXVA 3D1HA 2GA7A 2BJ9A 2PA8D 3DNCA 5G0RB 3AJDA 3M2UA 1OYDA 5A2QY 4DV7J 3SXLA 3NL0A 3I96A 3MD3A 4X4SA 1HYSA 1ZETA 4DV1J 2OKQA 2WTFA 2YKQA 3VAIA 1B70B 3TA0A 1UA0A 3ZNUA 2FZCB 2E9ZA 1FERA 3I9V9 4DR3J 2E29A 3NGTA 2XM3A 2VG7A 3L3CA 4F2SA 2P6TA 5DDPC 2CPEA 1RP5A 3MMJA 3QJPA 5GAHU 4OX9F 1M1GA 2IA0A 2B4OA 3ICLA 4PR6A 5LT5A 2NUHA 2RRBA 5IV4A 2HHSA 4ZJOA 2KHCA 1WHXA 2P9GA 2YQ0A 1YK9A 2BW2A 3OT9A 3BSNA 1BQMB 2DNRA 3G6ES 4OI0A 2JWNA 3DM2B 1J5EJ 3HPOA 3WC2A 5CD4H 2YX1A 2BXJA 5A8RA 2ZH4A 3QBCA 1Z2LA 2BANB 3A4TA 4KO0B 2KXNB 2FJEB 1G6BA 2FYXA 3TVYA 2JZ5A 3V6KA 4OX7A 3SV3A 3MUVP 2D9PA 4CLFA 3FEXB 1Q79A 3CCVS 3THPA 2EKNA 4M5GA 1A0OB 3HJFA 1FNMA 2JDJA 2KYZA 3FCWA 1VK8A 4JYAJ 4TY8B 4OZ0A 1DTQB 2IM2A 4U95A 5HQLA 4DR1J 4K59A 3NWRA 5ETSA 1PJ6A 2AT1B 4LUBA 4U9RA 3CWJA 1V5VA 4RW4A 1J27A 3MF5A 3VVUA 3PCOB 3BO2A 1H2VZ 1Q16B 3JTPA 3GMGA 4WK1A 5KFTA 1FA0A 5F9LA 2HQGA 1M5HA 1PC5A 2OLWA 1RHUB 3LP0B 4L3NA 5GADI 1HQEA 5H9FK 2WBRA 2YBVA 4DN9A 2HAIA 5DLGA 2XMVA 1KHWA 3ZZOA 2ZITA 1GXUA 3BM7A 4NA3A 2AX1A 3ZZ0A 4E8UA 4EFAC 4YUDA 5IWAJ 4XDDA 2ZH7A 3RZAA 3JB9k 2GVDB 3DM2A 3HVTB 2F9JA 4C6AA 1XQIA 1V5IB 4H4MB 5CAAA 3CDWA 4BLGA 1FI4A 3M9MB 3RB0A 1RT1B 3DDNA 1ZZNA 1QAXA 2QGFB 2WB1D 3W61A 5CH7B 2VBWA 1RU2A 3WBZA 2PMWA 2MKKA 2MY8A 4P10A 4IG0B 2LEPA 5FD1A 5M2PA 3KMSA 5I3UB 2QJ3A 5KG6A 2E1MC 4JV5J 3T19A 2EFGA 4EI2A 3CC4S 3QO9A 2QA1A 2HGLA 4ZN3A 4B9NA 1HBMA 2XZDB 5KT4A 3HHLB 3MCMA 3MTJA 3F73A 1SL2A 2L08A 2KU7A 1S79A 1DRZA 1HQ2A 4RUBA 2R2TA 5HMXA 3DXSX 4UOHA 4E0DA 4IG3B 2HW3A 4ZOSA 2V8VA 3POTA 1NK4A 1H73A 2BJDA 1VQ7S 3EGZA 3BF4A 3J7Z5 3BKFA 1TKXA 1RTIB 3W2VB 2ZVIA 1CBKA 1HNVB 1N33J 4PWDA 1REVB 2GVZB 5HQMA 4DR4F 1C0UA 2FDNA 2PI5A 4PG6A 5L1JA 2MZSA 2W7AA 2HGNA 2RNEA 4IDKB 1OJ4A 3E01A 1SQEA 3M32B 2K7JA 4WP3A 3HO1A 3TARA 3DLBA 1B99A 1TL7A 2CNOB 4CO4A 2QLFB 3AOBA 5D77A 4ES1A 3J80U 4MYTA 1WHVA 1KSPA 2HBQB 4KHMA 4J37A 3PHEA 2HS4A 3ZZUA 5CD4A 1WKLA 2DPIA 4ILLA 1T03A 4LRCA 1S1XB 1N56A 4R8UA 5KFQA 1NK7A 5IWAF 3G71S 2UVUA 3PG9A 3OSPA 4ECUA 3EXCX 4JI2F 3U1MA 1WHYA 1UPMB 2EEYA 2VC1A 3TNVA 4LSNA 2PI4A 3V6JA 2EKYA 1YX2A 4QWAA 4ZCMA 2JLGA 4EEYA 4F4YA 4ERDA 5A76A 1FXRA 1EP4A 2XWYA 2ZVSA 3PJXA 4PYDA 2G0CA 3OPKA 1U6ZA 4ZVEA 4DU7A 2RIJA 2XY5A 4B3OA 3CULA 1IKVA 3D9BA 1WD6A 2Y1JA 1Y0HA 4JV5F 1CQMA 1EETB 4LSZB 4QBUA 2JVOA 1C2PA 1QVFR 2KM8B 2Y0BB 3T9ZA 2WBMA 2ZH9A 2XCAA 1VQNS 1KEKA 1HBUB 2UV8G 4OLOA 4F3QA 5KFOA 4LRBA 3VAJA 2IYGA 2I2YA 5KG3A 4JI4J 5FJ4A 2VG5B 4QW8A 2U1AA 2E9RX 4V19X 1S7HA 1V3RA 1HL6A 3WX4A 3J7YI 3FCHA 3G8SA 4UUXA 3CIMA 3ZFVA 3KK3A 2DRAA 3VGSA 2NXCA 3B8HA 2LECA 5M2UA 5KFZA 2L41A 2KRRA 1U2RA 1M5KC 2VBZA 4A8FA 4B3MF 3CJ8A 1FX2A 4WE1A 1S57A 2B3TB 1IBKJ 3DOMA 2AHOB 2KXHA 3I4PA 3NNCA 1RKIA 3VZHA 1ELOA 3IN5A 2VG6A 2C2DA 4Y2CA 4USHA 4USVA 1GQEA 3NXZA 1MN9A 1NBEB 2WB4A 5A8WA 3CUNA 3DLKB 4X4VA 1EP4B 2ZDPA 3TX0A 2GMLA 3BBFA 3TAMB 4DUYF 1TV6A 3EZOA 3KKFA 2Z30B 4J9MA 2AP6A 3AB4B 4TU9A 2Z2YB 5KFVA 2OEMA 4WXOA 4CT8A 4FBTA 1LEOA 2C3OA 4XTTA 1KFSA 1FXLA 4JB8B 3MXHP 1JLFB 2KB2A 1AYEA 2BANA 2OHDA 3M1VA 4O3RA 4FF3A 2QSFA 3JSYA 5EUHA 4WCEQ 2UVRA 5K5MA 1KQKA 4RW9A 1M5SA 1U0HB 3ZO7A 4F7VA 3UQSA 4B9UA 4IQXA 2M7SA 1U49A 2OPQA 1KLMB 1RT6A 3J7YU 1WC6A 3Q22A 3ET6B 3NGDA 1HWJA 2WK4A 2YKPA 3HHDA 1SH2A 2XMTA 1FDAA 1HQUB 5L46A 4R5PA 5ETRA 2HFZA 3DKDA 3JSBA 2ZC4A 2QIFA 3G82A 4KC5A 4BWMA 2BOPA 3CC2S 4PUOB 4Q8FA 1RAHB 3QGIA 1R43A 2YKMA 1U7LA 3A13A 2LQJA 3RBZA 4RNHA 1HA1A 2Y3YA 1W2BR 4NCGB 2WVEA 2DISA 2M9KA 5BYSA 4C4WA 1QUPA 3QSYB 3OSNA 4K0KF 1SPBP 2D7SA 1U6BA 1PYSB 4XPEA 1DJ0A 2V2KA 2FGCA 3M8PA 2WVCA 4RW7A 1RT2A 2HRYA 2LEBA 2VBYA 2UUWA 1YGYA 2IM0A 1Z1ZA 1PGZA 4ZJQA 1KN6A 3V6DB 1NDLA 4ED1A 2CQ0A 5F8JA 3UCGA 5IS2A 2KZZA 2LLZA 3DGVA 2W9BB 4OHWA 1QTMA 1RAOA 1YZ7A 4I2PA 1LV5A 4E98A 3RG6A 3SQGB 3H8YA 3OFFA 2HQCA 3I56S 1TP7A 3LAMA 4AL7A 4CM0A 2FLPA 4QU7A 2IVMA 2GHPA 2ZDOA 3QMQA 3Q8RB 4DN0A 3KUEA 2OI2A 2QMUB 5D15A 2YWGA 5J2MA 1IUJA 1AA1B 1S1UA 2P2CB 4L76A 4UOGA 2V2ZA 4ZCLA 1PKUA 1VCTA 4M94A 4ILRA 2XSFA 2J8AA 3OL6A 3IM8A 3A3NB 4EGLA 9ATCB 1RTIA 3N6MA 1V6HA 4QR1A 4C8MA 1LW2B 1WORA 2JC1A 2P5VA 3K5NA 3ILJA 3V4MA 3MECB 1K47A 1FCAA 3EX7B 1R0AA 5F0WA 2ZHOA 1NB7A 2V8HA 1RAGB 4CWBA 5EWEA 3DLHA 4PEOA 2VONA 3BPDA 2R3VA 3FEYB 4CO1A 4R8UB 3SQOP 3UR0A 2XZWA 4KT0C 2AGOA 4QCLA 2BKOA 5JJBA 1FT8A 2CQPA 3OFHA 2V67A 1RT3A 2OFGX 3N5BA 3R5BA 4OHVA 1H2UX 5AT1B 2GIFA 4YDXA 4A8MP 2LA6A 3DDIA 3UCUP 1IKXA 2DY9A 2DGUA 1L3KA 2RF2B 2ASJA 2CZ4A 4I69A 3C14B 3BO4A 2MSTA 3HFVA 4NLYA 4HL9A 3UDEA 2J9DE 4DV3F 2GCFA 1DZ5A 3R5CA 1X4HA 2CXEA 4H4KC 3GILA 2X3GA 3SZ2A 2VD3A 5BJRA 3TUPA 4OZJA 3DN9A 3I0RB 5BYRA 5K8MA 5KAKA 3CJ3A 1L3TA 1OY8A 3GG0A 3M05A 2VL1A 4K5RA 1H98A 5B0FA 2FJVA 3W9HA 4DL7A 4WJBA 3QWPA 2UXDJ 1RWUA 2CPHA 3UW1A 1R8BA 1IM4A 3DI6B 1S4EA 1VQSA 2HZVA 2YXLA 1U26A 1VR6A 4RWXA 3KDOA 1TMJA 3GWCA 2DR7A 1RADB 2YWKA 2W2NP 1J5OA 2ZZMA 2VU5A 3T1HJ 4LIWA 1DURA 3OL9A 2BM0A 1NDPA 2DJWA 1GTEA 2MMYA 2OD6A 4B3TF 3X3UA 2BJ8A 2WOMB 2XY7A 1RCXB 1Q7LB 1I5OB 2ABYA 5IZHA 3MD1A 2WZ1A 4XAKA 3KK3B 1X5OA 1I6JA 5FDLA 4WFNQ 1CS4A 2NYIA 4CLZA 2F4VF 3HFZB 4ECWA 2Z2ZA 3A3OB 3P96A 1ZA2B 1YBTA 2LA4A 3DYAB 3IRXB 1QUVA 2GNKA 2LQBA 3AOAA 1A6LA 4NYZA 4Y34A 4HHJA 5DQHA 3GIIA 1S7IA 1VFJA 3TUIC 1UEUA 2XEXA 2VHGA 2FVRA 2CZVC 3TQEA 3RW6A 2LFVA 3A1YG 4EYIB 1RYRA 1S0VA 2PMZD 2CPXA 2HFNA 3FQKA 4DFPA 3C3LA 2OTJS 2VA3A 1S97A 1LKZA 2FVQA 2UXCJ 4L6V3 5CQGA 1REVA 2GVZA 3R7SB 2D9OA 2CG4A 5J2PB 2AD9A 2XB2D 3RBXA 1UJ4A 2FC9A 3QRRA 3CCSS 2FLOA 4ZLNA 2QLJB 3NMAA 4B3SF 2DPJA 1NJIT 4NLOA 4LF1A 1VBYA 3PO5A 1NCLA 2RKIB 2ZH3A 4ED7A 2BACA 2E66A 4GVBB 4DV2F 2DNQA 1TK8A 5KG4A 4LF8F 1HI8A 2FC8A 4URGA 2G2YA 5DDOC 1O51A 3LWLA 4ELUA 1XNRF 1S12A 3Q83A 3A8EA 4OQJA 2FHKA 2Z4PA 3GE9A 1K8AT 2MQOA 1RDRA 2W4CA 2E1AA 1WTFA 2QZ8A 2VUGA 2FLNA 3HSZA 2OPRA 3R5JB 7FD1A 1VC5A 3I9ZA 1XR5A 2KG0A 1RSCA 3K7RA 2BE2B 1ZH5A 2HQFA 1W25A 4O23A 3Q0AA 4NXMF 3P45B 1FX4A 2YKMB 3MMCB 3ELHA 1SJ4P 4RLEA 2HQIA 1IQZA 2RD5C 4B9TA 2F4VJ 4I67A 3AXMA 4USWA 4WZMA 1YZ6A 5AE2A 4NCGA 4Z7CA 1SV5B 1GX5A 2CQHA 4TQRA 1FJ7A 4RW6B 2A10A 1CPZA 2IDLA 2HZAA 1NKCA 2X1FA 4AE5A 2C2EA 2PC6A 3ENVA 4X2BA 2IRYA 3D0GE 1C0TA 1MMDA 2J9CA 4HH1A 4QIEA 3GTYX 3KDNA 3DDKA 2J9EA 3TJ8A 3KUHA 2O3DA 3SCKE 3KHHA 3G6XA 4F0KA 1TMMA 1NH8A 2V63A 5JUMA 1IM6A 2B9WA 4KV8B 3ITHA 4DUTA 1G7CB 4DV5F 2MZJA 3W5XA 4DV7F 3TANA 4FPRA 1NU4A 1NK0A 1T3OA 1I51B 2YNIA 3MPUB 4I6YA 4NYOA 3AH6A 3DMJB 3W1YC 4DR5F 3HJVA 4G1QA 3MEGB 5KFUA 1H3DA 2E7VA 2HFUA 1Q8KA 3BGUA 5HBMB 2BBEA 4RNFA 2R2UA 1R0AB 2AV5A 1X4AA 2YX7A 1NK8A 1RWWB 3PFOA 4OJGA 3T41A 4ZITA 2OTLS 5BYQA 1X4FA 2N4DA 1QJHA 2RQKA 3NCPA 3QGHA 4JI0F 2DCUB 3HM9A 3KG0A 3M7VA 5SUHA 5F8NA 4U96A 1MG7A 1P9QC 4OYIA 2W25A 4ZLLA 2V9KA 1Q95G 1YLXA 2ROEA 4FN5A 1WC3A 4I2QA 1IBLF 2ZH1A 4KR0B 1JLCA 4WU2A 1KLMA 2EC2A 3M8RA 4LSLB 3TZYA 4XO0A 4JI7J 1YJ7A 4AYBD 1KVKA 1IJEB 4TXSA 3OTOF 4OV1A 1U1LA 2HNYA 1LWFA 5HP1A 5HLFB 2OGUA 3C14A 3C2PA 3A3PB 3H98A 1UMJA 2MKIA 3TRGA 3DOLB 1QAIA 1HHQA 2NXNA 2YNIB 1KNZA 2WAQD 2OH2A 1TK0A 1VHFA 3EWGA 1XNQF 3NGSA 3VTIA 1XMOJ 1WF1A 4PWDB 3UDVA 3EXYA 2OSQA 4RW8B 4OYZA 2H5JB 1NMEB 2V68A 3FBEA 2Y0SD 3FMBA 2D3O1 5KG7A 5L1KA 3QT6A 1N6QA 3DI6A 4OZ2A 2DR9A 4F26A 5CCLA 4X64J 3Q8UA 3AY0A 3OW2R 1WG1A 2C22A 4KHRA 2GAGC 2GQ2A 2FPHX 1EARA 3CTRA 1F0XA 3FUYA 3M30A 4A46A 4M5KA 4PXEA 2FUG9 2JX2A 3H40A 5DDQC 1S9EA 2RUGA 2AJFE 5AE1A 2H3EB 1UEKA 3W7BA 5E3AA 2VOPA 1UAWA 2XTJP 3HHEA 3IWNC 3S8SA 4ZVRB 4XDCA 4BC9A 1ZPWX 3MM9A 4NOHA 2NXEA 3VCDA 5K8NA 1CULA 2VICA 4YP3A 1DTTA 2G2OA 4C2MA 3DYAA 3JS9A 4V19J 4I0WA 1JLEB 1X31C 1M1KT 1X60A 2UUAJ 3MM7B 4K8RA 2A18A 1QSYA 2A6OA 4K2XA 2Y8YA 1EETA 4F4KA 5B0BA 4CLLA 5KG5A 4Q2LA 4HHUA 4Q0BB 5T7LA 3M2RA 4ITSA 2VB6A 3FQLA 2CQCA 4I56A 3TYTA 3HXMA 4ZVSB 1C4CA 2DHHA 4BBYA 2X1BA 3BN4A 1IKWA 2PEHA 1ROFA 1ZAXA 1N33F 3C15B 3Q89A 4CO2A 1XN9A 3O3LA 2QT7A 5HK4A 4I7FB 5LMNJ 5ETPA 4P2FA 3BYRA 2JVRA 8RUCA 3O8WA 4USIA 3NG8A 3S1TA 5B0AA 3WHIA 2FJWA 3E2EA 1D8YA 1HFEL 2CDRB 3OHBA 2KO1A 3W8PA 2UP1A 1HWIA 3QO9B 4PG7A 1MROA 2BOAA 2C2ZB 5FIIA 2GHWA 4PWUA 3U27A 1D3WA 1JNRB 1F6TA 3K5OA 4DLGA 2AWZA 2BM1A 4O4GB 3AAWB 3TX8A 2BKPA 3W2WB 4O0NA 3KLFA 3GV5B 8AT1B 4P72A 2V4JB 3QGPA 1SKUB 3G96A 3Q86A 5I42A 2CDQA 3R2DJ 2BE7D 1WELA 2R2RA 3GJSB 3UN2A 4JI2J 1TKDA 1S1VA 4DCPB 2DBBA 4DZ6A 1XK8A 4LF6F 1YDLA 4KRWA 2D41A 1S99A 1TKXB 2UZAA 4IFYB 4O44B 3W2VA 4X66F 4YB1P 3HP6A 4OHYA 4JV2A 3K17A 1FFSB 1HNXF 3Q2TC 1MSWD 1REGX 3ZZRA 3BS9A 3K8WA 3KG4A 2YWEA 3DLGA 5C42A 5HO4A 3CMAS 3H5XA 2ASLA 3GU0A 1XMQF 1Y10A 2XLIA 1OY9A 5C2GA 2UXBJ 3UN5A 3EPGA 1NK5A 3QLHB 4BC7A 3WC0A 2M3DA 3PJ9A 3OVSA 2W2OP 4Z2XA 4DL2A 1EQ0A 4JP8A 1JLQB 1L3UA 4C48A 1JJ4A 3G8QA 4LSNB 4OZLA 4TY8A 4ZPBA 5BR8F 2XC9A 2CJAA 2O5DA 4EU0A 5DG9A 4DFKA 3M6WA 2C3PA 1UCNA 3BDPA 3L9ZA 1HNIA 1SBRA 1I3OB 2ERRA 3KNAA 2RILA 4PUOA 3IWXA 1SQGA 4OX8A 5LSRA 4K4ZA 2GGPB 2HFOA 1F2HA 5C5JA 2XCPA 3MOJB 2E1CA 3V6HA 1ZM9A 3QAUA 3U7JA 5HBMA 1Y5NB 4KPCA 1S9GB 4IYQA 2NUUG 3FZ2A 4K7QA 4Q45A 2UUTA 4P52A 4Q2MA 2CZ9A 2DXEA 1NHUA 2NPIA 2PMHA 2ZEJA 5J2NA 1SH3A 4TYBA 3CDEA 1UETA 4NPOA 3JAMU 4UQGA 3LWMA 4J9KA 4KB7A 1N4LA 4HKQA 3DLGB 4BS2A 3UFCX 4QU6A 2D74B 3H25A 4NI2A 5CCMA 4H4OA 2G0IA 2K3KA 3BR9A 3MCOA 2J76E 4MIAA 3V4IB 3C16A 1MU2B 1YBUA 2LDIA 3IM9A 4GVLA 1WKJA 1BQNA 4CO5A 2HMIA 4ELTA 2UVWA 3OVBA 2XLJA 1FJGF 3BJYA 2E5HA 4DBQA 1QE1B 3JAMY 2OO4A 4DR2F 1WJ9A 2W4PA 1HNXJ 4DI6A 3OXLA 2XHWA 1Y9OA 3D5MA 4FVCA 2LVWA 3NOGA 2DGWA 4DV4F 4EZ6A 2HSEB 4NZ0A 2HBYB 2YKOA 3DRYA 3UE2A 5J2MB 2XS2A 2KTQA 2K06A 3KK1B 1H7WA 3LGNA 5B09A 4U67Q 4DV0F 4NE9C 3BQ1A 1CC7A 5A0YB 2F4FA 2IM1A 3OR1B 2ZH5A 1UWBA 3GYNA 2VKZG 5BR8J 2CYYA 2ZH6A 2LMIA 2VFUA 1IBLJ 4ZVFA 1K1QA 2YY3A 3UPFA 2QA4S 1H7XA 3FFIA 2DNYA 3JTNA 1FKOA 4F3OA 3PFEA 2HK3A 2NLWA 1D09B 3D0IE 1PO6A 2LKZA 1U8WA 3D6TB 3HK2A 2QTWA 5LMUF 2DR6A 5KFRA 4KGZB 4DQRA 1GTHA 4O3PA 3KNGA 1SJ1A 1MN7A 2O66A 1LFWA 3KJQB 3RAMA 2GAHC 5E41A 2K1RB 3EVMA 4MKVA 4JI5J 4K0KJ 1JMTA 3MM9B 1AZSA 2RS8A 1YRTA 5J1EB 3V81A 3TWZA 2ZZNA 2B8QA 2MJNA 1ZM2A 2HQ3A 1Q82T 2PDAA 2WONB 3N6LA 1JLEA 1LOUA 4DPUA 3LW5C 5D0RA 5F41A 5T41A 2IFXA 4AD6A 2AJ2A 1Y5IB 4JBCA 1B0PA 2BQUA 5CHCB 1FEHA 2ZNYA 3N0VA 4B02A 3VGTA 1WKKA 4NLRA 2E7WA 4J9PA 4AL5A 1MWQA 1Q8BA 2KT5A 4FS1A 1BC6A 2ZBPA 1RT4B 3BPSP 2RH3A 4FYWB 4ER8A 3R5DA 2YKNA 4UF4A 4ZA1A 1WI6A 3PEHA 1ZTWA 2YQ1A 1KDNA 3FFIB 3U02A 1FRIA 1WG4A 1EZZB 1IWAA 2W24A 3MEDB 4G1PA 4WP8A 5E33A 2DO0A 2J6UA 2VG5A 1P8GA 2RRAA 3N6NA 4ED0A 1SC6A 4C8YA 1TKTA 1DFDA 4B9VA 2MQLA 4ZPCA 4R0EA 2W2MP 5J2QA 2DNHA 1T3NA 1KHVA 4MK8A 4Y2MA 5MAOA 1MROB 1OS5A 3BH6B 4J9VA 2P9EA 2QL5B 1QTNB 2HEKA 1DQ9A 1SB6A 2ZD1A 1B7FA 1RACB 1RTJA 1QY7A 4N8OA 1RB0A 2J0WA 5HMWA 5K9FA 5LMUJ 2CPIA 4P2MA 1IR2A 3PXGa 5E0OA 2B9EA 3R1LA 1WI8A 2CJ9A 3MUMP 3ZTRA 2GO8A 1MMLA 2M5YA 4WK3A 4PYAA 4IR1A 4DR1F 3AD8C 4C7QA 5J2PA 4DV3J 5HVHA 2DR5A 4N76A 2KXFA 2G1HA 1S1TB 5LMNF 2MLYA 2I5JB 2K8GA 3IR5B 2ZM6F 3JYTA 5F3ZA 3CJKB 4C11A 2P6SA 5C2CA 3M8WA 1R3NA 1RT1A 3UI3A 1HR0J 4CM2A 1RBAA 1X0PA 3VAGA 2C2RA 2HNDB 2QG9B 3W8GA 5HAOA 3OUYA 4LQ3A 4GKKJ 1TUGB 1F5AA 1VC6A 1NB2A 4ZHRA 1D0EA 4ICLB 2RMLA 1BD6A 3PY8A 4JI1F 2V8DA 1EX8A 2VPZB 5I3QA 4R25A 3GQCA 3T1HF 1OSCA 1AB8A 1IKXB 1SCJB 3LO3A 2VG6B 4N7TA 4NLPA 4YS2A 3KWMA 2CJXB 1GNKA 2AYMA 1Z4UA 2ZWPA 3DGPA 3N9UC 1TUVA 4OFZA 2HVIA 2NREA 1HI1A 3D67A 2AEJA 1UKUA 3GPAA 4OYBA 5KFPA 1JWWA 4K4TA 2NYHA 3DOKB 1VLYA 2DTJA 1TELA 3C6UB 5GAGI 3M8YA 4KO0A 2Z57B 3VR1A 2CPFA 4M95A 1XBWA 1B7YB 3MMBA 3P5TL 3M9NB 2PIIA 2ZE2B 4HTJA 3U1NA 4FDFA 3VAMA 2MZQA 4LRAA 1UVJA 1KQSR 2HURA 2OUGA 3TW0A 4KPYA 1CJVA 2BZ2A 1RWXB 5IQ6A 3H5YA 1Y3KA 2CJKA 1LNQA 4O3SA 3GLJA 3HKZD 4C8LA 1CVJA 2CWKA 1NNDA 1RT6B 1H74A 1YTYA 1RLDA 3JSMB 2VG7B 2M4MA 1SJQA 3SCJE 3ZTPA 2IHR1 4CP5A 2W8KA 2JC0A 4USUA 2N3OA 3OVAA 3U1LA 5SZTA 4DQQA 2AU0A 4LF8J 1HR0F 3KLFB 4F4XA 1KWMA 2ILZA 1XNRJ 3OL8A 1UJ6A 1S10A 4ZPWR 4LIRA 3L09A 4Q43A 3MEEB 3KYLA 1GMVA 1N5YA 1YJVA 2DEIA 3PJWA 4MK7A 1EKSA 4OZNA 5A0YA 4IH6A 1F1BB 4F4AA 5IT0A 4YY3F 2W9AA 4ANDA 1RUSA 4Z37A 2VC0A 3MMBB 5E5NA 5JMNA 3DLEB 4IOCQ 1N8RT 2DIVA 2AEFA 1FJGJ 5KG2A 2DCLA 4A47A 2C1EB 1X5PA 5A2QU 3PACA 3OLBA 5ETQA 2R7WA 1OQ3A 3CIZA 1GXLA 1RCOB 5CA5A 3P6YC 4K4XA 1U1QA 2CQ3A 1VQ9S 4DR4J 4ZK7M 5H1SV 3J7ZT 2DGVA 5DM6Q 1RHJB 5IT4A 1U0SA 4DCOB 1SC3B 2MB0B 3QIPB 3I6PA 1FNXH 3QPIA 2BRKA 1IXKA 1AUDA 2IAJA 2KRBA 2G2ZA 5DG7A 1MMNA 2Q1LA 3MGJA 4YMEA 2VDHA 2BVZA 4YR3A 1J5EF 3A8KA 3S7RA 3UNGC 2HNZB 3IC1A 2GMJA 4CO3A 4CTAB 4KGXB 1AFJA 1UWAA 3Q8PB 3MMAA 1YI2S 4KH0B 5KFKA 4QQBA 3LH2S 3DXBA 3V2UC 4TQSA 1PILA 3ZZTA 1F3VA 1SKRA 1NM2A 4K4UA 3PIOQ 2YNGB 4K4SA 2RJZA 4RW6A 1IBKF 1LW0A 1AUSL 2C42A 1EQMA 2NPFA 1JJHA 4KJIA 4U7UD 2COLA 3V5RA 3BGOP 4L72B 2JRSA 4FPIA 1TKTB 4OJ3A 1SKSA 2IY5B 4DHVA 5DQGA 4C9DA 5IT9Y 1AFIA 2EG1A 2QFJA 2F5GA 2XS5A 4LF7J 4PG5A 2KZMA 1DY3A 1PG5B 4DU8A 1VRTA 2OMLA 3P5BP 3ITHB 2IJNA 2BABA 2XMJA 2HVZA 2W9CA 4WU3A 5IC6B 2HG4A 4DMZA 2O01C 3QT5A 4A8KA 1X5SA 4AXIA 3MPWA 5T14A 3T5HA 1ZZFA 3H0PA 1YG0A 3HHLD 4KGMA 5F8HA 5KFMA 3VQTA 5ETVA 3PW2A 4QIGA 4DEZA 4JI8J 1DHMA 1F9HA 3BSAA 3F44A 3EICA 3SSRA 3JXOA 3S01A 1RAFB 4F25A 3J7A1 3NMRA 1PCAA 1U8SA 3I4HX 4G1QB 3FBFA 3MAQA 4BWJA 3PW5A 5L1LA 3RB4A 2W2QP 3IFEA 3OTDA 5KFCA 4NRUA 1S1TA 1HD1A 4MKYA 4QWDA 1RLCL 1C1CB 1JNZB 4G65A 4DF8A 1M0SA 4EK2A 5KFGA 5F0UA 1WDDA 6FD1A 1R8CA 2O67A 4NA2A 2B4UA 1BXNA 1URRA 1YJNS 5AXNA 2PA3A 5B0GA 1FDNA 3SFUA 1VHIA 4C3MA 3PRDA 4CQ1A 1RHQB 3E8OA 4ZVPB 3UD3P 2WW8A 1V9OA 1X7VA 1FWKA 1ULRA 2D3ZA 2RAQA 2BQ3A 4ANEA 7FDRA 2EBEA 2ROGA 5L9NA 4HH0A 1X4CA 2VPYB 2JOQA 4C8NA 3RRGA 1UL3A 1RTDB 5DS7A 4ETXA 1RAAB 4LBPA 3DOLA 2GFFA 5LOQA 1JXLA 1O6XA 2BW7A 1NRKA 2DD8S 2Z58B 2NS1B 4QOTA 5B0CA 3OXFA 4WP9A 4OMFG 2W8LA 3CJQA 3RJMB 1FRMA 1VI7A 4G6VB 1XERA 1FRHA 1HI0P 1N52B 1TAQA 5DM7Q 1SJ3P 2JEJA 4DX7A 1OMSA 4WTYA 4F4ZA 3BBBA 4HI2A 4IO1A 1VQPS 4NCAA 2HHUA 2XGQA 3AQPA 3UD4P 3PYFA 4LR7A 1SV5A 4NLWA 4LRDA 3PYGA 2O1PA 3IBWA 1HWLA 2ZOMA 1GEHA 4P7TA 2B4VA 2CA9A 2RRNA 3TOQA 5IOLA 1XWLA 3KK2A 2ADCA 1G4CA 1SXLA 2ILYA 1LWEB 1NXIA 2EFNA 2IVYA 1GXTA 1IWGA 1YRUA 2P8IA 3HHKA 4FNIA 4NLQA 4ZPTR 3HVRA 4O3NA 1JLQA 4RJVA 4IFVA 4FYXB 2A2CA 1CQNA 3WQPA 3C46A 2RQ4A 3J80Y 2DNGA 3Q8QB 4ECZA 2Z2LA 3VQSA 4OL8A 4OI4A 5D78A 4IO9Q 2IRUA 2G13A 2JJ4D 3MR5A 4PQAA 1E6VA 2L48A 4IH5A 4USKA 1FNOA 3M2VA 4YB6A 5U47A 5L38A 5KT5A 1N34F 1JLBB 4C8KA 1VGYA 3OR2B 3RBDA 3ULHA 4YB5A 5I4MA 2W7OA 1WC4A 1IR0A 4I4BA 4LVOP 3C19A 2XGPA 2I9SA 1JQGA 3GFZA 4W4MA 4WWSA 5KT6A 3Q23A 4URSA 3CXCR 3C6TB 1NJXA 3ISZA 1JJCB 2IJFA 2IBKA 4JI1J 1UEVA 3J81Y 4DSIA 1T9XA 2B0GA 4DL3A 1N32F 2MQ8A 3GB0A 2OFHX 3AD7C 1RK8A 4DV6J 3W3SA 1CLFA 2R2SA 3VHQA 3MM6B 2XS7A 2KI2A 2ZBCA 4ZVUB 1LWEA 3TUZC 1XJWB 3PKMA 5ADZA 2RU9A 4ZS6A 3NGKA 3FC9A 1HHTP 1FKPA 3HF5A 3NS6A 1RWNB 1TL5A 5JVHQ 4KHPF 3KJNB 4OV6A 4DPXA 4F0MA 4CLSA 4DL6A 4QWEA 1TR0A 2V8PA 2VFTA 2R7SA 3PW7A 1S4FA 3TQ1A 5HQ8A 1PSDA 4DR3F 2FJDB 2JLFA 4UZCA 6AT1B 1Q86T 4PWWA 1T7PA 1S5ZA 4QYZJ 3J81j 3MCSA 2XO7A 1Q4RA 2HHPA 4OYMA 2Z0GA 5EX3A 3BR8A 3W9JA 1BQXA 3RAQA 2R7QA 3O5TB 4XPCA 3MMAB 2C28A 4FZVA 3LGHA 1UWBB 4C8ZA 1NDKA 3OTBA 1HBNA 3W66A 1EB0A 3KLEB 1D9FA 3K5PA 3QJJA 2DO4A 2AYEA 3PR4A 4JI6F 1JLAA 3MPVA 4Z7YA 4L75A 1VBXA 2XG8A 1S1WA 4JUZA 1LW0B 4DSJA 1PBAA 4MMOA 2DB1A 2WHOA 4DQSA 2VF3A 1H0HB 2YNFA 4ZVOB 3L7PA 3KHGA 2H1YA 2YH1A 2H5IB 2C2OB 3KLHB 2DK2A 1TZ0A 1RWMB 3US5A 4I2QB 2MYFA 4M5HA 3BB5A 3RB6A 3QRQA 2UV8A 4ZPVR 3VF0B 2D1CA 5J1EA 1LK7A 1NSPA 4ZP6A 2Z56B 3I55S 3I5BA 4M5MA 3QZ7A 3DOMB 2C2MB 3SSQA 1O0PA 2XYGB 4MTPA 2HWIA 2M88A 3TZZA 4GKJJ 3CEDA 3QQCD 1K0VA 1DTTB 2FD2A 3AODA 4LJMA 1YBAA 3Q24A 2KVQE 3M6UA 1B3TA 3AJ1A 1M90T 1AXQA 1S1UB 4M63A 3BKTA 2ATCB 3KLGA 2R7RA 4DL4A 1SH0A 4NLXA 1V3SA 1QD1A 3W63A 3M4XA 2YH0A 2BYCA 4OZ5A 3HVTA 2DGSA 1Y11A 1KTVA 1BHNA 1FO1A 3R27A 3CJTA 4C3KA 2HRUA 3LQVA 1CSJA 4MIWA 2H9ZA 2YNFB 1TTHB 2DGTA 4F8RA 4D3HA 4ZKAA 1BQNB 3TZXA 1H38A 4DPYA 2MDAA 4NXMJ 4NRTA 4B3RF 1IBMF 3C15A 1PAUB 2HHQA 3M2UB 4NI2B 1S9EB 5A6PA 3PTWA 4ILMA 4KAIA 2H48B 4Y28C 1UZDA 4FVMA 4CLPA 2P9CA 2ASDA 2GQQA 3IRXA 4HR2A 1WACA 4Y65A 3CMES 2HIYA 2GZOA 2W7PA 3G2XA 3I0SA 2KFYA 4GRSA 1KOOA 4A8YA 3DRRB 4AT1B 4P75A 3TVZA 4A8WA 1VOMA 2LQ5A 3GIKA 1BWVA 3LPEA 3BSCA 1BQMA 1PAEX 2JEFA 3AT1B 4NXNF 3EZUA 4RBTA 4LF5J 3GONA 4X64F 2LXIA 1U1NA 4LF9F 2R7UA 4EZ9A 2L9NA 3CCLS 4J9OA 1DAXA 5K14B 1N5TA 3TJAA 1WSRA 1LWCB 3CJRA 2IC3B 2QL9B 2CFXA
chains in the Genus database with same CATH topology
3GR0A 2B51A 1LQ9A 2EFPA 1J5OB 3OL7A 1NZAA 1U24A 5DGAA 1VQ6S 3ZZYA 5FDLB 1TL1A 2DITA 4DS4A 2LQ9A 1HPZA 5KTQA 1ZBTA 1S48A 3KHLA 2I0XA 2K3IA 2DRBA 3DFEA 2UP1A 4ZVGA 4RW4B 2RDIA 3VALA 2WONA 4W90B 1YJTA 4AQYF 2X1AA 3GFHA 2ZH8A 4DSEA 4KSEB 3PNIA 1RYSA 2GW8A 4I68A 1CC8A 3GSDA 3MFIA 1X8DA 4JV0A 2DT9A 2WSCC 2XBPA 2ALZA 1JKHB 1KFDA 3EZ5A 2MQQA 3CJ5A 1UVMA 2QRRA 1RQ0A 2L9WA 2Y1IA 1TL4A 2ZJQQ 2APOA 1L3VA 3H2UB 5D8HB 1X4GA 1NJWA 3MHYA 3OLAA 5A6WA 5KFHA 3ZC4A 1X9MA 4PPZA 3AA8A 2V8GA 3CF5Q 4ED2A 4K4WA 1TL3A 1TVRB 4N5SA 1QLNA 2BRLA 1NAQA 4YDDB 4NL5A 4C0HA 2IM3A 2UXDF 2GJ2A 2F8MA 3OV7A 3BGFA 4QIFA 3NS5A 1XC9A 1KOHA 5LXYA 3OHAA 3CCTA 1SUQA 1VQMS 3BEGB 5C25A 2OIHA 1UVIA 4KKOB 3MM7A 4CO0A 4JOUA 3Q2SC 4JI7F 2EFVA 3MFHA 4U7CA 2ZOFA 4J9SA 3R3TA 2K2PA 5D4OA 4LMZA 4ZCKA 5IM0B 5A8RB 3FJ2A 1K9MT 1JLAB 2FVPA 2IYIA 4FNHA 4CZCA 1S49A 2KVIA 1WEYA 3CJ4A 2PGCA 3OUYB 2ZOGA 2CQGA 1XMOF 4DQIA 2U2FA 4BHQA 4LQ9A 3GG1A 4CNYA 4OHZA 3IXQA 2QYCA 1I94F 1CG2A 2HNYB 1X0FA 1WEXA 2GC8A 2MQNA 1QSLA 5F8NA 3MEKA 3LANA 3OXGA 2QMWA 1Y7PA 3HFKA 3CT9A 4J5OA 2KDOA 1GX6A 5KG1A 1HD0A 2A1BA 3IG1B 3PEJA 3QZ8A 2ZHAA 3DRPB 1R8PA 3BO3A 4RWWA 3G9CA 3ENQA 3NBPA 1X9SA 4HLBA 3T1AA 3PKMA 3Q8SB 1RISA 2PE8A 3DU6A 4RU9A 5C24B 2BV3A 4AFFA 1T8EA 1Y4ZB 3FMWA 4JV1A 2FJAB 4X4OA 3B4MA 3MUTP 4J9QA 3PDNA 3SDEA 3C6TA 1M5PC 4O3OA 3IGNA 2DHAA 4ZLPA 3KHRA 3M8PB 3O44A 1VS3A 2EC0A 3K8VA 1VMBA 1R31A 2VA2A 1KQGB 1UFLA 2V4RA 3CCQS 4DL0C 4UOCA 4GKJF 3V6DA 1KVJA 1FJEB 4IOBA 4X4QA 3PVXA 4X62F 3LP2B 2CPJA 2MKHA 3C8YA 3HDSA 2DNNA 2C3MA 2NR0A 3HVAA 3HHLA 2CKWA 2MSSA 1RGVA 1HNIB 4F67A 5A8WB 3MURP 3IR6B 2WSFC 3G8TA 1ZAVA 4ZP8A 1LWFB 3DHWC 1U4BA 3I82A 3CCES 3K0JA 3NBPB 2OPSB 5IXUA 2KJVA 2RT3A 4C98A 3RR8A 3N5FA 1CVJA 4WKYA 2V94A 2DGQA 2NXUA 2FVSA 4RBUA 3CCJS 2AJ0A 4FP9A 2UUCF 5HROB 1LWCA 1VRUA 2ASYA 3C66A 2ZNZA 2QMXA 3SDEB 2QA4G 2IMOA 2JHEA 2XNQA 5L8RC 4FXVA 3T9NA 5K8PA 2BR0A 3H2VE 3LP1A 4RUAA 5EWFA 2JH3A 2XMMA 4O3QA 4B9NA 2E7XA 4DFJA 4PXBA 1YJ9S 5F9NA 3FSXA 3RTVA 2FLLA 3BGRB 3HHLC 1U1KA 2GJIA 5KFAA 2MZ1A 4TN2A 2IMWP 1N36F 3IS9B 5AXMA 1KQFB 3QIPA 2Y1RI 3G6YA 3BQ2A 3KMQA 1YIJS 5F8LA 1HNZF 2BA9A 4FXWA 1T05B 2UXBF 4QIVA 1R7IA 5KT7A 3ZZZA 4DV1F 2OPSA 5KFIA 2VPXB 2V4QA 4OJHA 3BQ0A 4ED8A 1FEEA 3HKWA 1RT5A 2GV1A 4B9LA 3I32A 1UVLA 1FKOB 3OQ2A 3BREA 2RB7A 3O1LA 2F8HA 3M2RB 3KFWX 2AGPA 2KJWA 1MWZA 1LK5A 4X4PA 4BDPA 1D9DA 1U09A 1R27B 2LXUA 3JSRA 5DQIA 4FF4A 4I6WA 2UUAF 4ZHRB 3BGRA 2B9YA 1KONA 3DC2A 5HI7A 4Y00A 2MHEA 1KR4A 1S6QB 2HWTA 3SQGA 4G1IA 2LU1A 2V4JA 5H9FJ 1RT7B 2BJEA 2ZH2A 4DG1A 1G2EA 2M2BA 3DRRA 1FD8A 1HBOA 1OPIA 1U25A 4OLPA 3L7OA 3NRBA 4QR0A 3MWBA 5F8MA 4JI5F 3E3XA 2PD1A 2YX4A 2EBGA 1HNWF 1YQHA 2PN6A 1FRJA 4MFBA 1J2VA 1JXEA 1Q8IA 5KFJA 2LDYA 1B0VA 1FRKA 2J7KA 3TA1A 4ES3A 1E6YA 1N6QB 4WZQA 3PZPA 2BUNA 4KTQA 1JLFA 2DGOA 2B56A 2J7UA 3BSOA 2RQMA 3M30B 3RW7A 4WFBQ 5D4NA 2OP5A 3CPWR 1R89A 5EN1A 3P3DA 1VBZA 2W4DA 5KOXA 2X1GA 2V5HG 1BGXT 4QPTA 2OPRB 4DDFA 2IAJB 2CVEA 1LXJA 2RQCA 1HMVB 2RF2A 2J7WA 3ENWA 2GQCA 3I31A 2R8GA 4K4VA 1Y3JA 2K7KA 5DGBA 2FVCA 4EBCA 2X51A 3DRPA 4EWTA 3KJVA 2CIMA 1KC8T 1N5YB 3LOUA 2AW0A 4DF4A 4ECRA 2AX0A 2EVZA 1PC4A 1A9NB 3DLEA 3IO1A 4PKDB 3KK2B 5B0EA 1RA7A 4DOZA 2R4FA 5CXTA 4OX6A 1M5VC 5ITHA 2J5AA 4CH7A 1ZOTA 2DNOA 4IQMA 4ELVA 5HMZA 4H4OB 2OSRA 2W9BA 1BY9A 1WF2A 1ZM4A 2FB0A 5MLCV 4WYWA 2VODA 2MHNA 4F4WA 4FXDA 2HZCA 4Q5VA 2KFZA 4TKTA 3M2VB 4TLQA 2R8KA 1HQEB 4DSFA 3AJ2A 2HNZA 1M5OC 1OQ6A 2Q6BA 4R0JA 2I8EA 5I42B 1FHTA 5C25B 1JLGB 3MM8A 2XNRA 4CH0S 3SI8A 5HROA 1IKVB 2AYBA 2OPPA 3UR3C 3CCWA 1QM9A 5B08A 4J9RA 1FESA 4WIIA 1RTHB 1XMBA 2DGXA 3DRSA 2MKCA 2PI4A 2F8EX 2RKIA 4F50A 2GIQA 3H4DA 3IAM9 4TYAA 1C4AA 1VJWA 1YRXA 3IGVA 3KLVA 4DFMA 5I3UA 1U48A 5DLFA 1T02A 2K1RA 1R6YA 1S76D 1FTRA 4J9LA 2CJQA 1F60B 2RE1A 4ZDNA 2JEIA 1X4EA 3CCUS 3JSMA 4DLEA 1X4DA 4KFBB 3PRBA 4FBUA 4ECQA 3QYYA 2B5JB 2PO4A 3V81B 1NJYA 1S77D 5CYQA 4C97A 3HZEA 3PR5B 1NK9A 4PG4A 2NSBA 2XI3A 2KFNA 5D3GA 3FVYA 5A8KB 4GKKF 3DRXA 1WG5A 3QGGA 4EUVA 2E1RA 3MTKA 4QIWD 5GVQA 2XY6A 1OO0B 4ZPDA 3MAHA 2GIRA 1TV6B 5AXLA 3LGMA 5J2NB 2DHXA 2F1FA 4X84A 3KLIA 3HHNB 4IDKA 4DWIA 4ECSA 2AJQA 2YNHB 4Q7AA 3DRSB 3FZBA 1AROP 2BQRA 4HT7A 4YEAA 4MKAA 4H4MA 2GHVC 2RU3A 4UW2A 3TAQA 1T03B 4TU8A 3TR5A 2HMIB 4Q0BA 1GH8A 2ZUGA 4IG0A 2HHXA 3N79A 3OJUA 1A7GE 1P1TA 1RT7A 1S1XA 3B4DA 5D4LA 1RTDA 2R7VA 2CRLA 4ID5B 2B7BB 2LXFA 2VPWB 2ZD1B 5E7OB 4EBDA 3M8SA 5KFYA 1YHQS 2M8DB 1YVFA 4B17A 2M52A 3N4WA 3CDBA 1JLBA 3POTB 3C6UA 3NNHA 2RDJA 4J9NA 5L39A 1FK9B 3CB4A 3HMJG 4N56A 1UP1A 3JYTB 3ONQA 4EBEA 1E6YB 1HNVA 3FNNA 1RKJA 4NA1A 4DR7F 4NZ6A 1XR7A 4M1KA 1MW7A 2YVSA 4P6QA 4C11B 5E3PA 4ALZA 4ZMMA 1K73T 4G3IA 3QIDA 4GO5X 3HZGA 4X4UA