1NU4A

U1a rna binding domain at 1.8 angstrom resolution reveals a pre-organized c-terminal helix
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
91
structure length
91
Chain Sequence
b'RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1A RNA binding domain
publication title U1A RNA-binding domain at 1.8 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 28
structure length 91
sequence length 91
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1nu4A00
2MKCA 1K8AT 2AYEA 3TYTA 2D9PA 3VAGA 1O0PA 2DGUA 1VQ8S 2MZSA 1FJCA 4LIRA 2DGWA 3MURP 2EVZA 2JVRA 2JWNA 1U2FA 1WG5A 1QVFR 2MB0B 3G71S 2RQ4A 3P3DA 4Z2XA 3CC2S 4FXWA 1SJFA 2MYFA 4TU8A 2LEBA 4LJMA 2EK1A 2X1GA 2LYVA 1ZZFA 1DZ5A 2XS5A 2HVZA 2CPZA 2LECA 2LKZA 3P49B 2DGSA 1WF0A 4WF9Q 3S01A 3CCLS 1UP1A 2MKIA 3J7YU 1YWXA 3S6EA 2DHAA 3I56S 2X1BA 5GAHU 3RW6A 5MLCV 3Q2TC 4WFAQ 2HGLA 3MUMP 3MXHP 3CCUS 4F25A 3ULHA 2DNYA 2U2FA 2CQ1A 2DNZA 1NJIT 4QU7A 1P1TA 2RU3A 2RRAA 2DHGA 2N3OA 2MSSA 2PE8A 1OPIA 2DNLA 3NNHA 3CXCR 2CPIA 3UCUP 2HZCA 1VQPS 1XN9A 2E5JA 1SJRA 1VQ7S 1U1RA 1HD1A 1H2TZ 2YH1A 3VF0B 4YUDA 5IFMA 2L9WA 3THTA 4IOCQ 2KRRA 2VODA 2M7SA 1VQLS 2DGXA 1K9MT 2GHPA 2YWKA 3EGNA 1W2BR 2XS2A 2OTJS 1OIAA 2KT5A 1YHQS 5DM6Q 2YH0A 2DNGA 3V4MA 1F9FA 2B0GA 2KYXA 3S7RA 3CUNA 5LJ3Y 5JVHQ 1VQ4S 2U1AA 4RU2A 4IOAQ 2MZTA 4TLQA 2RRBA 1X4GA 5DDRC 2KI2A 2V94A 2LQ5A 1G2EA 2SXLA 1VC6A 4WKRA 1FJEB 2LMIA 2DNRA 2DO0A 2XB2D 1YIJS 2KVIA 3MDFA 3MOJB 1QM9A 2KHCA 2LXUA 2M4MA 1UAWA 2OIHA 3VALA 2LEAA 1X4EA 2M2BA 2MZ1A 1U1NA 4TU9A 1VBXA 3CPWR 3R1LA 4ERDA 3CTRA 2KFYA 3NNCA 1VC0A 2O3DA 2J0SD 2ADCA 3CC7S 3CMAS 5EN1A 1ZH5A 1R8HA 2WBRA 2CPHA 2QA4S 1SJ3P 2FHOB 1B7FA 2M88A 2MKKA 3PIOQ 1M5OC 3EGZA 3VAKA 4BS2A 4CIOA 2MKJA 1RKJA 3NMRA 3S8SA 5LXYA 1D9AA 2DNPA 1WTBA 1SJQA 4PRFA 3L3CA 2AD9A 2KU7A 2MQOA 2RS8A 3CCJS 1QVGR 4WFBQ 5CXTA 1OO0B 1X0FA 2ZJPQ 3B4MA 1FHTA 1X4CA 1A7GE 2HGMA 3R27A 1WHVA 1WI8A 2ERRA 1FT8A 1S79A 4C4WA 2MQMA 3HI9A 4QPTA 1Q7YT 2KXFA 2RT3A 2NLWA 2KM8B 2DO4A 5HO4A 2E5HA 2DGQA 1Q81T 4W90B 2YTCA 5D78A 5IQQA 1X5PA 2RUGA 3UCZP 2M9KA 2CJKA 2G1DA 5LXRA 1WEZA 5CA5A 1FJ7A 1A9NB 3H2VE 5BJRA 1X4BA 1U6FA 4CH0S 3G96A 1VQ5S 1JJHA 1JJ4A 2HYIB 4C0OC 3R1HA 3CC4S 2F9JA 4QU6A 2FY1A 1R8PA 2XNQA 3MD3A 1VQOS 2N82B 3JB9k 2CPDA 1OWXA 4M5DB 2KXHA 4V19X 2MSTA 3SMZA 1S72S 1U1LA 2CPJA 3UWTA 1IQTA 3BO3A 2MZJA 1WEXA 5DDQC 2M8HA 4WCEQ 3VAMA 1JJ2R 1M5PC 2AYGA 2RNEA 2CQHA 1YI2S 4YOEA 2DH7A 3SDEB 3NNAA 1VQMS 4UQTA 3CMES 3HHNB 1ZZNA 2DB1A 2DITA 4Y0FA 4ZKAA 2VOOA 2LXIA 1WEYA 2K8GA 2MJNA 4LMZA 5JVGQ 2M0GB 2D3OR 1KD1T 3CCMS 2OJ3A 1U1MA 2J76E 3CULA 2RS2A 2G4BA 2F3JA 1M90T 2CQPA 2DNKA 2JVOA 2E44A 2EK6A 5ITHA 1VQKS 4QQBA 1URNA 1N8RT 5LJ5Y 1YJNS 2D9OA 3LPYA 2MZQA 4C7QA 2VONA 3CCES 4ED5A 2LA4A 3J7ZT 2KG1A 3P6YC 1UFWA 2MPUA 1WHWA 3U1MA 5DDPC 3US5A 3IWNC 2DK2A 4FXVA 5CYJA 3SDEA 1U1PA 3UE2A 2BZ2A 2DHSA 2QFJA 3DXBA 2MQPA 2MGZB 1X5SA 5GADU 1D8ZA 1KOOA 2ZJQQ 4F02A 2MY8A 1FXLA 3D2WA 2N7CA 1YTYA 1DBDA 3OW2R 2MQNA 3RW7A 1VBYA 2M8DB 2KXNB 1VQ9S 3BO2A 4WIIA 4UY8T 1BY9A 2CPXA 1U1KA 1WWHA 2CPFA 3VAHA 2G0CA 2HGNA 1WG4A 3CCVS 5LSOA 1X4FA 2DIUA 3CCRS 2A3JA 4PR6A 2DNHA 2CQIA 4OZ0A 2DNMA 1N52B 1U6BA 5DM7Q 2CQBA 2MGZA 3EX7B 2ZJRQ 2KM8C 2DH9A 1CVJA 2CQ2A 3CCQS 2CQDA 2DIVA 1M5VC 1HA1A 3PIPQ 1X5TA 2DGOA 1HD0A 1N54B 2X1FA 2MJUA 2L08A 1NU4A 3VAFA 3H2UB 3TP2A 5GMKa 1FO1A 1K73T 3U1LA 5GAEU 1DHMA 3BS9A 2CQ4A 1U1OA 2KH9A 2JRSA 1WF1A 2OSQA 1JMTA 4PKDB 2RQCA 1KQSR 1YJ9S 2YKAA 3G8TA 3MI7X 2N3LA 3G8SA 1PGZA 2KRBA 1N88A 4IO9Q 2CPYA 4Y00A 2OSRA 1WI6A 1UW4A 3Q2SC 2X1AA 1YITS 3MD1A 4F26A 1KOHA 2GO9A 2UP1A 1YJWS 3K0JA 2I2YA 1P27B 1Q82T 5IM0B 1L3KA 2K3KA 2DNNA 5H1SV 3DLLQ 3CD6S 2DHXA 2NZ4A 2MY7A 3UCGA 3FEXB 2KN4A 2CQCA 1PO6A 1X5OA 3MUVP 5DDOC 3G4SS 1H2VZ 2MMYA 5LSLA 2CQ0A 2VOPA 4CH1A 4CQ1A 1Q86T 3I55S 4WFNQ 4A8XA 2XSFA 2MQLA 3SXLA 3UD4P 1WG1A 1VQ6S 2JX2A 3NS6A 1HL6A 2CQ3A 2E5IA 2DNOA 5D77A 3THPA 2DISA 1M1KT 2M52A 2MZRA 3IRWP 4W92B 2XNRA 3VAIA 3G9CA 2DGVA 1U1QA 5IM0A 3N9UC 3B4DA 3NS5A 1H6KX 2LA6A 1WHXA 4TU7A 2DNQA 1FNXH 2FC9A 5FJ4A 1WF2A 1X4HA 2J8AA 1SJ4P 2QEXS 2MHNA 3ZZYA 2CPEA 5GAGU 4YB1P 3FEYB 3TO8A 1AUDA 3VAJA 2XS7A 4EGLA 4U67Q 1DRZA 1VQNS 1M5KC 2ADBA 3LQVA 1H2UX 2MKSA 3ZZZA 1VC5A 3MUTP 1RK8A 4OZ1A 2FC8A 2LCWA 3CCSS 2F9DA 2MKHA 4J5OA 2KG0A 2OTLS 5GVQA 1WELA 3G6ES 4IUFA 2MXYA 3BO4A 2DGTA 2AYMA 5DETA 3P5TL 2E5GA 2AYBA 2I38A 1KC8T 2PEHA 3BEGB 5HL7Q 2Q79A 2FPHX 3CF5Q 1NO8A 2J0QD 4P6QA 2MQQA 1X4AA 1SXLA 2L41A 3UD3P 1X4DA 2M70A 1WHYA 2CQGA 2BOPA 2RVJA 2DH8A 1VBZA
chains in the Genus database with same CATH superfamily
3FK4A 3TYTA 1IQZA 3HSJA 1Y3JA 3PW4A 3CD7A 3CC2S 5HVHA 3LA0A 2IFXA 2CNLB 4M95A 1V6HA 3H5YA 5DLFA 1SIWB 1JKHB 4DL0C 1Q53A 3FJ2A 2BR0A 4ANEA 2XWXA 3K2YA 2RJZA 5GAHU 1PC4A 1MSWD 4KH0B 3KDOA 5E2QA 3GZ7A 3QT8A 2AEMA 4LSLB 4PG8A 3L95X 1KQKA 4NYPA 4AL7A 4KYZA 3EYZA 3QGGA 3SYZA 2CJ9A 3G6VA 2PI5A 4RBVA 3MMAB 3P8BB 4OHWA 4A8QA 4I64A 4RW8A 2DNGA 2B0GA 4FYVB 5LJ3Y 1N32J 3LW5C 4M1KA 3O8WA 3SZ2A 1GTEA 3AJ2A 2HW3A 3CJ0A 5LM7E 2GHWA 4ZJQA 4K5SA 2HVIA 2BEFA 2CNKB 2R7TA 1WJ9A 1RT4B 4IDKB 1K0TA 1U02A 3CPWR 3RRKA 2WBMA 2ADCA 3J80U 1ZH5A 2HMIB 2HS4A 3D28A 3C2PA 1R6YA 1AA1B 4DUYJ 1T9UA 3DDKA 3OL8A 2AWZA 3AD7C 4LRFA 4Q8EA 2RDIA 4ES2A 4LVNP 3B4MA 2FVSA 2KTQA 2C3OA 1WHVA 4L76A 4K2JA 1BMQB 1S79A 4I2QA 1Q7YT 4ZLPA 4NLWA 3RR7A 2RMLA 3RZAA 1LWFA 1IKVB 3E51A 4DBQA 5D78A 4EZ6A 3KJFB 2AJ0A 3FFIB 1U6FA 3PDNA 3TQEA 1TUVA 3IC1A 2IDLA 5E0OA 2XTJP 1S12A 1S1TA 4ED2A 1R8PA 3JB9k 2PA8D 3BREA 4TY8B 5E3AA 2VC1A 5DDQC 3H42A 3DC2A 1IR2A 4ZLLA 5HP1B 4ZKAA 2GVDB 2NS1B 2QL9B 1B7YB 1SCJB 3DLKB 3DU6A 2MZQA 3CCES 2PD1A 3J7ZT 1HYSB 5F3ZA 3CE8A 2XLJA 3TAQA 4P74A 3I0RA 2J8SA 4LBPA 4WK1A 1RHQB 4I2PA 1HWIA 1F5AA 5I3UA 4YHHJ 1SVDA 5FLXU 2HIQA 2V9WA 3EDRB 4USMA 1UVKA 4ATNA 3SFUA 4HI2A 3CCVS 2E29A 2QTWA 2DNHA 2ZH5A 4AD6A 1YGYA 5ETKA 2MGZA 2KM8C 5CHCB 3PIPQ 3IA0A 3T9ZA 4I6WA 3MPVA 3VAFA 5GMKa 2UXCJ 3BS9A 3O2IA 4PG7A 2CRLA 2Y1LB 2FHJA 2RQCA 2IMOA 1YJ9S 3MI7X 3ZTSA 3KK3B 5J2MA 2OSRA 4P2FA 4P9SA 2J6TA 1EHWA 5HBMB 3MEGB 1RHUB 1YJWS 4LBHA 2K3IA 3OTOF 3DLLQ 3MCSA 4ID5B 2YWFA 2NZ4A 3FEXB 2BM0A 3PKYA 1PO6A 3UI3A 4WFNQ 1CSJA 2DY1A 4ZPTR 2UZAA 4X4NA 4LF9J 4KGVB 1UA0A 1LFPA 1FJGF 4W92B 1IWAA 1KVIA 4G1QB 3M2RB 2A2CA 3QIPA 2MHNA 2B7BB 4ED0A 1KLMB 3PVXA 3GSDA 3TJ9A 2LU1A 1M5KC 2YNGB 2JC1A 5KT7A 1EETB 3KFWX 5C42A 2L9NA 3PR5B 3MM5A 2KG0A 4ZP9A 1KKHA 2MXYA 3DYAA 2V67A 5D0GA 4DR1J 1R3NA 1TL7B 4LF8F 4PWUA 5B08A 1U2RA 2VOOA 4LRAA 2DR7A 4UW2A 4FN5A 5AXNA 2QMUB 5IWAJ 2OEJA 3BDEA 2COLA 2I0XA 2W2NP 3DOLB 2LYVA 1O5JA 3IP0A 3B54A 1HWUA 4QCLA 1N5VA 1FKAF 2QLJB 2UU9J 4Y3CA 3KJVB 4NPOA 4ENOA 1NK9A 4AYBD 4EEYA 1HNZF 2DNYA 2U2FA 1RDRA 3O6QA 1G1XA 1S4EA 3AH6A 1Z2LA 3BB5A 4DL6A 3VR1A 6FD1A 3GV7B 3WQPA 3H40A 1EX8A 1VQ7S 1NHVA 3EXCX 5D3GB 2CZ4A 4DSEA 4DL4A 1FNOA 1WKJA 5DS7A 3BGRA 4TQRA 5L1IA 4C6AA 3OHBA 3FMBA 5KFGA 4CLUA 1L3VA 1SC6A 3EZ5A 1WD6A 3QBCA 1TL3B 2KHCA 5A0YA 4KHPJ 3IS9A 2ZEJA 1X0PA 5KFEA 2GVZA 3KOAA 3MPYA 3NEKA 3TEHB 1N32F 3NBPA 4PG5A 4PCQA 2PFDA 2QG9B 3ELHA 4A8WA 3G86A 5F8HA 1N5YB 2KL8A 1RKJA 3S8SA 3DLEB 4RUHA 5J1NA 4ETXA 1I3OB 1SJQA 3MM9B 1T03A 5GAGI 2NUUG 2DD8S 3VV2B 4PAAA 4LR7A 4C4WA 5D4PA 4PG4A 5MAOA 5DG7A 4UOHA 1Q8KA 5HO4A 4X2BA 3NLCA 1C1CA 1X8DA 2V8HA 3MCNA 1HNXF 3KLFA 2H4YB 4DR3J 3D67A 4HHJA 4LSZB 4ANCA 2XSJA 3PV8A 5HMXA 4V19X 1RAJA 2MSTA 5J1EA 2CWKA 4FNHA 1S72S 3UWTA 2VJUA 3HD2A 2AYGA 2Z8QA 2GHVC 1WDTA 4OYIA 3RBDA 1FXDA 4DL5A 3RB4A 4M5LA 5IOLA 1M90T 2ZM6F 1H0HB 4JI2F 4CO3A 3CCWA 4C7QA 4NI2B 3HZEA 1TZ0A 4DOZA 1APSA 1TKZA 5J2PB 1XTZA 5T41A 2CZVC 2W7AA 4PXBA 2K1RB 1LQ9A 1DTQB 4J9NA 1RWMB 4ZCLA 3FRZA 3W2VA 1FXLA 2M8DB 1U1KA 3ILOA 3GG0A 2CPFA 2OEKA 5KG6A 2FJXA 4KHRA 5HROA 2O01C 5M2RA 2FZCB 2YWEA 2RD5C 3JXOA 1FK9B 2WVCA 4DG1B 5ETLA 1SUQB 3HLUA 4DR4F 2CXEA 1FKOB 4YHHF 1HD0A 2RQMA 3JQJA 6FDRA 2GGPA 2KH9A 2AMCB 2MQ8A 1B70B 4PXCA 2GO9A 1L3SA 4PPZA 4BBYA 2I2YA 2K3KA 2VFSA 2VG6A 3L09A 1EQ0A 2YNFA 2AZ1A 3PTWA 3O3LA 1CJKA 2CJQA 1KTVA 5B0FA 3OL9A 1HWJA 2J6UA 1W2IA 1DQAA 1CC7A 2AV5A 3OL6A 3EVOA 5K8PA 2HBRB 2JOQA 2RQKA 3NS5A 3T1HF 5HVFA 1Z1ZA 1I51B 1X9MA 5EWEA 4YB1P 4KIAA 5LOQA 1HI0P 3HVTA 2ADBA 2ZH7A 3IG1A 2MKSA 3J81Y 4QIVA 1T05B 3DRRA 3CCSS 1RTHA 4K50A 5EX3A 4OI3A 3BYPA 5AXLA 3PO4A 4DR6F 2DGTA 3BPDA 2C1EB 2XC9A 1Z4UA 1D3WA 3PHEA 1YJNS 4B02A 4TXSA 3CWJA 2HLTA 1NSKL 4H4OA 3AXKA 2FLPA 1U2FA 1QVFR 1OY9A 4ECRA 1PAUB 3I4PA 5HLFA 4P10A 2VU5A 1CULB 3FSYA 4ZK7M 2XMMA 1FE4A 2XMAA 2RF2B 4FF1A 2DR9A 3OL7A 3S6EA 3ITHB 3W62A 4F4WA 1W26A 1MMLA 3R5BA 3MUMP 4A47A 3OPKA 2E1PA 2GX8A 2ZKTA 3FBBA 4L3NA 3K57A 3TAMB 4P73A 2FJEB 5AXMA 4C9DA 4F3QA 2DNLA 4AFFA 3UCUP 1S1VA 1AW0A 2V50A 1V3RA 2UU9F 3M8ZA 2H5IB 2Q1LA 3SQGB 4IQMA 1MMNA 2AJFE 4DS5A 1GXUA 1WDDA 1YHQS 3V4MA 4JYAF 3OFEA 2D3ZA 1SC4B 3D0HE 2YXLA 3QLHB 2LQ5A 4WKRA 1YRXA 4P72A 5KFAA 2XB2D 4EU0A 1QM9A 1CS4B 4ZPAA 1HBOA 2MZ1A 1SQEA 4DV1J 1LWEA 3SQOP 3V2UC 4JV1A 2YNIB 2QV6A 3AB2B 3AA9A 2WBRA 5C2CA 3CNQP 3M8PA 1RE1B 3DMJB 3GONA 1SV5A 3KHLA 5KFWA 2F1FA 2NPIA 3D0GE 1KHVA 5G0RB 1P9QC 3M1VB 3H4DA 3TR5A 4KFBA 2WSFC 4P7VA 4NOHA 5CCLA 4Q45A 2BV3A 4LUBA 2HGMA 2QSWA 1NDKA 1WI8A 4JI7J 4QPTA 2DT9A 2RT3A 3JTPA 3MR5A 1VR6A 4CLPA 2KYZA 2W24A 4OI6A 2MKYA 5BJRA 1S7IA 1VBKA 2HYIB 3CC4S 4QU6A 3MD3A 3TRGA 4RZRA 4KV8A 3E3XA 4YN3B 4K5RA 3DHXA 3DI6A 3QIDA 1GFWB 4WCEQ 3VAMA 2YKPA 3TVYA 4XPCA 5B0DA 5K14B 3AAWB 4WP8A 3MHYA 1E6YA 3V81B 4DR3F 2HHVA 3U27A 2IVMA 5ITHA 3N4WA 4QQBA 3VQTA 3KUHA 1QSSA 2D1CA 2ZOMA 1UFWA 5DDPC 1TK5A 2VQEF 5D4NA 1OYEA 1FRHA 2ZFHA 2VPZB 1LXNA 5BYRA 4B17A 3X3UA 2FLNA 1U24A 4OZ2A 3BV8A 3DDNA 3QGIA 3TA1A 2HGNA 2FY8A 1HARA 4B3SJ 4MK9A 1BWVA 3BZQA 1N52B 2WVEA 1PJ7A 4EYHB 3MEEA 2OP5A 3TOQA 5KG2A 1OY6A 3KLGB 5F8LA 3FUYA 1NJXA 4NLQA 4WXWA 2PIIA 2OSQA 2KB2A 5L8RC 5THWA 1A6LA 1RT5A 3PG9A 5CABA 2YKMA 3QO9B 4ITSA 1RT1A 2DYAA 3H98A 3EDQB 4ZP7A 4B9MA 1P27B 3ILJA 3CJ4A 2XEXA 3MEDB 1XC9A 2H65B 4DMZA 1WG1A 4H4MA 4WK3A 4YR0A 2M52A 3GIKA 3NGRA 4GC7A 3UN5A 4A8YA 2OGUA 5JXSA 4ECUA 1TKXA 1FNXH 2FC9A 1RI7A 3C16A 4FYXB 3HVAA 4JP8A 4EFAC 3VAJA 1NMEB 4QPXA 1XBWA 2EFNA 4G1IA 1NNDA 5IT9Y 2XG8A 1FXRA 4O4RA 1HMVB 4BCAA 4OL8A 5AT1B 2LQBA 2UXBJ 4LFAF 2XLIA 2RU9A 1TKDA 4C97A 2DPJA 1XR5A 2VL1A 1WHYA 2PI4A 3N01A 4KE5A 2D9PA 3I9ZA 3UD5A 3MURP 1SH2A 2DJWA 3Q8VA 4Z2XA 2OH2A 3TJAA 1JIHA 1MMDA 2CYYA 1HBNA 1FDDA 4ZITA 4F4KA 2X1GA 4NLPA 4JI1J 4MAKA 5HI7A 3HHEA 2W7OA 2QX0A 1UWBB 2J9EA 2KJVA 5KFBA 2VV5A 2X3GA 2CDRB 4ZVRB 2B4VA 5KG3A 3VQSA 1RWNB 2DHGA 1FRKA 2ZZTA 1JKHA 2IAJB 1C0UB 1R7IA 1JLFB 4HDGA 3WZ0A 4ZVEA 2M7SA 5G4DA 3HFVA 2YWKA 2XS2A 4EWTA 1C0TB 3K5MA 2HVHA 1RISA 1EP4B 4LSLA 3ET6B 2QN6B 2RRBA 4BWJA 2IM0A 2XULA 5I3PA 2ZH6A 4ED8A 2LMIA 4MKYA 3SIPB 1W7WA 2VH7A 3MDFA 3MOJB 2B7CB 2EBEA 2F40A 1F3FA 3DOMB 3MMAA 3MEKA 1SQGA 4ES1A 2KFYA 2O3DA 1T9WA 2Q43A 2MKKA 4DFJA 9ATCB 3GP9A 3LGHA 4MK7A 2YY3A 3HO1A 1RT4A 3L3CA 4HTIA 4IDKA 5F8GA 2HIYA 3DHWC 1JB0C 2I5JB 4K0KF 3HCXA 2HMIA 2BM1A 3QSYB 3BGLA 1GH8A 2F8EX 3AQPA 3MAAB 4QBUA 4BHQA 4PYAA 2QZ8A 5CAAA 1X5PA 3W60A 2VJVA 1QTMA 2CJKA 1WNEA 1WEZA 4DX5A 3HVRA 5DGBA 3IR5B 4KRWA 3K58A 1VQ5S 1JJHA 3BN7A 1LOUA 1RWWB 4JI7F 2YX1A 3PYEA 1NB2A 3FCWA 3KK2B 2FJDB 1S76D 2VFUA 1RHMB 1IKVA 3IBFB 1RAGB 3OVSA 2KDOA 3P5BP 2HQCA 1ZA2B 1AZSB 1XNQJ 3FFIA 4E98A 5K8MA 1MWZA 2FD2A 4QWCA 4LF5J 3OTBA 5IC4B 3CGIA 5LJ5Y 3LPYA 4ED5A 4TY8A 5E41A 2LEPA 1Q7LB 1QD1A 3ENQA 4DQRA 1HIYA 2R8JA 3T5KA 4USJC 1FRLA 1HNIB 4IR9A 1UVIA 3ZNJ1 4ELVA 4ECQA 5HP1A 1D8ZA 1S0MA 2NQPA 3N28A 1MWQA 2HVDA 3DKDA 1S10A 1RU1A 1FRJA 2GVDA 2BKOA 4CM2A 2QLXA 5HSPA 2A2DA 2B4PA 1WKLA 4WIIA 2E5LF 2B4UA 3DLKA 4CO4A 1WWHA 3R7SB 3JQMA 2R9LA 2C3PA 1RP5A 1R0CB 3ZTQA 4DU8A 2YQ1A 3HJVA 5A2QU 3UO0A 2GV1A 5AE3A 4WU2A 2XGQA 3I4HX 1AROP 3TUJC 1TFWA 4DSJA 5D4LA 1RTIB 1U1OA 1HNWF 4C8YA 5HN0A 4PKDB 5KG4A 2N3LA 4DFKA 4B3SF 1TFYA 4B3TF 5RUBA 5KFOA 2CPYA 3Q2SC 4Y2AA 4I7FB 2WSCC 1XEZA 1NSQA 1U0SA 3MZIA 1U0HB 3C15B 4RNNA 2DHXA 3BQ0A 4DSIA 4EK2A 2CQCA 3KK1B 3EJMA 3A3NB 4CQ1A 3I55S 4A8XA 3KTQA 3BGOP 3VZIA 4N5SA 2YPYA 3C19A 3KK3A 5LMUF 1O6XA 3T1YJ 1G4CA 3VGVA 1VGYA 1Y7PA 5HBMA 2OMLA 3MEGA 1ZYQA 2VHGA 1GAOA 1WHXA 1F9HA 4ID5A 1T02A 4HHUA 4RW7B 2BJ7A 5GAGU 1PKUA 4RX6A 3LQVA 1YJTA 3ZZZA 4ED7A 1IBKF 5KFNA 4LBIA 2BE7D 2R7WA 2GIQA 2JHEA 3N6MA 2K7JA 2BQ3A 4G1QA 4CLYA 3BJYA 2H4WB 1IVZA 3MCOA 2FPHX 5L9XA 1I5OB 1KLMA 1X4DA 4P2SA 2BOPA 2YNGA 1NKBA 1EETA 3AT1B 4DZDA 2AYEA 1NAQA 3D1HA 2WONB 5KFPA 1FRIA 3EMTA 3HVWA 3P3DA 3PW7A 2Z2MA 5E5NA 2DBBA 2HHSA 3CB4A 1ZBTA 1TL7A 2LKZA 3NMAA 2CWXA 2Z58B 1WF0A 3CCLS 1CPZA 1NM2A 4X62F 3PYDA 1RT6B 1SKWA 2X1BA 3Q2TC 2HGLA 3TA0A 2OELA 3JTNA 4F8RA 2W9BB 3DOLA 2MSSA 1FA0A 2V68A 2IRYA 4E2FB 3HMJG 1YDLA 2D69A 4XAKA 2ZITA 5IFMA 2FHKA 2KRRA 3F44A 2Z2LA 3R97A 3KJVA 1UVLA 5CZXA 2GHPA 4EBDA 5IT0A 3L7UA 4JI5J 2Y9HA 1DTTB 1F9FA 4M5JA 2IIHA 1HHTP 2WCXA 4LQ3A 1NZ8A 3M05A 1TR0A 5IV4A 1TVRB 1IR0A 4LRCA 4NYOA 3HSDA 3QAEA 1YVFA 5D3GA 4EBEA 3UFCX 4OZJA 3DM2B 4G3IA 4Q2LA 3ILIA 2E66A 3HSZA 4FYWB 2FQQB 4MIBA 1TL1B 3ZZUA 3WC0A 3D6HB 1FFGB 2VASA 2HHPA 1H7WA 3I5BA 2DNPA 2HFVA 1EQMA 1TL3A 2BUNA 2YKOA 1QVGR 4LF6J 5CXTA 5DQGA 1WORA 4JI0J 5ETVA 4DN9A 4K8RA 3P45B 5KOWA 1EB0A 3R5CA 5F3TA 2VFRA 5AJ3J 3WIUA 1JNRB 2W8LA 3UQSA 2FVRA 2PMWA 4UOCA 1N56A 4W90B 1N5YA 1IN0A 3DLEA 5M2UA 4X4UA 3MM9A 5CA5A 1A9NB 4DFPA 1V5VA 2X51A 4ILRA 4IFYB 1K44A 4K4WA 2FY1A 2AEJA 5FD1A 4TQSA 2BDPA 2UVRA 1K1SA 4XDCA 4O3RA 1Q8LA 1FDAA 3H90A 3I9V9 4LF7J 1WSVA 2ACYA 2QA4G 3SDEB 4NEYA 3HHLB 2L9DA 2M0GB 2F3JA 1TTHB 1N34F 2QFIA 2PN6A 4CWBA 5F8JA 4C3LA 2KG1A 3AOBA 4C0BA 5CQGA 4D3GA 5DZ7A 4ZPWR 2B6AA 1YBUA 3TVKA 4ZHRB 2EBGA 1EARA 1XNQF 3DXBA 3V5RA 2MQPA 2IJRA 4HT5A 4OFZA 1YTYA 3CJ8A 4LF5F 5CH7B 1OPZA 1VQ9S 1X9SA 2JEIA 3HHDA 4NI2A 2LXFA 2G0CA 3KNGA 1KFDA 5L1KA 3RJMB 2HS0A 4OX8A 2W2OP 3QZ7A 1U6BA 2K1RA 2R3VA 1DTQA 5HMWA 3T19A 4X4RA 1KDNA 1OQ6A 1NU4A 2PGCA 4RNHA 1YJRA 2HWHA 1PBUA 4ZLNA 4DV4J 1RWVB 4GKKJ 4DR5F 3M2VB 1VFJA 3IXQA 1HBUB 1FK9A 3PJ9A 3FMWA 2XYPB 5HANA 4DG1A 1SUQA 1R0AB 3M8QB 1FKOA 5KT3A 5IT9U 4FZVA 5K20B 5LMNJ 2KN4A 2ALYB 3GIIA 2CQ0A 2XMUA 3IN5A 4AQYJ 4DV6F 3NAHA 4KKOB 3SXLA 4UZCA 4RPFA 3A3OB 2YX7A 1M1KT 2WSEC 3VAIA 2F4VJ 2DGVA 1VHIA 4JUZA 4A8SA 2HK2A 3PX6A 1NK7A 4RW4B 4H4KC 2HS3A 3ZFVA 1FWLA 3IBWA 2Y3YA 3UDLA 2EG1A 2W4PA 2OEMA 3IR7B 4U67Q 1TELA 1S57A 3FQKA 3T1YF 3RRHA 1LK7A 4A46A 3ZTOA 4IH6A 2GJ2A 1XMOJ 1M1GA 2PEHA 3J7AN 2J0QD 2CIMA 3M6XA 3DOKB 3JSMB 4DQPA 5D8HB 4N7TA 3M32B 3TA2A 2Y8YA 1XR6A 1T05A 2OI2A 3DRPB 5B0GA 3KWMA 1WG5A 3G71S 2RQ4A 1T3OA 4PG6A 2E1AA 4E0DA 2EK1A 4Y2KA 3EUNA 2CPZA 2HQDA 3G82B 1Y5LB 1VK3A 3QRPA 4BC7A 7FDRA 4OYMA 1GQEA 1YKWA 2IMWP 2AJQA 4HT7A 1RT3B 4XPEA 2RF2A 2UXDJ 4ZPCA 5GAEI 4LVOP 3ITHA 4QR0A 1CC8A 2UUAJ 2VODA 2ZH4A 1N5TA 4PQUA 1Y11A 1OIAA 3M9MB 2DXEA 2PDAA 4M5NA 3HP6A 3TAMA 1X4GA 2V94A 4OV1A 2ZE2B 2PMHA 4N47A 3N5BA 3HHLD 2MLXA 3ZZOA 3JYTB 3ENVA 2RAQA 3SQGA 1BC6A 3LH2S 4OYBA 2DRBA 4URGA 3CMAS 5DGAA 1NHUA 3QLHA 3PFOA 1TUWA 4YMEA 4X4SA 3GJQB 4FBUA 4NLVA 2OPPB 3OSNA 3OTDA 3FQLA 3LOUA 2AD9A 2HNDB 1CS4A 1KBRA 4B08A 5CD4H 3IGNA 1NHKL 1UTAA 4QJVA 1KONA 1NPPA 2YNIA 5HATA 1FI4A 1MN9A 2RHQB 1JX4A 2HAIA 4DQSA 3DMJA 3QWUA 2OD6A 3V6KA 2KM8B 1Q81T 4IRDA 3BR9A 5G0RA 1P6TA 1FJ7A 4EYIB 2VB6A 1XR7A 4NMXA 1WSRA 3H2VE 3M1VA 4LF6F 1LW2B 2Z56B 1UVJA 5SZTA 4C0HA 5KT5A 4JI4J 1RABB 7FD1A 5AJ3F 2OPSB 1OWXA 3AA8A 3GQCA 1J5EJ 2W01A 3IM9A 2QRRA 2VG7B 2ZC3A 3GSIA 4UQTA 3AD8C 4DV2J 1NSPA 2GW8A 1F60B 1S1XB 1RT2A 3GYNA 4XO0A 1NUEA 1URNA 2EK6A 2FIUA 3EWGA 1XNRJ 1DQ8A 3W2WB 4LF7F 4YB6A 2DK2A 5CYJA 4X84A 5K14A 2HSEB 5BR8J 4RR5A 4CNZA 2Y0BB 3V81A 2W2PP 3D4JA 5H9EJ 1FFSB 2MQNA 1QJHA 1FRMA 4DQQA 3G2XA 1ROFA 1AT1B 4PR6A 2CA9A 3S1TA 3D9BA 1BWEA 4F4AA 1U45A 3RBEA 4Y28C 2AJ2A 2J7KA 2DH9A 2CQ2A 1NDPA 1TAUA 1OJ4A 4CTAB 5BYSA 2MTLA 1TL5A 2B56A 1N54B 1D1UA 2X1FA 4DU7A 3A4TA 2JRSA 3KHHA 4FF2A 2JC0A 2BXJA 5ADZA 3D5MA 3EVMA 4DV5J 3QSIA 4QZVB 1KOHA 4DV7F 2AW0A 4NL5A 3KLGA 2D74B 4DWIA 2BE9B 3UR0A 4RJVA 1Q86T 1O8BA 3RTVA 3B6BA 1M1HA 1IBLF 1RQ0A 3QO9A 2DNOA 3THPA 1GK8A 1Q1KA 3D6FB 1RBLA 2AIRB 2XZTB 3CJTA 2HRYA 1LK5A 3J7A1 2IDEA 4USWA 2J9CA 4TVAB 1RTDB 2OLWA 3W9HA 3QJLA 4MJKA 1RLDA 1LW0B 4ALZA 2P6SA 3I5AA 4AQYF 1TL4A 1N0UA 1VQNS 1XERA 4N77A 2NPFA 1KFSA 4CI0B 1VLOA 4CDIA 4FKXA 2LCWA 1T3NA 2MKHA 4F7VA 2DR5A 2OTLS 2F4VF 2K2PA 1HQ2A 5IZHA 1GMVA 2BABA 3H25A 2HVEA 5ETSA 4J9OA 1B64A 5HL7Q 5F9NA 2OPQA 2HK3A 1SXLA 4IO1A 4H4KA 3RR8A 2JNJA 2XY5A 1QSLA 1VQLS 4FPRA 2BACA 2GO8A 1AYEA 1D09B 2R4FA 3FZ2A 4I68A 1FJCA 4U96A 4F0MA 1HMVA 4YB5A 2KO1A 1XMOF 3R9LA 4MKVA 2MYFA 5D4OA 5KTQA 3MECB 8RUCA 3LP2A 2HQFA 3GYGA 4R5PB 2DGSA 2HWIA 2L3MA 4FS1A 5EHHA 1NK4A 3QNWB 2W8KA 2ZH1A 2JEGA 3H5UA 4CNYA 4ZDNA 2CNOB 2N3OA 4ANDA 1V3ZA 3BYRA 1H2TZ 1UWBA 5KAKA 4RLEA 2WW8A 3AODA 3DNCA 1N4LA 2XMJA 4ILLA 2MZTA 1ZTTA 1RA6A 1KP6A 3KJNB 2IAJA 3T6BA 1J27A 1JLFA 2P5VA 2BJ9A 4MYUA 3BBBA 3JAMU 2IC3B 4DQIA 5HK4A 3GWCA 1C0TA 2IA6A 1VC0A 4CO2A 4JBCA 3Q8QB 1EP4A 2GFFA 3ET6A 2W9CB 2GZOA 1BGXT 8AT1B 1SJ3P 2LDYA 3BR8A 3QYYA 1M5OC 3DGPB 2V4QA 3NMRA 2WOMB 4DCJB 1PILA 3IAS9 1REVB 4LQ9A 3FBCA 2VG5B 4QYZJ 3DOMA 5F0WA 2KU7A 2RS8A 3CCJS 3TUIC 2JEFA 1OO0B 2XZDB 2ZHOA 5KFZA 1VIOA 5K8OA 1R31A 5H9EK 5FDLB 4ZLJA 3MR7A 2H54B 4M5MA 4C3KA 1GMUA 1GXTA 4J9VA 4USUA 3UCZP 4OX7A 1KN6A 1RWPB 3BSNA 4RW8B 2HFUA 4V1Ak 3JS9A 3D54A 2W25A 3PCOB 4U9RA 2I5JA 2PMZD 3JQKA 4X4QA 2APOA 2KXHA 4DLGA 1U1LA 1WEXA 3MAAA 3FNNA 3JSRA 1JJ2R 2CJYB 1GTHA 4S0MA 1RHKB 3OQ2A 3POTB 1SKRA 2WHOA 1ZZNA 4Y0FA 1JQGA 3L7PA 2YKQA 4LMZA 1XK8A 1KD1T 5KFVA 1JLQB 2NXNA 1KLNA 3KK2A 2LA4A 2MPUA 1EIYB 3PR4A 2V63A 3FEZA 2HNZA 2ROGA 4DL2A 2W7PA 2DHSA 3Q83A 2QFJA 1AZSA 2ZH3A 3VZHA 4CLSA 4ZVUB 3RW7A 3CVKA 3TZYA 5E3RA 4IR1A 1U09A 4J9SA 3M30B 5C25B 4LF4F 3MPWA 3D1QA 3VAHA 4USIA 1XIQA 5LSOA 1X4FA 5KFUA 1CJVB 1H72C 1WOSA 5KFLA 1X60A 2OMOA 1HNIA 4DZ6A 1PIEA 2OO4A 4DUZF 3CCQS 1MU2B 1HA1A 3BKFA 3HT0A 3A13A 1HNZJ 1FO1A 4H54A 3Q8YA 4J9MA 1Y00A 2H48B 3BQ2A 1RYSA 2KRBA 4IH5A 4TKTA 4IO9Q 4Y00A 1YITS 2W1BA 2CDQA 4F04B 5IM0B 2AHOB 3M8YA 3T41A 4MT1A 2V2KA 1Q8BA 1JXVA 1X9WA 3F73A 1UEUA 3CD6S 3SI8A 1RTIA 4AXIA 1ZAWA 2B8QA 1LV5A 4LF2A 3TEGA 3TJ8A 4DV5F 1N33F 3UD4P 1VQ6S 3T5JA 3NS6A 2CFXA 3R2CJ 4I2PB 4I7FA 1LXJA 3B4DA 1U0HA 3C15A 4DJBA 5ETNA 4F2SA 4QR2A 4M94A 5FJ4A 4WKYA 5B0CA 3KK1A 2AT1B 4KT0C 3D66A 1NK5A 4DPWA 2AJ4A 2Z30B 3NCQA 4NYZA 5E7OB 3UVJB 1S6QB 2HZAA 1SPBP 1JNZB 1FD8A 2AYMA 2VBWA 5A8WB 4GVBB 2B4OA 4RW7A 5C5JA 1XJWB 2J7WA 4Y34A 2M70A 2C2OB 3OLBA 3LPEA 4EZ9A 3FCHA 5KFHA 2JVRA 1QTNB 3K7RA 1U4BA 2B9WA 3PNIA 2ZDPA 3MTJA 1S99A 2LEBA 2V2ZA 1HNXJ 3CSKA 3I96A 4WE1B 1K1QA 3DLGB 2XO7A 1LNQA 3BF4A 2JSXA 4KPCA 2OAUA 1WOPA 2CG8A 1L3TA 4RWWA 1N5QA 5ETRA 2WONA 1Y5IB 3LWMA 3PRDA 3ULHA 4F50A 1HW8A 2DNZA 3O1LA 4CRJA 4KY3A 2OPRB 5KT2A 1ITPA 2EC2A 2RU3A 3FVYA 3ZTPA 3MR3A 2XZWA 4Q2MA 2L48A 3NCRA 2XHWA 3PW0A 2WRMA 2OHDA 1RYRA 2D41A 2QO3A 5C42B 2ZM6J 1SL2A 4JI2J 4K4XA 1KR4A 2IPOB 1ZTWA 1RT6A 2NSCA 2JZ5A 2YH0A 2EW9A 4UZBA 2W9BA 2HHUA 2PT0A 4FDFA 4U6PA 2FGCA 1KS2A 3IBCB 3HXMA 2Y1RI 3UR3C 1GX6A 1RA7A 3HDSA 1W25A 1X4EA 2BJ1A 4JI6F 2DCUB 2RKIB 1DTTA 2J0SD 3DU5A 1WC5A 4DR4J 4X66J 4FF3A 2RIJA 3EGZA 4BS2A 2B9YA 4NA3A 1TVRA 2VC0A 1HW9A 5H9FJ 4NZ0A 1Y4ZB 1YJUA 2XHCA 2KT2A 1WC6A 2GS8A 2AGQA 1H73A 3DM2A 5EX0A 1X4CA 4OI1A 4C8LA 2RUSA 3T9NA 3HI9A 4NXNF 2KXFA 2UUBF 3PM9A 1PJ6A 1VISA 4B9TA 3KG4A 4HL9A 4FF4A 1Z2ZA 5LT5A 4HEA9 4C8MA 2W2QP 4C0OC 3CO0P 1F2GA 4IYQA 4F67A 4Y65A 5IT4A 2C3MA 3T1HJ 3EPGA 3VCDA 3IS9B 2JFKA 2J6SA 3H4BA 5DZ6A 3P96A 2A6OA 4KPYA 4I67A 3PW5A 4CO0A 2AP6A 1YZ7A 1I94F 4U8VA 4IFYA 1UEKA 4GVLA 2BJEA 2V8PA 1S9EB 2R8IA 2FHMA 1VMBA 4I6YA 1VQKS 3M8SA 4DR6J 3OR1B 4HVZA 3U1MA 2PO4A 4QIGA 3J81j 3SDEA 2MLZA 3HHLA 2ZHAA 5F41A 2RILA 2P9GA 1KOOA 2QL5B 1IM6A 3AFGA 1FCAA 1U8SA 2A1BA 1SBRA 3CCRS 4CT9A 2HQ3A 5HMZA 4ZHRA 3PACA 2IA0A 3PFEA 3ISZA 3KYLA 2I8EA 3EX7B 4ZVTB 4I6AA 2MJUA 3OXGA 3PY8A 2D3O1 5F8NA 2EPIA 2XYGB 4KAIA 5GAEU 3J80Y 2NUHA 3G8TA 2P8IA 3G8SA 4B9SA 3IR6B 2X1AA 1JXEA 4PYDA 3NWRA 4MYTA 5DRKA 5KT4A 3HT3A 3OJSA 4JYAJ 2QE5A 3G4SS 3MUVP 3CDUA 4NLUA 2JFDA 4ZJOA 1CEZA 2ZH2A 3U1NA 1PYOB 5JJBA 2CUYA 1HL6A 3PX4A 4OYPA 1HBUA 3UNGC 4PQAA 4UOFA 3I0SB 4CLWA 1R0AA 3M8QA 3TX8A 4ER8A 5HROB 3W1YC 2IYGA 3RU0A 3ZXWA 1G3OA 2ROEA 2V34A 3ZZTA 1H2UX 4KKOA 4OZ1A 4DX8H 1YG0A 2VA3A 1S1WB 1B0TA 4RUCA 1WELA 4HH1A 1CJTB 1NEEA 2ZD1B 4WP9A 4K4SA 1DLOB 3UW1A 3T6JA 4RW4A 3W9JA 4QWAA 4YQWA 5ETPA 3CIMA 1RKIA 1J2VA 1FTRA 4X64J 4KO0B 2DH8A 2X7IA 2H1YA 1ZAXA 4ECWA 3MAHA 2DGUA 5GMEA 4L75A 3SCKE 2BJ8A 2OFGX 2XM3A 4CLFA 4J37A 2GMHA 5J2NB 3THVA 1ZZFA 2XS5A 2LECA 4K2XA 4B9NA 3R5DA 4J90A 3JSMA 2H3EB 5FLXY 3M32A 2NYIA 3DRPA 2YWHA 3PEHA 3K8VA 2E7VA 3D6MB 1NJIT 5D15A 5IV3A 3G82A 4BDPA 3SBMA 1VQPS 2BYCA 4DSLA 4PXEA 1SJRA 1WC0A 3N6NA 1U1RA 4FBTA 2EFOA 2VQEJ 1G7CB 1X31C 4RW9B 3BQ1A 4NCAA 2HFOA 3W63A 1YJVA 1GT8A 2B43A 1DURA 4TLQA 2R2SA 5DDRC 5KFSA 1UCNA 4LFBF 2F7VA 1NPKA 4L3KA 5I4MA 4M5DA 2VQFJ 2KVIA 2QA1A 4NASA 1BUXA 1V5IB 1WTFA 4IFVB 5KFTA 2E7WA 4B3OB 2UVVA 1TAQA 3AHPA 1UJ5A 3CO9A 2CPHA 5B09A 2ZH9A 1MNEA 3DCAA 2RSQA 2FUG9 2ZE2A 3RUBL 1P9YA 1NXIA 2MKJA 4GRSA 4CIOA 4OZNA 1JLEB 3JYTA 4AXJA 2QT7A 5KG1A 1M0SA 1PBAA 2EXUA 3WBZA 3M6WA 1S0VA 4X66F 1IBCB 3MAQA 5DO2A 3EGWB 3ILLA 1ZM4A 3D3CJ 2OPPA 3CJ3A 5CYQB 5BYQA 2G1DA 3OT9A 2HNDA 4ID8A 4LSNA 3M8WA 1PJ5A 4DHVA 3AOAA 3CEDA 4EUVA 1R27B 3NGTA 3GV8B 4HLBA 3GIMA 4L6V3 3KLHA 4TY9A 4JV0A 1S59A 1AFIA 2R2TA 3QFWA 4OYWA 1VS3A 4G65A 5C2GA 1LW2A 3DGVA 3QRQA 3LANA 5C7PA 1EKRA 1YRTA 1UL3A 5HAOA 4B3RF 2YKNA 2DR8A 4IG0B 2XYHB 3Q8SB 1NZAA 3R8YA 3P6YC 1KHWA 4LFAJ 2PEBA 2ILYA 3C46A 2VG7A 1N36F 1N6QA 4KQZA 1BE4A 3DLJA 2XBPA 4AL6A 3W3SA 1CJUB 1S49A 2G2OA 3IWLA 3NGDA 2XCPA 1VBYA 1S1XA 2Z4PA 3BO2A 3GJRB 1BY9A 2C2RA 1NBEB 1S9GA 2HHTA 3A12A 2HG4A 2YVSA 5ETOA 3W2WA 2NYHA 2GCFA 4JV5F 3EM1A 3MM8B 3OTCA 1PCAA 5AE1A 3ISNC 3E2EA 2ZJRQ 3TZZA 2JLEA 1CVJA 4KV8B 3H0PA 4YP3A 2VPXB 1VYAA 2P2CB 2J0WA 3U1LA 2CQ4A 3CDWA 5HQ8A 1T9TA 1BXNA 5B0BA 2FZGB 4R0EA 1R8BA 1WI6A 1ICEB 4ZCIA 1P8GA 1FWPA 4CTAA 4D3HA 2DNNA 3M2UB 2AKWB 1VRUB 2M5YA 2Y0SD 4C8OA 1X5OA 1H2VZ 3GFXA 2QC3A 5L9NA 4K7QA 3G8QA 1S0NA 2E5IA 3IRWP 3K59A 4I4BA 1U1QA 3N9UC 1RXOB 4TU7A 1RAAB 4L73A 4JI3F 3TO8A 4OIXA 3C14B 3PXGa 3MUTP 1NKCA 2GJFA 3KHGA 3OXFA 1MN7A 1IWGA 3T3FA 1R0BG 4IQXA 2QYCA 3K5OA 2ASDA 4DR2J 2FYXA 3B82A 4WZMA 1KC8T 3BEGB 3Q24A 5IXUA 4WTYA 2QMXA 3C66A 4K0KJ 1IM4A 2HBZB 2KZMA 2AU0A 4F26A 3WIVA 2HHQA 2XI3A 1ZETA 5EDWA 4DSFA 4WYWA 2GQQA 4OJGA 4DV0F 3OR2A 4UY85 4OJ3A 4X64F 4WF9Q 4X4VA 4LRBA 3KLEB 4LT6A 2QJ3A 4USVA 2A0FB 3QZ8A 3CDEA 3ZZ0A 4QU7A 1R8CA 2E7XA 2RRAA 3MECA 1Q8IA 1S1UA 4USKA 1SQFA 4R5PA 2E5JA 4ZN1A 3OV7A 2O1PA 2DGXA 2FVQA 5K5MA 2EFGA 1RHRB 2UUWA 3R5GA 1TV6B 1BQMB 2BMBA 1JWWA 5F8MA 4DPTA 4X65F 3TAPA 2IY5B 4O23A 3WDOA 2E1RA 1T9VA 2E5LJ 4CLLA 4W98A 2WVFA 3G87A 4YB7A 4F36A 5DJBA 3CCZA 1RAFB 4EMDA 2ABYA 1U1NA 3HFZB 2W9AA 2UVUA 4ERDA 1F3VA 3FRYA 3NRBA 5EN1A 1HPZB 2VFVA 4EO8A 1U8WA 1KVKA 2VQFF 2GNKA 1E6VB 1HNWJ 1DJ0A 4KTQA 4FVCA 1SJ1A 2V4JB 2WTFA 4YDDB 2IC3A 2DXDA 4DPYA 4B3TJ 4OHYA 1RTJB 4N8OA 3SSQA 2ERRA 2JEJA 1F6TA 2W9CA 3TNVA 2Z2YB 2ZOFA 4FPIA 2NLWA 3AD9C 2LVWA 3DGPA 2YNHB 3MM7B 1D9FA 4AT1B 2WOMA 1EZZB 1S6PB 1REVA 3M9NB 2VG5A 3JSYA 3RAMA 5FIIA 3N79A 4CH0S 3G96A 5I42B 3NCPA 5F9LA 1ZPWX 3TARA 5LMUJ 3C3LA 1SH0A 3LP1B 2KZZA 5FDLA 5DQHA 1KWMA 1WC4A 2CPDA 2GQCA 1ELOA 1GNKA 1G6BA 1RACB 2RNEA 3MF5A 3W8GA 3TUZC 1H98A 1ZM2A 1F1BB 1IBKJ 3J7YI 3ETMA 3KMSA 2RS2A 1RBAA 1RHJB 1N8RT 1SKUB 4TNOA 4O44B 3AJDA 3BGFA 3KDNA 1LWCB 4MH8A 1OQ3A 2OFHX 3GR0A 4R8UB 1TUGB 3GFHA 3POTA 1U1PA 3KNAA 4ED6A 2YPZA 2ZBQA 4KH1B 2ZJQQ 2CADA 1JLQA 2G2YA 1HNVB 4HACB 4ZVFA 4N76A 4DR7J 1RBOB 1UETA 2RH3A 2IVFB 4G6VB 3GV5B 3LP0B 4ECTA 2LLZA 1Y5NB 4X62J 2ZVIA 4XTTA 4Y2MA 3MMBB 2CQDA 4OZLA 4WXOA 1F5BA 4CP5A 2QLFB 1YX2A 4ICLB 3M30A 4O3OA 5C25A 1NDLA 5B7WA 4B9LA 5F0UA 1CJVA 1XMQJ 4IRKA 4LFCJ 1URRA 3BN4A 4ZN3A 1UA1A 4YFUA 4KGXB 5C24B 4JV2A 1NLKL 4MIAA 3BSCA 1MU2A 2ZVSA 1MROB 1NH8A 3MFHA 1IKWB 4ETZA 2R7RA 1XQIA 3C6TB 1BHNA 1ZPVA 4ELUA 4F0HA 1ULRA 5I3QA 5KFRA 4P2XA 3A8JA 3K17A 5IM0A 5EUHA 2DVIA 1U47A 1WF2A 2J8AA 2F65A 1IBMF 4DL3A 3FEYB 1VDHA 4CLZA 6AT1B 1T9XA 1S4FA 2BE2B 1FNMA 1HHSA 2WVBA 3N0VA 2FC8A 3GB0A 2FJBB 1Y3KA 4NMLA 2POKA 1RAOA 3H5SA 3GIRA 2QA2A 2HNYB 2LQJA 4Y2IA 1QAJA 4P6QA 4ZCKA 4ZJLA 4NXMF 4NLGA 3C8YA 3UPFA 4U95A 3VAGA 3T1AA 3TI0A 1H3DA 2UUCJ 3UVJA 2BANB 1S6QA 2I6WA 1I6JA 4C98A 3HKWA 2VICA 1VLYA 4DR2F 2XCAA 5A8WA 4GVBA 2JLGA 3M4XA 4PPDA 4C2MA 1Y0HA 2I9SA 3L7OA 3DN9A 3CDAA 1WACA 3KLVA 5MLCV 2FB0A 5E3QA 2DY9A 4EI2A 4CM0A 3U7JA 4WE1A 4O3PA 3NY0A 3DLGA 3CXCR 2CPIA 2HZCA 1N34J 2D7SA 4J9RA 3GIJA 1NK0A 3THTA 4IOCQ 4FNIA 3QT5A 2E9RX 3EGNA 2U1AA 4RU2A 1Q5YA 2OPRA 2B51A 4OLOA 1IKXB 2SXLA 3LWLA 2DNRA 2DO0A 5KG7A 1R89A 1S9FA 2M4MA 1NK6A 3NL0A 1VJQA 1OY8A 4Q7AA 2N4CA 1V3SA 2EKYA 1Q4RA 2QA4S 1TMMA 2E1CA 3PW2A 1HYSA 1UMJA 1WTBA 1P1LA 4PRFA 1J5OB 2Y1IA 4W4MA 2Y1JA 1CBKA 4DR5J 3R3TA 4V19J 2DXFA 1SL1A 1UZHA 2RKIA 3R27A 1KQGB 3AB4B 1MW7A 5D0EA 3QGPA 5J1PA 4GC6A 4N8NA 2DGQA 2RUGA 3TUPA 2ZUGA 2E9ZA 1PSDA 2R2UA 2ZWPA 4DV6J 4MK8A 1HQEB 4OYOA 3MPUB 2JL9A 3R1HA 2BW7A 3IRXB 3J81U 2VFTA 4QWBA 2K06A 2AGPA 4URQU 1M5PC 1YI2S 2R8GA 1VQSA 1VQMS 1Q5VA 3O5TB 4CLTA 4CH7A 2K8GA 2MJNA 3A8KA 1B0PA 3FDSA 3SCIE 2YWGA 2QIFA 4OHZA 5HMYA 1R43A 5AE2A 1NB7A 3HSGA 3IWNC 2H5EA 4OYZA 2ZBRA 1EAYC 2NXEA 2MY8A 2N7CA 3MPDA 3IFEA 3KXDA 1S9EA 3W64A 1CLFA 3M2RA 3OR1A 4ZVSB 2C2EA 4C8NA 3OSPA 1VCTA 1U49A 2ZNYA 3NXZA 3GTYX 4KR0B 1FESA 3RG6A 2WB4A 4MMOA 3PX0A 3KKFA 2DGOA 1JLAB 4ED1A 1YZ6A 4DFMA 4HHHA 3D0IE 4DUYF 1ZM9A 2BJ3A 2VD3A 4DR7F 2R7UA 2F63A 3AQOA 4WZQA 4OX6A 1PGZA 1SL0A 3HULA 2R7SA 2RHSB 5JMNA 3TZXA 5D6GA 3FGVA 3QJPA 3DRSB 2UP1A 1Q82T 2HZVA 4DX7A 1AUSL 5T7LB 2B6AB 3M8RA 4RWXA 2CG4A 1XMQF 4WYLA 4LFCF 4M8LA 2WK4A 3MOZA 4M63A 5A8RB 5A8KB 3DRXA 4CO5A 2E1MC 2XNRA 2ZWOA 4RO0A 4RL1A 2LA6A 2VF3A 3HZGA 4ZPVR 4OHXA 2MEWA 3CIZA 2QEXS 1JLGB 1AUDA 2V9KA 2XS7A 3CD0A 4CYUB 2ZUAA 2NXCA 3KG0A 3M7VA 4I56A 5E3CA 3W61A 1C4AA 4J5OA 3L9ZA 3CJKB 4XIUA 3I0SA 4J9UE 4A8KA 1VK8A 5HJYA 3ZZRA 3SV4A 2LP4A 1K47A 4WP3A 2MQQA 2DRDA 5L1LA 2L41A 4OYAA 2RVJA 3H20A 2RE1A 1BQNB 4NRTA 3B78A 1R8AA 2ZZNA 2DGWA 4HDHA 1S1WA 4Z7YA 2LQ9A 1MG7A 1FDBA 1CJTA 3W7BA 2ZD1A 1DLOA 2VKRA 4NLSA 8ATCB 1EKSA 3R6GB 3BPSP 4O4GB 3S01A 1UP1A 4KO0A 4B3MJ 1YWXA 2VPWB 3GJTB 3V6HA 1DARA 4IOBA 2UUCF 1KTQA 2B9XA 3CCUS 4IG3B 4UTGA 2UXCF 4B9UA 2AGOA 1KQFB 5A2QY 4PWWA 5J2NA 2G1HA 4A48A 1WKKA 1OPIA 3NNHA 3DLBA 1RT7B 4Q43A 1HQUB 1TU0B 4A8FA 4NA1A 4DI6A 2YH1A 4K59A 3VF0B 3QT6A 3VVUA 4FYDA 4P7TA 3K5NA 4MIWA 2BVZA 2BOAA 1W2BR 2F5GA 3CJRA 2OTJS 2KT5A 2KYXA 2ZDOA 2LDIA 3HFKA 3G6XA 5KFJA 3OFFA 1HWKA 4PEOA 1U2CA 1G2EA 4LF9F 2HQIA 1YIJS 3NGSA 2UV8A 3H7HB 2LXUA 1QE1B 3ADAC 1HBMB 1T94A 3R1LA 5IS2A 4RW9A 3K5PA 1D9DA 1PYSB 1SC1B 2LQ8A 3RBXA 3MTKA 4N56A 1RWUA 4UF4A 2R42A 4OZ5A 4RUBA 2DEIA 2KKHA 4NCBA 3PYGA 3PYFA 4IFVA 3MCMA 5J2PA 4KB7A 4B3OA 4OHVA 2ATCB 4DR1F 2VUGA 3E01B 2V2VA 1GMWA 1UVMA 4DV7J 2ZHBA 3ZO7A 3R2DJ 2IM3A 3MWBA 5KOXA 4RU9A 1RU2A 1JLCB 2DO4A 4ED3A 2B5JB 4PQUB 1JLEA 5IWAF 1YBTA 2VDHA 3GMGA 3OBIA 1AFJA 1YQHA 4J9LA 3NS7B 1IBLJ 3GPAA 3CT9A 1IXKA 3MR6A 2N82B 2ASJA 4TYBA 3LTOA 3Q8UA 1F5CA 3F56A 2CQHA 4WFXA 3NNAA 5CYQA 5EWFA 3MM6B 5DLGA 2DITA 5F8IA 2A10A 1OSDA 1U1MA 3CULA 1T7PA 4L74A 2V2QA 2CQPA 4RBTA 3SCLE 4YR2A 4ZP6A 3GCXP 4UQGA 3ENWA 2ZH8A 1TP7A 4FXVA 5KFMA 3SSRA 4F2RA 1DY3A 2VBZA 4O3SA 2HRTA 1OS5A 2YBVA 4OX9J 1B3TA 4YEAA 3IWXA 2P9EA 2CPXA 4IG0A 3VHQA 4CZCA 3CJSA 4KHPF 3KMQA 4A8OA 2J0XA 3QT7A 3LAMA 2C42A 2CQIA 3Q23A 3R6LB 4K4YA 1HI1A 1CJUA 1NPRA 1K73T 3HF5A 1XMBA 1FKPB 3EVWA 2DR6A 3UN3A 4DF8A 4RBUA 3EE3A 3A8EA 1WF1A 2LU2A 1HR0J 2YKAA 1NK8A 2G0JA 3K5LA 1NJYA 3GG1A 4Q0BB 3MM8A 1JJCB 1RT2B 2GQ2A 2GAHC 3BBCA 1AB8A 3K0JA 5ETQA 1L3KA 3M6VA 4CLKA 1CULA 1SI9A 1UPMB 4ILMA 1KEKA 1FTCA 1H7XA 3BSAA 4E8UA 1FERA 3CJ5A 4Z7CA 1SH3A 1QSYA 5CCMA 3M2UA 2DEJA 4NCGB 3ZZPA 1VRUA 2HWTA 3ICLA 2J9DA 3KJQB 1DRZA 4F4YA 2C22A 1IKYB 2HAFA 1YBAA 3CJ2A 1NDCA 1VC5A 2CZ9A 1FVSA 4X4TA 1LKZA 4OQJA 4ECXA 4IUFA 4J9PA 1Q78A 3V6DB 2E5GA 3I5CA 3J7Z5 3M9OB 4URSA 3ZNUA 3C14A 3K89A 4QW8A 2RB7A 4HKQA 2F8MA 2A6MA 2ROPA 3FZBA 1RLCL 4LF1A 3MMJA 1F0XA 1AXQA 5HQMA 2NZCA 5K8NA 4FXWA 4TU8A 4ZP8A 4FXDA 1RZMA 2HPUA 3FKBA 2BKNA 3H5XA 1UFKA 1U25A 1OSCA 2HEKA 2WW4A 3TWZA 3J7YU 3AY0A 2BQRA 3MXHP 2R8KA 4Q8FA 1NH7A 1C1BB 4F25A 2G9OA 4MFBB 3W5XA 2XY7A 4FKYA 4B3MF 3I87A 2DTJA 1PYTA 2L9WA 2CKWA 3KLEA 4O0IA 2AF6A 1JLBB 2BX6A 4ECZA 2IVYA 1IJFB 2OPQB 3WC2A 4DN0A 1UJ4A 1NKEA 1RAIB 1ZAVA 4QOTA 4OJHA 4F4ZA 4ZPBA 3L4BC 2YX4A 1FEHA 4LF4J 2P9CA 2JLFA 4DPOA 3A3PB 2C2NA 1S5ZA 1M5SA 2FDNA 1V9OA 1VBXA 4RW6B 2KFZA 4BLGA 3NNCA 5E3PA 2GMLA 4ECVA 3LP2B 1WOOA 5KG0A 5CD4A 1TV6A 1BQMA 4DUZJ 4UUWA 1U7LA 4F4XA 2PFFB 4XDDA 1FVQA 3PRVA 4Q5VA 1TK0A 3BDPA 3SSSA 5LXYA 4DS4A 2HLUA 1TK8A 2AZ3A 2BBEA 3CMQA 4DF4A 2Q3PA 5KFDA 3C6UB 3H2LA 2HQGA 2ILZA 5CYMB 3HPOA 1TKTB 4ZCMA 2F4FA 4M5HA 2MQMA 4QWEA 1HPZA 2IBOA 3HD1A 2YTCA 4OI4A 2OUGA 1KNZA 1E6VA 2M9KA 4C3MA 7AT1B 4OI0A 3D1OA 3V4IB 2V4JA 2R7OA 1UJ6A 1X4BA 1N33J 4CCHA 1I1GA 1S0OA 2CJAA 3LALA 1RTJA 4O0NA 2XGPA 2XNQA 3PEJA 1GEHA 4DCPB 9RUBA 1B4SA 3GLJA 2HHXA 2MZJA 3GFYA 4PWDB 4OI2A 2YNHA 3MM7A 4WTOB 1S6PA 4KSEB 5KT6A 1C4CA 3QJJA 3GR1A 3QPIA 2DPIA 1GXLA 1WC1A 1WEYA 2NREA 4M5GA 5JVGQ 5I42A 3CCMS 4C11B 1RWKB 3DDIA 1S7HA 1TMJA 3LP1A 4QIEA 3ZTRA 2VDIA 2IBKA 2YQ0A 3OUYB 1CQNA 2PA3A 4O3NA 1YRUA 4P75A 1ACMB 5B0AA 5E33A 2ZC4A 3TVZA 2DCLA 3MEDA 4O3QA 4WFZA 1X5SA 2V69A 3RAQA 3D2WA 3KLIB 1RWOB 4GMKA 3F41A 1VIXA 2C2DA 2A18A 1FFWB 4FYYB 4X4PA 2V6AA 3TANA 1M5HA 2DKOB 5KFCA 4O44A 4IH7A 2I1RA 1LWCA 4WU3A 4DV1F 3KHRA 4R8UA 3EPIA 4OZ0A 3IAM9 1H74A 5DM7Q 2CQBA 4ZS6A 4OX9F 3UNYA 1X5TA 4QWDA 1HNVA 2NXUA 4HACA 1UPPA 3MMCB 3O44A 1QDUB 1VOMA 3OFHA 1ZA1B 1OYDA 1QAXA 2G0IA 3NOCA 1RCOB 3WX4A 3LP0A 4R0JA 5L1JA 1VRTB 4USHA 4Y2CA 5KFQA 3MMBA 2AEFA 2JJ4D 1H38A 2MY7A 4ICLA 3UCGA 4DXLA 5LSLA 2VOPA 2CVIA 2HNZB 3EICA 1HR0F 1EJ7L 4PUOB 4WIQA 3UDVA 5D77A 4F3OA 2DISA 4C48A 5C24A 5L39A 4G1PA 3G9CA 2V8VA 1MROA 1IKWA 4JI6J 5J2QB 2V4RA 2V5HG 3OFGA 4Z37A 3C6TA 2CPEA 2AJ1A 1FX2A 2J5AA 3MGJA 1VHFA 1T9YA 2EEYA 3OLAA 2R2RA 4XK8C 1C0UA 3R5AA 2EC0A 2WVDA 2QLWA 4OYXA 1YLXA 1JXLA 3P5TL 2I38A 3N5FA 1RSCA 3VTIA 2YQ3A 1X4AA 3T5HA 4KHMA 4NXNJ 2NR0A 2UUBJ 2MKCA 2BE2A 2ATLA 2EI5A 3BKUA 4LIRA 4P52A 1LFWA 2EVZA 1IR1A 3VGTA 2XMKA 1NRKA 2AX0A 4LJMA 5GADI 2HNYA 2K7KA 2B9EA 3P49B 1YJ7A 2XMVA 3TQ1A 2MKIA 1LWXA 2DHAA 3I56S 3RW6A 4IRCA 4WFAQ 3IO1A 2BANA 2ALZA 2ZBCA 1O51A 4HYKA 1I94J 4EO6A 1L3UA 3HJFA 5JUMA 1VJWA 3RAXA 4HI1A 4YUDA 1QLNA 3HKZD 4ELTA 1QY7A 1PG5B 5DM6Q 3S7RA 3CUNA 5JVHQ 1VQ4S 3U02A 4J9QA 4K4TA 2KI2A 2R7QA 1BLUA 2ZZMA 3H8YA 1FJEB 2GIRA 4YS2A 2C28A 3ETOA 2J7UA 1UAWA 2LEAA 4LR9A 2QYGA 1D0EA 2IRUA 1N0VC 4I2QB 2FHOB 1YK9A 3HM9A 1LWFB 4CO1A 1IKXA 2BRLA 4ECYA 3I31A 4PZVA 4UUXA 1WUUA 2HBYB 2HHHJ 2Y8WA 3IGVA 4B9VA 4WFBQ 2UXBF 3OVAA 1S1TB 3NAIA 2W4DA 1FT8A 3R7BB 4AE5A 4TYAA 2E5HA 3PJXA 4F3MA 5KFKA 4HTJA 2HFSA 5LXRA 1J5OA 1RWXB 1RGVA 3W5ZA 3BKTA 3UN2A 1S6UA 3QWPA 1RUSA 4NX9A 1JJ4A 4U7UD 4K4ZA 4JI1F 1HI8A 4WWSA 2ZKUA 1VQOS 3SMZA 1UVNA 2R7XA 1XWLA 4YR3A 1QAYA 4U8YA 2KT3A 3I0RB 3HHNB 1NJWA 4TN2A 4L72B 2LXIA 2IYIA 5HQLA 1HQEA 1FDNA 4OLPA 2D3OR 4WJBA 2G4BA 5I3UB 5GAHI 3Q22A 3IRXA 3CD5A 2G13A 3W5YA 2FVCA 2CVEA 2UVWA 3SCJE 4QW9A 3R5JB 2IM2A 4YDXA 1BQXA 2C2ZB 2CAJA 3D3BJ 1Q79A 2MGZB 1RJJA 2BW2A 3M6UA 3N6LA 2Z57B 5D0RA 1T0TV 2PC6A 3GFZA 3F0NA 4UY8T 3W65A 4NLRA 2MDAA 2HRUA 3IM8A 2XWYA 2A3JA 2VBYA 2XO6A 1DQ9A 2HKEA 4NWBA 5J2MB 3IMQJ 2DIVA 1M5VC 1UFLA 2V0NA 4YY3J 2L08A 4TLRA 3JAMY 1YSJA 2ZBPA 3FBFA 1FE0A 4FS2A 1JMTA 4HH0A 5LSRA 5L38A 2XMWA 2HBQB 1UW9A 3QGHA 1QAIA 3LGMA 4QYZK 3QIPB 1JLAA 1RB0A 5DQIA 4GO5X 4DPXA 1Y9OA 3JTOA 2MQLA 2O66A 4LIWA 2XLKA 2W4CA 2GA7A 4LFBJ 2Z2ZA 1CQMA 3MM5B 5A6PA 2HHWA 3DRSA 3NGUA 3DYAB 2RDJA 4JI8J 4NRUA 4OMFG 4HR2A 5T7LA 2GMJA 2C2KB 2O5DA 4N41A 2B3TB 4DSKA 1RK8A 1F9EB 1NJZA 3NWGA 5A8RA 5A8KA 3WHIA 3B8HA 4DPUA 2XI2A 1QUVA 3VGUA 1JLGA 3ENAA 3UD3P 4CYUA 2Q6CA 1SIZA 4USTA 1K8AT 1KVJA 1O0PA 1VQ8S 1KRPA 2MZSA 4C8ZA 1SB6A 4DDFA 3CJKA 2FZKB 1UWAA 2MHEA 3GCWP 2QSFA 2VA2A 3AJ1A 3TZWA 2XQCA 2HVZA 4ZVQB 4ES3A 4FVMA 1TL1A 1Y10A 3MFIA 2KHDA 4WFYA 1MWYA 5B0EA 1BQNA 3Q8PB 3CDBA 3GJSB 2FJAB 3BGRB 2QL7B 4AL5A 5IQ6A 4A4JA 3ISND 3EZUA 1T95A 2IM1A 2EFQA 2F8HA 4LREA 4O4GA 4B3RJ 4GKJJ 1HD1A 2VBXA 5A0YB 3NGKA 3HK2A 2ASYA 2VKZG 2GVZB 1ZM3A 1K9MT 4OJ1A 4IG3A 1N36J 2FLOA 3NBPB 3I32A 3GU0A 2ASLA 1FEEA 3K8WA 3Q8RB 1VC6A 2B8PA 1RT7A 2BQUA 4AUKA 2IJNA 1HQUA 4OZ3A 3QRRA 1X7VA 1T03B 2OIHA 4TU9A 1JK9B 3CTRA 4JV5J 3CC7S 5U47A 1U26A 5SUHA 1B7FA 4ZVHA 5DG9A 4M5KA 2FJWA 3LGNA 2CNNB 1RAHB 1C1CB 4J91A 1QE1A 1HBMA 2MQOA 1HKAA 1IJEB 3KLFB 2MLYA 3OTEA 2X3DA 3E8OA 4C8KA 3TW0A 2XSJB 2WB1D 5J1EB 1B99A 3SEOA 2FHJD 2C3UA 1VI7A 2BKPA 4GO7X 2FTRA 1R6VA 3BSOA 4ZPDA 2HHHF 5K9FA 4ECSA 3E01A 3KG1A 2XY6A 4ZVOB 2BRKA 2ZNZA 4M5DB 1IQTA 3BO3A 1JLCA 1REGX 1TKZB 2M8HA 2B5JA 4JI3J 5EWGA 4YOEA 5HJXA 1U48A 1OMSA 2DH7A 3GILA 4IKAA 3RBZA 3CMES 4J7CA 2DB1A 3M2VA 3W2VB 3HHKA 2OJ3A 2J76E 3CW2C 2DNKA 2JVOA 2E44A 1RAEB 2VONA 3OXLA 4NLTA 2GAGC 5ETTA 5KG5A 1FF2A 4KGZB 1RCXB 3US5A 4J9KA 2OKQA 3FC9A 2DHHA 4JI5F 4NE9C 4DV3J 1SKSA 3MM6A 2EFVA 3FCVA 3PHTA 4F02A 4P71A 4JOUA 3RGIA 4RNMA 4WBFA 2BJDA 1DBDA 3OW2R 1S97A 1NCLA 4OV6A 2GGPB 4DV0J 1S6OA 2ACMA 4LSNB 5KFXA 1N48A 3P4UB 3KUGA 4NLOA 1FWKA 3KLHB 2D3UA 1PAEX 2VG6B 3OJUA 2YNFB 5AXKA 3H2UB 1CJKB 1DHMA 3RB3A 1UZDA 2R8HA 2E9TA 4DCOB 4QR1A 5ETMA 1VRQC 4ZIWA 2EKNA 3DOKA 1N88A 4DL7A 4JI0F 2BA9A 3MD1A 2W2MP 2QMWA 5KFYA 5H9FK 2YKNB 4YY3F 4NA2A 3VWSA 3VVTA 3RB0A 2XMTA 5H1SV 2IHR1 1FKPA 3PZPA 4I0WA 4EBCA 2ZBIA 4PXDA 3AXMA 4I69A 4X65J 3DRYA 1N6QB 3HVTB 2XSFA 3IG1B 1L5UA 4DLEA 4ZMMA 4NZ6A 2JX2A 3DRRB 1RTHB 2N7YA 2CQ3A 4NLXA 4Q0BA 1FD2A 3UDEA 2MZRA 3BM7A 3PRBA 3NKYA 1S9GB 1H6KX 3EZOA 2V8DA 5KFFA 1X4HA 3ZZYA 2NXJA 3I82A 1RT3A 2HFZA 2AQ4A 4H4OB 4LRDA 5CZVA 2F9DA 2Q6BA 1A0OB 5GVQA 3G6ES 5HLFB 4JI8F 5DETA 4FP9A 3OD2A 4MKBA 2H9ZA 2EFPA 4NCGA 2YWWA 1NO8A 3NOGA 1PC5A 1Q0NA 1IKYA 1VBZA 4U7CA 2VPYB 3UDCA 2JWNA 4KBIA 2MB0B 3V6DA 2QLBB 1SJFA 1DAXA 2IRXA 4R25A 3QQCD 1HFEL 1DZ5A 1S1VB 3CCTA 1D8YA 2OD4A 3G6YA 3I6PA 2V8GA 1GX5A 3LUYA 1N5SA 2CQ1A 1P1TA 4LR8A 2N4DA 4DV4F 3QFHA 2PE8A 3Q86A 4GKKF 3AOCA 3BH6B 1XN9A 3BH7B 4RNOA 1HBOB 5EGYA 3SFGA 1LWEB 1C1BA 4KGKA 3RRGA 5LMNF 1F2HA 3M8PB 4IOAQ 1BD6A 5GMDA 1SV5B 2HFNA 4UT4A 4ZOSA 3JSBA 4K4UA 3ONQA 4GKJF 2OPSA 4MFBA 3H59A 3PJWA 3MR2A 3VALA 2JDJA 2M2BA 4KFBB 3LF0A 3EGVA 1UKUA 3Q89A 3OR2B 1JLBA 3LO3A 2C3YA 2M3DA 1R8HA 4RKUC 4A8MP 2M88A 3PIOQ 2Q66A 1T8EA 3VAKA 3RB6A 2C2MB 1D9AA 5M2PA 5LL6d 4RW6A 1X0FA 3QATA 3D7SB 2ZJPQ 1FHTA 1A7GE 2FVPA 4QIFA 1S1UB 1LEOA 5L46A 2R7VA 2PSZA 3QMQA 2LFVA 1MLAA 3DI6B 2O67A 3NP5A 3LAKA 2IJFA 5IQQA 3BGUA 5BXIA 1NSAA 2KFNA 2JH3A 2EWHA 5IC6B 4ED4A 1E6YB 4QYRA 3C6UA 4UOGA 1RADB 2F9JA 1TKTA 2UV8G 5CYMA 2H51B 3A8IA 2H5JB 1SC3B 2CPJA 3W66A 4JB8B 3A1YG 4U7UK 1QUPA 2DRAA 4QIWD 1IBMJ 5KFIA 3Q0AA 4DEZA 3V4IA 4NLDA 2CJXB 5T14A 4WPAA 4ZVPB 2D9OA 2UXDF 3R7NB 3OHAA 1WC3A 2GC8A 4NEZA 2VIHA 1WHWA 4RNFA 1ZS6A 2UUAF 4PWDA 2Z0GA 4DUTA 4ZVGA 3HX9A 4DX6A 3NG8A 3UE2A 4NXMJ 2BZ2A 4I1TA 3SV3A 5A76A 5GADU 2CJBA 2FLLA 1T11A 3KUEA 2ZOGA 4PABA 3MEEB 4C11A 2KXNB 1IUJA 1RTDA 3DXSX 3OUYA 1WG4A 4BWMA 2DIUA 2P6TA 1TQLA 1B0VA 1LW0A 1RT5B 1Q95G 3T5LA 4DV3F 2YKMB 1C2PA 4K4VA 2DNMA 1RT1B 1K0VA 2AX1A 3W8PA 4Y6IA 3KLIA 1GMWD 4M5IA 1VQYA 2UUTA 3OTOJ 3TP2A 3DLHA 4X4OA 2WAQD 4P2MA 1HHQA 1KQSR 2KJWA 4NZ7A 1CG2A 4H4MB 2VZ9A 3VGSA 3D68A 3FBEA 1UW4A 3PKMA 2FGOA 1RTZA 3V6JA 1FJGJ 1S48A 1TKXB 1U6ZA 2HURA 2NSBA 3WX8A 2FJVA 3TX0A 4CT8A 3HHLC 4NLYA 4ZA1A 1KSPA 3C16B 3MMCA 5DDOC 2MMYA 4CH1A 4KJIA 3EXYA 2EG2A 3QAUA 1Q16B 3DFEA 3FSIA 3FSXA 3X1LB 3PO5A 2RRNA 3RYLA 1VRTA 1FX4A 4KGMA 3W9IA 4JI4F 3D6TB 1HLWA 4MTPA 4BC9A 4F0KA 1J5EF 2DNQA 2QGFB 5A6WA 1SJ4P 2G2ZA 4ZIVA 4MKAA 4EGLA 4LF8J 4KC5A 2RDDA 4DV2F 3BBFA 4PUOA 1HWLA 2NCKL 1S77D 3GYXB 3BO4A 4RUAA 2KVQE 2WZ1A 3CJQA 3ZC4A 2J9DE 4Q44A 1XNRF 1FRXA 1UEVA 1HBNB 3GE9A 2AYBA 5D0HA 3OVBA 5J2QA 2Q79A 2GJIA 1DFDA 1ZOTA 5DG8A 3CF5Q 2GIFA 5HVGA 5BR8F 2CQGA
chains in the Genus database with same CATH topology
1EETA 1ZAXA 2AYEA 3TYTA 4ECWA 2ROPA 3MAHA 2DGUA 3SCKE 1NAQA 3D1HA 2WONB 3FZBA 2OFGX 1IQZA 5KFPA 1FRIA 1Y3JA 3MMJA 3HVWA 3PW4A 3CD7A 1F0XA 1AXQA 3P3DA 3PW7A 3CC2S 2Z2MA 5E5NA 5K8NA 4FXWA 4TU8A 2DBBA 4ZP8A 4FXDA 2IFXA 4J37A 2HPUA 2HHSA 2GMHA 3CB4A 5J2NB 3THVA 4M95A 3H5XA 1ZZFA 2XS5A 1ZBTA 1V6HA 2LECA 3H5YA 5DLFA 1SIWB 2LKZA 3NMAA 1JKHB 4K2XA 1Q53A 1U25A 4DL0C 1OSCA 3R5DA 4B9NA 3FJ2A 1WF0A 3CCLS 3JSMA 2BR0A 1CPZA 4X62F 2XWXA 3J7YU 3K2YA 3AY0A 1RT6B 1SKWA 2X1BA 5FLXY 2RJZA 5GAHU 3M32A 1PC4A 2NYIA 2BQRA 3Q2TC 1MSWD 2HGLA 3MXHP 3DRPA 2YWHA 2R8KA 4Q8FA 1NH7A 3TA0A 1C1BB 4F25A 5E2QA 3GZ7A 3PEHA 3K8VA 2G9OA 3JTNA 4F8RA 1NJIT 2W9BB 4LSLB 4PG8A 3L95X 3DOLA 2MSSA 1FA0A 1KQKA 4NYPA 4AL7A 2IRYA 4BDPA 1VQPS 3HMJG 2BYCA 4DSLA 3EYZA 4MFBB 4PXEA 2XY7A 1SJRA 3N6NA 3QGGA 4XAKA 1U1RA 2ZITA 4B3MF 3SYZA 2CJ9A 3G6VA 3I87A 4RBVA 2PI5A 2DTJA 5IFMA 2L9WA 4FBTA 2FHKA 3MMAB 2EFOA 2KRRA 2CKWA 3F44A 2Z2LA 4OHWA 3KLEA 3KJVA 1UVLA 5CZXA 4A8QA 4I64A 4O0IA 2GHPA 4EBDA 1G7CB 5IT0A 2AF6A 4RW9B 1JLBB 4RW8A 3BQ1A 2DNGA 1DTTB 1F9FA 4NCAA 2B0GA 2HFOA 4ECZA 5LJ3Y 1YJVA 2IVYA 1HHTP 1IJFB 1GT8A 3LW5C 2OPQB 4M1KA 3WC2A 2B43A 4DN0A 1DURA 4TLQA 2WCXA 3O8WA 2R2SA 4LQ3A 3SZ2A 5DDRC 3M05A 1GTEA 3AJ2A 1UJ4A 1TR0A 1NKEA 2HW3A 1ZAVA 5KFSA 3CJ0A 4QOTA 4OJHA 2F7VA 4LFBF 4F4ZA 4ZPBA 2GHWA 2YX4A 1FEHA 1TVRB 4M5DA 5I4MA 4K5SA 2KVIA 1IR0A 2QA1A 4NYOA 3QAEA 2P9CA 2HVIA 1YVFA 5D3GA 2JLFA 2R7TA 4DPOA 1RT4B 1WTFA 4IFVB 5KFTA 3UFCX 4EBEA 4IDKB 1M5SA 2E7WA 4B3OB 1K0TA 2UVVA 1TAQA 2FDNA 1V9OA 4OZJA 4RW6B 1VBXA 3DM2B 3CPWR 3RRKA 2KFZA 4G3IA 4Q2LA 3AHPA 3NNCA 5E3PA 2E66A 2GMLA 2WBMA 1UJ5A 3CO9A 4ECVA 3LP2B 2ADCA 5KG0A 1ZH5A 4MIBA 1TV6A 1BQMA 1TL1B 2CPHA 5B09A 2ZH9A 2HMIB 4UUWA 1U7LA 4F4XA 2PFFB 1MNEA 3DCAA 4XDDA 2HS4A 1FVQA 3D28A 2RSQA 2FUG9 2ZE2A 4Q5VA 1R6YA 1TK0A 3C2PA 3BDPA 4CIOA 2MKJA 3ZZUA 3WC0A 3SSSA 4OZNA 5LXYA 1JLEB 2VASA 2HHPA 3DDKA 3OL8A 3JYTA 1H7WA 3I5BA 2DNPA 2AWZA 4DS4A 4AXJA 1TL3A 2HLUA 1TK8A 2BUNA 2BBEA 2QT7A 2RDIA 2YKOA 4Q8EA 5KG1A 4ES2A 1QVGR 1M0SA 5CXTA 4DF4A 5DQGA 2Q3PA 5KFDA 4LVNP 3B4MA 2FVSA 3C6UB 3H2LA 2KTQA 2C3OA 2ILZA 4DN9A 5CYMB 3HPOA 1TKTB 1WHVA 4ZCMA 5KOWA 3WBZA 1S79A 3M6WA 3R5CA 2MQMA 1S0VA 5F3TA 2VFRA 4X66F 4I2QA 1Q7YT 4ZLPA 4QWEA 1HPZA 4NLWA 3RR7A 2W8LA 1JNRB 3MAQA 2RMLA 3RZAA 1LWFA 2IBOA 3UQSA 2FVRA 4UOCA 5DO2A 1IKVB 1N56A 4W90B 3EGWB 3E51A 4OI4A 2YTCA 4DBQA 1N5YA 1IN0A 1KNZA 5D78A 1ZM4A 4EZ6A 1E6VA 2OPPA 2M9KA 4C3MA 3DLEA 5M2UA 3CJ3A 5CYQB 2AJ0A 5BYQA 2G1DA 4OI0A 3D1OA 4X4UA 3MM9A 5CA5A 3V4IB 2V4JA 2HNDA 2R7OA 4ID8A 3FFIB 4LSNA 4DFPA 1UJ6A 1A9NB 1X4BA 1U6FA 3PDNA 4CCHA 2X51A 4DHVA 3CEDA 1TUVA 4ILRA 4IFYB 3IC1A 1I1GA 1S0OA 5E0OA 2CJAA 4EUVA 1S1TA 1R27B 3LALA 1RTJA 3GV8B 4K4WA 2XGPA 4ED2A 1R8PA 2XNQA 3PEJA 4HLBA 3GIMA 3JB9k 2FY1A 4YOEA 5FD1A 4L6V3 4TQSA 3KLHA 4TY9A 2BDPA 2PA8D 3BREA 4TY8B 2UVRA 2HHXA 1K1SA 4XDCA 2MZJA 4O3RA 3GFYA 2VC1A 5E3AA 1Q8LA 4JV0A 4OI2A 5DDQC 4PWDB 1AFIA 2YNHA 3MM7A 1FDAA 2R2TA 3DC2A 3I9V9 2ACYA 1S6PA 2QA4G 3SDEB 4KSEB 5KT6A 1C4CA 3HHLB 3QJJA 3GR1A 3QPIA 2DPIA 1GXLA 1VS3A 2L9DA 5HP1B 4ZKAA 1WEYA 2NREA 1LW2A 5JVGQ 2M0GB 5I42A 3CCMS 4C11B 2F3JA 1S7HA 2NS1B 3LP1A 3LANA 1N34F 2PN6A 4QIEA 1YRTA 1UL3A 3DLKB 5F8JA 4B3RF 3DU6A 2MZQA 2YKNA 4C3LA 2DR8A 4IG0B 2IBKA 3CCES 2PD1A 3J7ZT 2KG1A 1HYSB 3Q8SB 3OUYB 5F3ZA 1NZAA 4C0BA 5CQGA 4D3GA 3P6YC 1CQNA 1KHWA 2PA3A 3CE8A 4O3NA 1YRUA 5B0AA 4ZPWR 2ILYA 2B6AA 5E33A 3TVKA 3C46A 2VG7A 2EBGA 2ZC4A 2DCLA 3TVZA 4ZHRB 2XLJA 1N36F 1N6QA 4KQZA 3MEDA 3TAQA 1XNQF 3I0RA 3DXBA 3DLJA 4O3QA 4WFZA 3V5RA 2XBPA 2MQPA 4AL6A 1X5SA 3W3SA 4HT5A 4OFZA 3RAQA 4WK1A 3KLIB 3D2WA 1S49A 1YTYA 4GMKA 3F41A 4LF5F 4I2PA 5CH7B 1VIXA 3IWLA 1HWIA 1OPZA 3NGDA 1F5AA 2XCPA 5I3UA 1S1XA 2Z4PA 2A18A 2C2DA 1VQ9S 3BO2A 1X9SA 2JEIA 1BY9A 2C2RA 4X4PA 3HHDA 1S9GA 3TANA 2HHTA 1M5HA 2HG4A 2YVSA 2HIQA 2V9WA 2LXFA 2G0CA 1UVKA 4ATNA 5KFCA 3KNGA 4O44A 3SFUA 4HI2A 1KFDA 2I1RA 4IH7A 3CCVS 5L1KA 2E29A 2HS0A 3W2WA 1LWCA 4WU3A 4DV1F 3KHRA 4OX8A 4R8UA 2DNHA 2GCFA 2ZH5A 3EPIA 4JV5F 3MM8B 3OTCA 4OZ0A 3QZ7A 3IAM9 5AE1A 1U6BA 1YGYA 3ISNC 5DM7Q 3E2EA 2CQBA 2K1RA 4ZS6A 2MGZA 2ZJRQ 2KM8C 5CHCB 2JLEA 1CVJA 1DTQA 5HMWA 4KV8B 4OX9F 3PIPQ 3T19A 4X4RA 1X5TA 4YP3A 1OQ6A 3IA0A 4QWDA 2VPXB 1NU4A 2PGCA 3MPVA 4I6WA 1HNVA 2NXUA 3T9ZA 5GMKa 3VAFA 2J0WA 3U1LA 3BS9A 3MMCB 3O2IA 3O44A 1YJRA 1VOMA 4RNHA 3OFHA 2CQ4A 2HWHA 3CDWA 4PG7A 2CRLA 5HQ8A 1QAXA 2FHJA 2RQCA 2IMOA 5B0BA 4DR5F 3WX4A 1YJ9S 3MI7X 4R0EA 3M2VB 3LP0A 4R0JA 5L1JA 3KK3B 1VFJA 1VRTB 5J2MA 1R8BA 1HBUB 2OSRA 1WI6A 3IXQA 4USHA 1FK9A 3FMWA 4ZCIA 2J6TA 4DG1A 4Y2CA 5KFQA 5HBMB 3MEGB 1YJWS 1P8GA 1SUQA 3MMBA 1R0AB 3M8QB 4CTAA 1FKOA 4D3HA 5KT3A 2K3IA 3OTOF 2DNNA 3M2UB