1NUQA

Crystal structure of human cytosolic nmn/namn adenylyltransferase complexed with naad
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
233
structure length
213
Chain Sequence
SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords FKSG76
total genus 76
structure length 213
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2003-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nuqA00
2QTMA 3ND5A 4L2IB 4J75A 4U7JA 5AHWA 1M8GA 4MWEA 4KKVA 3G5AA 3DO8A 2QTNA 3UY4A 1WXHA 3CLUC 3Q12A 3HL4A 3FH0A 2IELA 3N05A 4EG4A 4RPIA 1V8FA 2CYCA 4Q16A 2CYAA 3SEZA 4TS1A 1FFYA 4CDMA 1XJQA 3SP1A 2A1UA 2PFSA 3CA8A 3IODA 5TS2A 2D13A 1VBNA 3UOWA 1Q19A 3KT8A 5TEVA 2RD2A 3QTBA 1PFVA 4YP5A 3H97A 1LW7A 4XSVA 2ZUEA 4JZYA 2PZ8A 2WQ7A 4ZT4A 3A2KA 2CFOA 1YUMA 2J08A 4DNXA 2AZXA 5DK4A 3COYA 4QREA 1U7XA 4K0RA 1T6ZA 4MVCA 3GUZA 1MBZA 1F9AA 1MC1A 3CVYA 1KAQA 4GRIA 5KHAA 4DDMA 2YXNA 4MVWA 5JBNA 1O96A 4I6GA 3RBAA 1JIKA 1JZQA 1YIAA 1KORA 2QUIA 4MLPA 1MAWA 2PXHA 3COWA 4MAFA 5FO1A 2HMAA 2OQ2A 1NI5A 1O97C 1NUSA 4MUKA 4MUJA 3ZJVA 1G8GA 1KQPA 1N2OA 3HMQA 1O6BA 1G8FA 3CLRD 3IVCA 1WXFA 1KR2A 1N2IA 1K97A 4NX2A 4F4HA 3COVA 1MJHA 3IUEA 3E27A 3H9BA 3PNYA 4MW0A 2DUMA 2O8VA 5K0SA 1O95C 5HG0A 2PIDA 3LOQA 1T9GR 4JXXA 1N2BA 3TZLA 2A1TS 1I6KA 3C8ZA 3IOEA 2YWBA 1QU2A 4CDNA 3MLAA 1JZSA 2WQ6A 1B6TA 1TEZA 2DXIA 1O0CA 1Q11A 4ZCQA 4ZCRA 4R2LA 1EFPB 1ILEA 3FG9A 3MUEA 1LI7A 3TNJA 4HJXA 4MW1A 1T6YA 4F3RA 5H16A 1PFUA 2JA2A 3H99A 3CVXA 3NBKA 2J07A 1O97D 3K32A 1PFWA 3K9WA 3S3TA 3BL5A 4EG3A 5J58A 4GU5A 1N2HA 3IMEA 2E21A 4HK4A 4MWCA 2H29A 3SZGA 1VL2A 3A4IA 4KPUB 4MW2A 4ZT5A 3SDBA 3MMXA 5H7XA 3ND6A 3CVWA 1N2GA 4Q93A 4X0EA 3M5WA 1IQUA 3KT0A 3CLTD 3AFHA 4EFKA 2YY5A 2E0IA 2TS1A 3CLSD 3ND7A 4NDAA 1EUQA 3GMIA 1MAUA 4CQNA 3AG5A 1NURA 2IJGX 1JECA 2X3FA 3VGJA 5KCMA 3SEQA 5TEWA 3ISJA 2I1LA 2GKSA 1I6LA 1COZA 3VRHA 1IVSA 2J5BA 1H3FA 1NYLA 2IP1A 3FNRA 2DETA 1EXDA 1NSYA 3CVUA 4E1AA 3A05A 1ULHA 3CLSC 3TZEA 1EFPA 1OWLA 5DASA 1KAMA 1J20A 1J1ZA 2R5WA 3AL0C 4L2IA 1TFUA 2PZBA 1GLNA 5BNZA 3FI0A 2VTBA 3D6UA 1Q77A 2X1MA 4ND6A 1A8HA 4ARCA 1WXIA 1WQ4A 3IOBA 1QQTA 3IUBA 1OWNA 1LI5A 2H2AA 3I05A 1M83A 1M8PA 4OUDA 4YBRA 1R6UA 4MVXA 3X1KA 2J4DA 3P52A 3FHJA 4CT0A 5FNZA 1N1DA 3NBAA 4R0NA 1RQGA 3D6VA 4EGAA 3PXUA 5FO0A 3DPIA 2X0KA 2CYBA 4MW9A 2O5RA 3IVGA 2HZ7A 2QJFA 3X1MA 1NUUA 1OBCA 1H1TA 5J59A 1EJ2A 1NP7A 2Z09A 3N9IA 1WXEA 1O95D 2G36A 1Q15A 4MW5A 1JHDA 1QTQA 4ZCTA 2JANA 4DDKA 2E89A 4MULA 3H05A 1MOPA 3H9CA 1NZJA 3Q4GA 3UMVA 3IH5A 1KH1A 3RK1A 3DLAA 1TYAE 1F4LA 1GZUA 2EL7A 1WJGA 1WKBA 1KP2A 2GOYA 1XNGA 5IJXA 1G59A 1O94C 4PBRA 4S1OA 2QJTA 3JXEA 3FETA 1JIIA 1IH8A 1N2JA 1H3NA 1F7UA 2DR2A 2DERA 3A04A 4ZT2A 4ZCSA 4MWBA 2WB2A 1DNPA 4H3SA 2VXOA 2GM3A 3IOCA 5TGTA 3Q10A 1J21A 4MUGA 2A1UB 4K03A 3ZUGA 4EG5A 4DE5A 1N3LA 4KPUA 4AQ7A 2Z3VA 2CV1A 1N77A 1UFVA 1KQNA 4QRDA 2A86A 2PZAA 1N78A 1KH3A 2AKEA 3HV0A 1JMVA 3KFLA 1K4MA 1MB9A 4G5FA 4KR9A 1T9GS 3SZ3A 5J5AA 1U3CA 1OD6A 1VLHA 3QE4A 1JGTA 3CLRC 2CUZA 1J1UA 1S4MA 1GTRA 4EF6A 1K4KA 3UC5A 3CLUD 1IHOA 4G5YA 1V47A 1XNJA 1PG2A 5LFAA 3ZXIA 2D54A 4XFDA 2D5BA 4P2BA 1IQRA 3KT6A 1ZH6A 2QTRA 3X1JA 1JILA 1R6TA 3MLBA 5LM3A 1QNFA 1VBKA 3PNBA 3CLTC 4WNYA 1KQOA 1TQ8A 1O0BA 3ZGZA 1MRZA 1GAXA 1I2DA 2DLCX 1JIJA 1O5TA 3ZXSA 1XNHA 4MUEA 3IMCA 2A88A 4ND7A 2V0GA 4A91A 4PBSA 2QJOA 1KKUA 2PG3A 3KT3A 3AKZA 3TS1A 1O96B 3ZJUA 3FIUA 2NZ2A 1M8FA 1GN8A 3RHSA 3U1VA 4U8HA 5LLTA 4EG7A 1O94D 4KR7A 4BWVA 1ZJWA 1YUNA 2A4MA 3PRHA 3UK2A 1WOYA 1YULA 5EKDA 2CV2A 1U3DA 1KP3A 2NSYA 3ZIUA 3N2YA 4I6EA 4YMIA 5KWVA 2B7LA 1JEDA 1TYDE 3LCJA 3PNVA 4RUKA 4MW4A 4U63A 1OWPA 3N8HA 1JEEA 3IDFA 1M1ZA 3F3MA 3OP1A 4MUFA 2DEUA 4JXZA 1I6MA 1ZH0A 3P0JA 4EG8A 3AIIA 2CV0A 1QRSA 4UZEA 3P0IA 2A84A 4NZPA 5HUJA 1T6XA 4EG6A 1TYCA 3L93A 3RFFA 1OBHA 4YP6A 1WQ3A 4DJAA 2CT8A 1Y42X 3LE8A 2V0CA 4EG1A 4NAHA 4MUNA 4OJMX 3FY4A 4ZT6A 2HGZA 2OV4A 2J09A 1FYDA 1EE1A 5IHXA 3VU8A 1GPMA 1H3EA 1WZ2A 1R6XA 3GLVA 2AG6A 1J70A 2QUJA 2XRZA 3CR8A 1QRUA 3SYTA 2ZP1A 3RJZA 1NUTA 4G6ZA 3G6KA 1KH2A 3FWKA 1QU3A 1IRXA 2XRYA 4HJRA 1EFVA 4MVYA 3COZA 1TYBE 4XFJA 4ZT3A 3MXTA 4MUIA 4WSOA 5DB4A 4HPWA 1WXGA 4MQ6A 1IQ0A 4QBTA 2VTBB 2QUHA 4DDHA 4OUDB 2QUKA 2EJCA 5HUHA 5DEOA 3ZJTA 1VBMA 4MUHA 1D2RA 2BTEA 1IFXA 3L92A 1CT9A 4UZFA 2X1LA 4ZCPA 2RE8A 3HZRA 4J76A 3IMGA 4PY2A 1PFYA 1U7DA 4MWDA 4AS1A 1P7PA 1YIDA 4JYZA 2JAXA 4I6JA 3P0HA 4PBTA 1K92A 4R2MA 3IVXA 1QRTA 1F7VA 1M8JA 4YP7A 3QTTA 4NATA 3ILVA 1NUPA 4JFAA 3FOCA 2CSXA 3G59A 5F23A 5K0TA 1M8KA 1EUYA 3HGMA 3TQIA 1OWOA 1YI8A 1ZUNA 1N2EA 2YWCA 3NV7A 1GTSA 4ARIA 1HYBA 1BS2A 4NAUA 3FDXA 4MW6A 2A7XA 4DLPA 3OTWA 3HFJA 1WY5A 2WSIA 1J09A 1QJCA 2C5SA 1U0BB 1SURA 2DPLA 1MB2A 3DV2A 3INNA 1X8XA 4FZJA 3AG6A 4MW7A 2E18A 4ZT7A 3TQOA 4KR6A 1G8HA 1PG0A 2BYTA 2Z08A 3CVVA 2A1TR 1NUQA 2ZUFA 1EFVB 3ELBA 1N75A 1OWMA 3RK0A 1X6VA
chains in the Genus database with same CATH superfamily
1GR0A 3BFVA 1XXLA 4WY8A 5E9QA 2H5EA 3FE2A 4RL6A 3U0BA 2HIGA 2NU9B 1Z06A 1ZL2A 1CZNA 3DJYA 4M76B 1K3UB 4QDJA 2CLSA 2ONZA 1UKVY 3OKPA 2QJRA 3Q12A 1GUZA 5B55A 2AEJA 3ANSA 1V1JA 1J0BA 3K1AA 1K7SN 4MJLA 2ARKA 3A4TA 4WNAA 4U7FA 1SY7A 2FPIA 1PEYA 1NXVA 1E2JA 5LD2B 4ZYUA 4RVCA 1PR3A 3AETA 3WB0A 4GR5A 3FWPA 1T5BA 3U6KA 4R2KA 4ZI3A 2FR0A 4JLOA 2G80A 3TW0A 4KU4A 3KHSA 3HO8A 2PZ8A 2EYQA 1XOIA 2IIPA 4HEA6 4QICA 5K0ZA 4W7SA 2NAPA 3KOOA 4DC9A 1T6BY 5KWJA 1C0EA 4NCXA 2BDTA 3IUYA 4RMNA 4PFSA 4HWGA 4WK0B 3GI1A 1YHYA 2P2SA 3D7RA 4IINA 4URWR 5CRIA 5AJZA 1NN3A 2Y1FA 4D6YA 4ZAVA 3IDAA 4QREA 4M1QA 2CLIB 1XZDA 2HLDA 1QQBA 4G3XA 1IEWA 4MVCA 3DFUA 1J5XA 2ADFA 3TINA 1OLXA 5DCLA 4BQIA 3SXUA 1IIBA 1OASA 2SCUA 1Q83A 4GMXA 2JH9A 5EXTA 3UAOA 4KQKA 5IS2A 3P7MA 3EZYA 1B15A 2G0NA 2YMQA 2B6HA 4J49A 4LX8A 3RBAA 1PR1A 2HW8A 4WCVA 1P8JA 1H8HD 5BR4A 3RVPA 3SFTA 1T4DA 2D6FA 1TK3A 1GRQA 3CZ4A 4D9JA 3S2FA 3SC2A 5J4YA 1RKVA 1Z6ZA 1WW3A 2XI4A 1BVHA 3OKAA 4FGWA 1B8PA 3AHFA 4UDNA 4RZHA 3C3PA 5C4GB 3W2FA 2NSJA 2AKYA 3O1IC 2VRNA 1A82A 2BIFA 3FNBA 3GUYA 3HCNA 4RHEA 5E2BA 2QTAA 5HMMA 1WXFA 4KUGA 2Q6VA 3D4OA 4IKPA 3W7AA 1CJUC 2REQA 2ERCA 1SQSA 3LMKA 3KQVA 1M2GA 1TLLA 3KB1A 4U2EA 3PCTA 4WVFA 3TLZA 3VUFA 3BMQB 4WXRA 1CZOA 2GUGA 3HYSA 4RVOA 1I4WA 5CB8A 2PZFA 1YS9A 4HAYA 5KTNA 5LP1A 4HXGA 3PSAA 4C07A 5AT1A 2KWIA 4M1YA 3UMMA 2I7VA 4I1VA 3WYBA 2I2WA 5K0GA 3DVAA 4ZA2A 3EEOA 1E0KA 4X7PA 4D9BA 5IN4A 2RH9B 3PC2A 4KWHA 3VZBA 1LTQA 5DF1A 1DAOA 4YAFA 1CS4C 5E6UB 2YZNA 3K70B 4Q18A 5EE1A 4L02A 4RY2A 4YRDA 1GKIA 3ELYA 4V2UA 1CVLA 3V4VB 1TOAA 1E2LA 1GG2A 2A5YB 3A25A 3RARA 2H1FA 3E58A 4X65B 4Y2UA 5LU8A 2Z1NA 4Q9LA 4I5DA 4R2JA 3V5NA 1N4AA 1EK1A 1B7GO 3NT5A 3RSFA 1KYQA 1E79D 3BYZA 1U7WA 1ISIA 1Q44A 1R5NA 1C9NA 2WM2A 4IIVA 3ZYCA 1RXEA 2ID9A 4IY1A 3LHKA 2IHVA 2NU6B 3BCHA 3HKBB 3C6QA 4YMGA 5AVSA 3TZKA 2FUG1 2PBZA 2YJ5A 1UMCA 3I04M 2GEBA 1VIYA 4GQIA 1MEOA 3AHCA 4B0OA 4EG3A 4TLBA 3QNMA 1L5QA 5C37A 4XWYA 3RVQA 3T3HA 1HEYA 1G1MA 1RI3A 3AONB 3UJPA 4YDQA 1SVSA 1Z0AA 2X8LA 1JJFA 4LMBA 3EGXB 3MJTA 3ZZNA 1MEEA 1ESMA 2EJBA 5I5GA 3SWWA 1GPLA 3GDFA 3U7GA 4X0EA 1D0SA 1B6SA 3AEUA 4TYMA 4II2A 1CJVC 1B8VA 2OY0A 4KI7A 4MKIA 1IQUA 3O8RA 2XDQA 1PJQA 4QXPA 4RESA 2FFRA 4OL9A 1SUBA 2VIIA 1QR2A 2R1UA 1JNXX 5B2FA 2JAUA 4GVPA 5LXTB 1FF9A 3PJDA 2PUEA 4E14A 5ECYA 1Y9AA 2Z5FA 3KR2A 5HIMA 1XT6A 1YC2A 3AP1A 5DT2A 5F73A 2ISQA 5GMOA 4CCYB 3E15A 2X9QA 1RWNA 3ZIAA 1QHYA 4E3WA 3A6HA 3CKKA 2G9ZA 5DI9A 1NI3A 1SQ6A 4X71A 4MWTA 4OL0A 3ZCUA 3OEHD 2VJMB 1H2YA 1GN9A 3OECA 1F8FA 3CLSC 1ZDMA 5JXGA 1W9MA 2AR9A 2ZB7A 1P4GA 3LPCA 4H1HA 1UK9A 3FPJA 5FLKA 4KIJA 3QVLA 5FUBA 3V7YA 4EUNA 3G9TA 2OESA 5JC8A 3TXYA 3ZWBA 1R0BA 1BH2A 3IBYA 1WUYA 4AKEA 2QGZA 3HN7A 1G9TA 2OFFA 1IY9A 2D3TA 1PQPA 1QVAA 4OXNA 3KSRA 2OFOA 4IIJA 5FUQA 4PLVA 4RZ2A 5LBIA 3EXG1 3KWFA 1G4AE 2XR1A 3ZJ5A 2PH7A 1Z6AA 1OWNA 5C5CA 5IFLA 1CF9A 3HJTA 4D4LA 5LBUA 3F5QA 2OQVA 5BNTA 1X1BA 2CDAA 1KQFA 1K68A 1L4EA 2BFBB 4KWIA 5F5XA 4ALMA 2CZGA 3G17A 1PV1A 1YBAA 1KGDA 2XMGA 3PQ6A 3Q3GE 2PQ6A 1Q17A 1UWVA 1K0FA 1N1DA 1VRWA 2MIIA 2WUFA 1E2KA 2JFWA 5CYPA 2EG5A 2AZMA 3VO2A 5CBKA 3D4IA 3PE4A 4LFCB 1QOQB 1G8YA 3WQSB 3JQ9A 4B8YA 4JKIA 3LVFO 4H9GA 2YH2A 4YH1A 3VKVA 4BX3A 1U3UA 2FKAA 2P90A 2QRNA 3C7AA 1FLNA 4IUDS 4F1WA 2XLBA 1SZJG 4MPPA 1QIJA 1AG9A 1PFQA 4U7GA 2E4WA 3KB6A 3P5SA 3WP0A 1PI3A 1AKYA 5KWEA 1KARA 2IP2A 2Z09A 2O57A 2Y9MB 3I4LA 4JCOA 1J2JA 4ALKA 3BGVA 4B32A 4OHMA 5I5EA 2C2WA 3K72B 1A96A 4L5BA 2A9OA 5DGCA 3HLYA 1P4JA 3Q1KA 4CFYA 1F2UA 1M6EX 2Z9DA 4FX2A 3KQYA 1P6QA 2IYUA 3DT6A 3RIXA 1TLTA 1RRGA 4F3NA 3ZHOA 4PZDA 5BSVA 1RRFA 1Q6ZA 2H8GA 3KPYA 1NJ5A 4TKUB 1EQAA 1C9EA 1A4IA 1K4YA 4G5OA 4UHHA 2C61A 4PYMA 4MYUA 2P9GA 2PJZA 3WGJA 1XB2A 1PK8A 5I45A 4JLUA 5P8WA 1GG8A 5AW1A 4URHA 3IURA 4QU8A 4TL6A 2TSYB 3BSFA 2FPKA 2GOYA 5IJXA 4X1KA 4GPTA 5L6LB 4CU5A 2L0XA 4PBRA 4DSTA 3NVKI 2QJTA 3QOWA 1KK2A 1NT2A 4UCFA 3IRUA 3USCS 4AJKA 2YOFA 1NF8A 1MIOA 3PUJA 4JZKA 5JQGA 2W2KA 1MAVA 1XCPA 1GU0A 1U02A 2C1XA 3ORSA 1WUIS 3Q9LA 4KX3A 1VYTA 2VTVA 3D8NA 2J85A 2BFCA 3FUVA 1YJQA 5LOVB 2WPNA 3DEJA 3C5CA 3B9RA 4IL5A 4PLWA 4AJ1A 3W9YA 2VS1A 3GAFA 4H17A 1T34A 4EG5A 4TTRA 2JI9A 3GDHA 3MWDB 2Y1GA 3M4YA 5I7FA 4BRSA 2WAMA 2JIZA 2LR0A 1A4XA 4G89A 4LQDA 4FEYA 4MCHA 5E7IA 5CVVA 5JVDB 3E35A 3RU9A 4YRMA 2XB2A 4R68A 1BVYF 2ZZKA 1LDEA 3PDIA 2H2GA 1Y8RB 3KQSA 4HMQA 4IR7A 1WHTB 1EWKA 2ENUA 3LNCA 1F4PA 2O2GA 1ENOA 3FMFA 4YREA 3BSWA 3K1ZA 2EWWA 4HVTA 3EWNA 4KR9A 2W93A 3L8GA 3T5DA 3WRWA 4LN1A 1RACA 4U6NA 4HXYA 1PS0A 4EB3A 3U3DA 5KTKA 1PQ4A 1ZD5A 1DTWA 2FFJA 2P1ZA 3BJMA 1JR3A 1XUOA 3H1PA 5EUMA 4XW2A 5L3QB 1NU6A 1P1CA 1S4MA 4R8SA 2GXQA 5CUQA 5CAEB 1ZPDA 3M34A 1MOZA 2B30A 4AMZA 3DHNA 4A6XA 4BDSA 1OAOC 3IQWA 2CVPA 2YRFA 1V47A 3U9SA 3GGCA 2DQYA 4GL4A 1RJFA 4GVXA 4B4KA 4A6EA 1T4GA 1XZGA 3RM3A 3TJRA 4BZQA 1DBRA 4V24A 5HHTA 4A0HA 2B5WA 3WHLA 2QTRA 2IU0A 3UAWA 4DCUA 2PGDA 4W7IA 1J0XO 1XNQB 1ZQ9A 1VBKA 2ZIXB 4E6EA 2XCRB 5FA6A 4UNPA 5DM1A 1X1SA 2C82A 2Q29A 1GAXA 3AU9A 3VNQA 1HLGA 3OLVA 2C3YA 1E69A 1K3TA 1O5TA 3HK2A 5CU7A 1XNHA 1L4LA 2HQBA 1DIAA 1GGVA 2VNIA 3EODA 3GH1A 4KBFA 2E4XA 2ZG6A 4N1AA 2UUCB 3BB4A 4D0NA 3UK1A 1SHZA 2R44A 2V6FA 5CK5A 2BEWA 4F6RB 2B7CA 3HHPA 5HQJA 1NA5A 2HQ1A 3EULA 4Q01A 3ZJUA 9LDTA 5BV7A 2VUIB 3E18A 3S5UA 1A2OA 2J3IA 2O2XA 3U1BA 2OHHA 1RC0A 4R69A 3Q8LA 5LLTA 1M7BA 2QD2A 3TOZA 4M6WA 2DHEA 2OM6A 3EF1A 3WFZA 3LZDA 1Y1PA 3QPDA 2FPPA 5CDUA 2VQEB 5D85A 2X0JA 3IEVA 3ML1A 2YYSA 1UKBA 2G82A 3ZBQA 4ER3A 1EM8A 3P2OA 1J90A 4LOKA 3T06B 3AT1A 4POOA 1U3DA 4IFBA 5FYDA 1W88A 2HMYB 4U3JB 3ET5A 3ZIUA 4LXIA 4BVBA 1PK9A 1VPVA 2VTDA 4Y7DA 4FGKA 1R8YA 1PSWA 1RRVA 3A9UA 4KL8S 1L7EA 2GK7A 3WQQA 3X1WA 3AOEC 3KO8A 5PNTA 1WX1A 4P4SB 5LR6A 1TF7A 3AIIA 3D4PA 3UGKA 4FZRA 5D5HA 1XZAA 4IJQA 1II8A 4C4SA 2WABA 4G8JA 2WFAA 3EN0A 4XVCA 1XSEA 2XWJI 3D6HA 2PLNA 3TQTA 3ZY6A 4EI8A 4HB3A 3V8QA 2YJGA 2QLBA 4X45A 5SZKB 4PN3A 1QVVA 3RB8A 1P19A 2YYAA 4DJAA 4F46A 4CKWB 4QUDA 1BNCA 2MSLA 2D5CA 4DPMA 3TBHA 5GJCA 4CDGA 4UM5A 2NU9A 1S3IA 1L3IA 4XYMA 2ZAGA 3A2LA 3L1JA 2IHUA 4O3MA 2UKDA 3KQTA 3UB4A 1RHUA 4Z0HO 3SE0A 5KQSA 2UYHA 3U4IA 2R6HA 1UAGA 4NHOA 3LDFA 4OSPA 1OB5A 2YWHA 4JL5A 2GM9A 3RVBA 4LRSB 4TWJA 1W25A 3C5EA 4ZN6A 1KJZA 2QUJA 1U8CB 3CR8A 1U3VA 1Q1NA 4GICA 4A2CA 5C2JB 2V7PA 1YA6A 3GRKA 3BJRA 3K09C 1I8TA 2DTXA 2GASA 3VVBA 1QCYA 5IAEA 4YAJA 1ZUHA 5AKKA 1L5HA 3N3BC 1BHO1 4ZT3A 3OI7A 4EY4A 2FW1A 3HBLA 1DJOA 2C2MA 3NBYC 1QUFA 1IEXA 1NAHA 1NLMA 2MYTA 3PFIA 4GEGA 5CTAA 1YS7A 4CMEC 8LDHA 5F2NA 1DXHA 1I3LA 2CVOA 4Q3CA 3DE2X 5J47A 4G0NA 3O2QB 4WHMA 4KV7A 3T4EA 4YRKA 3R9WA 1NVKA 3OLXA 4MRSA 2B0JA 3P27A 3P2MA 1ST2A 4RV5A 3BTOA 3T1YB 3HZRA 2IU4A 1CG6A 1A9XB 3IUQA 2X76A 5F3WB 5SZIA 3WIDA 1UJ5A 3H5VA 1C3OA 2WIFA 3KM0A 2JCGA 4O4HA 5LNK1 4AZWA 1BE6A 2A6PA 2HF8A 2XYGA 4B45A 4X8LA 4B84A 1ZINA 1FDWA 4N0EA 3ZHUA 1O6CA 2IDKA 5ERGB 1YIDA 4ZXFA 1L6IA 4A8JA 2CZQA 2N1BA 2OEPA 2O2ZA 2P77A 3FLEA 4A10A 3HGTA 3C43A 2AQIA 1EBUA 1NRWA 2XKKA 3DDHA 4QRHA 4ZVMA 5IBQA 1MVOA 3EIOA 3OMXA 1GKUB 1AZLA 2YHSA 3TLKA 3TNYA 4QOEA 5IC6A 1CUEA 5B36A 4JFAA 3VOTA 3WR5A 2DX7A 2ZWVA 1ZI6A 3G59A 5CT9A 4QEDA 5JZ9A 4ZVSA 1EUYA 3GJ0A 3IQZA 3PPYA 2C7PA 3HGMA 3ZCTA 5EXEA 4WERA 5EWLA 2H51A 1GNSA 3V2GA 2I6XA 4YMLA 1G0OA 1YJBA 1BGWA 2K87A 3I76A 4I55B 2GEJA 1C4OA 1E3TA 3MC1A 4KWCA 5EQJB 2FWRA 5FFNA 4F4CA 4KHPB 1VJ5A 1GDTA 3HVKA 4TQAA 4Q3LA 1UADA 2ZZMA 1WHSB 2ICAA 1IMJA 2WSIA 3B2NA 4BJHB 2CLKB 1UC8A 1IOZA 2C5SA 1CVRA 1GNPA 2P9EA 4RVDA 1UM8A 1MR3F 1OBOA 3AIKA 4TMWA 5E7QA 5AR1A 3ZBPA 4B8ZA 1JN0A 1Y89A 2PZEA 3INGA 5EE9A 1NN5A 1E4YA 1PP4A 1QRUA 1Y6ZA 3ZOZA 1IG3A 2FN9A 2XNKA 1U1IA 1CR2A 3EMVA 4FR0A 4OKIA 4OIMA 4OQMA 5AWFC 1PVOA 1FB5A 3V8VA 2ZSIA 2GHTA 3GLUA 3T41A 5DYNA 2R6R1 1NW7A 3PNPA 4AQDA 2HGSA 4WXMA 4AYTA 1VXRA 5EQTA 4AN0A 5LNK6 1E9EA 1U0OC 3FCUB 1OT5A 4NU0A 4CEIB 1UEJA 2FN8A 3IAS1 4HXFB 4N7JA 3EH1A 1R00A 4Z4HA 5CMLA 5BOSB 4DNQA 1OX4A 3AUJB 1QPZA 2VNSA 5GGYA 3QFHA 4V0RA 5BV1A 3W2GA 1F12A 3GCGA 5G4KA 3RUEA 5BYAA 3O83A 3FPFA 1Y9EA 3MTEA 3GCDA 2OO5C 3BJZA 2IHYA 1AA6A 3S68A 4KE6A 4AUKA 2R48A 3DMTC 4ZVOA 3CLUC 3ZY2A 3R41A 4KNYA 1HDGO 4DA8A 3ZKWA 3MFQA 1F48A 4JYCA 2DWOA 2GDZA 4AJHA 5GPBA 2EFDB 3SEZA 1R6AA 1H0RA 2CVFA 4FI3F 1Z36A 1ABBA 3TBKA 1BHSA 2OHIA 2Q4EA 2YIDA 3EZNA 2VZLA 1IVNA 1TUBA 2G28A 4G97A 5DU2A 3SFVA 3H97A 5ETJA 2C9YA 2WE7A 3UENA 2ZIFA 5AJXA 4ZYWA 1E1KA 4U2BA 5KNCH 4BV8A 4ICIA 1ORIA 1L8LA 2QUZA 2FEKA 4IIUA 2FZKA 3ICVA 5F77A 1V7ZA 4BCCA 4U3JA 1JT2A 2HHJA 2Q1WA 3NYWA 5JLAA 2OXIA 1L5VA 1C4WA 1CUDA 2FK7A 5DK4A 3U4GA 3URKA 4C5AA 4HFRA 2RBEA 1G7TA 1MQAA 4RPJA 2JD0A 4B35A 5KYWA 1B76A 5BSTA 2Q2OA 3Q3CA 3NC4A 4II3A 1M6WA 3DCJA 3HG7A 4PU0A 4UEWA 5JQGB 2R6DA 2WEKA 3DONA 4KMRA 1TF5A 1KNQA 1IBRA 2DR0A 4TYWA 4TVOA 2XYHA 4WBXC 7ADHA 1TKCA 2HQOA 3QYPA 1IXSB 4MAFA 3RYIA 1BU8A 4DV4B 4WOJA 1DKMA 4XKJA 2HMAA 3DOUA 2YKGA 1UKAA 3D81A 2Y0EA 4GPBA 5BT8A 3JWGA 4P22A 5CX1A 1JWBB 1TMKA 3KKEA 3DSRA 2G06A 4YN3A 5CB4B 1GYQA 1N2IA 3IBFA 4WX2B 4PQRA 3E1SA 4FFBA 5L7TA 3PX3A 3UJBA 1UFKA 3RRJA 4C4OA 5L4NA 5JD5A 3GLGE 2IITA 3D6FA 3MLEA 2C77A 4EZBA 4ERNA 2CXRA 1QK3A 1UDCA 1V71A 1XAIA 1G5FA 1WB4A 1TX4B 2OO5A 2Q9BA 4S0ZA 3HVJA 2P3QA 3ABOB 5K0SA 1GRVA 1OHHA 4Y9UA 5G3ZA 3BEDA 5FPPA 3ZHQA 5JUWA 1M54A 2QQEA 1I6KA 4D44A 3HTXA 1OLUA 3RS7A 3ED5A 4DY4A 3DUFB 3HO6A 5EOVA 3CNOA 3TI9A 2GBCA 4FDTA 3UHOA 1OGJA 3ADCA 2Y76A 2R751 4QFMA 2D5AA 4PVDA 1F5SA 4WASA 4MYTA 3BZBA 3K96A 1C50A 1XV5A 4IQFA 2HSDA 5HX7A 5HZGA 3AZOA 2DFTA 1A9YA 1RJEA 1U9CA 3Q85A 3ZV7A 2I54A 2VHEA 3OCWA 1QYRA 2QV0A 1PS8A 5J2UB 2NSLA 2C9MA 1PR9A 2H3EA 2UVQA 2ZTSA 4Q03A 3WIEA 4JLVA 4AROA 1Z22A 3NP7A 1GQRA 2N3ZA 3LBYA 3GH3A 4TV8F 5J58A 3ANMA 3GEIA 4C3ZA 3KIPA 3OESA 4MKZA 3RVNA 1CDOA 2GJSA 1M6VB 4NENB 4KPUB 2HRQA 1GTL1 3DD5A 5ADVA 5IH7A 1W46A 4RV9A 3FSJX 4HQ6A 3G88A 3V1YA 3ZYZA 1X7XA 1ADYA 4XIGS 3DV0A 4RAQA 5CLGA 3ZU2A 1GKKA 1HZJA 2IQ5A 3IHLA 4X1KB 4DYDA 3RC7A 4BLOA 3L7NA 3VR0A 4ODIA 1WPQA 1POXA 1KEVA 1KMQA 2ZOSA 3I6ZA 3PEUA 4QG7A 1AUQA 1EA7A 3HU1A 3JYNA 4HDSA 4WLOA 3QA9A 3ZIDA 1AMOA 3AOGA 4B3CA 1JHOA 4UCWA 3HWSA 4KEAA 1SXHA 4RTNA 4TMFA 9MHTA 4RCZA 3K0KA 5BSRA 3UWKA 2R68A 1OY1A 2I1LA 6ABPA 2QR5A 3O47A 2C2ZA 3HKEA 1EFTA 3L01A 4NZOA 4JBWA 1TAQA 3ACDA 1JTFA 4BNFA 2FPGA 4OM8A 5E4YA 3A05A 5JJCA 2NNLD 3FHCB 1KEUA 2D7JA 4H7DA 5DASA 5HQTA 4MXDA 4ALNA 3Q2IA 5EKSA 2CB9A 3LY8A 4F4UA 1DJQA 4YUXA 1AQJA 1KE1A 1XVIA 3SJUA 4BCBA 3G13A 4CV0A 3NHLA 4B79A 4RHYA 4RENA 2QZ9A 2PBFA 2WJ3A 3O73A 4PCUA 3SMVA 4ZI2A 3H11A 1P9RA 3GLQA 3IAM1 4K9KA 2Q07A 1AX9A 4L57A 1SUPA 4ARCA 4TWBA 2AQHA 4DC1A 2QMUA 1ZJ5A 3ED1A 3CLVA 3LH5A 3M9WA 1CUGA 2VDQB 1ZD4A 1PL0A 2BDEA 5HS6A 1XEFA 2GD1O 1GCAA 3OFND 4IHAA 4K6OA 3RJ5A 2Q46A 2ZS8A 1NGSA 1KQ3A 3H9JA 4ZDJA 4GL2A 3W4JA 3WKDA 1K1EA 4OUDA 4ISCA 4ZI7A 1UODA 1W6RA 1VE7A 1NW9B 5ES3A 2VRCA 5ANRB 3T3EA 4CKBB 1M6YA 4YMTA 3OEWA 1KSFX 3DBLA 3DMNA 4CT0A 3I42A 2JHCA 1WF3A 3BSYA 3CB4A 4P2GA 3VI4B 4C5BA 4EY5A 4YROA 3U7QA 1JYEA 4XWAA 4TN1A 4F8JA 1BKSB 1QH0A 2W0MA 2WR8A 3N87A 4CIVA 4EQZA 3O9MA 2H7XA 3FCYA 1YFKA 3WGGA 3FWHA 2BISA 4BNUA 2AMLA 5A3RA 4DBLC 4COKA 4QGBA 1VMAA 3DC2A 3UM9A 4D8XA 5FQOA 3PBKA 2B83A 1TK2A 2X77A 2I8LA 3DB1A 3E82A 3ZZUA 2RD2A 1I80A 1SU8A 4DAEA 4D9MA 1T1JA 1G6HA 1YGYA 4D74A 5JH7B 4O2BF 3LD9A 3ZDEA 3SHFA 3GFVA 1Y37A 3GLTA 4QHTA 3ZD9A 1P74A 1VHWA 1WY7A 3MJDA 4QU0A 4B6PA 4BGDA 2QN1A 1VOTA 5HR5A 3H05A 1MFZA 3K0FA 4Q4LA 3MOGA 2ZT5A 4B3HA 4D3DA 4R31A 1KEPA 3A4MA 2RH4A 3IAM6 1ORWA 1VMKA 3CONA 3F5SA 3P2YA 1FDUA 4QL3A 3C1TA 4LY6A 3FFXA 5EPOA 1LW6E 3REQA 4P7GA 5B7PA 4MV0A 4OGKA 4UQOA 3B36A 1YV9A 2CXHA 4GPD1 4EH1A 1HL3A 2AN4A 2O3JA 5FWNA 1P5RA 3JXEA 3QFSA 2V5VA 3LPMA 5TQ0A 5B3KA 1GEEA 4IKEA 1V5IA 1NW4A 3MK31 2WP0A 2OAQ1 1F7UA 2VNHA 3VYVA 1EFRD 3KR0A 1PL8A 1R27A 2AEMA 3A04A 3C4VA 3MTQA 3O1LA 4JEIA 5D87A 5ALLA 5G2OA 4R71A 3AC0A 4UQLA 3ZWNA 2VJLA 3O84A 3RFUA 3OWXA 2BMWA 5IF9A 3FVQA 4OHPA 4B40A 5TGTA 1J21A 2XWQA 3CINA 1Z7WA 2EOAA 5KMGA 2Z9BA 1K8QA 2ZWOA 4G25A 1MGPA 2ZTUA 1FMFA 4Q1EA 5JH7F 4XYBA 1Q0TA 2JFHA 3O7WA 4F2GA 1HLPA 3TLGB 4BB9A 4FBMA 4U2GA 2QX8A 3OOJA 1Q0RA 4QRDA 4N76A 3A6GA 3KKLA 2FWJA 5K0BA 4KFCA 2LDXA 3AJAA 3S2UA 2CMGA 4E4RA 3KQQA 1L4UA 3PC4A 1ZXLA 4HZIA 4N7RA 3F73A 3MD9A 4Y6LA 4FW8A 2C8JA 1OD6A 1TYZA 3L7AA 1DADA 2CDRA 2GM5A 4E5NA 3CSUA 3BGSA 3KOWA 3GVIA 2C5BA 2WPDA 3K1AB 1M1YB 1DB3A 3ZXYA 5KNDH 1X1AA 1Z5NA 3K5HA 4GWKA 4WRRA 2M2IA 4HTAA 1DL5A 2KBEA 3IE0A 1L8AA 2BEUB 1WLSA 3JYLA 4G5YA 4M60A 4UJ3A 5ECDA 2C00A 4DN6A 4NY1A 1KJ9A 3OY2A 3WGVA 4QUHA 2ANBA 2OQRA 4O8ZA 4C7MA 1KMNA 1CE8B 2JGNA 3QUCA 4P83A 1J99A 5DW3A 3V97A 1IY2A 2CLCX 2WIGA 4E70A 3ZE1B 1KJYA 2P78A 1QMGA 3MFYA 5EUQB 4RFSA 4NCBA 1CQJB 3LW7A 5IJ0A 1HE3A 1MRZA 3EZXA 5KQMA 4B3BA 3ES9A 4LYYA 3K31A 4BN4A 3IV6A 4DRXB 3U4QB 4RHFA 4WKBA 3U7JA 2GARA 2W71A 4TMKA 4YRBA 2HLPA 1JU4A 3K9GA 3MMSA 3AKZA 1DAGA 1W36C 4PC3A 4AY2A 5LBTA 1UMBA 2O0HA 4HBZA 4MRAA 4E5UA 3WV5A 1M1NA 2NO1A 3NV9A 3NALA 1QHHB 4DJFC 5DNYB 2VJQA 3RRYA 1S7CA 5BVHB 4BQSA 2N47A 2IUFA 3RAPR 1T4CB 2QGNA 1YUNA 4Y2QA 3PRHA 1HK7A 5FTKA 1EESA 1HDOA 1SHUX 1VGVA 3AM3A 5A3SA 3HGQA 1Z15A 2OCGA 4FXPA 3MHPA 1PE0A 2D5IA 3PFKA 1U2TA 2P6MA 3OFJA 4YASA 2Q99A 3Q88A 5LXTF 1SGWA 1ULAA 1JEEA 4DIUA 1FVFA 4H7FA 4LOJA 1U1CA 4X94A 1PR6A 2AJDA 1QZ3A 2JBHA 5FPHA 3QXJA 4NFLA 5DNCA 4LYFA 4WFJA 4ILKA 4B46A 1GD1O 5LCXA 2OHFA 3FTFA 1HE2A 1KGSA 2NUPA 1JV2B 2INGX 4IV8A 1QRSA 1PT8A 2A84A 3MG9A 1WW8A 4M9UA 1F0YA 3DE0X 3BE6A 4R2WA 1EEHA 4KE9A 3GU3A 4GOOD 3OPYB 4N6OA 4IEFB 5TC4A 1HG1A 2JZCA 2GMWA 1M5UA 1L5KA 3T1NA 1I3CA 5F1OA 3A1TA 3L4BC 4MDYA 5C3UA 4TT8A 4ZT6A 3M1AA 4UMDA 1ULUA 2Q3BA 2H7VA 2Z8XA 4MIEA 3R6WA 3BIXA 3Q7TA 1GU7A 4WEOA 2ZQ5A 1H3EA 3U3KA 3UGQA 2COUA 1TCBA 2L82A 3DBRA 1PQWA 1RYEA 1ZN9A 2H1VA 3KVOA 4H7KA 1AURA 3CRRA 4DBLE 3NWEA 3E5NA 1T0HB 2GFHA 4KG7A 4FYKA 3SIXA 4Q3BA 5EZYB 1JLSA 1TYBE 2FYTA 4FSXA 1QUEA 3T0FA 3TBFA 1EHYA 3OPYI 1JXAA 1TECE 3OOYA 4MUIA 3ZWWA 2E7ZA 4IF6A 1IJEA 3LQ4A 4Y9TA 1K6EA 5AVYA 1E77A 5A04A 1TO1E 3PC7A 1T3HA 2OLKA 3EGEA 4GOXA 1C8VB 4LJ5A 5JAUA 5JQWA 1TA9A 4A8JC 1U8AA 1VBMA 4H3KB 2CN1A 2AZDA 2W43A 4MUHA 5E1DA 3TAXA 2QPOA 3ZHZA 2PKQO 4LXHA 4CGZA 1VYHA 2X1LA 1IYZA 3PKZA 4WNCA 2G4CA 3G8YA 4U2CA 4G0XA 2PRIA 2WU1A 2ZBRA 3H5WA 4DNPA 3DFFA 4L78A 3KVNA 3ORQA 5IVHA 3BH6A 4O0LA 3GRUA 3N59A 1S8AA 2WINI 2GPNA 2F3RA 3ENWA 3K9BA 3O8BA 1ZM2A 1HFWA 3AERB 5CEFA 1H2HA 4BE4A 4BRWA 4D4JA 2O8CB 1FBNA 1M34A 2A33A 2VUHB 3AY3A 5DTJA 5JXHA 3AI1A 4EOGA 1VM6A 3CHYA 5B1EA 3PGVA 1YD7A 1D3AA 4R2MA 5EXPA 3G0BA 5FBQB 3R3WA 1XN4A 2EJVA 3T5BA 3ILVA 3IEUA 3MJ4A 1U4NA 4J0JA 4BO4A 5AK0A 1T8UA 2ZJ0A 3VKUA 2FE4A 4U2FA 1NJ6A 3M83A 3RC8A 1TVKB 3I12A 4L5JA 2VAVA 1L3CA 4BVEA 2WBLC 5KTRA 4KN5A 1RPNA 2UXDB 1QGUA 5DYIA 4JJFA 1BS2A 1TJ4A 2WWFA 1W52X 3BWCA 3HKBA 3S6JA 4JB8A 3QI2A 4UPEA 2LRHA 3Q8MA 3OA2A 3OZCA 3FCOA 2XB9A 3A3OA 1J09A 2F62A 2H7YA 2QM0A 2QU7A 3H13A 3GEDA 1MG0A 4OGGA 3DOEA 2G83A 4Q21A 3S8MA 4R5HA 5CYGA 2G09A 2VK2A 2YV2A 2NXCA 1RCTE 1CCWA 4E88A 4EBBA 5KS2A 5F3DA 4M7WA 2WRZA 1NQUA 4GOJA 4HB0A 4N0PA 4ND5A 4X3CA 1IHYA 3JD1A 4FGZA 4KAJA 2RI1A 2JLVA 3SQNA 1WM1A 2XZTA 2OVFA 1QPBA 1CUIA 1XTSA 1A3CA 5FI0B 3VFDA 5JNWA 5FEUA 4EA8A 3HVIA 2IPAB 4Z51A 4KLAA 1SKYB 3TCKA 1ZKMA 1XMPA 2YV5A 4RZIA 5EG5A 3I8OA 3KP1A 2IFTA 3OMWA 4B43A 4C4YA 4EKEA 1EVEA 1U2EA 3CLKA 2QHXA 3D8RA 2XVZA 5JR3A 4I2VA 1XEXB 2FJPA 4PEVA 1DAIA 2P2GA 3G1WA 3Q7PA 4X24A 2X22A 3ZU4A 1H85A 4L2IB 2X6QA 1TM1E 4J75A 5AHWA 4V0ME 1M8GA 4QGGA 4FX5A 4GYJA 3GVPA 3BWEA 3RUIA 3SVTA 2UUBB 2JLRA 1JAHA 3TLEA 3LS2A 4FFPA 1NMZA 4IIDA 4PICA 4RV4A 4I9GA 4IVQA 5CHYA 3G8CA 3IP5A 2AHOA 2WHYA 3DE1X 1XVUA 1YL6A 3B85A 4JCCA 3SXUB 3TSZA 5MHTA 5FORA 2FA9A 1K2VN 1WA5A 3SBEA 1Q57A 5TEVA 1ZEJA 4OQEA 5FL3A 3OM1A 4YP5A 3ZWOA 1JXQA 1LW7A 4S1TA 1ZCZA 1WD5A 2BWJA 2WF7A 3FFAA 3PXEA 5THQA 4KOEC 3WSVA 2VI5A 3NRBA 1Y7PA 1T9HA 1E3WA 1XMVA 2FMFA 2G04A 4AW9A 3NIWA 4CM9A 1Y81A 1R0CA 3QU2A 4PX2A 1XRRA 3BKXA 3FUWA 4L74A 2WD9A 2QMOA 3A3NA 2ZYWX 1KXZA 4L72A 3I58A 1B3RA 1P2BA 1G5RA 2DGDA 3CKYA 3SI7A 3I2KA 2BI8A 5DBHX 3F47A 2PMWB 4M88A 4IX1A 3IQEA 1BSVA 1NYRA 3P96A 4N54A 4BMZA 4D8YA 1ZJ4A 5JCJD 3TVDA 2C0CA 3S55A 1Y4AE 1QZXA 4EJSC 5B7QA 4J1NA 2VAXA 4CMHA 2KLHA 1RM0A 3VBCA 3D0OA 1GZ4A 3WBKA 2HCBA 1NI5A 4K9QA 4F97A 3IEMA 2DFDA 1QPGA 2XX3A 3FSGA 3H65A 3OCVA 1N2CA 4EVQA 3C6XA 1N1GA 3R9XB 4Y1FA 1ZN7A 4FT2A 3R0VA 3TB4A 3CMCO 4Y2XA 2IWRA 2VFAA 3CLRD 3O3MB 1ODKA 4WKNA 4QGAA 3HY4A 1UPBA 4WAUA 2BCGY 1EVLA 3I52A 1BHQ1 2YRWA 5A1JA 3A6FA 2XJ9A 3OZFA 1L5OA 4M4SA 1M9NA 3ROGA 1H6AA 4R9VA 5EZYF 1B00A 1ODIA 1X1DA 5JJLA 2KSQA 1IOWA 1NVAA 1N6OA 1NXWA 3UFBA 5KYXB 4IVNA 3OJXA 3ZWYA 3WA7A 2ZTVA 1W0JA 2ODWA 3K0SA 3T7JA 4IM7A 5IH3A 4LDPA 3G7SA 4KE8A 3R5KA 5AIAA 1RFGE 4EECA 1M74A 1M1UA 4JSRA 3E03A 2PWAA 2ZJ3A 1N7JA 5FOVA 3QI7A 2VHYA 5HW0A 1YFLA 2F8TA 5DNEA 4ER5A 4OK5A 1HV8A 2XMBA 3AEXA 2M9MA 4LDZA 5CT8A 1D2MA 5I3CA 1O0CA 1BFUA 4HGPA 4MA5A 3WLJA 2QR2A 4ATNA 2W2PA 2BOVA 4HDOB 3GMDA 5LOVF 1DC3A 2VDUE 3F4KA 4MUAA 2ZWPA 3UXHA 4EUEA 2TYSB 5EJGA 2O9JA 2QVLA 2IYSA 4JJ6A 1MXHA 1R18A 3PR3A 3RJ9A 4Y6QA 3THWA 1QAOA 5B3JA 4JS0A 1MDFA 1W4LA 4A3SA 4ZCMA 5FQNA 3K9WA 3LUAA 4QFDA 2F6RA 4JI8B 3P9YA 2IEZA 2XA1A 3B6EA 3OIVA 5J9FA 2QV7A 3C74A 2ENWA 3TL2A 2A9RA 4RABA 3UK0A 3I64A 1XK7A 3DTVA 3B3FA 4Q4JA 1TJ5A 4LQ4A 4FDMA 5ECWA 4C20A 3DEKA 5JRJA 3NJRA 4RZSA 3GRVA 2BFAA 1EJ6A 4JJAA 3L04A 2GF2A 3ND6A 4Q15A 5H7XA 4DA6A 3D31A 1W44A 2D2IA 2FFAA 2C03A 1GQOA 2UVDA 5LA6B 1ZK1A 2PCLA 1E3SA 4F9GA 4KFSA 3WIBA 3H75A 2O8CA 2B4AA 2E0IA 1ZICA 1VC2A 2OUKA 2ZM5A 1TUEA 3AVPA 3DLCA 4KAXA 5DN6D 4RW0A 5ALZA 4C6HA 5K4HA 4W99A 2BHLA 4NCIA 1E2FA 1MFPA 2HWXA 3AG5A 2PFGA 3WYDA 1HKUA 4ZJUA 2RG7A 1JECA 1DWPA 2EBFX 3F3KA 3OZGA 4FYMA 5TE9A 5TEWA 2X5OA 4GZMA 4HV4A 2QXTA 5KOHB 1X8JA 4M54A 2ATCA 3JQ8B 4B76A 2J5BA 1PV4A 4ECAA 2FCRA 2V9ZA 2BGIA 4C6SA 2BR4A 4GPAA 3VSEA 1A77A 1QTNA 3DBRB 3HDQA 4BUCA 5K3SA 1EMDA 2ZULA 1EFPA 3CZQA 3KXDA 5EHIA 8AT1A 4WKGA 1KAMA 3DTYA 3HA7A 3U9TA 3ZHBA 1NPYA 2R5WA 4H6XA 3NRCA 4UU0A 1D4FA 4P80A 2VDLB 2PH3A 1W8DA 1JA0A 3GNTA 4OMDA 4U6QA 4XCXA 3E8SA 3NWJA 3P97A 4AY3A 3UJ8A 1TVCA 3Q7IA 1JLLA 1GZ3A 1DDOA 1KS9A 2CLEB 1JR2A 2GEFA 2H18A 3LVRE 4Z4IA 4P6VF 3VYUB 3PFHA 4BP9A 1QQTA 5ITSA 1DG1G 2Z43A 4A15A 4X93A 1DG3A 3AP3A 4BMYA 4QT4A 1Q12A 2F1OA 3P9IA 3ZCXA 3ZVLA 1NL3A 1OH6A 5DP1A 4XEUA 3SIRA 9ABPA 4ND1A 6AT1A 3CBQA 1B74A 3HYCA 2I2DA 3HRHA 4DW8A 2AV6A 2O8DB 2LKCA 4P4UA 3JALA 1JPNA 1ZVMA 2E87A 3H83A 1JFLA 5M7EA 1XZEA 4I50B 3OQJA 2F8LA 3QXSA 3ESCA 3KU1A 3IDSA 5AKLA 2B4KA 1V6AA 1XCMA 3SQDA 4NTZA 2JLUA 4HVCA 4CNBA 4ARBA 5K0JA 1VGRA 5JASA 1H1TA 2QORA 4FYXA 3HVRA 5ALSA 1GLVA 3OD1A 5BSGA 4DQLA 1JDVA 2O4CA 3ZWMA 1OZHA 2QF7A 2H9IA 2VZEA 3KPUA 4K5QA 1VJ0A 2N1MA 1FMTA 5E1OA 4OHWA 2JI4A 1T5TA 3GZJA 5I7RA 1T9BA 2QTCA 1QZZA 1K08A 4GSKA 1RE1A 4RA6A 4JY7A 3IALA 3Q0TA 3ZNQA 4CM1A 1UWLA 1X1CA 2IHBA 3ZX5A 3G68A 5LDGA 4OBBA 3DLAA 3T3IA 2GWRA 1QV9A 2D4HA 4BKPA 1HQCA 4ARSA 5J40A 1YZ3A 1IEVA 2HNBA 1ND6A 3B6JA 3OD5A 4KK4A 1JFRA 2QTWB 3HQ4O 5G4LA 1H9AA 2Q2WA 4AM8A 4DR5B 3F6BX 1D03A 2IYQA 1JIIA 1JPUA 1J24A 2H9YA 1E8NA 4GKKB 4BHTA 4AO8A 3RRNA 3JVIA 3HBNA 3EG5A 2DR2A 2C4NA 4ZO8A 2OZEA 3ZGNA 4H4EA 4C2AA 3G0IA 4EJSA 1C7FA 3SK0A 5CDSA 2I9KA 2WWVD 3SYKA 1OA0A 3DE4X 5FUMA 2FW6A 4TTTS 5BWOA 5AVQA 1NXOA 1S2GA 4U7HA 3AINA 4K9NA 2OT3B 3VR5A 1BKYA 1EG2A 3BHMA 3KRTA 4LK3A 2AI2A 2C4WA 3I37X 5EZQA 4WY2A 3DKPA 2AOUA 1YOVB 3J7AC 1KQNA 2HSGA 4IO1A 1Y7HA 4RPHA 1Z6TA 2IKQA 2LGJA 3B1KA 3ENZA 3NYIA 3WWCA 2TMKA 2ZWAA 4P31A 3FCAA 3IEXA 1LC3A 3DLPX 3EXIB 2BM9A 3N86A 3GGPA 3P2EA 4ZREA 1R74A 1Z4QA 1QFZA 2R2AA 3ZZTA 1S02A 1IUKA 1JGTA 4RD4A 2QTZA 5JCXA 2IC5A 3EQ7A 1N3YA 3AVYA 5DI3A 1R66A 2WM9B 4HHEA 3MGCA 4EO4A 4B2PA 1ECJA 1HWYA 4K8RB 2FF5A 1WF6A 2BHTA 1RR6A 2ETVA 2R6JA 3FPEA 4WCDA 4UNIA 3S70A 3UC5A 1YZNA 3ZN2A 1ZWLA 2GNOA 5AHOA 5J1TB 5EHQA 3AIMA 7GPBA 3BIFA 4WZAA 5JCOA 4PIMA 3TTTA 5GIOE 3KOMA 2D4AA 2XE8A 1JH8A 1JI0A 4HQNA 4CJXA 5CD1A 3CNBA 4OBEA 3LF1A 2V74B 2WHXA 2HY7A 3QYJA 4D6XA 3O1JC 3MLBA 2FSPA 2DBRA 4MVJE 4UCQA 5IVDA 4BE9A 3CLTC 4DLKA 1UOPA 3G0GA 3ESAA 3DGEC 4NMLA 4D26A 1X13A 1YRYE 5IABA 5KYWB 5KINB 1ZNXA 1UFOA 4O2LA 5H9WA 1EUZA 5HE8A 5F64A 4MUEA 1S2LA 2WUGA 4ZK2A 3OBBA 2O2DA 2X4GA 1AHIA 2MSEB 3M3PA 1Y4ZA 3OFVA 4HRYA 2I34A 2XVXA 2X15A 4GRDA 4LJ6A 3KT3A 5EAIA 1DJMA 4LWOA 2Z8YM 3ANXA 1BWPA 4XQEA 2RGWA 4FYVA 5IT4A 3FIUA 4JLNA 5JDCC 4F2HA 4UBOA 4ND2A 3GDOA 1OXVA 4IQGA 3DW1X 3JQ8A 5CA1B 1KMHA 3N2GA 2WSSD 4NFSA 1NW5A 1W96A 4JITA 3OPVA 4J4TA 3X1ZA 3LCCA 1L4NA 1Q1BA 2HF7A 4ZPXA 4EHFA 2C5GA 3VC7A 2LP4Y 5E4TA 2EZ4A 1SZDA 1R6BX 4ENRA 5JMOA 4GG1A 3CF2A 2RBGA 3BD9A 5BV8A 1CB7A 1N5KA 5BQ3A 1OH7A 3WQHA 3F3MA 2XVAA 4RKWA 3V1TC 2P27A 4RK0A 2VK1A 2BEVA 4ECEA 2V55B 1Z25A 2B0CA 4YCCA 1BDMA 1BMDA 4DBVO 1IN4A 3EDOA 4IXNA 5JADA 3DCIA 3RFXA 4UOZA 3IELA 4UD2A 3VDRA 2JAQA 5FNVB 5HUJA 1JLMA 1ZH2A 4LNAA 1AS3A 3VR2A 1XX6A 1KL7A 1Y33E 1RADA 4J2TA 3UANA 4I5EA 1EBFA 4TKUA 1IXKA 1Z0DA 3H9QA 4U7TB 1JQKA 5H9VA 4DPLA 1RWOA 2GZ2A 3MTBA 4HB4A 5KZMB 1YAJA 3WBJA 2XZPA 4B6GA 4GI2A 2FSHA 4Q7JB 3VPXA 2XIQA 2OV4A 3O26A 4OREX 5IJ0B 4CODB 3EFBA 4HVAA 1U0SY 3LDAA 3TM5A 1G8JA 1XZJA 3TZHA 1C2TA 1CJBA 3B9BA 5LDHA 2JGLA 4KBYA 3ROMA 3TM4A 3UMJA 2JI8A 2XTZA 1OX6A 1TRHA 4O2BB 1FX0B 1FNNA 2XNSA 4YI5A 1J8QA 1JHZA 2KI5A 1AQIA 3BGOS 3ZG6A 3LY5A 1S1CA 2QUBA 4G8CA 5JJKA 4RSHA 4ZVKA 5JZMA 1RNLA 1Y1RA 3OUTA 3JASB 1QV7A 5FTJA 1YZYA 1MW9X 2H17A 2O50A 4HDQB 4BZZA 4OOEA 3P9CA 4DNOA 5ICGA 2CL6X 2CJPA 3WGYA 3QA3E 2YY7A 2QNBA 2YWFA 2JFVA 2ZJBA 4G67A 4B2YA 3RSHA 1SHJA 2QUKA 5K8IA 1Z33A 3SOZA 3TR5A 5I3ZA 5K3CA 1VIVA 1E63A 3F7TA 5K03A 1LLFA 4HATA 4I55A 2AMYA 5EIOA 2IYTA 2WTXA 4ALLA 4YUWA 4KMSA 2RAVA 1DSSG 1DI0A 2R6FA 3BAZA 3W0LB 2FJ0A 3U3RA 1E1CB 4EJMA 3DEZA 1QP7A 2W6MA 3LLMA 2ZRJA 3P0HA 3QUSA 1W75A 4HNSA 4I99A 4O1MA 4ZICA 2EW8A 3L8EA 1P2SA 4KVGA 3LHSA 3GFSA 3MGKA 4TS9A 3NJ8A 3RWMB 3OF2A 2QP4A 4ARZA 4E5MA 4DR4B 2CSXA 5BQ5A 1CXZA 2G70A 4AZVA 2NTJA 3MS7A 3OM8A 1YBFA 1XQXA 2AUTA 4RY0A 3TQIA 4BEJA 1E6EA 3LRXA 2YFKA 4JP3A 5D7NA 1ZNYA 5E7JA 5FB3A 4HWSA 2OGUA 4HRVA 5KYKA 1H4VB 4ARIA 4G0PA 1UDRA 3IKMB 4LF7B 4JU8A 5ESXA 2LBPA 5ALIA 5K51A 1GU1A 2PD3A 2ZLBA 1A2QA 3DQZA 4MGIR 4KDEA 3BDVA 2GJKA 1W1IA 3MTGA 4YALA 3WRXC 4DLPA 4WGGA 3OJFA 1J00A 5AHXA 4ZAXA 5G0WA 4QJ4A 1LJLA 4EFMA 1HBJA 4YA6A 3JYPA 2AXQA 2JLWA 4WADA 3ZVNA 2D74A 2IXGA 2VCHA 4L9WA 4Z7OB 3C8MA 3QKTA 3M4JA 3R7WB 5JWOA 3WGIA 3VJRA 3PFGA 5J4KA 2BGMA 3B7PA 1Y98A 2HF9A 3QFFA 4ZT7A 3OQIA 3VH1A 1E7WA 2Y1KA 1SKUA 2I76A 4RJTA 3S8YA 2AG5A 2DHQA 1BXGA 4N9WA 1TUIA 1SVMA 4RZ3A 5LQDA 2PTHA 1EXVA 1ZA1A 2XCOA 1R4AA 1DIOB 2CFRA 2FB9A 3WJ7A 4P0QB 4Q9DA 4PAGA 2GKOA 2FX5A 3KPVA 4OK3A 4ZVQA 5KX5F 1S2OA 4G26A 4I19A 4C08A 5CVUA 3EXHA 1COWA 3GOHA 3OEED 3TZCA 3VTAA 3AKYA 3BE8A 5J5AA 3W05A 4B6QA 1I4LD 3LUCA 1G38A 2OLJA 3VMMA 3QLUC 1UBLS 5GOZA 4KKVA 1V8BA 1KY2A 2OO7A 3HJFA 4JP2A 1OXBB 4E0BA 1UBMS 1AH2A 3ZW8A 5JV5A 3DBOB 4XPIA 1KZ9A 4FVTA 5D2CA 4HSEA 2C99A 4O3FA 4A0SA 2F00A 2ERYA 3IT3A 3VYWA 3TMKA 4BFXA 2GETA 1YVEI 2Q6OA 2YV1A 4MI3A 2X0EA 1YQEA 4OG2A 1TO6A 3IAUA 2DWUA 2OO3A 1KO7A 3GV0A 4J3JA 3LQ1A 3HJHA 5HKLA 1SVIA 3CXRA 1XEAA 4EDHA 5T3UA 3VU3A 3KQLA 1GPUA 5DJ5A 2J32A 2PS0A 2R4UA 1Q2UA 3N3AC 4MI9A 1M3SA 4ZT4A 7ABPA 1MC8A 2G3YA 1LLQA 1PZGA 1LPNA 2YZGA 1W5BA 2HMSA 4KLRA 2JIOA 2VBFA 4G81A 2C42A 3P9XA 4LYAA 5C46F 4X95A 4URFA 1H5QA 1ZHFA 1SCQA 1XCGB 3E3NA 2ZKIA 1C0KA 4JQSA 1TA0A 1O95A 4AZ3A 4TXLA 3TRKA 2JJ8A 2WQZA 3MN1A 3QUQA 2QN9A 4ZVRA 2HK9A 3UJ9A 3WNZA 1KRWA 4Y2TA 4A0QA 1Y5LA 1RI1A 2ZUSA 4KMMA 4WIAA 2V65A 4MRNA 1RKUA 1LF5A 4TL8A 1TUBB 1KJWA 3A1SA 3OU2A 2WWIA 2Y4OA 1Z38A 3LXRA 1B0PA 3PXXA 3LLUA 4GKVA 5AIBA 3PPIA 2W2MA 4NYIR 3H0EA 1WNTA 5EP1A 3EVZA 3V4ZA 3S4YA 4EKNB 3O3OB 1HC7A 4DARA 1R50A 1XE3A 4HGOA 4XH9B 2MJLA 1OT3A 4JLWA 2O5EA 1H1LB 5DE3A 4DIDA 1CW2B 2GZ3A 5A5DA 1RJDA 1VKNA 2C4TA 2HA4A 1S2IA 4ID9A 3JQPA 4IJ6A 3ZY5A 3JR3A 2R60A 3AHGA 5IJ9A 5AW5A 2B5VA 3L82B 2IPOA 4W6QA 3HXKA 2PX2A 2O54A 1HEIA 1ZOOA 3NBFA 1NIPA 3H9BA 3RGGA 5IXYA 3C24A 3UUFA 1REQB 4QIHA 4HNAA 3DCNA 3ZGLA 4DXHA 4JXXA 4PPGA 4EAAA 5DBIA 5TNXA 3BA6A 3TZLA 2A1TS 3L6OO 2Q5OA 3PQ8A 2ZVJA 4S35A 4F2PA 1EFDN 3QELA 5LYJB 1H8HA 1VJRA 3IOEA 5G0VA 5EP4A 1QU2A 1KJ8A 5E2AA 7MHTA 1JZSA 3K6KA 2HHAA 1AHNA 1Q3TA 1UP7A 2PUWA 2ZBQA 2ZUUA 2C4KA 1Q5PA 5CD9A 1WBDA 2EP5A 1CY2A 1CQIA 4H7JA 5FH9A 1B73A 4R16A 1ES9A 1EYZA 1NZDA 5EIHA 4FFNA 1DKLA 3ITKA 1R8QA 1P18A 4BNMA 3RVMA 5EJ4A 1I4EB 1R0WA 1YB4A 3M6FA 4BVKA 1YJ5A 3H5LA 4IICA 3CLHA 4F3RA 2MCFA 4ADSG 2J48A 2J07A 1TCUA 2XTMA 4BMVA 3G5MA 4N5NA 3WGQA 4UBIA 3WNBA 4E2YA 4DLUA 3AEQA 3I9OA 4A1FA 4MKRA 1EH5A 1Y6FA 4K40A 1XYVA 2HWYA 3M33A 4HK4A 4MWCA 4PCVA 3LK6A 5E8JA 4FR2A 3H8JA 5KMGB 2J6HA 1E1RD 1GYRA 2MDTA 3C7CB 3OX1A 4HSGA 4L27A 5EIBC 1OW3B 4CV2A 3BREA 3LBFA 4L8GA 2Q1UA 1KZYC 4RFVA 4V39A 3A3KA 4QUAA 3I1FA 3OUZA 1CNEA 4R1NA 4CKEB 1OB2A 3IQFA 2HYDA 5EYPB 2BM8A 1DQNA 2EATA 2FW9A 4BC1A 1O9HA 2C1ZA 1RM5A 1FDTA 1YDFA 2QX4A 2YJ3A 4MUYA 4Y2VA 4KITB 3OO0A 3DBHA 5JWRA 4RWEA 1TZKA 4WFQA 4UVEA 3O95A 4CRWB 1Q0SA 2NQTA 2CLFB 2O07A 5BNWA 5BR1A 3WTCA 3MA0A 4KSYA 4LSZA 4CL0A 3UFXA 4OHYA 4YJ3B 1IY1A 1I01A 2P4SA 4C0LA 2AA3A 3KZCA 3UOAB 3PFWO 3LYAA 4E5SA 2OPHA 3K0CC 4QEZA 1JKJA 3EA0A 1EINA 3MJVA 1G42A 2FQYA 2W6JD 2V7EA 2XMCA 1TEHA 3VNVA 1RWKA 1E60A 1YNOA 2FEOA 4IV5A 4CKYA 3U44A 3DF9A 4GBJA 1NLFA 1SVWA 3T5CA 3PGA1 4EB8A 4Q4HA 5B3LA 1DBVO 1EUDB 1V1MA 4P7JA 2OCDA 2O3UA 1K5PA 3M2TA 1YQXA 3TLAA 4C29A 4B81A 2X1MA 4PN7A 2PUTA 3L8HA 1KAGA 1P7WA 2SKEA 4CEJA 4CIYA 1P2UA 4JHXA 2P7HA 4ITVA 1EDBA 2BEKA 5F51A 1EHIA 1QO9A 4CMJA 1A4UA 3FYUC 5F7OA 1GNQA 2CXNA 2H2AA 3B82A 4AN1A 2VCEA 3E22A 1CJMA 4YJ2F 3CR3C 1X0XA 3LQQA 3TL6A 3Q3VA 2CVHA 2WFZA 2HAEA 1QO0A 3FBWA 4W5JA 2R25B 3FTCA 5EXDA 2IY8A 2NQ2C 1W93A 2JPDA 4NICA 4NOKA 1ONSA 4BUZA 3RG8A 3GUVA 3EXFB 4BXOB 3JQAD 4V0LA 2VJMA 5JECA 3BMQA 2M6LA 3OP4A 3WFJA 2OXCA 1BVUA 3T4PA 1A50B 1T24A 1ZKDA 3HWX1 4KMOA 1SHTX 1K7YA 2DHRA 3JD0A 3PJFA 3PWTA 4FBLA 4ZAFA 4C3UA 3JATA 3GFOA 1NNSA 4UKDA 5AW7A 2HZ7A 5F3RA 2R7MA 3KFVA 3RVDA 4UMVA 3UHAA 3W6OA 4BECA 4EX7A 3ER6A 4CWAA 5AK6A 1G2QA 5J59A 3NUGA 4A5SA 3ZVRA 3R9XA 3VHXA 4YR7A 1JLRA 1WCIA 3PFBA 1OI3A 1Z4LA 3TD2A 4CLOB 1HG0A 1IZ9A 3NQ41 1WBJB 3NASA 4M1ZA 5T8KC 3NVDA 1LLDA 2NUTB 1TXGA 1STOA 4FMDB 4EW3A 3CZCA 4DMRA 3NNNA 5HWSA 1KIFA 4RADA 5B58T 2CGEA 2D06A 4MVJA 4URYR 1SCUA 3TJZA 3T5MA 4OA5A 1EWRA 1GGNA 4V0QA 5CBPA 1KOGA 4JNCA 4UUBA 5AVWA 4OCZA 1ZM9A 3H0KA 1N9GB 1EJBA 1VLZA 3HR4A 4FJ1A 3S40A 2FX2A 2WYIA 4JQOA 4ABTA 5EN4A 2FV8A 3EHDA 3N07A 3FTNA 3FOZA 3AEKB 3SQOA 2ZJ4A 4YQZA 5JNTA 2NV6A 4OXYA 4UTOA 5CITA 2JHPA 1PLKA 1DQZA 2XAAA 2XODA 1V1RB 3HWRA 2I1WA 4JP8A 4IP0A 3WGKA 2YS6A 3OZUA 5B3AA 5EPUA 1MX9A 1U28A 1K3FA 5IASA 2I8AA 2GN1A 3IJRA 3OURA 1EZ1A 2DERA 2WU8A 2I3BA 1ZR2A 3GJRA 2H4FA 5T7BA 1M2FA 1UR5A 3C6ZA 4LJ4A 3LO5A 3UCFA 2VKTA 2H92A 3ZQ6A 2VXOA 4G84A 4JDPA 3H5RA 5F76A 1P8AA 4R1TA 4PW0A 1HF3A 1IHDA 4HY3A 2PRYA 2FPUA 3DZIA 5K3DA 2RIRA 4QGHA 1YR2A 2FMHA 4YRAA 3Q8WA 3PHLA 3EIUA 3ZNNA 4BQOA 3I92A 3PWSA 2Z3VA 1PK7A 4LPSA 3LSYA 1K8YB 3MMZA 1T29A 4P0TA 4J8PA 2GTHA 3ODGA 4YACA 3NTVA 4FS8A 1ZGGA 4EY7A 5K0NA 1RBYA 4ZC1A 4QLOA 4TN5A 2X1VA 4H3HB 3TSAA 1GOTA 5JY1A 2WWWA 1I0ZA 3H3JA 2XNJA 3WGHA 3U40A 1Y1SA 1XQ1A 1T43A 3QX8A 2ONCA 2QI9C 3A9SA 4L8LA 2DBZA 4XIIA 4UU1A 3CH7A 3R3JA 1XLTC 4AJIA 1W4BA 3I53A 4Q1BA 5FWYB 1DGQA 5F1KA 1W6UA 3QIAA 4W1RA 3AF2A 1TT5A 5AP9A 4KX5A 2TMDA 3P8ZA 4R8VA 5T4FA 1CF4A 1AKQA 2LKDA 2YWXA 3T54A 2IZZA 4E1VA 4ZC8A 3KPJA 1I2MA 1JQ5A 1QGDA 2C8KA 4HTFB 2VA8A 4GT1A 3EUFA 4YYZA 1Y5IA 3AQIA 2ZVPX 5TMPA 3VNAA 3WIOA 1GZSA 4G5QA 4GPIB 4P5EA 4RXMA 5T8KA 4EHDA 3O4HA 1TQ8A 2JH8A 4IH4A 5HBRA 5HF8A 3RC3A 4UE2A 5M2QA 2REOA 4UNQA 2IU6A 2WV9A 5E6RB 4Z4EA 2WHEA 4MVJG 1QQ5A 3S2EA 3BCRA 4ZHSA 4YXFA 4KW7A 4NEHB 1QCCA 2IEIA 1CB0A 2W4IA 3LXXA 4F56A 4QULA 1N5DA 4RVNA 3ESZA 3ZU6A 3FNGA 3SDSA 2YASA 1VSTA 1L4FA 2Z5LA 1FFEA 3D8TA 3L7IA 4RPCA 4ZOLA 2VP3A 3FZYA 2HCTA 5DTRA 1KQGA 2ZB3A 3LDHA 4U8HA 5FV4A 4D46A 2NO4A 1LPBB 4WINA 4GNRA 4ZFNA 4EJ0A 1XALA 2CL0X 2G1PA 5BN5B 4UU8A 4LZOA 3VSBA 3V2UA 4MVJF 4B17A 2DSNA 3WI7A 2VHTA 3LCJA 2YFHA 4KAFA 4EYGA 1H93A 1N0WA 3FMOB 4IDPA 4LZLA 4EK9A 3DMYA 5CPBA 1G1AA 4L7VA 3FMGA 3ZI7A 2QLNA 2UXCB 1J9EA 4Y6OA 1HDZA 2VEOA 3IKTA 2DSTA 1J42A 2ONKA 3P0IA 2BH2A 4EPYA 3B52X 3WQBA 2WYVA 1CEYA 3EXHB 4JYPA 3FROA 2W2VA 3NOQA 4FB4A 2P6OA 2QSUA 3DAFA 3NDPA 2DFLA 1VA5A 2WJAA 4QOSA 3T52A 1WSWA 2HBRA 5JZVA 8ADHA 2HXSA 1OOEA 1S3SA 2ZAYA 4D7AA 1WMSA 4XJXA 4CQMA 1YZHA 5DSXA 1NAIA 4IRMA 4Q48A 4WGFA 1OA1A 1EDZA 1JHPA 3RHFA 5JG7A 2V7TA 3VA7A 4G0WA 5WRFA 4WOKA 1FRZA 4M0EA 1VQ1A 5BSMA 2OC9A 3NRJA 3VKWA 2CXQA 3LWZA 1UJNA 4E7OA 2QAIA 2Q1YA 2V8BA 1CUVA 4MGYR 2BKVA 5IHXA 2YOGA 3R76A 5A2QA 1RHMA 3DP9A 2XRZA 1BE1A 3HA2A 2KBFA 3ADOA 4S2EA 1BE8A 5K01A 1DT3A 1L7OA 5DPMA 3FWKA 2AKAB 1QO7A 1DEAA 3EWSA 3MBOA 4X62B 4FWTA 1FXWF 2O2IA 3QVXA 1JFFB 2XRYA 4FINA 8OHMA 4NC9A 4DMFA 1XD2A 4WBSA 3CC8A 2LE0A 4I4LA 2E6UX 7REQA 4C0KA 1G21A 5EWMB 4BB5A 3THXB 3LO8A 4NPHA 3S2GA 4R0MA 9ATCA 4RHCA 2KW5A 2VYNA 5D86A 4GR9A 1P91A 5FPSA 4U7PB 2Q6TA 2EJCA 3C1UA 3QSGA 3WLMA 1AB6A 1T36B 5EYPA 1MAHA 2PLWA 2QRVB 2AFIE 3FI9A 1VI5A 4JC0A 5K0EA 1FP6A 2EP7A 4IDAA 3TW6A 2N46A 1MJNA 1N7HA 3NDRA 3MT9A 1RQPA 5EC8A 1RWWA 1WPXA 1CLEA 4CM9D 1QC5B 4GE3A 3HSSA 4H59A 3OQNA 3EFHA 4MP3A 1ESEA 5JZOA 4QDXA 2IKSA 5AQEA 5GV7A 2JAXA 5PGMA 5T6BA 3UPUA 2DYKA 5L51A 5JARA 3ASUA 5BPFA 1QOPB 3JQDA 3RC9A 2RKBA 3WDKA 3L8CA 4PBTA 2PY6A 4YLEA 4MYRA 4JI2B 1AA9A 1XJ5A 1RHKA 3LQFA 1PJZA 1U0HC 2I0FA 5K0CA 1ZR4A 1NOKA 1RAIA 2YL2A 3UV6A 3ZBTA 5REQA 2I4NA 4AYXA 2AE1A 3CX4A 3K5WA 1W8IA 2B8NA 4GOMD 2QTGA 4EF4A 4RTQA 4Q19A 4LV5B 5AH0A 2EIHA 5LQKA 2C4HA 1E64A 3EBOA 1JYFA 3KUDA 2EHJA 3EGOA 1Z74A 4XIFA 1NVWQ 5FWXB 5IT9A 5INTA 1SBNE 4RQAA 2B8JA 4MW6A 4ZGGA 1RAHA 1BDJA 5F78A 1I5OA 4CLXA 1OZGA 1XAJA 5AW2A 5K99A 2NUAB 1KR5A 1Q7CA 2FG5A 4X5OA 1ILWA 4BQFA 2X0RA 1RCFA 1N7GA 1U0BB 4HAZA 1MB2A 3REFA 4NU6A 5JXJA 5IDVA 2VYCA 5D5PA 3TE7A 1NW3A 1NFRA 4K6GA 3OZAA 5AVVA 4B3RB 1XD8A 3OU7A 1J0DA 3HUEA 4RFLA 3G2NA 3ROEA 3SJBA 3WWOA 1DDGA 5HOQA 1N1MA 5KNDA 2E9SA 3EK2A 3BWMA 2QN2A 1BN7A 1PRYA 3QWAA 1VE3A 2ZATA 5ELLA 3SF0A 5LZ2A 3LA6A 1UPCA 3H2HA 4XIYA 1WTAA 3T1HB 2YXLA 1UBUS 5EE5B 2ZXFA 1HA3A 1X2EA 2I3GA 2UYOA 4IX9A 4LIPD 4F6CA 4MV1A 2P9CA 1N75A 5MGNA 5DMXA 3RK0A 3RRXA 3L0CA 3KU4A 2GN6A 4RKEA 3GD5A 1Y8QA 3PCXA 1ZAKA 4G1CA 4BIIA 3LGAA 1JG1A 1TT5B 3O4IA 3EPRA 1K0UA 1JAIA 3OAAD 4JUFA 5LZ8A 2FDRA 3EVBA 5CB4A 4IXDA 3M5CA 1GTG1 3OLWA 4NEQA 4TLDA 4OM7A 3F8TA 5IUKC 4ZQHA 3K9QO 2GPSA 2X0IA 3STHA 4MDFA 1DJPA 1H6CA 3A9VA 1TDJA 1XP8A 3MB8A 1MQ9A 2FW0A 2KM1A 2Z04A 3SZOA 4B6JA 5DHPA 3QE2A 3EZLA 521PA 1RWVA 3TMYA 3L7CA 1Y4UA 3F3YA 1XTBA 4RANA 3CU5A 1UK8A 4C3VA 2Y1WA 5GJVC 2FOLA 2WILA 5CXXA 3EA4A 3NNDA 1WB5A 2XCLA 3E5MA 4ETNA 2WQ7A 1G3UA 2UZ4A 4J3NA 2O1WA 4DB2A 5BVGA 2CFOA 5MN6A 4K0KB 2V6MA 4EMTA 1YACA 2WDZA 1NJGA 3QX7A 1RIIA 3NHKA 1CZLA 2UUPA 1XDGA 5AUPB 3N70A 3O0DA 4ZO6A 3SJZA 1E1DA 1UT6A 1Z68A 2A8YA 2XA2A 1QKKA 2QRMA 4NG5A 1SD1A 1CX9B 5KOJA 4B7AA 4RHTA 1VDMA 3A7EA 4URZR 1SUFA 2PUJA 2WTBA 4GRIA 1Z6QA 4HQKA 4KXYA 5KHAA 4BU1A 4KPEC 1A0OA 4JHLA 3RSCA 5AW3A 4XLLA 1YJXA 2POQX 2BRUA 3QP9A 1WMDA 4L75A 4PFQA 3BXHA 3BD8A 2Q9CA 1PTJA 1VZ2A 2WU3A 3COWA 3EEYA 4LW8A 3GRZA 3DJFA 3HKCB 4OYLA 1DC5A 4S1PA 1R88A 3MGAA 5DCUA 1KYWA 1MX1A 1TZJA 2FWBA 2W6ZA 3TSCA 2J0SA 1JYSA 1XQWA 3D6JA 5K3FB 4X1YA 1SIWA 4HYYA 4RIGA 1XXHA 3NAGA 3VPCA 2J3MA 2FDXA 1NVDA 2QW0X 1KWKA 2D1SA 2GD6A 3S1LA 3L6RA 3WGZA 5DI3B 2UYYA 1LTHR 3R3YA 5FUWA 2HR1A 3WRYA 4CNQA 4MQLA 3HACA 2BFOA 3NHWA 4TQUS 5H81A 3ZHCA 5GVSA 4OHUA 5C7OO 3N2IA 4PLYA 1LBTA 4Y2JA 4EKIA 5HIJA 3IMKA 5IANA 1VIAA 1Z5GA 5H59A 4PHGA 1J0EA 3HFGA 2C4MA 1ESCA 3D3WB 4UDYX 2G1JA 4ZYLA 3LUPA 1FNSA 3FOEC 4LA4A 2XY4A 3QVGA 4HDCA 3REGA 1SPXA 4ZEVA 4UM8B 4US1R 1ZJYA 3NM6B 4P9NA 4Q9IA 3B2EA 1ZVJA 2O3RA 4KXQA 1HETA 2PD4A 2PLAA 1NMXA 4US0R 3BB1A 4WCFC 2YW2A 3PRJA 4LXTA 3DHEA 2AC2A 4C21A 2PVCA 5AW0A 4L9AA 1FS6A 4ZKDA 1NOIA 1T10A 4AO7A 1Z4JA 4NBUA 4ZCRA 4ZOAA 2H59A 2Z4TA 3CSSA 1P1HA 3DC7A 4F92B 4O8CA 1C7JA 4KB5A 1KOJA 1YUBA 1EFAA 3GEEA 1ML3A 2RDMA 3ZV5A 1JFTA 2I4TA 5HZHA 2RGXA 4R6XA 4DWOA 1E32A 4KOAA 1PS9A 1G6KA 1VLMA 4DEVA 1FTGA 2FR1A 2V96A 4RETA 4LE2A 2ORYA 3DOJA 4PO3X 5EQFA 4BFUA 1XG5A 3P0EA 3DDSA 4BGUA 3IMEA 3OKCA 1RJ9B 4EI7A 4E46A 4UFPA 4CFZA 3A27A 2C98A 1S96A 2CXSA 4JUCA 3ZDRA 5KREA 3DKVA 2P9FA 3KHTA 4QQRA 5FT9A 3U16A 2J31A 1G98A 2VP4A 1HE4A 1H1LA 3A31A 4LTDA 1MAAA 2AN9A 3RE1A 3RIYA 4YAEA 3ZR4B 3UV3A 1ZD2P 1U9YA 3F3SA 2Y1LA 4FC6A 4A2QA 4HQFA 3WO0A 1VTKA 3GNSA 1XFAA 2JLCA 1ZRNA 3DZKA 4LDJA 1CIVA 3SC2B 1BX1A 1NDQA 3UJCA 3FCXA 3KVYA 3IKLA 2ZWIA 4EB6B 1HKHA 4JD5A 3G9ZA 3AEUB 4MROA 2XSZD 3B6KA 5B6IA 3DZFA 2V4ZA 3ISJA 3D0RA 1WL8A 3O2SB 3K94A 1S01A 3HCCA 4D96A 3HSYA 3U13A 1GILA 1ULHA 4A9AA 4KE7A 4WJLA 5C7YA 4JA0A 2X5JO 4ZDIA 2EAUA 4TUYF 1CYDA 1M66A 5C9ZA 3EPKA 1J2RA 5HF5A 2XUJA 3E8MA 3FRHA 5D3KA 4B4UA 1KO8A 4DLBA 2PJDA 2DC1A 1OPXA 4R9UC 1P1KA 5K9ZA 4L7QA 1E1YA 1KA9H 2FEMA 1GZVA 4CEHB 5TT1A 2XH8A 1QTRA 1GLNA 4JBYA 5KWIA 4WL0A 3H1GA 2PHZA 3EQ6A 4ITUA 4JAVC 4PYLA 4I3GA 2W6CX 1NWHA 2H4HA 3PXCX 1A8IA 1OLOA 2Z6AA 3AOEA 5KYUB 1JWLA 3QWFA 4E1BA 5ECGC 2JDID 1XD2B 4PZEA 4HTFA 4B83A 3RIEA 1NJ1A 3IUSA 3KB2A 4NBKA 1DELA 4DR6B 2JI7A 3W5SA 2LIPA 1VSVA 3E3AA 3OFKA 1JBKA 4N3NA 2F3SA 5T4BA 4EAQA 3G5LA 1RZUA 2E82A 2HU2A 2V97A 1DKUA 4MVXA 2JS7A 2NM0A 3ACBA 4LKOA 3F46A 2QLLA 2JVKA 3FNQA 3QKWA 2F1RA 5SZHB 2C8LA 3H2IA 3KJFA 3EOAI 4GO1A 1TNDA 1WO8A 2EDAA 3EVAA 3GFPA 5K45A 3ISVA 3H0CA 5CLLA 2QRHA 5JCZA 3HI6A 5IEJA 3VDMA 1QHNA 3WTBA 5CH3A 1OF1A 1Q1ZA 3RVOA 3TX6A 2UZ3A 2BEVB 3PDHA 5LJIA 1NVEA 4EIWA 2IS2A 4RD0A 3PR2B 2WD7A 1YF3A 3L46A 4UQPA 2CUTA 3LCMA 3L2OB 1ZA2A 3C8DA 5JY6A 4LDAA 2JJYA 3EBPA 3ILHA 4RKRA 3A58B 3TTVA 3UQZA 4N3CA 1KKLA 1S2DA 4W1QA 2D3WA 2NYRA 4ZCTA 1GTMA 2PMDA 2RHTA 4EGCB 5HJ5A 2HMWA 3KQHA 3N8GA 4YP1A 1P2FA 3AH8A 3CZPA 1G3IA 3EPPA 2V58A 1U7UA 1NZJA 3H5TA 4R1OA 3SYNA 1M6NA 1P7ZA 3ESXA 3EARA 3Q4GA 3ZBUA 4ZJYA 4Y1RB 1KH1A 1YU6A 1L4BA 3BOSA 3EQZA 1BJKA 2ZKLA 3DMPA 2C7QA 2WM3A 4CMIB 3KBOA 1ZOLA 3PTLA 4DGQA 2XKJE 4DY6A 2ZQZA 2RI0A 3GWZA 2ZI4A 4GZ5A 4W8GA 3SG0A 1UBGA 3F7MA 1YQWA 1ZUWA 4OMUA 1TE2A 1CZHA 1WDMA 4RCVA 3D3NA 3D7LA 2JIBA 2I99A 4BFYA 3QWIA 4HDSB 1MIHA 1QVWA 2OCXA 3OF3A 3F90A 2H63A 3UCXA 3F8WA 2P3SA 5EJFA 4Q24A 1FUYB 1MT3A 3NI2A 1QP0A 1SQ5A 3PL5A 5C8DA 3EPLA 3DV0B 3HUUA 4TMTA 5TPZA 1GDHA 1ITZA 4M49A 1GEGA 2VK8A 2DF8A 5ALNA 4DZZA 1U8FO 3COSA 4TYNA 4FFOA 1KU6A 1VZ3A 1QHHA 3GDWA 1PO7A 1H0KA 2HA7A 1GQ2A 4MB2A 4P3NA 1JDBC 4WZAE 3A6ZA 4QU9A 2WJ4A 2WU0A 4CTMA 1UPFA 5B1HA 2I2CA 4I55F 4XA8A 3ZCPA 2BMAA 2MTBA 4AJ2A 1R6DA 4PXAA 3ULKA 3W34A 3M0EA 4G5HA 2BKUA 5ESDA 2D1TA 1JZTA 5JO9A 3W8EA 7REQB 5JANA 2VPIA 2X9LA 3E84A 5HDBB 2L42A 1QE3A 2JCBA 1A27A 1E5VA 3EXEB 2PBRA 3F6RA 5IAGA 2EFEB 4JJIA 5DBFA 1R9GA 5IJZA 4NSNA 4WT7A 1GTRA 1XTIA 1P62B 1T5IA 2FP4A 4MI6A 4TXNA 4WDRA 2FSVC 4YRRA 1PJRA 3TTWA 4YMWA 3I5MA 3RV3A 1GGJA 4J7CA 5HRCA 1RJWA 3KT6A 4RULA 5LP6C 2HIMA 3IBTA 4XUEA 1N2ZA 3R3ZA 1QKIA 2PUGA 1OU0A 4P86A 1XR3A 3FPAA 2H0AA 1W85B 3BL6A 5C7LO 2B4TO 1GV0A 4MOWA 5CA0B 1MGOA 5HGXA 2RHMA 3SS9X 1F9EA 3AHDA 2GTPA 4PONA 3JW8A 2DLNA 1P3JA 1YH3A 1OH5A 2W11A 5BW8A 4PTYA 1CPYA 4QQ8A 4DLWA 1BS9A 3UH1A 3ELUA 1YNSA 4RWZA 2PRSA 3PEYA 2Q0HA 1J8FA 4OXIA 4ESEA 4CV3A 1L5ZA 4W6ZA 2ATIA 3ROTA 3K71B 1ZSYA 1UL1X 1L9KA 3KUXA 2J30A 3GUHA 2ZTLA 4JUDX 4KO4S 4CV1A 1D2CA 1R10A 1E2GA 2BSXA 4LSGA 1M0WA 2VHUA 4J91A 5K4GA 3FPKA 3PQDA 4BWVA 2VSNA 3RR2A 2A4MA 4UUMA 1UXKA 3FDFA 2P4UA 4JI4B 1JG6A 4MS1B 4YONB 3KD3A 2HUNA 5CVCA 1XA3A 3O4GA 4RLQA 4BX2A 5FF9A 4LUCA 1OWPA 2ODTX 1E3IA 1SJ9A 2IUYA 2IYFA 2JFXA 2WTMA 3D64A 4GQBA 4W82A 3VR3A 4XWOA 5JYDA 2X8BA 2PUFA 2CXTA 1ZCAA 3KKOA 3QLTA 4X8HA 5EESA 4OP1A 3TRIA 2ZSHA 2CV0A 1G21B 4EF5A 4AZTA 2WG1A 1Y34E 1PZHA 2AWNA 5KJFA 4IIJF 2G67A 3REQB 1P5ZB