1NUQA

Crystal structure of human cytosolic nmn/namn adenylyltransferase complexed with naad
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
233
structure length
213
Chain Sequence
SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKSG76
publication title STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 213
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2003-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nuqA00
2J08A 3TQOA 1NZJA 3CLRC 3FDXA 3UOWA 4L2IA 4MWBA 4Q93A 2CT8A 3AG6A 1WXIA 4CQNA 3SDBA 4R2LA 1OWLA 3AL0C 1COZA 2I1LA 1JZQA 3KT0A 2H29A 1XNHA 3INNA 3P52A 2OV4A 1IRXA 1QQTA 4ND7A 1EFPB 5HUJA 1YUMA 3CR8A 1M8KA 3PXUA 1VBKA 5LFAA 1M1ZA 1M8JA 1O95C 3DLAA 3RHSA 1MB9A 2EJCA 4XFJA 3N8HA 4I6GA 1VBNA 1KP3A 4KPUA 1F7UA 2DLCX 1GLNA 1JEEA 4ZT5A 2QTNA 1GTSA 5JBNA 1OWMA 1F7VA 3IH5A 4QRDA 4J76A 4NZPA 5DEOA 2R5WA 4EG7A 5BNZA 1EFVA 2PIDA 3RJZA 2AG6A 4ZCRA 4NAUA 3JXEA 4G6ZA 2Z09A 4MW4A 4MW6A 4EG8A 1QJCA 4YMIA 3E27A 4RPIA 1Y42X 4R0NA 4MUFA 3NV7A 4F3RA 3D6UA 3QTBA 1F4LA 1O5TA 4HJXA 4MW9A 2PXHA 1N2BA 2BTEA 2QUKA 1YIDA 1NYLA 1ZUNA 1PG2A 3X1KA 3Q12A 1TYCA 4L2IB 4MUEA 1MRZA 3UC5A 4FZJA 1YI8A 4CDMA 3TS1A 3COWA 3PNYA 1XNJA 1IQRA 1ZJWA 4HJRA 1TFUA 4PBSA 4X0EA 4KR9A 3COVA 4PBTA 4U7JA 2RE8A 3HZRA 3GMIA 1KQOA 1OWOA 1G8FA 1I6LA 2EL7A 3ZJTA 3ND7A 3COZA 3H9BA 2E89A 1N2HA 4UZFA 1PFVA 1NUQA 1TEZA 3AG5A 2A7XA 1YUNA 1GPMA 3G59A 3GUZA 4K03A 1M8FA 1DNPA 1JZSA 2D54A 5J5AA 2A86A 3FI0A 1MB2A 4J75A 4EGAA 1U0BB 2ZP1A 4MWCA 3X1JA 4AQ7A 1IHOA 4ZT7A 2E18A 2OQ2A 1OWPA 1U7DA 2A1UA 2YWCA 4UZEA 1TYAE 1PFWA 1U7XA 5AHWA 1EFVB 1TYBE 1OBHA 1H3NA 3FWKA 2QJFA 3RBAA 3ZJUA 5J58A 1M8GA 5FO1A 4ZT6A 3SEZA 1N2OA 4QREA 1MJHA 3IODA 3P0HA 3VU8A 2CSXA 1JIKA 1HYBA 2RD2A 3ELBA 1A8HA 4ZT4A 3F3MA 1N75A 1FYDA 1KQNA 1NSYA 1JECA 2PZAA 2XRYA 2A1TR 3IMGA 1KAQA 1G8GA 1TYDE 2X1LA 3FY4A 3NBKA 4RUKA 3HL4A 2O8VA 4MVCA 3QE4A 1R6UA 3M5WA 1KH3A 3SZGA 3MLAA 5J59A 1JHDA 5TEVA 1O97D 1EXDA 3A2KA 3ZGZA 1H3EA 1BS2A 2QJTA 4YBRA 1Q11A 2A88A 1KORA 3SEQA 1QRUA 2CYBA 1X6VA 1N78A 1H3FA 4EG5A 1J09A 1N2EA 1O0BA 4ZT2A 4EG3A 1O94D 3CLTD 1K4KA 3HMQA 2VTBA 2DETA 4DDHA 1IFXA 1Q15A 2PZBA 3N9IA 2NZ2A 3DPIA 3H05A 4ZCQA 3A04A 1ZH6A 4JZYA 3AKZA 4JXXA 2G36A 3OP1A 4WSOA 2A1UB 2DXIA 2JAXA 2WQ6A 3CVXA 2X3FA 4I6EA 3CLSC 4ZCSA 1Q19A 3MXTA 3N05A 1SURA 1K97A 1LW7A 1M83A 1G59A 1V47A 3TZEA 3TQIA 1JIJA 1VBMA 1T9GR 1WXFA 2H2AA 1IH8A 1QU2A 1WJGA 2JANA 1N3LA 4NX2A 5TS2A 2IP1A 1EJ2A 2A84A 1F9AA 3CVYA 1J21A 4YP6A 4DJAA 4XSVA 3IUBA 1WQ3A 2DUMA 4OJMX 2AZXA 2PG3A 1J1UA 1NURA 5K0TA 3CLRD 1ILEA 1U3CA 4EFKA 2WB2A 3CLUC 4YP5A 1KH1A 4HK4A 1KQPA 2X1MA 2YY5A 1J1ZA 5IHXA 1N2JA 1KP2A 3PNVA 1J70A 4MVXA 4P2BA 3FH0A 1OWNA 3N2YA 2CUZA 4KKVA 1M8PA 4H3SA 1EUYA 3VGJA 1R6XA 3IOEA 3P0IA 1I2DA 3C8ZA 3ISJA 4MQ6A 4MWDA 3AFHA 4ZT3A 2IJGX 4ZCTA 3OTWA 1H1TA 3G6KA 2DR2A 1NUUA 2VTBB 1VLHA 2IELA 3AIIA 3HFJA 4MUGA 1I6KA 2QJOA 3IMCA 2TS1A 3IMEA 3TNJA 4MUHA 4DLPA 4ARCA 3RK1A 5FNZA 3FHJA 2WQ7A 2C5SA 4QBTA 4ND6A 5KHAA 3ZUGA 2YXNA 1LI5A 2Z3VA 3H97A 1UFVA 3FG9A 1JGTA 1NUPA 2QUJA 1D2RA 4MW5A 1R6TA 4EG4A 5K0SA 5IJXA 3U1VA 1J20A 1EUQA 1WXGA 5KWVA 1K92A 3MUEA 3RFFA 3UY4A 2AKEA 1WXEA 1JILA 2DPLA 1NUTA 3MLBA 3SP1A 1WKBA 3ZIUA 2A1TS 1T6YA 3L92A 1T6ZA 4OUDB 1B6TA 4YP7A 4AS1A 5EKDA 4G5FA 2QUHA 2NSYA 2CFOA 4MLPA 1QNFA 3ND6A 2GM3A 5TGTA 4MUJA 3Q10A 5HG0A 3K9WA 3TZLA 4GU5A 4WNYA 2QTRA 1IVSA 1JMVA 2D5BA 3PRHA 4HPWA 3CVWA 4F4HA 3BL5A 3DV2A 1S4MA 3LE8A 4JYZA 1QRSA 1PFUA 1GZUA 1WY5A 1WOYA 2DEUA 3Q4GA 1U3DA 2E21A 1WZ2A 1CT9A 1OBCA 1O0CA 1WQ4A 3GLVA 1JEDA 1MAWA 3HGMA 1O96B 3ILVA 3LCJA 1QRTA 3FIUA 1ZH0A 1PG0A 2B7LA 2HGZA 4PY2A 2ZUFA 3IOCA 1P7PA 3H9CA 3CVUA 4MW7A 2WSIA 1KKUA 3IUEA 4MWEA 1NP7A 3UMVA 3K32A 1O6BA 2HMAA 4KR6A 1KAMA 4S1OA 1T9GS 4NAHA 3P0JA 4U63A 2D13A 5DASA 3IVCA 1NUSA 2QTMA 3A4IA 5HUHA 1EE1A 2J4DA 1N77A 4I6JA 3I05A 1N2GA 3DO8A 1XNGA 1PFYA 1RQGA 1ULHA 4DDMA 2X0KA 4MW2A 4ARIA 4OUDA 4MW1A 3SYTA 1GTRA 1WXHA 2J09A 1MBZA 2JA2A 5H7XA 1G8HA 2HZ7A 4JFAA 1TQ8A 4E1AA 2J5BA 1FFYA 3QTTA 4XFDA 4EG1A 3COYA 3S3TA 2CYAA 3ZXSA 3L93A 1X8XA 4MUNA 1XJQA 2O5RA 4CDNA 4DE5A 4R2MA 1N1DA 3A05A 4A91A 1I6MA 2ZUEA 1VL2A 4MUIA 2V0GA 1QU3A 1YIAA 1YULA 4G5YA 1O97C 3KT6A 4MUKA 1O95D 1GAXA 3KT3A 1MOPA 2PFSA 3IVXA 1GN8A 3KT8A 1O96A 2DERA 5LLTA 2CV0A 1N2IA 1T6XA 5KCMA 1EFPA 3PNBA 3VRHA 1MAUA 2QUIA 3IVGA 3ZJVA 5TEWA 2Z08A 2V0CA 4DNXA 1KR2A 1O94C 3CLTC 2GKSA 3ND5A 5LM3A 4NDAA 2XRZA 1K4MA 4MAFA 4GRIA 1KH2A 4EG6A 3MMXA 1QTQA 2CV2A 3LOQA 3H99A 1IQ0A 4NATA 1OD6A 5F23A 3CLSD 3HV0A 2A4MA 3CA8A 4KPUB 4MULA 2VXOA 4Q16A 4KR7A 5DK4A 3IOBA 2GOYA 4JXZA 1JIIA 3SZ3A 1Q77A 2E0IA 3FETA 4TS1A 1NI5A 4ZCPA 2CV1A 3FNRA 3X1MA 3RK0A 4MVYA 5FO0A 4DDKA 3G5AA 2CYCA 1IQUA 1MC1A 3CVVA 4EF6A 1LI7A 2YWBA 3NBAA 4BWVA 2BYTA 4U8HA 2J07A 3FOCA 3ZXIA 2PZ8A 3D6VA 3CLUD 4PBRA 4MW0A 1V8FA 4MVWA 4K0RA 3KFLA 5DB4A 3UK2A 3IDFA 5H16A 4CT0A
chains in the Genus database with same CATH superfamily
4MMZB 4AF6A 4DNPA 5AVSA 1YC2A 1BD3A 1N5KA 2F3RA 2JAQA 4KZKA 2LCQA 3T4UA 1MGOA 3L6RA 3AQIA 4BPRA 3TM5A 1X7HA 3QWHA 2F2TA 2VQSA 2A33A 3K8OE 3UAYA 1KERA 1KFCB 1NAHA 2PGDA 4WVFA 5FTWA 3ROQA 3RVQA 5L3QB 3QKTA 3ODPA 3QX8A 2YJ4A 2GK7A 5GVRA 2IBMA 3WLEA 3HKDB 4X8MA 2OWDA 1XKXA 5B12A 1GSOA 1E3IA 5TQ2B 2HXYA 4LRWA 1JG3A 2BUCA 2PKRA 1HTTA 3GPLA 2L0XA 1MJFA 1AQYA 3EVAA 5K0FA 1ABEA 4BLTA 2PKWA 4JEUA 5IU6A 4WFJA 2QAGC 4BC0A 3ZE1B 1W1WA 1FIUA 4JITA 3HK2A 1TZKA 4BXOB 3EF0A 1WCWA 4INZA 1U0NA 4F4JA 2QL9A 1CUFA 3I5UA 5U9CA 3BX1A 3TIIA 5AHKA 4ASUA 4BU1A 2BMWA 3BEOA 2O2XA 2QN7A 4OYLA 5L7YA 1YASA 1YZUA 3K0KA 1YXMA 3NU1A 2Y2VA 4GZLA 5FTJA 1R0XA 5J9FA 2FPGB 4IJ6A 3UF0A 1MORA 1XZBA 3RK4A 4GZ3A 1PEKE 4UOQA 4LCBA 2CXNA 3FYTA 5IW8A 1D7AA 4Q1DA 4JVOA 2GPWA 1VCMA 4Z9FA 5KTNA 1RRKA 4PLGA 5AHRA 1PZXA 3QNWA 3RYCB 1U2RA 1H2BA 4OJYA 1EFVA 3ZHUA 4PRZA 4GBGA 2BY4A 1JUDA 1XHEA 2G1JA 3C2QA 4C0JA 4PLCA 1XV5A 3CX6A 4LOIA 4COOA 3H04A 2OXTA 1GNTA 2HA7A 1M7GA 1PQYA 2F67A 1QRRA 4IDBA 4RPIA 5HE9A 4MUFA 1N4AA 5DM1A 4ARUA 5JJCA 3S6JA 1CW2B 2ZT7A 1VPDA 2QRHA 4QXQA 2V6FA 2VHUA 4YRPA 3ZLJA 2B4KA 3KU1A 3MMNA 4Q37A 5DLPA 4F4DA 5BWMA 3BGIA 5HJ5A 3H18A 1MAAA 4X6UA 4YMSA 1QHXA 1E79A 1SOAA 2ECKA 3E3NA 3KLPX 1CUBA 4B6RA 1P4HA 3ROXA 3EQ8A 2YIVX 3AFOA 2D3WA 5AKXA 4HUTA 5ALVA 3PNYA 4LHSA 1QOPB 1RXCA 3CKMA 3ND9A 4OH7A 3RIEA 1AKEA 1DJNA 3S55A 2IBSA 3ANMA 1K06A 3DOFA 3ZI7A 4YDQA 3K4HA 3QE0A 5C7IO 2Z5VA 5FNVB 1TD1A 2MYUA 2VKTA 3TXAA 4X1IA 2AG8A 3HZRA 1WPXA 3LNTA 4CCWA 1G8FA 1RBQA 1UKYA 4HZIA 2ISQA 5T4FA 3MPOA 2HFKA 1QX4A 1JU9A 4GI2A 4GWKA 4UU8A 4FK8A 2AFRA 2RIRA 4MICA 5CT5A 3QEBZ 1W36D 3MWGA 1AXEA 2HRQA 3GVPA 2CDRA 2O14A 3KOMA 4URWR 2D5LA 4DANA 5HKOA 2JLSA 1NJ6A 4MRSA 1NBEA 5COAA 3PX2A 2C3PA 2QAGA 1JZSA 1VJ1A 3BIJA 2ODNA 3CH4B 3T0IA 1WIWA 3OHSX 3RD5A 1LSUA 4PZAA 4WN9B 1UJ6A 3H9UA 3OIYA 4KLCA 1GRNA 4OI4A 1DXHA 3QFSA 1XKTA 3B6KA 4MS4B 4AMYA 4RXUA 1AQNA 2PRIA 3X1JA 4PYMA 2PNJA 1IPFA 2O1EA 1MQ9A 5DM4A 1VHWA 4F7DA 4BLQA 3CY6A 4FKMA 3SQLA 5TRTA 3B3AA 4QGFA 4DBZA 2B7CA 4DQLA 4AU1A 2OKCA 2W93A 1F5SA 2OYRA 1Z12A 2JFPA 1JEOA 4Q00A 1A69A 2PM8A 3WZLA 3SJAA 1DZIA 1SZCA 3P45A 4KQWA 4O4HA 2CV0A 2BFNA 2ZRKA 3FF1A 5FO1A 1LQTA 3KC2A 2C3UA 1O9GA 1P0MA 2VHTA 4OXQA 4RDCA 4PVCA 1KBZA 3I2HA 3VPFA 5B1DA 4K05A 4F5WA 3QM1A 5DXFA 4Y2PA 4BE9A 1SBYA 3DHVA 4J1QA 3NFRA 1G5PA 2HSJA 4R01A 3HL0A 4YJHB 3AVOA 3BFVA 3L8MA 5CVCA 3WAKA 4CKEB 5E9WA 1C30A 4UFOA 2GMWA 5CNMA 4EJSA 4GE0A 2O2HA 3ADKA 1B8OA 2C4VA 2C2XA 3EEBA 3GC6A 1S8NA 2XMRA 5SYNA 3IMGA 2JI7A 5JHGB 2Q3HA 2VDRB 2HHAA 3ONNA 4ABYA 2MSNA 2E5LB 1T2NA 1ONOA 2QTVB 2FRVA 4QPZA 3C85A 4G0UA 2CDBA 4H4EA 4B2YA 2YOFA 4L51A 5C5IA 3TQHA 5K99A 4PAWA 1LBEA 2WNSA 3R77A 4KW7A 3M5WA 1KH3A 2AF3C 1D07A 5EZYF 1U0BB 1NF8A 2BWJA 1EVLA 4E46A 1J7JA 3RC1A 1RBMA 1Y1KE 2HK8A 1LLQA 1OBFO 2VZEA 3RVOA 1GY8A 1NFRA 4Y98A 1D04A 1Q11A 4PQRA 3P7MA 1NSTA 4WESA 3R7DA 2ID8A 4B4WA 3T1NA 1QRUA 4WK0B 4MMYB 1W73A 2J32A 4B8YA 3M83A 1N78A 2HBYA 1E9BA 1SB8A 4CM9D 4Z54A 2FMHA 2OPBA 1K4KA 4DV4B 1VM6A 1YDWA 1YR1A 2NXJA 4ECAA 1PNTA 2P0YA 2HU5A 5K3BA 2ZTMA 4ER0A 4HUJA 1HE5A 4S05A 1Q15A 2O52A 3AHJA 2Y3IA 1J0BA 2ZR8A 4YRBA 3SQWA 5BRJA 4FGKA 2FXVA 4MUMA 2XQKA 3GDFA 4P1ZA 2H2WA 2KLBA 3OJEA 2LGJA 2QU7A 4LZNA 3KYDA 4BO7A 4G5XA 4WRRA 4NSNA 4R2JA 5DRTA 3ZV5A 1TMKA 1E5LA 2XVZA 4EA6A 3WGTA 4B75A 5EJ6A 5IANA 2R0QC 5A6SA 4DJFC 3TGLA 5ECDA 3VNSA 4KV9A 3UJ3X 2SNIE 2CUNA 4BJHB 1U7WA 1TM1E 1UKAA 1Z17A 1C3LA 3BMXA 4ZAXA 2OYCA 3TM4A 3HVHA 2ZUVA 1SC6A 2X1HA 2V3WA 4HI0E 3SIXA 4DHEA 1YQTA 3JR7A 1WXFA 5K5EA 4H0CA 2CHUA 4LWZA 3RRZA 3F73A 1OF1A 3ESRA 2VWHA 1F8GA 2EX4A 2JGNA 4WBSA 5A1TA 3ISTA 4YT2A 1PS8A 1SKBA 2RI0A 3P2KA 1GPDG 4HSGA 3TOVA 1YSCA 3X1ZA 5LDDC 1MQSA 2XUHA 5HSGA 3H5WA 1W0JD 1I1QB 7REQA 4UU1A 2Y1OA 3EIXA 5K0CA 4BFUA 4W99A 4ZC1A 5BWLA 3EH1A 3I8SA 2IHBA 1RSZA 5ALEA 4CTNA 1U3CA 2E4VA 3CIFA 2WB2A 5FADA 1KK0A 3WIDA 5I8WA 3A6ZA 4ZCMA 5HX7A 3VXKA 1RVV1 5IHXA 3JQ6A 1Y9JA 4V24A 2LW7A 3J80A 1K0UA 1F3LA 4O5AA 3WLSA 1F2DA 1WLYA 2GNOA 1JNYA 1TCBA 4FMDF 2BCJQ 2Y99A 2VTVA 3HR7A 4YH1A 4MDFA 4HX9A 1YB6A 1UDCA 3R3YA 4F84A 1V8OA 3ZW7A 1D0IA 1GCUA 2HXGA 5BRNA 1NJ1A 3R5SA 3QWAA 3RJ9A 5HUQA 2D62A 4UULA 1I24A 2QLFA 2ZRMA 3DMDA 3G2OA 4RYLA 3TCXB 4RTSA 1X1CA 3WL8A 1E9DA 5LBIA 4MDYA 3WRXA 5KWSA 3R5JA 4XI9A 3V4VB 4Q3KA 3RRYA 3G88A 4QYIB 4CTKA 4A2QA 1O95A 4AKGA 3E1SA 2B69A 3G9UA 1WX1A 4WKNA 4ZC8A 1KEWA 2D1YA 3SKYA 4FB4A 1K27A 4EAAA 3BH7A 3V00A 2J3EA 3KE8A 4JEMA 2IS1A 3EC2A 3FJYA 3HFJA 4RGQA 3V7FA 3HVIA 3GEPA 4MPPA 5C1IA 3BC1A 3V7UA 1FXUA 4F60A 1P2VA 5JZOA 2FW6A 1ISSA 1JFLA 3I09A 4ARCA 1VI2A 4N8EA 3AM1A 2X23A 1E61A 1RMTA 5KJFA 4RTRA 3MTEA 1WXXA 3ZUGA 1EHYA 4K26A 2AL7A 2EEZA 5LBUA 3WVNA 4DMLA 3ED1A 4IILA 5EWMB 4M1SA 4B79A 2JJYA 4QUKA 4ZAYA 1FUUA 1R9NA 1S8AA 1JGTA 3S99A 4D4IA 1W94A 5E7QA 3U62A 4C01A 4NYJR 2OD2A 2EFHB 3B5EA 1YNOA 3THSA 1TAGA 1RHUA 1Z36A 3JU3A 3L6EA 3WLOA 1EUQA 1MA0A 1QMPA 4J49A 2OHXA 4WN3A 3STTA 3UJPA 3UZUA 2HA6A 4TLLB 3TH5A 3LCUA 3E7DA 5ALJA 3WKAA 4D9KA 3E03A 1LNQA 2FHPA 2IZ0A 1RZUA 1YC5A 3DHNA 1FPMA 3FOZA 4RFSA 1WMDA 4F6LA 2AKEA 2BFCB 3GDGA 5GM1A 3FF4A 4O33A 4FW8A 1U04A 1Z0DA 2A1TS 2VPZA 3BHIA 4J6FA 4LVCA 2A8YA 1S1MA 4O4JA 4RY8A 5FWYB 4ZMRA 4DV6B 3MQ4A 3ST7A 1K1EA 3LK6A 1JIVA 2Q9CA 2O0JA 3AR8A 1PWHA 2EW1A 2D8MA 3CF0A 3OZ7A 3CW2A 4RD4A 5CPBA 4BEVA 1D2EA 5IH3A 5FUMA 1Z73A 3E84A 3JQDA 3OWXA 4HB4A 4Y9DA 3K71B 1QNFA 1CQJA 3O94A 2OT3B 4ZO8A 1CERA 2B1RA 4M38A 5F5LA 1BWPA 1QKJA 1C7RA 4WNYA 3LIIA 5D6NA 3GJRA 5DXAA 3VKWA 4D3DA 5KTRA 2CB0A 3NOXA 2JIBA 3OEHD 5JY6A 2CL5A 3GJYA 4X64B 1M34A 4BMNA 1ZD2P 1HZZC 4TZ6A 5BOVA 1DQPA 1TAHA 3H3JA 3F6EX 4U2KA 2ZTHA 4TTJA 4B32A 4BJ1A 1NNI1 4DF3A 5LBTA 5B7GA 3I0NA 4FDTA 3Q9LA 4MKXA 2A35A 4Y30A 1OBCA 3EFHA 5DDIP 2WTEA 3AOGA 4R8RA 4AULA 2PUFA 4AF8A 3SHWA 1XEAA 3JD1A 2EJVA 4OHBA 4ESVA 4C21A 1EG7A 3MIIA 3UATA 1Q0QA 3OJ0A 4R69A 2TMYA 2OILA 2V6BA 4YFYA 3CH6A 1B26A 2VJCA 3FBGA 3VPHA 2CXUA 5B5SA 2CCGA 1EVYA 4G5SA 4O2AA 1KFEB 1UT6A 2SHKA 1KKLA 1KJ8A 3DE0X 2GTPA 1VIVA 3K70B 3FPKA 2P40A 2VSFA 4Y6QA 5CBPA 1TNDA 2VS1A 1LXCA 3ANNA 3B2NA 1E1NA 4RNCA 4KE8A 1FDUA 3PDCA 3H8WA 2VP6A 3SIWA 1C9MA 1NZDA 1SHLA 1E5TA 3KTOA 4P9NA 4CL2A 4CEIA 3L1KA 3WYBA 1RW4A 4B3BA 3DZFA 3F9RA 2YHIA 1A2QA 1HFWA 1TMGE 3A32A 1JT9A 3IVCA 4JC4A 4OK3A 4S1VA 3U26A 2NXEA 3R0XA 3U80A 4DA0A 1NUSA 2WIFA 1EM8B 3GU3A 3SSMA 2CFRA 4P93A 1KU0A 2GX6A 4L74A 1RAFA 5J40A 2ZBUA 4HXFB 4JASB 1U6KA 2XIQA 4EJFA 2XMGA 4A36A 1D4OA 1GDHA 3DDCA 2TMGA 3A1FA 1VPWA 1XZAA 2IEDA 4YRCA 2ZSDA 1VGVA 1UUFA 1IATA 4JH0A 4GKKB 3GLFB 4DS3A 5K45A 1EDDA 2PK3A 3RFXA 3IBFA 2YVAA 1NUAA 4KR0A 4CQMA 1TC1A 4IHJA 2Q2QA 4XFDA 5LN1A 2P9TA 3QGMA 4K9DA 4PNHA 2WYWA 5TPWA 1DCMA 1PR5A 2EP8A 2IEBA 1KMHA 4L22A 1UZUA 3F9CA 3SVTA 1O87A 3KHSA 4M7RA 3JYLA 3LLMA 1Z0AA 3PJEA 4J1SA 4N03A 3P1JA 4BBJA 4P4SB 4QG3A 3H7AA 4AMGA 3A37A 5TF4A 1A9OA 3KT6A 2OFPA 4NBSA 1HZZA 3KS9A 1LZKA 1HDYA 1Z4OA 3KEMA 4HNGA 3F5QA 3KSZO 3GJ6A 3ZKWB 4OMCA 1O96A 1JPUA 2ZIGA 2BFBA 2PCJA 5LLTA 5LVAA 1AC5A 3OZEA 5C8YB 4AURA 4F96A 1CG6A 1TAQA 4XARA 2HYDA 5SZKB 2O19A 2VTDA 2YW9A 1ZU5A 3QPBA 2PRSA 2QRJA 4JLMA 1PZNA 3TFOA 3UB4A 2Q4DA 4D8UA 4XRGA 3RS0A 1PT9A 4O6VA 2HA4A 3NAZA 4GRIA 521PA 5E9JA 1TU3A 4KWEA 4YRAA 1MX5A 2Q8QA 4XTCS 5ALMA 4ZJUA 4P53A 3CLSD 1QC5B 4IMJB 3WNQA 3T4PA 4NXNB 4MULA 1E1DA 2RK4A 3IDQA 5DTRA 3WB1A 1H93A 3DJYA 3IAEA 3LXRA 2Q9UA 3HCWA 4A10A 4OL0A 4LFAB 1ND5A 3E61A 4KR7A 2KJQA 1J97A 3DVAB 4N18A 4ENTA 3TEFA 1PLJA 3U3RA 4JYCA 4MRRA 2VJPA 4U2EA 1JR3E 3X1MA 1ABFA 4O4LB 4ENWA 1KPHA 5FUBA 4BC1A 4LHEA 1E3WA 1CUWA 2XLCA 1MAHA 3KQTA 1JAYA 3L79A 3NIDB 4L8VA 1AURA 2Z4SA 4RHTA 5EMMA 1LI7A 2Z9DA 3CKYA 4BWVA 3W06A 3DAGA 1WB9A 2YWGA 2OXRA 1C0LA 4WZAA 3S2IA 2VBCA 2JFQA 1TF7A 2WZDA 4ZOQI 1FB5A 5ALIA 3G2PA 1RRMA 3N0RA 4FBMA 4C87A 3ESCA 4D98A 5JBQA 1MQAA 3GJQA 4GUAA 4JBYA 3GLGA 4B40A 4KVFA 1ZNQO 2N9UA 2QSUA 1NZJA 2TRSB 3II6X 3IP9A 3GLSA 3IV6A 3KKZA 4NCHA 3VA7A 5KO2A 2G17A 2X86A 4MVJM 2J4FA 1X2EA 3PITA 1WNTA 5DK6A 5NULA 3VR4D 1V25A 5DKFA 3WQBA 2Z9BA 3DTYA 4ZQBA 4CUKA 5IKMA 1W5AA 4FMCB 3NYWA 4OIFA 2JAHA 4J3JA 1YQUA 3QVUA 2BGUA 3K0CA 1RHJA 3AL0C 3D8SA 3FSGA 3AV0B 3IIKA 4K9LA 2GKOA 4RLHA 2PMBA 4TWZA 3GNLA 4ZAGA 2OGTA 5KNCA 1A9RA 4QJIA 4QEZA 3TAXA 3A6LA 3N6VA 1E0DA 1KZ9A 1GILA 2P77A 4OFZA 4HS9A 4Q66C 5I7UA 4Q15A 2IQ5A 3QITA 2FUG6 4B4KA 1L2TA 4YCCA 5JRDS 3MCWA 4WCFB 3PXUA 2DFLA 4ITRC 3JQ9C 4ZRDA 2O54A 1VL1A 3GEHA 4PVDA 1VYTA 3NYQA 1E3MA 3V6LA 4OXIA 2PZMA 3C74A 3USES 5FLKA 1OH7A 2IZ5A 3BULA 3NALA 1ESDA 2HWWA 4EX7A 2DLCX 1XZHA 5CEJA 5HNKA 4JUCA 1P8JA 2Y4OA 3RU2A 2ZBQA 4QTYA 5FI1B 1E63A 1S2GA 4GP9A 1YOBA 1ZICA 4HVCA 5J2UB 4N4AA 5F35A 1FTYA 3ILSA 4N7RA 3UGJA 3LPDA 1CJVC 2XZTA 2BFPA 2ETVA 3I2GA 5EIBD 4BNYA 1GYQA 3NS7A 3D3NA 16PKA 5JAHA 5FTKA 3WP1B 3BMNA 1PL7A 3V2GA 1CWUA 4NAUA 1PJBA 1Q1QA 4LS3A 1PBTA 1YS4A 2OC9A 4UHFA 5KDLA 1T43A 4ETIA 5KSYA 5FWAA 4YMIA 3TZCA 1EAYA 3AWIA 3HE3A 4M1QA 5KPJA 2ZSUA 4UTRA 2NSHA 2I6TA 3L4EA 3PEWA 1RI1A 2CFCA 1QF9A 3P8ZA 4JJZA 3KDPA 1EIWA 1YCHA 2NU8B 1TVCA 4BMOB 1PG2A 5DLQC 2E55A 2IOFA 1L7AA 4X8HA 4IXMA 4LX0A 4NFHA 4FZJA 1OXKB 2C9CA 3EH2A 1YI8A 5L3SB 2ONZA 3B8HA 4FEAA 3I6BA 3N0WA 1G21B 3OWHA 4B3GA 2M6LA 4WD3A 1DX6A 2BRUA 1RRGA 2BE9A 1ZONA 2HA2A 3PE4A 4HJRA 3OX3A 4X0EA 4AI6A 2JFVA 2HPHA 3G8BA 1ACLA 1KXJA 2IPAB 5AW7A 3FZYA 4OATA 3A9WA 3W9UA 4BKUA 1EFDN 2PAAA 3GN1A 5DLYA 5FR1A 2ZB4A 4UOZA 1SVWA 4G4GA 3A4MA 1JHPA 1G4UR 3KPUA 3KOZA 4IDDA 2OZVA 1U8CB 3L0BA 1VHTA 4YV7A 1V4NA 3WISA 1XVTA 1JWBB 1Z22A 1EDBA 4IVPA 4DUZB 2Y1WA 4JJKA 2DHDA 1ZXXA 1GU0A 3O8OB 2BM0A 2LPMA 4WKOA 5BQPA 3QU5A 3FUVA 3PGMA 2N0SA 3O74A 2PX8A 3ROFA 1UFKA 1JSCA 1ZK1A 3OETA 4LPSA 2D1QA 4ZXPA 3DLIA 5TQJA 1SELA 4AW9A 2AEEA 2CY0A 2F7SA 3L8YA 2HQ1A 3FJ1A 3HJUA 1AY0A 3QU7A 4FGSA 5TT0A 2HKIA 5HMLA 4DUGD 4HQ6A 1DTEA 1OWPA 3ACCA 2A3NA 5DHTA 1DO0A 2PMCA 1TYAE 1DKPA 2XSZA 1JTEA 1U7XA 3HSSA 3TCNA 2SCUA 5K3OA 2O8EB 3RUEA 1T0JB 3BMCB 3LTEA 3OZXA 1HE1C 1EEHA 4M53A 4U7GA 4QQKA 3LWBA 4JJGA 3NTOA 5AM4A 1F4PA 3ZVLA 3JQGA 5JECA 5J58A 3EGDB 3JD3A 3KUDA 4RX1A 3V55A 1Z0KA 3BHJA 1ZLYA 2GD0A 3M3PA 3LP8A 2GERA 4XVQA 4JVLA 1TLFA 1S3SA 2F3SA 3A3KA 1OX4A 3ER6A 4D6YA 4WJZA 4YFVA 1KEKA 2GPBA 3COSA 3K8QA 4Y1RB 2NTVA 5A0TA 1T5LA 3QXXA 3UFXA 2EQBA 3Q15C 3AR4A 3G1UA 4U2BA 1GPYA 3STYA 1CD5A 3B82A 1G8SA 3C87A 3N0TA 1VE9A 4OLHA 4ZK2A 4DG8A 2V9PA 2A1TR 3RAJA 3I01M 2X1LA 3WXMA 4ZHQA 3RRXA 4D92A 2PLAA 3G1TA 1CUZA 5FA6A 1EM6A 2H1RA 4FE7A 1E2KA 3F2IA 4W7SA 4K8RB 1HDCA 3DEAA 4PN7A 1WB5A 3GWGA 4L4YA 3VPBA 1BMTA 1NY6A 1UXJA 3FN4A 4D4HA 4EECA 4D1YA 3R1IA 2GVZC 2HTFA 5EYPB 1JHDA 2MT9A 4LWQA 3BMOA 3T5GA 1UCFA 1BJRE 1NGSA 1XU4A 4C0AC 1T2FA 3ITKA 1GGVA 4FD2A 1NPDA 1DRWA 4NE9A 1GKLA 2QVBA 3GYBA 3OQMA 2FN3A 4Z4HA 3A3PA 4BWYA 5LD2B 3ANTA 5LWHA 3N2KA 3GGDA 3TTXA 1FJXA 1L7QA 1X3SA 1M1NB 2F64A 2NTYC 2D0PB 3G3EA 1L4GA 3CLTD 5CM9C 5F1OA 3T7IA 2JI9A 3KYCA 3HKCB 5JJBA 3Q8KA 2AKYA 1ULUA 5FORA 2IDZA 1EDOA 1H66A 4QD3A 2O57A 3WK5A 2F8SA 1IFXA 1T2CA 2PZBA 1GL7A 1Q84A 2H63A 1EP3B 1XLTC 3ENKA 3D1JA 4MWSA 1CP3A 4DEXA 1BQ3A 2PL5A 2NW6A 1P39A 621PA 3DBLA 3TF5A 5CB4A 2GASA 4JYAB 5EIWA 3FB1A 2VDVE 3B51X 2DXIA 4GO1A 2B35A 1TEXA 2YNMA 4YMGA 1RAHA 2MSKA 4NBVA 3WOHA 4KITB 3ICEA 3ADBA 4AROA 2OUKA 3RSQA 3AF3A 1K7CA 3D7RA 4UPVA 1YZYA 4RZSA 3RANA 4X65B 2I2XB 1URPA 4IBOA 2FSPA 2OZKA 3RLIA 2HSZA 2OAEA 3DCJA 3F98A 4L8YA 4LSMA 5KQMA 2EVWX 4TLCA 2V6GA 1IXKA 5IH7A 4QT4A 4K6CA 1QGED 2JHAA 4EMBA 3OU6A 4HUQB 2H11A 1F8FA 1YBFA 4Z9BA 3CBGA 2YHSA 4GXNA 1QGUB 4YP6A 4IFEA 1XAHA 3K3PA 5LP6A 1FP7A 1RP1A 3GGSA 4OMFG 4P5EA 3LG2A 2B36A 2JCVA 4WUTA 4ALLA 3BGWA 3HDTA 3HXKA 4GT1A 1F3OA 4TRJA 1JBKA 4W1QA 1SUBA 1ZMOA 2HIMA 5THXA 4Q4CA 3NGXA 3D43A 4EFKA 1JKXA 1QIEA 2P4HX 3PHCA 3R24A 3KOWA 3RAFC 3FA2A 3JQEA 2XHEA 4TN5A 1J1ZA 1UR5A 5K20A 5IC4A 1Y4AE 2R7KA 1E2UA 5GJVC 2ERCA 3VH2A 1MB4A 3QHPA 3UW1A 4XUEA 4A5OA 2INGX 2XEXA 5KPDA 1NTOA 2XA9A 1Q2XA 3OT4A 4YRKA 1OYOA 5HIKA 2XCSB 1OLSA 1VLQA 2FP3A 3I9LA 1EUYA 5AKKA 5IAJA 4P4LA 3K05A 3K9HA 3BRWA 1CUAA 3ABZA 3VTAA 4BZWA 3FLAA 4CHTA 4ZZIA 1B42A 3AB8A 3DTVB 2LTAA 1CPYA 2I4RA 3E9CA 5E6RB 4JQZA 3AF4A 2J3MA 3H13A 4TSFD 2PLFA 2OG2A 1PW5A 1GUYA 1QYWA 1RYBA 3FFXA 4E94A 1F1BA 5GJBA 2MHCA 3HHEA 2VTBB 2KLHA 4EGJA 4Y2RA 3IB3A 3UJ6A 1XTKA 2ID7A 1V45E 2XB6A 1QP4A 2B37A 5AR1A 2IYNA 2VDLB 4BQIA 4QT0A 3HMKA 2H5JA 5I7RA 4Q9DA 2C8LA 3PX3A 3IPXA 1OREA 2JLBA 2JIPA 2OO5C 3NR2A 1E58A 4QBTA 4FFDA 4JXKA 1WP9A 3AB3A 4FFSA 2ODTX 1ZXLA 3OMXA 3OQHA 4W63A 2HA0A 3PIIA 4NBRA 2MIIA 3HM2A 2IEYA 4G1VA 4D7AA 1EKXA 5JZVA 2OFFA 4RKRA 3RKRA 4RESA 5IM4F 5AM2A 2KI5A 3OBIA 3LBHA 3OAAD 3EGWA 4ZVMA 1HMPA 4BLVA 4P8RA 1E2MA 1FP4B 1H8HA 1L7PA 1K63A 1Y4UA 3ELDA 3E5HA 1GNVA 3ABSB 3BCUA 4KMRA 2J8ZA 4FE4A 2F3UA 2VR1A 4Y2SA 5DW0A 2C8VA 3FKSA 5KSZA 2WA2A 3ZXUB 3TCKA 3C1OA 4DDUA 4RF4A 1VKHA 3QX9A 5FCDA 5JVDB 2P4EA 4XSGA 1RWQA 1MDFA 2J3QA 2X7XA 1WKBA 1OIWA 4P83A 4Q39A 4AG6A 5BRAA 4O4LF 4XRRA 3LA6A 4NE2A 1J2EA 3KCNA 4C7KA 3GG9A 4OREX 4AJ9A 4NCIA 2GO1A 3QYFA 2DFKB 1Z7GA 1Y6ZA 1I3LA 3R5FA 1P5FA 1QQ7A 4CQLA 3VFDA 1O03A 4G63A 3RVPA 3KQLA 1Y6GA 5KSWB 2Q9BA 1R27A 1Z26A 3VYSB 3K9WA 3L0YA 1F5NA 1E5XA 5BWCA 5IDWA 3KAJA 4EB3A 1EXVA 2ET6A 1JI0A 2RC6A 3HB5X 3KXLA 3NM4A 3TPFA 3CVWA 1S4MA 1JDUA 1QIGA 1UZMA 5JO0A 4K6MA 4IRUB 1R9GA 2ZBRA 3IBCA 1R4MA 3LC0A 5H02A 3N7AA 3GCXA 5A3SA 4BMXA 4PSCA 5IG2A 2RJOA 5IZCA 2XWQA 1E9AA 4L4SA 3OM0A 3MRVA 5A0FA 2EJUA 3HXOA 1XCBA 4JHXA 3ZCQA 1W88A 3H2GA 4FLFA 4XGQA 2GN8A 3R7WA 4P0TA 2XA1A 4AG3A 4YRRA 1NVBA 2P6MA 3CNBA 3OKPA 5B1SA 3NKVA 4JQOA 3QFCA 3EXIB 2W11A 4TRNA 1NFFA 3FBWA 2G70A 4R98A 4XDZA 1KKUA 1W87A 3KXPA 4QQ8A 1R00A 4R1LA 1NP7A 1O4WA 2I03A 4JP8A 1XTUA 2BL4A 1JSRA 3G2NA 3LOPA 1OJ7A 3MT8A 2RAPA 5FKJA 5CGZA 2OO5A 4YCDA 4LYHA 2NT3A 4DC0A 4HX2A 3S2YA 2EKQA 1QQAA 4F7WA 1NOJA 2XZPA 1T9GS 3PIRA 1ZL2A 4WPGA 1R18A 1TAUA 1RNLA 4O1HA 3P0JA 4U63A 3RH0A 1FLDA 3EHEA 5AK5A 1W5EA 4KUHA 3OFKA 1CUXA 4N6NA 2VH2A 2EDAA 1HT1E 1KFKB 4UEJA 5J2UF 5DX8A 2I76A 2CK3A 2Z04A 5AJWA 3DXYA 1N3BA 2R25B 3D2BA 3HCOA 4I5FA 3E53A 4OA8A 4LZAA 5CNKA 3QKRA 4BKRA 4DDMA 2PO7A 2WHPB 2R8OA 3O92A 3RFUA 3V4OA 4E7PA 5JPCA 3G5LA 4CFZA 2JA2A 4QDXA 3ZXXA 1R5JA 3PGVA 5IYZA 2CKDA 2A9KA 2J5BA 4S0ZA 3B6EA 4RJLA 5TMEA 4EG1A 3LT4A 1FMTA 3D6MA 5EHZA 1X7YB 2BF4A 3RUHA 3T7RA 1QHHB 1GTZA 1RJFA 1K8QA 3GCGA 3O8QB 1RE1A 1VIAA 1N8TA 4TMWA 3K0SA 4K46A 4EHBA 5AVXA 2JD0A 2PRZA 4IV8A 2OHVA 1GLVA 1VSTA 2ZAGA 2YYSA 3OZFA 4HRVA 4DE5A 2WTXA 1N1DA 3C7DB 3K9GA 1VHLA 1O6CA 2DFTA 4TROA 1WKCA 3T41A 4C4YA 3QWBA 1GFZA 1I2AA 1SWWA 1ZINA 2HK7A 3HN6A 4IEIA 3ZD7A 4HTFB 4TS3A 3WZ2A 3GFBA 3FPLA 3KSRA 3FGOA 2W6NA 1PT8A 2PTHA 1C9DB 1B8NA 1ZMBA 2QMUA 3B1JA 4KV7A 1YONA 4L02A 4NC9A 4W7HA 4FZ5A 3HY4A 4OA5A 4B48A 2JA1A 3MYYA 3VBCA 5AW9A 2BFWA 4TN1A 3EG9A 1Q0SA 3ELUA 3PNLA 3LKVA 3EPKA 2CVZA 3QSYA 5DNVA 1RDFA 2N3ZA 2OSBA 1LA2A 1LV7A 4UVIA 5DGHA 3IRVA 5GV8A 3TBKA 1N6LA 2RKOA 4JLNA 5A04A 5C53B 1OU0A 1H2YA 4YP0A 5CA0A 1BN7A 1TQ6A 4AY2A 1FP1D 2KYRA 4J2HA 1SM4A 3EXG1 3FPFA 3NHPA 4Y0VA 3LOQA 3H99A 5DHRA 1YS6A 5K8UA 2B8NA 2XVXA 4F91B 2C9ZA 2PKEA 4BFCA 4NFSA 3TGPA 5LIRA 1N0UA 4CR7A 3W4JA 2X5KO 1AK2A 1NZFA 1Q50A 1U8TA 2X8JA 2C96A 3B70A 3KPVA 1W4LA 3M2PA 4DY4A 5B6PA 3CR3C 3AOEA 1XK6A 5DK4A 5AFSA 4G81A 4J3NA 5K6TA 1SCUA 2CD7A 1QIIA 3GNSA 1QIJA 1XRMA 2R7NA 2Q4TA 3FETA 3HS3A 3MG9A 4IUYA 1NRWA 4ZCPA 4ZI3A 1AQ6A 5EA2A 3SYRA 5J4LA 2CV1A 3RTCA 3CC8A 2IU4A 3TQRA 3UGKA 3DMTA 3NHZA 4BO6A 3GHHA 1DVRA 4JLJA 4MWOA 3JPYA 3ZNOA 4KXYA 3GDWA 4R8SA 3COJA 3CZ5A 1RACA 2GEBA 2HNBA 1E2GA 4MUXA 5HIIA 2FSGA 3IDSA 2FKNA 3U4IA 4RF3A 4P54A 2OBBA 3GZTB 3RAPR 4A5SA 3NTVA 5LZ7A 4MW0A 1XA0A 1PHPA 1OT3A 1IWPB 2R1TB 2VPQA 4DCGA 3T5AA 3DWIA 2ZWMA 5P8WA 2FWPA 2DHQA 2OFXA 2I34A 5KYYA 1P73A 1AMNA 2J0UA 4E5VA 2KPOA 3C4JA 3L4JA 2G09A 4Q93A 3CX3A 1Z0JA 3QUCA 2NZWA 4AAYA 2GN1A 2ZB7A 2PZEA 4GVXA 5CK4A 5FBWB 3T61A 3K6SA 2CL0X 3WTCA 1M6YA 1JT2A 2QD2A 4ENPA 2HRRA 5FPYA 3ZVRA 5TT1A 1OFGA 1Q7BA 1CSEE 4IVQA 1NUHA 3REQA 4IGIA 1TRHA 2CUTA 1JIUA 2CXXA 3LVRE 3P52A 4GXQA 1QHIA 2P2ZA 3CSUA 3CX8A 4K86A 4DJTA 1OX5A 4BV3A 3OFND 1U2QA 3P2OA 5HUJA 1AF7A 3M6WA 4LRUA 5DX1A 3V2UA 1N6HA 3M6AA 2CLLB 3OCYA 3QQPA 3A9VA 4IG4A 1VBKA 2BM9A 4XDHA 4E5KA 2GN6A 3OQIA 1K6EA 2BCEA 1HX7A 3TPCA 3FYCA 4F21A 4KGVA 2QX7A 2YOHA 3LD9A 1TECE 2OMEA 4KQEA 4JJ7A 4M9RA 4OKNA 1RCUA 4CJXA 5KYNA 2COUA 3DZGA 2ZT6A 3VYTB 3KJGA 4OOEA 4GKVA 3PT9A 2WK1A 4EL5A 1ML4A 4PAGA 4TKVA 3M6XA 1Y8QB 1EGHA 3F4BA 3PHGA 1KK3A 3R40A 4HPXB 4MHTA 4R1PA 3K8ZA 2JATA 1YVDA 1AHNA 1OWMA 3IAFA 4WECA 2O5CA 1KSFX 3SEAA 4NZPA 1DAOA 3BTUA 3G2KA 2IKSA 4HH4A 2ZSIA 2F3QA 1G6KA 3OA0A 1LB1B 3D1LA 4OY3A 3NNDA 4RM2A 2GQ0A 5DN6A 4UVHA 4COKA 2CNLA 4EG8A 2SICE 2Z56A 4DV5B 3ZZNA 3ZE7A 5EJ9A 1ZN8A 2IWHA 2B4QA 4LQLA 1YIOA 4G8CA 1IC6A 4F3RA 3DLHA 1XQ1A 2XVMA 3TR6A 3W6NA 4AVYA 1K7FB 2FWAA 3OQNA 2FLWA 5G41A 4UFPA 1IBRA 4LZOA 4XEHA 4ARVA 2P2CA 3R3JA 5KYXB 5CJPA 2QUKA 4CV0A 4TL9A 2Y76A 4MJLA 1UWCA 4LX8A 3P71T 3NBMA 5ERXA 1OASA 1BA2A 4N9QA 3SZOA 3OOJA 3IYLW 1YGPA 1GU1A 3PXAA 4IH1A 1K89A 2PVSA 3DOEA 5G0UA 2BZ0A 5JPDA 2GBFA 4U7JA 2W2KB 1P1CA 3DDUA 3DOUA 2VJMA 4ZDWA 3GMIA 3M1AA 4V0NA 5AM5A 4DYVA 3OE7D 5C3UA 3KM0A 4G67A 1JQBA 4QWMA 4R1TA 3KHUA 1X7XA 2VNAA 5K3FB 4BNHA 4URFA 3IP8A 3RPEA 1PFVA 4OBEA 2ZW9A 4QUEA 4NJMA 2DH5A 3AI1A 4V0SA 5JWRA 5K03A 1B4DA 2H5EA 3SOZA 3ZY3A 3QELB 1L5KA 4AO7A 4V1CB 1X13A 1OVGA 3VBEA 1NN1A 1Z6XA 3BCHA 4NDNE 4JJ6A 4KL8S 1VCIA 1TVMA 2JEYA 2EWVA 1YDFA 3ONVA 3ETJA 5KVQA 1REQA 4KWTA 5F78A 3LQFA 2NPFA 2K7FA 1WY7A 2W37A 3HA3A 1CFJA 3PQ6A 1OZAA 3RADC 2P9QA 4OTZA 4UMEA 3KKOA 1GVNB 3MJTA 3FX2A 5B4TA 2X6RA 3TOZA 2YWCA 5F7JA 5FBZA 3I6IA 2EU8A 3LI2A 4LHXA 4P7FA 2BHTA 2HQBA 4XOIA 1OC2A 3I0MA 5BSUA 5D51S 1Z6PA 1GA1A 2VWGA 2GHQA 2AXQA 4IS3A 3E05A 5GY7A 3S1AB 3ZHQA 5L7TA 2PBZA 4MIKA 3A4YA 1N2OA 4A6PA 3UYKA 1F8UA 1BCRA 2PR2A 2VA8A 3L8HA 3MQFA 1UAAA 1MJHA 4FHFA 1NKSA 3TOSA 2VZLA 1VFNA 5EIBC 1Y5IA 4DR2B 2M6RA 2FLKA 1A8HA 4N0DA 4RH1A 5IN4A 1I30A 2AG0A 2UYQA 1JHAA 1C50A 2P27A 2PXXA 1TXGA 3NM5A 4KMOA 4QBIA 3KQKA 2DQKA 1PR0A 1VKNA 4ALIA 1YS1X 1P1HA 4D41A 3U37A 3V97A 3GXBA 2H92A 3ZLBA 3MF4A 3E2MA 5CNIA 3KKPA 1OSNA 5GONF 3UHAA 2ACVA 2ZBPA 4N3GA 3QYPA 5EE5B 3AL3A 3Q72A 3E5MA 5THQA 3K1JA 1WEKA 3B2EA 2QMHA 2VHCA 4GI7A 5CIYA 1TM4E 3B1VA 1E5VA 4UBKA 5EZ6B 2A88A 3GT3A 3OLWA 4ZO7A 1UM9A 3MRTA 2F9MA 3G13A 1R74A 3FOWA 1JJBA 2XV1A 4R81A 4GI3A 1FUIA 5IUNC 1N2EA 1FQWA 3RJ5A 4R8KA 2W2MA 4JS0A 1GZHB 1TADA 1XMSA 1RHQA 1ZMRA 4FCTA 4P22A 4IF6A 3TTWA 3HDGA 2CNWD 3ZZ0A 3W0LB 3ITNA 3NOOA 4P38A 4A8PA 4E32A 1E4YA 1H4VB 4MAMA 1TUBB 1EWTA 3EJWA 3MXOA 2XUPA 3PDIA 1HE4A 1XDSA 1ZGZA 4DLXA 5C81A 4WSOA 4Z3KA 3OEEA 1ZM2A 5CG1A 3EC1A 3RDPA 1OHHD 4N0MA 1Z8DA 1W8IA 2GJ8A 2LBPA 2H7XA 1B15A 3DGEC 3THWA 1JP7A 4XIJA 5AKYA 2NN3C 2P5UA 4ZCSA 3VHQA 4NU6A 5KOJB 1ZIPA 1I4LD 4I8DA 1YQXA 3AWDA 4I50F 3ZDFA 1WP4A 3RS9A 3IUPA 4R2IA 1G21E 4G86A 2ERYA 5AK0A 3UK1A 1T9GR 3BWXA 5JMPA 3B6JA 1WJGA 2A9PA 3VSAA 3ETGA 1V3VA 2X41A 2WPDA 3VO9A 2ANBA 5CFNA 1F0NA 1V5WA 4PGAA 4F93B 2DPXA 2VAWA 3L05A 1RAEA 3EOAI 5DCLA 4DQUA 4TTQA 1SCAA 4QGGA 1ZIYA 2PUVA 4BUZA 3D0KA 1V8BA 3GJSA 3PVCA 1XELA 4PCUA 4E33A 1XEWY 3AJDA 3HTXA 1NURA 3AJ8A 3HBMA 5AKLA 2ZTUA 3GGJA 1VIDA 3OCCA 3RV3A 4YMTA 2OESA 4RLQA 3TTVA 1FL9A 1T34A 1Z35A 3JARA 4BS9A 1KP2A 4QEDA 1JEYA 2W2LA 3N74A 4QC2A 2FZWA 1E99A 5DIFA 3LUAA 1K6MA 1N6IA 1SIBE 4BNIA 2PWYA 1DEKA 1ODSA 3FUTA 4D9CA 3PRYA 1X87A 5A5EA 4RMIA 1JLLB 5EP3A 1E7MA 1E8MA 4NRDA 3V2IA 1DQSA 1GAJA 1GTL1 1ST3A 4NHEA 2NUAA 3CN7A 4ICIA 1ZCZA 2OBLA 5D2CA 3BZWA 3W3AD 4W5NA 1QGZA 3WGOA 4R0MA 1X9IA 1KZGB 1IHYA 2QTBA 4MV7A 4V03A 1ABBA 4N9WA 5KYUB 2EYUA 1ISFA 3AHDA 1DRVA 1OV6A 3E2PA 4XZ3A 2MCFA 3VHLB 4R9RA 5L40A 2AMVA 4MVJF 5F7XA 5ED4A 4M98A 5JCJA 1XCOA 2TS1A 1AH2A 2JDID 3AEKA 3KO8A 3ZCTA 4PRLA 5T4EA 3WL6A 4CT5A 1MCZA 2HPAA 5EIXA 1BYIA 1FNMA 2VSQA 3EDOA 4Q02A 5AW3A 3MTQA 1U3TA 3FHJA 4PWZA 4INJA 4X45A 5KKNB 2Z8YM 5KHAA 1P4SA 1MMFB 4E6EA 2CVQA 3WIUA 1UC8A 4RTJA 1NV8A 4DDTA 1NBOA 1RM4A 1YKSA 1IJFA 4B80A 3FG9A 1T91A 3FTPA 3EPRA 3NHLA 4J94A 3UJAA 1N7GA 3K73O 2PGLA 4X62B 3FDFA 1UZNA 3IIIA 1NW5A 2Z30A 3ZWBA 4B7CA 5CLGA 1GQ2A 3DVLA 3VZBA 4OHVA 4C0SA 1IJBA 2WU8A 1Y8RB 2ASEA 2PUTA 3M5DA 8AT1A 3IP1A 5LR6A 4MPTA 4MPJA 1MGPA 1U9IA 1XTRA 1UBGA 4F3CA 2IYYA 3MGGA 3WLIA 4UE2A 3KEFA 4QLOA 3ENWA 4RLSA 3EF3A 1G1MA 3MLBA 4JU8A 1T8RA 3S27A 1U7UA 1SUSA 2XYPA 4BP9A 1BCSA 1KEZA 2PBRA 5IJ0A 1RJDA 5H3LA 4LOKA 1RWWA 3ZHZA 3NP7A 1N2CA 1B6TA 2QP3A 4YP7A 3RBZA 1KVSA 3WKDA 1FMJA 3WMWA 2JIZA 1Q0LA 5B37A 4G5FA 2FSVA 1MC5A 3NWPA 3F3YA 3BH0A 3NVDA 3DFIA 1NATA 1TTHA 4YDSA 6YASA 3ANXA 4EF5A 2QHXA 2VHYA 4W5HA 5BQFA 2ZVDA 2I2FA 2JZCA 4G97A 4RJJA 3PR2B 2X1VA 4FEEA 3S1LA 1U5CA 3IPRA 3A1CA 4P80A 2JB9A 3MOGA 3AEQB 2YZNA 4G3XA 1IY8A 2IXDA 3MUFA 4HPWA 4L5AA 2Z58A 1FRZA 3WQHA 5CDGA 1Z82A 1IM5A 4DQVA 3KUXA 3T1TA 4CLEA 1CB0A 3LHFA 5EUQB 4TMFA 4CMIB 3HZOA 3GP5A 1JFFA 2OCIA 1WZEA 3M9XA 2WF7A 3P9NA 4FYYA 2XUDA 1K5GA 1O5OA 2BI8A 4K9QA 1FUEA 1GARA 3CF6R 3F7NA 3MJCA 4WADA 3AONB 3HI4A 2G77B 1L4YA 1GCIA 3FPSA 4CBVA 2GUGA 2JLYA 3I34X 4UVGA 5ES3A 1RCTE 4UBLA 3ZEAA 2AI2A 3UJ8A 1FFGA 2DUJA 2G72A 2YBEA 4OG2A 1P5HA 4QGSA 4ZVPA 4QXMA 1G9SA 1GN9A 1XCGB 3JVVA 1TJ4A 1GZ5A 3ETCA 4D4KA 3DEJA 5DCWA 1KOGA 1KEEB 1J07A 5AICA 2QR3A 3H11A 2VSYA 5E7IA 4KI7A 5HKKA 3CTMA 1R8XA 4I4TB 5LQUA 2PD3A 2V97A 2PH5A 2XMBA 3HJRA 4G5GA 2QXTA 3HNRA 2WV9A 4OB6A 4XAQA 3W5UA 5IKEA 3KZXA 3O9MA 3KXKA 4HDRA 4OBWA 3K94A 4KFTA 1QOQB 2XE7A 4CUJA 5ERYA 3I3OA 3JAKA 3P9SA 2HMVA 1QHEA 3I1IA 5DASA 1G2OA 2X7JA 4Y2QA 5EP2A 5C18A 1YHNA 1XZEA 1WRBA 1EE1A 2V7EA 1RABA 1UOPA 3MTAA 3OIUA 3KKEA 4WT7A 3DO8A 2VDUE 3ZCPA 1RQGA 3WA6A 4IO0A 1AK9A 1D7OA 2P9ZA 4MI3A 3W90A 2ZRCA 3VKVA 3JALB 3W2HA 2ILVA 1B73A 4FS8A 1DC8A 3NXKA 4N7MA 4B45A 3QPAA 4YY3B 5H59A 4U7TB 1RZ3A 1HV8A 4KSCA 5TMBA 4B7UA 4DCJA 1FFYA 5AQ1A 5TY0A 1YBVA 1XRLA 2AE2A 2NZXA 3ITEA 5KOHB 4XX0B 1JKIA 2Q7DA 1P2FA 2IA5A 2YYZA 2D7DA 1GTVA 3KK0A 2B30A 3BXZA 5CTJA 3OF3A 1USGA 3PF9A 2QN9A 4YRNA 2J5RA 5EQJB 4A8TA 4ZN6A 4TXJA 3RB8A 3LQRA 2CXSA 3WI7A 2XRFA 3FZQA 3GFOA 2XUKA 1KI9A 3EEQA 3L7JA 3Q2KA 1EK5A 4GFDA 1XU7A 4OXRA 2X14A 4BB0A 2IGTA 4KPYA 4GYWA 4MUIA 4OAPA 4X1YB 3JQQA 4GRAA 1JR4A 2NUTB 4RS3A 1VG9B 1XQ9A 3BXOA 4E09A 4C4TA 5HZGA 1CY2A 3R4VA 1B0ZA 4HAOA 5ITVA 3OKAA 4KQHA 4MQFA 4XYGA 2WOOA 3R4CA 1VJDA 3RUDA 1E59A 4Q9JA 1L8OA 2R86A 3ZGLA 3LQQA 1MAUA 1IN7A 1VPVA 3V1UA 3VH4A 3CE6A 4X91A 1UIMA 2G7MC 2H17A 4HGPA 2BGTA 4H9GA 4HQOA 3ND5A 5P21A 2V9ZA 1F0YA 4O4IF 5BN1A 4HV4A 5E2AA 5BW6B 5E3IA 4CLOB 1EFKA 4B3HA 4FCVA 1TFRA 2DQSA 1QGOA 4QGAA 3V7WA 2X9VA 2YZMA 4BWFB 4DW8A 1HUQA 1KAGA 2PY6A 3H83A 4NZYA 1HT0A 2QZSA 3C97A 4RANA 5EE3A 1JTFA 1L7XA 4F85A 5IAOA 4GBED 2HWYA 2WSSA 1F4VA 3BYZA 4JR0A 4BAGA 3PRJA 4L5JA 2E0IA 1G3RA 1S3GA 3IULA 2GT1A 4BVKA 1H4QA 2WUEA 5ICFA 4FFVA 3L0CA 1TPZA 2YINC 1F06A 1KWKA 3PLRA 2Q4EA 3RK0A 2QRMA 5FO0A 2VK4A 3IOYA 3I2YX 3ND8A 2D8AA 4KE7A 5E2BA 4C04A 2IUEA 1NG9A 1IQUA 5EXXA 1OYWA 1A8IA 4YJ3B 2VHWA 4LZJA 2AJBA 4GL4A 5KTSA 3OUUA 4J7CA 1GITA 2H2DA 4BNFA 2WOJA 3STXA 2J6CA 2PZ8A 5C5CA 4GPZA 5E3JA 1AGPA 2QV0A 3G0DA 4LYEA 4RKWA 3TZQA 2XB4A 1RJ9B 2X58A 3O4JA 4ZRMA 2J3KA 3ZX4A 3N1UA 4YQEA 2C4HA 4BLPA 1DPFA 4D9NA 4XYMA 3IURA 2IXAA 1HO3A 3JVUA 2P3QA 4X63A 3EQ6A 5D6OA 1WS6A 3ZHSA 3E4DA 3C8UA 4LXQA 5DTIA 5BQOA 3X43A 1UK7A 1NDUA 2ZSHA 1F20A 3H1BA 4IOLA 4ND5A 3ZVMA 2WJHA 1YFJA 4FBLA 5KOYA 5JDIA 4M8NE 1L4NA 1N5DA 1FUYB 1MP0A 1FJHA 3EUEA 3I04M 4DXDA 2AMYA 4U7DA 1SRQA 5LQAA 1DB3A 5ITWA 2LCFA 1U2SA 1XA3A 4I5DA 1ZD8A 1ZHHA 3S7ZA 2RGNC 4IKPA 4LJKA 5EJMA 1X19A 1FLNA 1GOTA 5FOUA 1XZMA 3P20A 1GG9A 4D43A 2UUOA 2WZBA 2ZXFA 5DCUA 1DG9A 2QTGA 3G9XA 4RZIA 5K0BA 1NW8A 3ECCA 3ZY6A 3ONEA 4JSTA 4JWTA 1C3XA 3WYDA 1HTBA 1AS3A 1HNNA 3N8HA 5IXJA 4E07A 3SF8B 1M6VA 3GJ3A 4KPUA 3CF2A 3DOIA 2C94A 4IGFA 4EA9A 4RO0A 1W2GA 1I8TA 2PUHA 4LMAA 3SDZA 2AZMA 2QY9A 2XNDD 4C2UA 2RJNA 2VZ8A 3D9QX 4O29A 1W85B 4R9SA 1FXWA 3G5TA 1YL6A 2VDMB 1KYIA 1UBTS 4ZGGA 3RIXA 4DCOA 1SBHA 3AHFA 4FR5A 2BHNA 4FDUA 3SX0A 5LMNB 1ZHOA 2HU2A 3O1IC 4H3VA 4Q12A 3AKEA 5CCXA 3MK31 4M4SA 3LFHA 5ERGB 4QARA 3LZCA 3VV2A 1BXKA 1NF9A 3I6YA 2OK8A 3OICA 4M8LA 4YN3A 3U3ZA 5TNXA 5M34A 1GSIA 2Z09A 4WGFA 1ODKA 3VJMA 3VOSA 1P7WA 3CUKA 1N36B 3MCUA 1XXHA 3EXFA 3FCYA 4R0NA 3UWSA 3B9BA 2B61A 3S5UA 4DZZA 5HZKA 4LOAA 3EXG2 1BWQA 1ZA2A 4X8OA 3PFWO 1XNQB 1II8A 4H6WA 5HBGA 3GEGA 2J7PA 3MHTA 3LHSA 4UBIA 1JFRA 1OR8A 2MYPA 2ZG6A 4L16A 4O02B 3UG6A 4Z0TA 2IEAA 2FQQA 4YV2A 3OLQA 1WZCA 3EXHA 1I2CA 4GMGA 2ORIA 1GSHA 3EZFA 3HVKA 1DJOA 1WWKA 3Q5DA 5EGSA 3MWFA 1PGPA 4DSOA 1XLWA 3ZDEA 5KNDA 3IP5A 4D80A 1J0CA 2OV8A 2ZCUA 2PS9A 3V4RA 1K5DA 1TPYA 1N6OA 4JAVC 2P5YA 3A14A 1SOVA 3EY4A 3WSVA 4ESOA 3A1VA 1G0NA 5GAJA 4UNRA 1P17A 3U0VA 5CFZA 2DZDA 5DRYA 4ZQFA 2EL7A 1Y1PA 3KUCA 4YRMA 4TKLA 2ZAOA 2JJ2A 5I47A 3DE6X 4X5OA 4EEZA 1QJ4A 3UGQA 4HLNA 1TCCA 5FFFA 4XPZA 4DEYA 1T36B 2JVKA 3MWDB 3R0JA 1DBRA 3VC7A 1KFBB 3WLPA 4O2BA 3P9KA 4K03A 1J9GA 1J7KA 4S1WA 5B3LA 4GHWA 3PC6A 4HWTA 3LUHA 2CN1A 2JBAA 1MB2A 4FNMA 3VVBA 3CEAA 4LK3A 4QPDA 1NLUA 4H7FA 2IYSA 4LY9A 1KO8A 1KO4A 2R2AA 4NPCA 2ONYA 5C5DA 5HQTA 4CM8B 2ACKA 4N0PA 4ZOAA 3VH3A 3M6IA 1W48A 3W3AH 3OM9A 3MT9A 1L3BA 1T0PA 1I5OA 5COBA 4A2CA 3JYNA 5BVGA 5CFMA 3BJEA 3HEAA 1IN1A 4BTEA 1SBTA 2Y4NA 2FSSA 5B58C 3PHBE 1RQNA 3UT5A 1GEEA 3L7NA 4H27A 5HZHA 4NU0A 3MNFA 3PGXA 4MLCA 5DF1A 2H4ZA 2DR0A 3ONDA 2ZI5A 4HADA 2V5UA 3GOQA 4YRZA 4EYOA 3SJUA 5CHEA 5LMCA 1Y7LA 2LCIA 2CWDA 2QDKA 2IYVA 4NMHA 2D3TA 4CL8A 5TXGA 4EY4A 4H6VA 1YCFA 1UJ4A 2FQYA 4ZU1X 4KEAA 1HYBA 3GRFA 3JWEA 3CR7A 2FDRA 3MTJA 4LA4A 5AXAA 1W96A 2B9VA 1FFEA 1K8RA 2QB5A 3UANA 4YIHA 1AQJA 3AFIA 1BVHA 3CTPA 3MMZA 5HPYB 2ZI3A 2I3GA 4RD3A 4KQJA 3IQXA 3KCQA 2XRMA 4AXXA 2EX1A 5ALYA 5CDYA 5GQSA 3CURA 4L73A 1ETUA 1JPJA 1O7JA 2RAUA 3K0HA 5IXSA 2XWBF 5EGNA 2ZRNA 1CZNA 3JRXA 3VU9B 5EFZA 4M0LA 2COKA 2YTZA 2WFAA 4ZEVA 4ZAZA 2J46A 3LPNA 4EHNA 1N7HA 3SJCA 1JIXA 3ETNA 5J59A 1CV2A 2FRDA 3A2KA 4MVJD 1YV9A 1HE8B 2ZCVA 2GLTA 2X3UA 2UAGA 5I7WA 1EEXB 1TZJA 3CNHA 3DDNA 2LP4Y 1TKCA 1ZK2A 4YBRA 4D56A 3HDYA 1ONBA 3DMHA 5ECYA 3VJLA 3W5JA 2W2XA 3R20A 4A15A 5D8DA 1OXXK 4YWJA 5K8IA 2CJFA 3EZYA 4D8VA 1G98A 2PX4A 2YZKA 2PX6A 5BSMA 4OXYA 3IPLA 5L4NA 5LA6B 1XZDA 1RBYA 1WB6A 3FGZA 4JGBA 3QEAZ 2JCBA 4EG3A 1O94A 4QYIA 5AUQA 3VPAA 4BRSA 5B55A 1Z0FA 2EZTA 3MB8A 1C0EA 4GOLD 3T5TA 2C8JA 3TZHA 3IP3A 7ABPA 1EFAA 3W5BA 4JJIA 2V58A 4H1HA 3TVTA 5J1SB 1JS1X 3N9IA 4F3NA 5EJ4A 1DC3A 2I2DA 4C2AA 4ZKEA 4AQYB 2YUTA 4DMMA 3HJCA 4GX2A 1XU9A 2PQ0A 3K70C 2MDTA 2KQUA 4AUMA 3BWCA 2OCDA 2P3SA 3CZPA 4IDNA 5FX2A 5J47A 3TNYA 1FFDA 2JFFA 3TO5A 3PENA 5EWMA 4E1VA 5IF3A 2FETA 4LV8B 2Z0MA 4LY3A 2KMLA 2JAWA 3R7FA 3E70C 4OV6B 4GVLA 3TJMA 3SC4A 3VDQA 1C1HA 1CDOA 2Q3FA 3IQFA 2H2AA 4RTMA 2UKDA 2YWHA 4RU1A 3KFXA 2AZ4A 1FFXA 1B3RA 4K87A 1G8YA 1ZG3A 1BO6A 2HJWA 2W5UA 4CCYA 2O1SA 1QTQA 3T3OA 2IP1A 4EVIA 1D1PA 5H82A 2Y6VA 1DAMA 3ZH2A 1KMMA 5B3KA 1N5JA 4WHMA 3CVYA 1FFAA 1NN3A 5FQNA 2HBZA 2YCLA 4UUNA 3F8SA 1P5JA 1TYEB 2HMTA 3G2HA 3FR8A 1JR6A 2D5IA 3NRBA 1TO2E 4YJGA 2GPAA 1P4JA 5FJIA 4DRXB 2IE8A 3VPGA 3WOVA 1GZ7A 1C3OB 1GZVA 1H0KA 3GQBB 3PSAA 4JROA 4ATNA 3FCUB 3G8AA 4A0RA 4JP3A 3W6PA 1JG4A 5D5PA 5K3CA 1XMXA 5DGXA 5KTOA 3UMCA 3PNVA 4BP8A 2EFYA 2Z1DA 4M54A 3U5TA 2IP2A 1JVSA 5DP2A 3AJAA 1KDZA 3RVJA 4Y1GA 4FFOA 3DS8A 1KYXA 3OTQA 4PIVA 3QVOA 3HVRA 4RTLA 3LF1A 2CNBA 3USCS 3GVXA 1GUBA 1N3YA 3RRNA 1RS0A 3SQNA 3NLLA 1HL7A 1CDDA 1PGJA 3WDMA 1U0EA 4MQ6A 3UIEA 3T5DA 4I4LA 3HUFA 4BN4A 3KNZA 3MT7A 1DAFA 4NPAA 3T7EA 4CEJA 4XCXA 3OTWA 1I4EB 2WJYA 5HKLA 4RPHA 1U65A 5AW8A 2ERXA 2HY7A 4RDHA 1W2HA 4GWLA 1BRMA 1TK9A 1Z4IA 2QSYA 1PWXA 4B3XA 2ETXA 3V9PA 1JHVA 2HZBA 5EN4A 4G26A 4HLUC 4B0OA 4QULA 2PLWA 4XUDA 5AW6A 1L7OA 1XEXA 5LQCA 2BFDB 1SQSA 1N57A 1L5MA 3X2FA 2ZB3A 2JFZA 2YXPX 1Y9EA 3MGCA 4JHLA 1KP9A 3NT5A 2CJPA 3D6NB 4PPQA 4PQGA 3WYCA 4J2OA 4OP3A 2BKEA 3HEMA 3L1VA 4CDGA 1C0IA 3S2UA 4E1BA 1YQGA 1CF2O 3C5HA 4TWIA 1D9XA 1UFVA 1Z7EA 2X9GA 4MX8A 4ED9A 3LBIA 2ZJ8A 4HDNB 4EG4A 1P19A 5H3HA 5IJXA 5ELXA 2AC4A 3AV3A 1LSJA 4NKRA 2CHQA 2X5JO 2Q5HA 3FDJA 3MC1A 3NX4A 5CAEB 5L6LB 4GPD1 1UQUA 3M3DA 1QH8B 4D4GA 3W1EA 2A4KA 3NAQA 3J7AC 5B1IA 2ZETA 1V4BA 3KSUA 4EPXA 3T3GA 2GI4A 1VLZA 2ZANA 5DM2A 1JFTA 1UMCB 2V7WA 3H6KA 5K7SA 1JYEA 3KLMX 1DAKA 2C7GA 2PL1A 3LW7A 4U2DA 2ZYIA 5DZSA 3K2EA 1T6ZA 1U7HA 3NDJA 1MHTA 3IAS1 3N53A 4A8JB 1Z5GA 2DT8A 4PE5B 3CUTA 4WBXC 4AKEA 3UPUA 1LZLA 2JIQA 1TQ2A 3F6SA 2NQ2C 4B6QA 4DRZA 2DJIA 3F6PA 1JR2A 2RHBA 4N8DA 4JQCA 2XT9A 1T5TA 4DC9A 2L69A 3DL2A 3E22B 4L5CA 5DLEA 3I1JA 1KSGA 2JC3A 2Q1UA 1NQ5A 3FGPA 3R3XA 4MV0A 4JYZA 1AKQA 1FRNA 1GUDA 1PFUA 1QIHA 3PWZA 1EUDB 3PS9A 3S40A 4BO0A 4F4CA 2Q1TA 4MGZR 4OFXA 3DZIA 2QX8A 4BVJA 2L18A 2I29A 2GD2A 5ECWA 4CI9A 1Y8CA 4YT8A 3PJDA 1JJFA 5FBRB 2C59A 5JMTA 2B98A 3NHJA 4M22A 3VNVA 4A0HA 4UC0A 4XLLA 1GQRA 1IXRC 2PSJA 1ZH0A 4XIIA 3DXZA 4WCFC 5C8YA 4RM3A 4N82A 2WSMA 3WK8A 5D85A 4UE6A 3RSZA 4JLOA 2G1AA 2E5FA 2B8EA 3LY5A 3C3AA 1GV0A 2ZSFA 4ZYTA 4ZYZA 1IY0A 2IV3A 1PEAA 2FZKA 4X7BA 5AI4A 1LEHA 3MUNA 4FSHA 3IKMB 4NZZA 3WLRA 3SYNA 2QR2A 1QC5A 2IQIA 2H4JA 4CL3A 1Z8FA 2G9UA 3OHPA 3OE1A 4FFBA 4EOGA 3OO0A 5DHSA 3RCBA 1R5BA 4KNYA 3H7IA 2VJLA 3RU3A 3NHAA 1I0LA 3WYEA 2B94A 3UWOA 1PJAA 2EBWA 2VC2B 3ME5A 4XWTA 1G55A 4DV1B 4JB3A 4BLOA 2XWJI 2DKNA 3R3SA 4A4DA 2GF0A 4AN1A 2J4DA 2QP4A 4I6JA 4IIGA 1N2GA 2XBLA 2GYVA 1F51E 1ULHA 1Z5OA 4X9XA 3EIUA 3IFSA 1SU4A 1CS0A 3I12A 1JDTA 3U3OA 1DRUA 3KQHA 4QVKA 2GGSA 1ODIA 4LOLA 1GG8A 3L02A 2QN6A 1SBCA 4O2LA 4JFAA 4UHKA 2V6JA 2YL2A 4E1AA 1S01A 1L7MA 3JWGA 1RWOA 1YZLA 3PUZA 3TEMA 3UKOA 3VZDA 2RMKA 3I9NA 3N75A 4N01A 3WNBA 2YY7A 1YZ3A 4QYTA 3QBDA 1U0RA 4CIXA 1FW6A 5GINE 3VC2A 5C46F 4D3XA 1A98A 5REQA 2B4AA 2Q0SA 2P62A 3OPMA 3PWSA 5JJ5A 4O3MA 4CDNA 2O3QA 1ZEMA 3KB6A 1JV2B 3NDIA 4B8WA 3C8HA 1JQ5A 3TECE 2H2IA 4UQOA 1E2BA 4JLAA 1UPFA 3ESXA 4ZQIA 4I9GA 4I7EA 4EITA 4Q7KA 2OL4A 4C5AA 1GAXA 2Y0PA 3RSOA 3URMA 3H1AA 3JVDA 2C2GA 2VH5R 3O82A 5ALOA 1ORTA 1TM3E 1K9VF 1X7WB 1MW8X 5C7LO 1VB5A 1P2UA 1T6XA 3GFPA 3TW0A 5LXTB 5MGBA 3BSWA 4RZ3A 3VRHA 3MS7A 4NMLA 1K8YB 3ENZA 1Y7IA 2GUWA 2WI8A 3WNDA 4EEKA 1T3TA 2UYOA 2W83A 1I7QB 5J4KA 2IT1A 2V0CA 1UBJS 3A70A 3LX8A 2ZDQA 3A9TA 2O6LA 1C7IA 4V1CI 1XTQA 1E20A 2FEOA 4WXMA 3RSFA 2XRZA 3IILA 4ZAWA 1EGAA 5TVKA 2F43A 2E2WA 4L3WA 2GRAA 3VPSA 4EQ6A 4F2PA 4F97A 4GYJA 1NQAO 1NXQA 4QGBA 3B3QA 5BNTA 2ZBDA 5BQXA 2O3RA 8ABPA 3GROA 4IWYA 3KTDA 1D4FA 3GF4A 1NNLA 1OKKD 2ZI9A 1U5AA 5AQEA 4RMNA 3TSOA 1HE2A 1T4DA 2XYGA 4KFUA 4E11A 3O7MA 1UKBA 1Q74A 4G23A 3S8YA 3GLIA 4ENVA 1CIPA 1K5PA 2AFVA 3DLTA 3L0PA 1XL0A 3WMEA 3LQ4A 5BUZA 4BL5A 1KTIA 2DMRA 6REQA 2GXQA 1SQ0A 2W8BA 4HATA 4TZKA 2EF1A 4K28A 3DMGA 3T95A 4ERNA 4HXGA 4XH9B 4B87A 1J5EB 4Y2YA 2YRWA 5IDXA 2Z5FA 4KG7A 1WDKA 3BF8A 4U6NA 1TC2A 2HHCA 5KQRA 2ZPTX 1INLA 2P7HA 1R3DA 1IN4A 1V8FA 2XCIA 1FF9A 3GLFE 1M2GA 3FWPA 2Y2UA 2NUBA 3HUDA 3NO4A 1BE1A 5JG7A 2WDPA 1SU6A 2DOKA 4LDRA 3THOA 3V1YA 1MV5A 2X19A 2W4IA 4OFWA 4U9HS 3DDSA 2BFOA 3MSXA 3PICA 1RWVA 3FXAA 1DU4A 3QJ5A 4DILA 1BQEA 5FPSA 2QBYA 3C6BA 2QK4A 2ZXEA 1ZR2A 3IQHX 3KDAA 2EWWA 3SZMA 2PS1A 3SDBA 3WB0A 4R2LA 5I5EA 3RW9A 2IX3A 1BHSA 2H00A 5IN5A 3EVGA 5PNTA 3SNHA 3ZE9A 1N5OX 3KHKA 421PA 3SICE 3PKIA 3VR5D 3HCDA 1IL0A 3CO0S 3M1LA 4YMLA 5K4AA 3SC6A 1YZQA 3MCVA 3NTXA 2YXDA 4G1BA 4XYEA 3WBBA 4P2GA 4AQDA 4CM4A 1T0BA 4FD3A 5BN4A 5AVUA 4AKIA 2OGZA 1QVRA 1SCDA 1M1ZA 4LQCA 3CB4A 4MDHA 1C80A 3N2GB 1HXHA 4O63O 2E6UX 2X13A 3HBFA 4IW3B 4A2PA 1UBHS 3ZBUA 2X0NA 3Q6NA 3EYAA 3JSAA 1VBNA 4OHKA 3I2IA 5JEDA 4I1VA 4AJEA 3KSBC 4DAOA 3VX3A 1P1IA 1SVKA 2YWDA 4JBXA 4G8BA 4D97A 5A0VA 1AKWA 3CJRA 4HWRA 3Q5GA 3BORA 4FS3A 1XZKA 5GZ6A 4B1FA 2BW0A 3Q87B 4POOA 1ZZEA 1MNAA 1N34B 4B6EA 2O3JA 2QRGA 1QGDA 1CLUA 2YV1A 1CBUA 4IXDA 4AJPA 4WA7A 3PR3A 3KAQA 3ZGVA 1TCVA 2ZAYA 4IKOA 4MQ4A 4QOSA 5B57C 5KVSA 1XQYA 3EPHA 1GKIA 3JXEA 4O4HB 4QASA 2QOEA 1SJ9A 2L42A 5AVQA 4RPLA 4MW6A 1GQYA 1VE5A 5EP4A 4LWPA 3KWLA 4IOKA 3E27A 5DNAA 1DO2A 1MOSA 1UBOS 3NV7A 1Z83A 4KBFA 2DBVO 1D09A 2NPIA 2JI6A 2PO5A 3M89A 3S5JA 5B6JA 3L40A 1BX0A 2OCBA 1FSZA 4Y1RA 4YAJA 5AO9A 2FPPB 4KLNA 5J43A 4Z4QA 2OCXA 3Q0TA 1XP5A 4H17A 4NK4A 4B2IA 2QN3A 4G0OA 1QIDA 1C30B 5GV7A 4GECA 2P2SA 4HDQB 5KVAA 4KBYA 1RC8A 4AB1A 4RIGA 5KAPA 4DPMA 4CDMA 4AZ3B 2XF2A 2H6EA 3L3BA 4RENA 3BAFA 4XCQA 1IQRA 2W70A 2J6IA 3PK0A 3TBFA 4HRYA 2ZRFA 4PBTA 2I6SA 1OXTA 4QO8A 5H1YA 2WIAA 3KLNA 4IF4A 4NBNA 5EYPA 3OT1A 5JI2E 2GJ9A 2A67A 2I7CA 1U94A 1SXJD 2EFGA 3MSCA 2RJ3A 2VYND 3COZA 3O8BA 3WKBA 4ZZ2A 5ALUA 4Z8XA 4Y0AA 4J2TA 3A1WA 1T1SA 2AEMA 3PQ4A 3ZUPA 2OAP1 2IOHA 3LC2O 2E4XA 3G59A 2E4UA 1QGAA 1M1NA 1RZRD 5J3JA 1BAPA 1S6YA 4A9AA 4XB2A 4KDEA 1G63A 1XTZA 3H2HA 2XVAA 2VO1A 2UXDB 5CVDA 1SU7A 1L1FA 2R3SA 2Z6VA 4OMUA 4DQXA 4M0FA 4HGZA 3SXJA 3TLZA 5A4JA 1DX4A 2YZ2A 3FLBA 4IL5A 2CBXA 2YVUA 4OFBA 4TMXA 5I7HA 2QJRA 2JLVA 2XB2A 4O0MA 2OHHA 3BB1A 4ECEA 3KYDB 3QRWA 4UZEA 3LL7A 3QE3A 3GLFA 1KBQA 2WJIA 1Q22A 3ROKA 5BV2P 1KE2A 4GKJB 1C4KA 3KYJB 3CEMA 5FHQA 3S2ZA 4DMKA 5A6SB 1YA8A 3HADA 3AFGA 5ILGA 2IEIA 4ER7A 4OLAA 4FQ5A 3WQQA 3EZ9A 2RAFA 2ZRLA 2FR0A 3EQ2A 3VNRA 4CLRB 4UEKA 3F3SA 4BGEA 5BUCA 1SC9A 3OY2A 1AUOA 3PC4A 1NBAA 4ARZA 3VISA 2CSXA 3LBFA 3FNIA 4R9UC 3EXEA 2O05A 2EL9A 5CDFE 5KAMA 1QGUA 2FFJA 2O4UX 5JALA 1E1QD 5LU9A 2H48A 4N49A 3DB1A 1N75A 1R50A 2I0FA 2VK8A 3F7MA 4H08A 2RGYA 1L8XA 2UVPB 4NG5A 3T0FA 4FFNA 1LCIA 4LZWA 5JFTA 4D0GA 4J0KA 2R6DA 4QU5A 3HL4A 4XB6B 4DN6A 3FRIA 3U44B 3DP7A 2IYEA 1LJ8A 5A3VA 5IT0A 2FZ4A 3I6ZA 4IGEA 2YOGA 4KN5A 2R4TA 2IFTA 4QU9A 1O54A 3SBDA 3UAOA 1JDJA 4AJKA 5F3WB 2ENWA 2BEWA 3BK2A 3HFRA 1H3EA 4GXTA 1USKA 5IM5A 3M9WA 2E7ZA 2WVHA 4MB2A 3GLTA 3H0CA 4PX3A 1A9QA 4B4UA 5A06A 4O59O 3U7QB 5IAAA 3CUSA 2O0LA 3BA6A 3I23A 4FWTA 3KVVA 2CYBA 3L4BC 2JLXA 4DDVA 3B89A 4FT4A 4MYDA 4EG5A 3TMAA 1AUPA 1U2ZA 3IUSA 3QG1A 3T3HA 5E6RA 4P33A 4CM9A 1GVHA 1DAIA 3DG9A 4G65A 1S9HA 1TT5A 5JSFA 1Q1EA 1BGWA 3HMQA 2IHNA 5E6SB 2J6BA 1E7YA 2VTBA 2A9VA 5IABA 1U0FA 2XJ4A 5JCXA 2VHZA 2AFHA 5ALNA 4ERXA 3DBVO 4MUBA 3S2EA 1L3IA 5TR9A 4REQB 5KKAA 1Z4QA 1W4RA 5ITZA 2PKQP 1Z7WA 5KOIA 1WQ1R 4CKXA 2Z8ZA 2IDKA 1AQLA 3BTVA 5CLFA 2WF8A 3BF7A 1FTQA 5KNCH 3KQWA 1IRIA 4LUCA 4N0EA 3P0FA 4OI0A 1FXSA 3EUWA 1M1UA 4KAXA 2JLWA 1V47A 3TZEA 3V8RA 4QZVA 3I3SR 1UT8A 4DM4A 1QFSA 4GSKA 4C3VA 3LYUA 4JGGA 2O2JA 3M81A 4UJ3A 1YQEA 4PS0A 1RCFA 3OMLA 4N5MA 1N3LA 3C3CA 3L7IA 4K1LA 2I2AA 4W9RA 4K9PA 2C0PA 5F77A 1P45A 3IR6A 2JHCA 3D2CA 3P5BA 2RB5A 2WKWA 4M1YA 3I0ZA 1W0JA 3HABA 3N3AC 4KK4A 4I5EA 4N47A 1MA3A 1TCUA 2ZKLA 2WWTA 4DL9A 1DMSA 3G8DA 4QUGA 2M9MA 1SKAA 4GZ6A 4M8IA 4O4JB 3C3PA 3RBVA 2R00A 4EVQA 4XWOA 5CFRA 1EGVB 4Y0NA 2BZGA 3ZNPA 3ABQB 2GARA 2H5IA 3PCRB 4QELA 4G25A 4D44A 4XWKA 1CCWA 3DE2X 1YJAA 4DJ5X 2YS6A 1IOWA 4A0GA 1CQJB 2Z2XA 1TX4B 1A5ZA 1G2QA 3A1TA 4B3FX 1T2AA 2XUFA 3T1YB 3IQEA 2ZCJA 3JV7A 2GDJA 3P0IA 3IKLA 1M34B 4QFCA 2AC7A 3C8ZA 3TTYA 4WCVA 2NV2B 4JD5A 3VH1A 3W78A 4LDZA 1ZM4A 4GD3Q 1NMEA 3Q8WA 3E4CA 2YZ7A 3AF5A 2WF5A 5DBIA 2HV9A 5B1HA 1NR5A 2ATXA 2Z57A 1NUUA 3B20A 3OCWA 4MQEB 4Q3EA 4UU7A 5EXTA 2N47A 4Z4EA 4BAZA 5FH9A 4JBLA 3PI6A 1QRAA 3OZGA 3ZW9A 2PU7A 3QF4A 4UNPA 1NI3A 1XLUA 3DR5A 4GYYA 4QX6A 4V38A 3SYLA 1RI2A 2Z3ZA 4O2AB 4DCNA 3KB2A 3Q3CA 3SKVA 1XZFA 4IGAA 3ER8A 4TMKA 2C3YA 4WZZA 1E2NA 4FOLA 2REQA 2PZKA 3BL8A 3K20A 5AP9A 4BX0A 4C3UA 1ZVKA 3H1GA 3O4VA 5I9MA 2C1EA 1TQ4A 3JATA 1A71A 1MN6A 4IICA 1NUPA 2QUJA 1K8XB 4RK4A 4RIEA 5JCZA 3EWAA 1Y4SA 3CM0A 4CEIB 1TLTA 1NJ8A 2HX1A 4NWIA 1FS5A 4WE3A 1KMQA 4BLWA 4MQBA 1S7CA 2YHIB 2J9ZB 1Z5NA 1LFDB 4WK6A 4OLJA 5BMVA 1ESNA 1DX9A 2JLQA 3F1KA 4GSLA 3SLRA 1DOAA 1OFIA 4AFNA 3NHBA 3DEKA 1O58A 3PGJA 4RZ2A 2DPLA 1US8B 3D7KA 3E5RA 3MCTA 3EZNA 3AJRA 3WO0A 4DY6A 2G04A 3A06A 3HXTA 1RYDA 5DHFA 2WHPA 1N5LA 4X61A 3NIGB 4L5IA 5CU7A 3I6MA 2OLJA 2XZOA 2FJ0A 4RZUA 2VOEA 3LO5A 2PSDA 2ZJAA 4IHJB 3UBMA 2XUIA 4TL7A 3JSXA 3QVWA 3SIPA 4R1MA 4DYHA 1QHHA 1BNCA 2XYVA 2RONA