1NUQA

Crystal structure of human cytosolic nmn/namn adenylyltransferase complexed with naad
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
233
structure length
213
Chain Sequence
b'SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKSG76
molecule tags Transferase
source organism Homo sapiens
publication title STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
pubmed doi rcsb
total genus 76
structure length 213
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2003-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nuqA00
1J1UA 1OBCA 4NDAA 5J5AA 3P0IA 1QU2A 2OV4A 2Z3VA 4PBSA 1Y42X 5LLTA 4MW1A 1G8HA 1WXFA 5TEWA 4MW5A 5LFAA 1K4KA 2C5SA 3KT8A 1MB9A 3IODA 1ZJWA 1O96B 2YWBA 3IMGA 2PZAA 4YP6A 1DNPA 3A4IA 2I1LA 4KPUB 3ZXIA 1QRSA 1NSYA 1KQOA 4MUFA 1GTSA 4ARCA 2WSIA 1NUTA 1T6XA 3HFJA 4MULA 3P0HA 1G59A 1JMVA 4YP7A 4ZCQA 3S3TA 1D2RA 1EUYA 1GAXA 3LCJA 3MUEA 3KT0A 1WZ2A 2QTMA 4YBRA 1YIAA 4R2MA 1A8HA 1V47A 2TS1A 1GTRA 3L92A 4MUEA 4P2BA 4EG1A 1O6BA 2J08A 1T9GR 2QUJA 3I05A 4MWDA 1EXDA 1M8JA 3MMXA 5F23A 3RK1A 4JFAA 1J21A 1EFVA 1GN8A 3X1KA 1M8FA 1XJQA 1QRTA 2H29A 2H2AA 1X6VA 2VXOA 2BTEA 3KT6A 1PFYA 3ELBA 1COZA 2D54A 4QRDA 3H97A 2DPLA 2CUZA 3UOWA 2CV2A 1B6TA 4PBRA 1M1ZA 1NZJA 1JECA 1KH3A 1NUSA 3IMCA 1IQUA 1VLHA 1M83A 4JXXA 2PZ8A 3N8HA 4MVCA 4ZCSA 4DDHA 3MLBA 4OUDB 3U1VA 1ZUNA 1FYDA 4AS1A 3A04A 3AIIA 1H3FA 4JZYA 4OUDA 3TS1A 3H9BA 3CLSC 4U8HA 4WSOA 1XNJA 4PBTA 2HMAA 4HJXA 1G8GA 2NSYA 1PG2A 1JZQA 1KKUA 1QQTA 5J58A 3BL5A 1CT9A 3VRHA 1LI5A 3X1MA 3AG5A 3DO8A 1O96A 2DLCX 1N2IA 2NZ2A 1M8PA 1U3CA 3E27A 1JHDA 3D6VA 1NUUA 3G59A 1J1ZA 3UK2A 5K0SA 4MW6A 4MQ6A 4G6ZA 2CV1A 4ZT3A 3NV7A 2A7XA 3ISJA 1TYAE 2J4DA 3OTWA 4PY2A 1TYCA 3TNJA 5IJXA 1TFUA 1QTQA 3LE8A 3QTBA 1OWLA 1KP3A 1VBMA 4NZPA 1MRZA 5K0TA 5TS2A 3IMEA 4EG8A 3IVGA 1OWPA 1PFUA 5HUJA 3MXTA 4G5YA 2DERA 4F3RA 2YY5A 1QNFA 4MUGA 3CLTD 2PFSA 1NYLA 4XFJA 1O0BA 5IHXA 1VL2A 3D6UA 3VGJA 3N05A 4DJAA 3PRHA 3N9IA 1IH8A 3KT3A 5KHAA 1J20A 1ILEA 4ZCRA 2YWCA 4KPUA 1NI5A 5H7XA 4GU5A 3ND7A 1IVSA 4F4HA 2EL7A 4CDMA 2A1TR 1J70A 3UY4A 3ND5A 3CLSD 2A1UA 4L2IA 3L93A 3ILVA 1O97C 1U7XA 4NAHA 4HPWA 4EG7A 1PFWA 1R6TA 5DK4A 3SEZA 3FHJA 1MOPA 2GOYA 2A1UB 3COYA 3ZXSA 2BYTA 5HG0A 2A86A 4DDMA 1LW7A 1YI8A 4I6EA 4R2LA 3SP1A 2QJFA 2ZUFA 1OWMA 3QTTA 4ZCTA 1YUMA 2E21A 3TQOA 4EG5A 3INNA 3HL4A 2XRZA 3A2KA 3G6KA 4ZT6A 3PNVA 3SYTA 1LI7A 2PG3A 4R0NA 3RHSA 1H1TA 2A4MA 4HJRA 1JIKA 1OD6A 1NP7A 1QJCA 4G5FA 1TEZA 3RJZA 3SEQA 2CYCA 1IFXA 2CV0A 2GKSA 2PZBA 3IOEA 4MWCA 4GRIA 1Q11A 1WKBA 3DPIA 3NBKA 1KQPA 1EUQA 3COVA 3N2YA 4CQNA 1Q77A 1X8XA 3FOCA 4MUJA 2IP1A 1I2DA 3SDBA 1N3LA 1NUPA 4ARIA 3CLUD 3AKZA 3IH5A 3UC5A 2PXHA 3CLTC 2EJCA 3CVUA 2AKEA 4XSVA 1YULA 1NUQA 5DEOA 3IOBA 1N2GA 2A1TS 3VU8A 1JGTA 1MJHA 2DETA 4ND7A 3CR8A 3RFFA 3ZJVA 3NBAA 2IJGX 1I6LA 1EJ2A 3FDXA 1I6KA 4I6JA 1JZSA 5H16A 1ZH0A 3H9CA 4EG6A 3SZGA 4H3SA 4RPIA 4NAUA 4CT0A 1F9AA 4MWBA 4AQ7A 5BNZA 1N2HA 1IRXA 4QREA 2X0KA 3F3MA 3TZEA 1O97D 1IQ0A 5DB4A 3ZJUA 4EG4A 2V0GA 2AZXA 3CLUC 1UFVA 2YXNA 3TZLA 1T6ZA 4WNYA 4UZFA 3IUEA 1PFVA 1WQ3A 4NX2A 4L2IB 3ZIUA 3IOCA 1KH1A 4YP5A 1IQRA 1F7UA 2D5BA 4EFKA 3P0JA 3Q4GA 5TEVA 2CSXA 3Q10A 1WXGA 1K4MA 2JAXA 1MAWA 4J75A 2WQ7A 1HYBA 1XNGA 4JXZA 1KORA 2B7LA 4S1OA 5FNZA 2HZ7A 4A91A 3AG6A 4MVYA 1U3DA 2X3FA 1N75A 2R5WA 1MAUA 2E18A 3CVWA 4FZJA 3JXEA 2J07A 3GMIA 3K32A 1XNHA 1K92A 2O8VA 1EE1A 2DXIA 1J09A 2DUMA 3DV2A 4MW2A 3TQIA 3ZJTA 1YUNA 4CDNA 4DE5A 1WXIA 3AL0C 4MUKA 5KWVA 2J09A 1KQNA 3HZRA 1F7VA 3X1JA 4U7JA 1TYBE 1WXHA 1WOYA 3IVCA 5JBNA 1KAMA 4K03A 2GM3A 3AFHA 5EKDA 4KR7A 2RE8A 1RQGA 3GLVA 1VBNA 3HMQA 2QUKA 4YMIA 1N2BA 4NATA 1VBKA 2X1LA 4KR6A 3CLRD 1JEEA 1GPMA 2WB2A 2WQ6A 3PNYA 4J76A 4HK4A 1BS2A 1M8KA 5J59A 3CA8A 3IDFA 3MLAA 1S4MA 2G36A 4U63A 3SZ3A 1F4LA 3H99A 4E1AA 2JA2A 4QBTA 3H05A 4MW4A 3CVYA 3FETA 1O94C 3FIUA 4MWEA 3ZGZA 1T6YA 4MUNA 4EF6A 1YIDA 4MW7A 1WQ4A 3COWA 1O95C 3FWKA 1G8FA 3CVXA 1T9GS 2A84A 3OP1A 4ZT7A 1Q15A 4EGAA 1KAQA 2XRYA 2V0CA 1K97A 2RD2A 5LM3A 2AG6A 1TQ8A 2QTNA 3Q12A 2IELA 3IUBA 1FFYA 4I6GA 1JILA 1IHOA 4MVWA 4Q16A 4ZT2A 1EFPA 3HGMA 3C8ZA 1KR2A 1OWOA 5FO0A 1JIIA 1O0CA 4ZT5A 2O5RA 1V8FA 4MVXA 1EFPB 1O94D 2E89A 1PG0A 4KR9A 1O5TA 1WY5A 3DLAA 1O95D 3GUZA 2HGZA 4MUIA 1N1DA 3RBAA 1N78A 4KKVA 4DLPA 4DDKA 1N2JA 1N2EA 3UMVA 1WXEA 3M5WA 1QRUA 4K0RA 1ZH6A 2J5BA 4UZEA 2ZP1A 3CLRC 3FI0A 3A05A 2CYAA 4MW9A 4TS1A 1U0BB 1N77A 2DR2A 5DASA 3CVVA 3G5AA 4X0EA 1H3EA 1WJGA 3PNBA 4ND6A 5AHWA 2CT8A 2CYBA 4MUHA 5HUHA 2QTRA 1N2OA 4EG3A 1KH2A 3QE4A 2DEUA 1JEDA 4MAFA 1MB2A 4Q93A 4MLPA 1NURA 1H3NA 3FNRA 4OJMX 1GZUA 5KCMA 1QU3A 1OWNA 1EFVB 1KP2A 3ZUGA 3LOQA 2VTBB 3FG9A 1I6MA 1U7DA 2OQ2A 2CFOA 4ZCPA 3IVXA 2VTBA 1SURA 3K9WA 1ULHA 1OBHA 3ND6A 1GLNA 2QJOA 2QUHA 5FO1A 3P52A 2A88A 2JANA 5TGTA 4RUKA 3RK0A 2Z09A 2Z08A 1TYDE 4ZT4A 3PXUA 4BWVA 1M8GA 2QJTA 2QUIA 3FY4A 1JIJA 4MW0A 2X1MA 2PIDA 1R6UA 4XFDA 2ZUEA 2E0IA 3KFLA 1R6XA 3FH0A 4DNXA 3HV0A 2D13A 1P7PA 3COZA 4JYZA 1MC1A 1Q19A 1MBZA
chains in the Genus database with same CATH superfamily
3LT0A 4XWKA 5DNUA 1OBCA 2OXCA 4W7IA 1PKXA 2W8BB 3TGWA 2QUBA 4I55B 4YRNA 1PF7E 1V11B 2MT9A 2OV4A 1G0NA 3O1IC 4AULA 3W5BA 1UAGA 1OFHA 2HQRA 3P9NA 1G8HA 1E6WA 4WKBA 1JPJA 2HF7A 2Q6OA 1DG1G 5T5QA 5TMEA 3TB6A 1P0MA 2V3CC 1FFEA 4CFZA 5F5XA 3NETA 1P91A 1V4BA 2PVSA 2WF8A 4K9KA 4B09A 1R4NA 2A9OA 5AXDA 1QCCA 4CR8A 3PC8A 5ED0A 5LZ5A 3FPHA 3M6FA 1B2LA 4BJ6A 2Q7XA 1T5TA 5DTIA 5TGZA 4KUHA 4YO7A 3P9KA 1UL1X 3GROA 3HXOA 3OJWA 4HNTA 4B6OA 1XRMA 4QSMA 1U9JA 2I7TA 4WXYB 1FYVA 1UMKA 1GQFA 2WF5A 3QMMA 1XZIA 3JWPA 4UAGA 3M3HA 3N8NA 1PR1A 1Z4KA 2VDWA 4FUTA 4UXJA 1SUBA 4Y2SA 5I9MA 3VC3A 1NONA 1RWPA 1MJGM 4MCAA 2O2HA 5COAA 3TTUA 2XA9A 1Z26A 3UMRA 5DM70 4YXFA 1U04A 3GPDG 2VYQA 4Y0NA 5EZYF 2ID7A 1MTZA 2O6LA 1KOJA 3DVQX 4NHOA 4UPDA 4CM1A 2OHFA 5KUTA 4XDZA 1CB7A 2FWIA 3HU5A 3CZ4A 1CNFA 4OHBA 4POOA 1Q22A 3IIKA 3PHCA 2F8LA 1E2UA 2IPNA 4FFBA 4FQ8A 4GZ6A 3SYNA 2WIBA 1NAHA 1MB0A 1AUPA 1XAIA 2XYRA 4P4UA 5JMPA 3HXQA 3MMXA 1ID1A 2XI4A 2LVBA 1PAUA 1R66A 4N49A 4BUZA 4DTCA 7MHTA 1OKKA 4NS1A 3FCOA 4GFDA 1DS6A 1QHSA 2OHJA 2YHAA 3L46A 5CVVA 5EESA 5H0IA 4EKDA 3EGDA 3EMDA 3RVSA 4JBIA 2FTKE 1X2EA 3DBRA 1R4ZA 1W0KA 3GDOA 1PR4A 1PZEA 4KQKA 2BHNA 3Q7PA 3WBBA 3QQ5A 4LE0A 5TQ0A 1N6IA 4DV6B 1GYQA 2XLCA 1M3SA 1UDRA 3IL2A 2G0TA 2HWKA 4QG7A 1USUA 2CHEA 2V8OA 1IUPA 1P1KA 2BFDA 3LCVB 3R2JA 4WK2B 1J2EA 4JT2A 3A28A 3EZNA 5MF6A 4QXMA 3L0CA 1DDIA 3OCXA 2E4VA 2FPRA 4ZCSA 4DPKA 3RANA 2C7QA 3LUJA 1EGHA 3EDRA 4AS1A 1WHTA 1TF5A 2PX4A 3A04A 3JYLA 4QJ3A 1JVNA 4IVQA 1NY6A 4QXQA 1BC5A 1IZ0A 1YZYA 4MKGA 3D3NA 4OAQA 1XDGA 4DLXA 5CVTA 4IG4A 5AVTA 3TTXA 2CK3A 1JBEA 1JE1A 2W83A 4ZMRA 4F7DA 1GA6A 1JZQA 1C1DA 2PJZA 3ZIAD 1G6Q1 2HCRA 5B7QA 3VSCA 4ZJUA 2AG0A 3R6WA 1PZXA 4RH0A 1Y7LA 4WQMA 3TLBA 1P9RA 1ND6A 1DAEA 2PLWA 3EEFA 4MH0R 2H11A 4OHUA 4Q6BA 3ZDYB 3DA8A 1CQPA 1UBOS 1EEHA 3GGCA 2GESA 4MP3A 3C3YA 1XXHA 2A5YB 3G59A 2ZJAA 1A9PA 1EVJA 2F43B 2FUCA 4PPFA 3EE6A 3IILA 3G8BA 3P94A 3EODA 5E2AA 1NNLA 4RWZA 3IEPA 4MQ6A 1JI3A 1P3DA 3ESBA 3R0VA 3ZWMA 4BB6A 5I7UA 3HVJA 2C4KA 4J0IA 2PYIA 3KFXA 4OHOA 3UJNA 1UBUS 4MRRA 4CIAA 5IJXA 2ZPTX 2JCYA 3EXFA 4XJTA 4DHWA 1P2DA 1VE9A 2PVCA 3O74A 5KTSA 4IGIA 1QH8A 2OILA 1XRJA 3HJGA 5DI9A 4Q7QA 3DZ8A 1C50A 4KACA 1ELOA 4KWIA 3ROEA 4BN5A 1ZU5A 3DP7A 2BTQB 2Q4RA 4CGZA 1RQ7A 1LU9A 4LDNA 2B5WA 4JLSA 2EKBA 3MF4A 1QHHA 3AGQA 1CF4A 2V54A 3E82A 3T38A 3H4MA 2HMSA 2OV2A 4MMXB 4KE8A 3HJRA 3V1TC 2O3SA 2GUGA 4EDHA 1FFGA 3Q3JB 3UM9A 2UYOA 2HPVA 3PHGA 4FVTA 1BDIA 3AFOA 3V4OA 3LBYA 1CUGA 2INGX 3OX1A 5F3DA 1UBSB 2VUUA 1QHNA 4QHSA 4K6KA 1JR3D 5T4FA 4EX6A 1MN6A 4MRVA 1RXIA 1A9TA 5I7AA 4Q4AA 5CEEA 1IN7A 1LB1B 3F6BX 3L6DA 4LW8A 3GAMA 5HEKA 4ZO8A 2DFKB 2G4VA 3QWBA 4MTLA 2ZATA 2QG6A 2PUEA 4ZEVA 1NULA 1GL6A 3DE5X 3A2LA 2A1TR 5AJTA 2IFTA 2Z5VA 3PUZA 2NIPA 3QF4B 5KMGA 3K5HA 3EXIB 2LZ0A 4L2IA 4GMDA 4FEEA 5IJ0B 1CUXA 3GJ6A 4EW1A 4OGLA 1JAXA 4HPWA 2XZLA 1IXYA 2BRUC 4N8EA 4MVJH 5JECA 4A2CA 1DWPA 1FFXB 3P5SA 3OA0A 2HK6A 1JG1A 3TW0A 3ADKA 1W35A 1TAHA 3R7SA 3TSOA 1MF7A 1QFXA 2O0JA 2WM8A 4E1VA 4ZIRA 2ZUFA 1WIWA 1ORVA 1M34E 3TQOA 4GSLA 1L3IA 1JHPA 1X7WA 2XMRA 1L1EA 3G1UA 3GXOA 3UPUA 2GLXA 1VKRA 2FFRA 2ON6A 4ISBA 2PSEA 4B32A 5JFGA 3ZCSA 2IOYA 4FZRA 3KAQA 3GEIA 2HWWA 4DV1B 1T6BY 2AG8A 1NP7A 4ILKA 2YNMC 3ZTYA 1AXRA 3EH1A 2VP5A 5HZHA 1JB9A 2AUMA 1WB4A 1E3LA 3TJZA 2PZBA 1WKCA 3PFBA 5KQSA 2I54A 1KZ1A 3G5MA 4E5DA 1VSVA 4MVJA 4M89A 1NX9A 3W79A 2WVAA 1V1MA 5CVCA 1EUQA 4ZI7B 1F38A 3O0TA 1ZGAA 2ZSBA 5CX1B 5F7ZA 1SMKA 4D3YA 1B7GO 3R7FA 4AN1A 2B25A 3N3BC 5G1PA 1N6RA 1QLWA 2V4UA 1SBCA 3DOEA 4LXQA 4CQLA 1C4XA 4WAUA 1WTCA 2GTHA 3E9EA 2IV7A 3S2ZA 4C0BA 4LFCB 1UKYA 4B80A 5LMNB 4BGVA 1T9CA 4D5GA 2PNJA 4K0KB 2VNJA 3OZCA 4JVNA 4MX8A 4F9TA 1DEHA 1QV7A 4LS3A 4KQ2A 3JASA 3TG2A 4HUJA 4ROSA 4JVSB 4HB4A 1WX1A 2ZJ5A 2X0RA 2HLHA 3A8TA 3NUQA 4LBYA 4YDHB 5F21A 4XX0B 1ZH0A 3H9CA 4U0JA 2WZDA 3MGBA 5IKXA 2P3LA 2BUBA 3Q8LA 1NJGA 1UAYA 2VHZA 2QF7A 2EV9A 3LRXA 5U4QA 3HPQA 1U9IC 1U3FA 3SQOA 4YCLA 4UHDA 4DGSA 5AVOA 2WUEA 4BB5A 3IFSA 4AW9A 5DTJA 1SC6A 1CKEA 2WT9A 2ZB3A 3KOOA 4L78A 4BN0A 1OASA 1VQ1A 2FPXA 1FP4B 2MINB 4LJ6A 4MYSA 4ND2A 3CKMA 1Y1LA 2G4LA 2HU5A 3SLGA 4UNQA 5DOZA 4REQB 1VC2A 3LV8A 4CF3A 2VSYA 3CWZA 1E4VA 4GMKA 4OEHA 1XDBA 2Q1YA 5F78A 3O91A 2ZBPA 3NCHA 2ASEA 2OXEA 4QIHA 2AR0A 3P0JA 4NL4H 3Q4GA 2W6IA 3OEHA 1R5JA 4ECEA 2G4CA 3ORSA 2Y2UA 1N2CE 2ZU0C 1ZMXA 3INGA 3LY8A 4B2PA 3KQSA 1MEEA 4WZAE 3BFVA 1ZJ6A 1NV9A 1Q1GA 1DQYA 3K2QA 2I4LA 3H2KA 4NJMA 4B0OA 1OA1A 1NVDA 1SOVA 2ILVA 3L8MA 2X0IA 2VK1A 3LW7A 3E9MA 4HI0E 2VQ3A 2YNMD 1ONNA 4RMIA 4MVYA 4JBHA 4HQRA 4HYQA 5K4HA 4M98A 2F1RA 3JW8A 2G9UA 3OCUA 2ZUSA 1JJBA 5AK5A 4ZCLA 2HW8A 1TAUA 5BSGA 5JR3A 5FWYB 4GDFA 1LVGA 2VQDA 2IKQA 1EVQA 1SAYA 1ST3A 1G7RA 1ZJYA 2H07A 2QEQA 1ULZA 2PD4A 4YI3A 4P4TA 4E12A 4MVJD 3LKDA 4KUGA 3UMSA 1ABFA 1AB5A 2BGKA 2PLNA 3D8SA 4PNPA 3R77A 4Z0NA 4KGZA 1G3IA 4OQFA 5K09A 1L9XA 5BQXA 1NW8A 2FKNA 3HZRA 4Q37A 2DR3A 5TPZD 4AT1A 3BT7A 1FTQA 1OZAA 1OZHA 2RKWA 5H4HA 4TYNA 2LDXA 2RJ3A 4DLSA 4ZYUA 2V1XA 1FNNA 1R64A 2I4NA 3EN0A 2J5KA 3HQ4O 2A9FA 4KN6A 2J0UB 5ICMA 1L4BA 1LSSA 3JZMA 4QATA 3DV0A 3VYUB 2PH5A 3CZPA 1G9SA 3K0FB 2P9ZA 4LI3X 2W58A 4Q3KA 3DLHA 4U2DA 4DUGD 5SZIA 1GPMA 2WQ6A 1A4IA 1NJFA 4Y9SA 3TD2A 1GRCA 2E3JA 3JZAA 4DADA 3ZI7A 1E4YA 2D74A 1UCFA 3C5WP 2V96A 3EYAA 1CVIA 1H5NA 1FRQA 1XFDA 4IGKA 1G2PA 4O1HA 5DX8A 3LGAA 3RTGA 4ZVTA 3VC1A 5A2QA 3PDCA 1OXSC 2YYSA 1XTRA 3THWA 3RT1A 2H54A 2ZSIA 1ESZA 3B8HA 2PQ0A 3NEPX 4G56A 1P4SA 3KK0A 5A7GA 1GDTA 4CKXA 3KKKA 4AJ1A 2J30A 3HA2A 1KI6B 4RYDA 4NYIQ 4BAUA 4IHJA 4MUNA 1U1FA 1YR7A 4N5HX 5F9MA 1WVIA 3TTWA 3QU7A 4XYMA 4BEWA 5KYWB 3CVXA 1C3VA 3NHAA 1YJ5A 4GOOD 3CUYA 4DR4B 4XLTA 4TYWA 2P5UA 3NWPA 3O73A 3IA7A 3BL8A 3L8ZA 3O1JC 3OD1A 5FBRB 3HY3A 1TQ2A 2XMCA 1QPGA 1TO6A 4D8WA 5C5DA 4YRTA 4YMUA 3H1GA 2GJ9A 1SZPA 1AGRA 5FQOA 3RRXA 3A6ZA 1RCFA 2DJ5A 5C1PA 5KNCD 1VCNA 4DR7B 5H83A 3PV0A 1SGWA 4GQBA 4K46A 4MVWA 4UEOA 4G26A 5BOVA 2IUUA 1SY7A 2W70A 4MROA 1N3BA 3DW1X 3IV6A 3ZDZB 4ZGWA 1P17A 1JJAA 3PWKA 4QTZA 3FVQA 3ZY5A 5IDYA 1HLDA 4UUPA 2PSDA 5AYVA 1ESCA 1YVEI 5JAZA 1VFPA 5H3CA 3SEAA 1F06A 2JCVA 2HMVA 4D96A 1DRVA 1MG0A 5ENZA 5J63A 1QUFA 3G8AA 4N6GA 3V00A 4EHNA 5JCPA 1XSEA 5IVPA 5LL6P 3WGLA 1QORA 1UWCA 1RMTA 4K1XA 4KKVA 1D2EA 4DDKA 4D25A 2C84A 4NICA 3SZRA 1A5ZA 1F48A 2ADOA 3TIGA 2W5UA 3A0UA 1KGSA 2JRLA 1E4EB 4KN5A 4RY2A 4X7BA 4JGIA 3P20A 4X71A 2XB8A 2DOKA 1E18A 1GTG1 3DXYA 2HT1A 1US8B 1RWBA 2HQ1A 1M7HA 4XUCA 2VSXA 1BH6A 2QQFA 3IQXA 3BMNA 3ETEA 3ROXA 4F2HA 3HJBA 1RRPA 4TTQA 3GEPA 4Y9RA 1T5DX 2VDJA 3TBKA 4F72A 3ETLA 3WB0A 4JJ7A 4L08A 2YWXA 1DT3A 3OLZA 3IQEA 3PNBA 5D3MA 1PK9A 2H2HA 4CF7A 4AMYA 2ZTUA 4CKYA 2VDKB 5IAGA 4KO3S 2CT8A 1XHEA 3IMKA 1J8VA 4JP2A 3HKBB 4MPPA 4PHCA 3PX2A 1N7IA 3NNNA 4C4RA 4YCSA 2NZJA 2YJNA 2PQMA 2ZBUA 4TTAA 1YJXA 3E2PA 2XMPA 3OIVA 1AZTA 4IDFA 1SQ0A 9LDTA 3C70A 5F5LA 3QBJA 2DJIA 4B3DA 2NVUA 3FGPA 2REQB 1OWNA 1C0KA 4HATA 2VWHA 3FPJA 1J8DA 1Z33A 4UHHA 3CCCA 1MAHA 2H3HA 1Z06A 3H6KA 5A9SA 1DC4A 1B15A 1D0SA 1VXOA 1W4CA 2DQKA 1SB8A 3N2GA 5I8PA 1QQBA 4K3VA 3IDZA 4L76A 4O4HA 4YI5A 2PX8A 1CJVC 2FRXA 3C7AA 1DX9A 3EC1A 3LHSA 5CFQA 1GLNA 2NG1A 1IUOA 2R7AA 3P52A 4HEHA 3WZLA 2P1DA 1U2SA 2PCLA 4H60A 4WXPA 3EPLA 4KTVE 3P9CA 4U8GA 3MCZA 5DCWA 3GRPA 3WYCA 3T5GA 4ADSG 1B76A 3TJRA 2CB0A 2J0UA 1DAFA 2Q4DA 1TZMA 1U7TA 1I2AA 3C4VA 3HN7A 1QAQA 1TECE 3LHIA 4EI7A 1B0ZA 2RGBA 4UDXX 4C7KA 3AW9A 3BCRA 1UUFA 1NDHA 2P2DA 3FY4A 4JLKA 5LMCA 2Q8NA 2AFHA 4IEEA 2DAPA 4XIJA 5CAEA 4GI2A 1WXWA 3F6PA 4PSAA 1Q0TA 2HA3A 4QOFA 3UB2A 3ANTA 5AIBA 4HGQA 4B7ZA 1W5SA 3ORQA 5DGDA 3UBTA 1RJ9B 2ZJ3A 1UJ2A 4IF4A 2QTBA 2B5VA 2YOGA 4NEHB 1ILWA 2AJTA 2Q9CA 1EM6A 1E1NA 1MJGA 1ZOIA 4ZTBA 4IH9A 1YQTA 2GEKA 3CCBA 4JDPA 3WMEA 1U2GC 4C6SA 3FDZA 3STTA 2IX3A 3U60B 1ZBQA 1NPDA 1QOZA 3UK7A 5CA0A 2WSSA 4UNIA 3RU2A 3I6QA 4BDSA 1N0HA 1Z4PX 4ZWNA 2H4HA 2JI4A 3AU8A 2IDZA 3EZXA 4BFCA 1CEQA 1QVZA 2EX1A 1DNPA 3T7RA 3SVLA 4IDCA 3G8YA 4O4HB 3WK8A 1G4UR 4Q9JA 4LSMA 2OAEA 5IABA 1B16A 1IE3A 3NP7A 5SZHB 1VSTA 4HB3A 3TDKA 4B2YA 5IT4A 3KJIA 2CHUA 3NVKI 2B34A 4JLNA 4HX9A 1ZX1A 1P5RA 2AG5A 2M6SA 1T0BA 1SUFA 4GX0A 4KU4A 4D0SA 3OTQA 2IHYA 2E87A 2RKBA 3KVRA 5AJHA 4CKZA 5I7OA 3T5AA 4LRYA 4BKQA 1RC8A 4BATA 3RSFA 4R2MA 1DLIA 3EF3A 2VDWB 2X6RA 3HYCA 5LA6A 3NBYC 3VR4A 3G5UA 3A3NA 4OHZA 4BLRA 5FPKA 1LDGA 2Q49A 4Z7QB 4QYSA 4PSCA 9ABPA 2A33A 1A69A 1NMXA 3CT6A 4G5RA 5IAJA 3U7QA 5HUQA 3PUKA 2QNIA 2BEKA 4QTUB 4YAJA 5KNBA 3R3VA 3RC2A 3ZIDA 2HU8A 4FFMA 2BI8A 3KDAA 2ZI6A 5FLYA 5JLJA 2W2VA 1EM8A 4L8YA 3NM6B 3AUKA 4QXPA 4TRMA 5KEIA 4YPFA 4CMIB 3TRJA 1GN8A 4WRRA 1Y6ZA 3P2IA 1GPLA 1XJQA 3ZD6A 3CW8X 4EJ2A 1V7CA 1LWNA 1Y37A 4IFIA 2XVXA 1TYEB 5JJIA 3T4XA 1UEIA 4JQZA 1AO3A 3WWOA 4Z1OA 4M7OA 1JNYA 3C16C 4QUIA 3Q8KA 2AR9A 2R7MA 3MFYA 3FMGA 5EHXA 2IE8A 5ELXA 4Z8YA 1JFFA 1Q7CA 3UV3A 1FK8A 1GEEA 4JJ6A 3D2BA 1YAJA 4CIVA 2CV2A 4X84A 1O4WA 1LLFA 2RH5A 1JKFA 3IXMA 3WYDA 2D2FA 2X76A 3U48A 2AQKA 6PFKA 3VTAA 1AHHA 1DQNA 3GY0A 4EHKA 3UXHA 3KTAA 3SF0A 1ZI6A 5DDIP 5CEFA 5DN6D 3DC2A 1PBTA 3AERA 4DMRA 2IZ0A 1RBYA 2Q2VA 4YWJA 3DQZA 4A5OA 4JI5B 1BN6A 4OUDA 3WRXC 5B30A 5BQ5A 4WD3A 2OHGA 1K7SN 4PLHA 1MRNA 2K2WA 4HJXA 3VKWA 5BSHA 2XNJA 1NSTA 1N33B 3TI7A 2X2OA 3JVUA 2ECFA 4GXNA 2EIXA 1BX3A 1EFTA 1GR0A 3R7AA 4MDHA 1QE0A 1F0NA 2OVFA 3NRCA 1KKUA 3QMVA 4D74A 3DZHA 4NRDA 3A3OA 3HXTA 4I9UA 1UOEA 1XNQB 3SQMA 4KXUA 2VCYA 4ITUA 1R4MA 1CJBA 1E3WA 2QVLA 1THZA 4HLUA 4LRWA 5KC9A 1E3JA 2PIAA 1MC4A 4DQLA 3O8OA 3LUCA 1LFAA 3GJTA 2HBQA 3D6VA 1NMEA 1K7CA 5KTKA 2QL7A 5EJ9A 4D4KA 4B3HA 2VRCD 2VZLA 1ADCA 3UJPA 1OLUA 3QIAA 1AGYA 2PQ6A 1T6NA 4OQLA 4YJFA 1H6CA 2FFAA 4PEVA 2O8DB 2A67A 3AI3A 1VHLA 3HCCA 3V7NA 1DKNA 3K5IA 1YZQA 4HS4A 4OU5A 4BQPA 1ZM4A 1YZTA 4CGYA 2DCMA 2OOKA 4HDQB 1HPLA 3HI4A 3PXGA 4WN9A 1KP3A 1GVHA 1X1TA 4RPKA 5BWMA 2PUAA 4K2AA 2XQVA 2IDJA 1RVV1 1L4KA 3BL6A 1H8HD 1UXGA 2D4HA 4EHFA 2YJTD 1KYZA 2WWVD 4OD0A 1KJNA 3HFGA 2ZM6B 1SHKA 5K03A 4LZNA 4X1YB 3V1UA 4BMVA 3AHGA 2WAXA 3RW9A 2IBSA 4XARA 3GLIB 2JBWA 3O1HB 4PX9A 2QK4A 2B2XA 1N9GA 4J1SA 3SOPA 3KUKA 3RH0A 2GPAA 1GUYA 1QVAA 3MTQA 2PH1A 3VGJA 1DAPA 4FCVA 3DHYA 4H9GA 3REFA 3TUJC 1OZ0A 1Z83A 2HK8A 3A9TA 3B2NA 3FLEA 4WUTA 4YR9A 4ZCRA 1H9CA 1U8AA 3E3LA 4X3PA 4IDNA 3N70A 4IKEA 3NALA 1IWBB 3PC4A 3EMKA 4CUKA 4C03A 2B8TA 2QVZX 1J42A 3ZGLA 1CK4A 5CDTA 4G86A 4JIGA 3AOGA 3AY0A 1QGED 4JHLA 2E7ZA 4QVIA 3FR7A 3UY4A 5JT1A 3F4LA 4PGAA 4K8OA 5GGYA 5AKEA 1SA0A 5AW7A 2VBFA 1YS1X 1SBTA 3AJDA 3BWYA 3IAAA 4K9PA 5ALHA 3TI9A 4WIAA 4ZVMA 4MR7B 1I01A 3MSXA 5HCUA 3GGGA 2Z8YA 1CUWA 1X7ZB 3ZXSA 3V8NA 5A02A 1HDOA 4QOSA 1DFHA 3JQ9A 4V3BA 2VPZA 3D8UA 2GFHA 3IB3A 3P9XA 5EGNA 5G1OA 1E3MA 3HI6A 4L4RA 3NJ8A 2ES4A 4KIGA 4LMBA 2HXGA 4HFNA 3EARA 4EG5A 3L4JA 1KU0A 2XZPA 3L02A 3RS4A 1ZCZA 4KPFC 5KTOA 5C31A 2PA0A 2DTDA 1EGAA 1GHTA 3DBIA 3O3MB 1L4YA 3KLPX 5ITZA 2ZT8A 4G01B 2WE7A 4HKTA 4MO2A 4DC1A 4DQDA 5HQ3B 3BD9A 1EWVA 1IG3A 4R2KA 3SEQA 4L0MA 3ZLUA 3OPXA 2GKSA 4MO9A 1KI4A 5DWVA 3LCMA 3H9QA 1KTIA 2EBHX 1P0FA 3PC8C 2ZB8A 3RJMA 1WKBA 1X94A 1YA8A 2DWQA 2E4WA 3OQNA 1VCOA 2JI9A 2XZDA 5ALJA 4X20A 4HQOA 2DPMA 1MOZA 1T4MA 2Y6UA 1T3ZA 1E2NA 1FMCA 1HDCA 4YFVA 1GTZA 4E11A 3JWIA 4ZYWA 1WCWA 2HSJA 3LBHA 3VH1A 5JS1A 4QUHA 2B9VA 3SS8A 3W8EA 5BNWA 5FNVA 4DRXA 2ZPAA 1O6CA 1E32A 3DEIA 2ONZA 4C06A 2O1XA 4K3UA 4LY9A 1DKLA 3H9UA 4RZQA 3R20A 3UAOA 5BN3B 2VSNA 4Y8VA 5P21A 1QP0A 1QG0A 3B5EA 1C8BA 1O9GA 1C9JA 4HAWA 1MW9X 3PVSA 6CHYA 5HIAA 2DETA 4LOAA 2O5CA 4ND7A 1DCTA 4G5QA 2Z1DA 5IK2A 1A9YA 2XB4A 1I6LA 3FYDA 1DJLA 1L9KA 3R5XA 4IIEA 4LV8B 4NCIA 4QM7A 4L4XA 4R1MA 3A58B 1BKSB 1BVRA 3F8WA 5EIHA 3BXZA 3P27A 4X63A 1CRPA 5KNDA 4INOA 3KYCB 3IQHX 4JJZA 4TQUS 4WEQA 1R2QA 3WXBA 1XLTC 5KVSA 4P2GA 3UV7A 4MR8B 1K75A 4MJ3A 2MHCA 2CNNA 3DMYA 4JC5A 2P11A 3GYBA 2IU0A 2WTBA 3SSAA 2FZLA 2FGJA 5KNLA 4DV4B 3G88A 3SD7A 4S05A 2BMDA 2OAP1 1FNMA 3EVEA 3C85A 4JJAA 4BCBA 2GYUA 4P3YA 4CU2A 2QLMA 2GA9A 3IUEA 2F9FA 4JLOA 5IAKA 3L43A 4Z5XA 2R8EA 2VJYA 2JK1A 3YASA 3T1VA 4R40A 1WF6A 4Y6PA 1Y1QA 4OXNA 5A03A 4ODIA 3TLZA 3ONVA 1Z2DA 5GTDA 1BAPA 1C9EA 1SN7A 3VKHA 1X7ZA 1ZY2A 3TINA 1G63A 1H2HA 3ZZ1A 4ZN6A 4RVFA 2AUNA 3IT0A 1K7FB 4WCFB 3AXTA 4L7QA 1GSAA 2WJZB 4NABA 4MPJA 1BWQA 3IHTA 1UKCA 1KY5A 3AB3A 3CINA 4RVOA 3HNPA 1G21B 2HZ7A 8LDHA 1F8YA 1G66A 4C3OB 3WI7A 1CY0A 3A36A 4Y6LA 2PJUA 1NM5A 1UANA 5C8VA 2J0SA 1RLUA 2P9JA 1OYOA 2ZB2A 2AD5A 2BY4A 3L0SA 4MV7A 4BPRA 1XRPA 1I1QB 3B1YA 3WK4A 3NDJA 2CBZA 3ZZTA 1EE1A 1WABA 16PKA 4KE6A 2G9ZA 1Q7GA 1RQLA 2WD9A 4R31A 3PGKA 3TTYA 1BEEA 4JP5A 5JAIA 1HNWB 3GLSA 3KQTA 3E1KA 2Z30A 5JLAA 5AUOB 1U5BB 5IK2D 1XIVA 1MPTA 2WV7A 4MUKA 1WPXA 5K8LA 7MDHA 4M0KA 3JAKB 4Q9NA 2UZ4A 3RVJA 4A6PA 2W2TA 3BULA 5F2NA 1CB0A 5FCDA 2BFAA 5JIBA 3JQGB 4UAVA 1M2JA 1SQ6A 5ARCA 3OU7A 4HXFB 2B9EA 1UFRA 3TLXA 4IDAA 3QPAA 3PI6A 5A1TA 4C7BA 1D0IA 3LD9A 5FJJA 3KJZA 4KI7A 3TRIA 2CL5A 1V8DA 3WBFA 1P19A 4XGNA 1GRQA 4PFJA 2F3QA 1KXZA 1V96A 4HK4A 2HJVA 5GV8A 4KITB 3ROFA 1KGDA 1Z07A 1EWQA 3AM1A 3MTBA 4WOJA 4R83A 3CB4A 4FGLA 1FUKA 2RI1A 3I34X 1VMIA 3MWKA 1EFRA 1MVOA 1S4MA 1YDFA 3N2KA 4AZTA 4LXXA 2OCKA 3LX6A 3I6ZA 1FMLA 3R09A 5JAUA 3RFUA 3U3OA 4DLKA 3NHYA 3GW8A 2EHJA 1MX3A 2YUTA 1XHFA 4ETMA 4PN7A 1U2QA 1AQ6A 1OXKB 2QYHA 4C07A 5A9SB 1XPUA 3CUEF 2ZK7A 2PDAA 1J56A 1YIDA 1NBOA 3KELA 3O2SB 2I3ZA 1AKVA 3TW8B 4NMLA 4XZ3A 1RXWA 3QWHA 1JFSA 4WEOA 2X9NA 3DF7A 5AHOA 1WR8A 4KEAA 2HRCA 4X1KA 5JG7A 2A7QA 3PI7A 5EKXA 2C4HA 3P2MA 1UWVA 2XOKA 3TE7A 2EX4A 4IIGA 3IIMA 3PVZA 4ZJYA 5CPBA 4L8FA 5KTYA 3DE1X 2WJJA 2VHXA 3CE9A 4CLOB 2BGUA 2YS7A 4YUZA 1SBZA 1VP9A 2NU7B 3CT4A 3I45A 2UUOA 3PPVA 4E51A 1Z7YA 3U4AA 5AHKA 4YCDA 1UR5A 3ST7A 6Q21A 4V0SA 2BGGA 4IICA 4KNYA 2YMQA 4KHPB 5EAIA 1Y7IA 2B20A 4N5MA 3CF0A 1I80A 1QQ5A 4HMOA 2XWBF 3OFVA 5BRAA 4FMCF 1G5PA 4MVJF 1SKMA 2ISQA 4LK2A 1CZNA 2AYXA 2YIMA 3NKVA 1ISHA 5EN4A 2E4UA 3WL6A 1QPBA 5D51S 1L7EA 4ZDKA 5LQNA 3G85A 4BRSA 5K5EA 1EVLA 3DOJA 2FSUA 1WCV1 2FZ4A 3E9RA 3C5HA 3D3WA 3FYHA 5KSPA 4IDOA 4JLBA 5ALLA 4PC7A 2HSDA 3IYLW 1EK5A 1ZRMA 1XRLA 2DPXA 2EJTA 3OPYB 4A1OA 1P0QA 5HPYB 2YQ5A 1QRUA 3EW7A 2TMDA 4UZEA 3KLBA 3CF6R 5TXGA 3BJMA 3O4VA 4G0OA 4NYJR 4ZAXA 3UNXA 1J39A 1HE2A 3R8CA 4EOGA 1KC3A 3VDNB 5C1OA 4P38A 2JLRA 3KKZA 1Y9DA 1USVA 4QA9A 3CX8A 3G5AA 4Z99A 2Y27A 2WV9A 3T5MA 4DMMA 1P9WA 2GRUA 1EZ4A 2FZGA 1T8PA 3E70C 2AW3A 4OXQA 1SCAA 4X60A 4E5KA 1GGKA 3L8EA 4JSTA 4S3MA 2VPXA 4OGGA 2I6QA 2XTAA 4G9EA 3WK7A 3ULKA 3UHPA 3F96A 3OPYI 1RKBA 5AKHA 4JB0A 3F71A 4F92B 1LLUA 2ZROA 2ZUUA 4EYGA 4EI2A 1L7XA 2I6UA 2MSKA 3IQIX 3DFIA 3TOXA 2ZRNA 5JUWA 4GH5A 2BC9A 3EA5A 4PG8A 1UZUA 4YRQA 1O54A 1QU3A 3L7DA 3WLNA 2DE0X 3LO5A 2CL6X 1SCBA 5K1ZA 1Q1EA 3L6UA 2BCGY 4TV9F 1YU6A 3Q11A 1KI6A 2JA1A 5KBYA 2ZRQA 3G2LA 4NU0A 4FB5A 2CFOA 2P78A 3BBPA 4TSKA 1I51A 1XEWY 3K9WA 1L5LA 3PWSA 4WNAB 4S1WA 2Q46A 2QUHA 3OZEA 4BX9A 5INTA 2F2TA 3DUWA 2C5FA 2JARA 3N8GA 4MICA 5DSXA 1NJSA 4WE3A 4CMEA 1MFZA 2DH6A 3PRYA 4J29A 3EDCA 4Q4LA 4PTYA 5KKCA 2X14A 3EXG1 2PU5A 1XDZA 1ZEJA 3LPDA 4I8DA 4WKNA 4DCUA 3DV0B 5FR1A 4RKRA 1E77A 1N1EA 2W71A 3JZIA 4BV2A 4UOZA 1RQNA 1SVNA 1BXKA 3KYDB 4EF5A 1P1BA 3JALB 3QLEA 5JCZA 2YC4C 3VKFA 3E03A 4CYMA 5ILOA 2ZZMA 1PWYE 4MW0A 1AXEA 2ASVA 2WT4A 4W6ZA 3S2SA 2Q0QA 3U81A 3ROZA 1XPOA 3KKEA 4M1ZA 4X8HA 3NKLA 1EXMA 2VL7A 3CUKA 1PKEA 5KYUB 3FH0A 1LLCA 2P9CA 2RHHA 3BVPA 3E5HA 3H3FA 3HV0A 3WDSA 1YQUA 3UT5A 2X5OA 3D6AA 3M4NA 3QK7A 4QVKA 1MBZA 1EA7A 1U31A 2BJWA 3I61A 1OXMA 1BOOA 2ZRPA 2V6IA 5C35A 2DQSA 1UJ5A 2YDYA 1ODLA 4GMHA 3MIZA 4HNAA 3PQFA 5GMOA 2CEAA 3HGQA 5LU9A 1E1DA 3GWZA 2O50A 1DHTA 4YCJA 4JP1A 1ONPA 2Y0CA 4X3CA 3T7IA 2CZQA 3ELYA 1O4VA 2JLXA 3KT8A 5JDCC 4DKJA 4Q4CA 4D81A 3RS5A 3QM1A 1D8TA 1AURA 4RVSA 4ZKEA 2GAJA 3RG8A 3NIBA 2Z57A 3OOYA 3TM4A 5FWXB 1M1YE 3LF2A 2PRYA 3BMCB 1Z5NA 2PK3A 2HQBA 1C9MA 3P2EA 4LV6A 1X80A 2VDMB 4PV7A 1KL7A 5DW3A 3VGPA 3WOHA 4CT5A 1CP3A 1O5OA 1D1SA 1OU4A 2YW2A 1I0IA 2HBYA 4XTCS 4LDQA 4O08A 2Q28A 1UBEA 4JC8A 1IG0A 3GRAA 5ILGA 1G6KA 4YYZA 3S5JA 3X44A 1HURA 1UKBA 1YGPA 3LX4A 3SOZA 2VTVA 3VR5H 2CVHA 5ESXA 2JGJA 4ZRDA 5FPTA 3WFJA 1JLHA 5GVSA 2E85A 3O83A 2X8JB 4KWCA 3WYAA 4G5HA 2JJ1A 2DFDA 3LL7A 3VPCA 5CU7A 4BMZA 1O6BA 3K8ZA 4WH0A 2IYAA 2P35A 5J2TB 3B7PA 4M9ZA 3BAZA 3QG5A 1AKYA 1OOEA 3DTVD 3AW8A 5E3JA 3T3GA 4F96A 5F23A 3RK1A 5GV7A 4NMWA 2N46A 2XZTA 1WZEA 2VP9A 1Z3IX 2P3QA 3HKCB 3OM9A 3PXBA 4IKOA 4PIPA 3LI2A 5J2TF 5JSZB 1UQRA 4Q9HA 2P1ZA 1T1JA 4FFNA 4HYYA 1QV6A 1U0JA 4GI1A 1W76A 1VG8A 4P7BA 4I1UA 4W9MC 4E33A 4IIFA 3E58A 3AVYA 4P08A 3EQ2A 3K2EA 4RETA 2GXUA 3NC4A 3W5AA 4LV5B 5A62A 2P7HA 3G9ZA 1W4LA 4QFCA 4QM6A 1BD4A 2ZS8A 5G40A 3VVMA 3ILXA 1ZITA 3Q2KA 5E6SB 3ZE6A 2VPYA 2VF8A 1JHMA 1S1CA 4PO9A 4D41A 3G7SA 4CIYA 3L01A 2XNSA 3E7WA 4IQ8A 3SBEA 3MLBA 2EF0A 4GYWA 1U0HC 2IPMA 2JZCA 4NH0A 3TQRA 3T54A 4H6XA 1DTWB 2D0OB 1GZ7A 4I4TF 1UPBA 1D4ZA 2K87A 2ONCA 3NQ41 3ZE9A 2D5IA 4ETNA 2F3TA 5C8XA 3TS1A 4EBBA 2CFSA 4C0HA 3A10A 3BN3A 4MLDA 2VRBA 3LC2O 3B53X 3LIPA 1IYZA 2DHQA 3HCPA 4PBTA 5EKSA 1Q91A 4E2YA 2OCAA 2X2PA 3OLCX 4EYOA 3E9NA 3E9YA 3I9V6 1IBMB 4CKWB 4OVKA 1TM4E 2L42A 1DEKA 5J58A 2FQWA 1R4MB 3F47A 4Z7NB 3BL5A 2YCLA 4LY3A 1WY7A 1YJQA 3IJEB 3HO6A 3UV6A 3WV4A 3X1MA 3T5CA 3ESYA 4UFNA 3WNQA 3ZGOA 1ANKA 2VJQA 2W2KA 4IO1A 4LGMA 3NHBA 3VR0A 4B5LA 4C78A 1O96A 3OG9A 4R71A 4G0VA 2J9GA 1GA1A 3RKSA 2CGEA 3WLLA 4N7MA 5K8VA 4MV9A 3GEBA 3QENA 3LY9A 2GK7A 3GZNB 3B3GA 1ZISA 1XTUA 2AOWA 1GPYA 1SQGA 2ZRKA 1PFQA 4F3CA 4OXRA 5G4KB 1F8XA 1FY2A 3AHCA 3ISJA 1TW3A 3JYHA 2H59A 1SCDA 2J4DA 1CY1A 3FI9A 4R68A 5HR5A 1PL6A 4N4AA 4EUNA 3OOEA 2EQ5A 4L9SA 1Q16A 2X23A 4DZTA 1F3OA 1R9NA 2CDCA 7YASA 2QM8A 4U5XA 2NZYA 4C5AA 1IOWA 1HSOA 1NJ6A 4NY1A 2O2XA 3C7TA 4UBNA 2R3SA 3AUXA 4AJLA 4GUDA 1AKUA 2B0JA 2FG6C 4D46A 2FPLA 2O1SA 3TECE 2IBMA 1UKAA 3OCVA 2NTVA 3K2BA 2JGKA 3WYNA 1ODJA 2FZVA 4D8YA 5IHXA 4L5CA 3ZV4A 1BEZA 1IN5A 1HLPA 3FBGA 3HDQA 3PRHA 5HE9A 2ZUDA 3VU3A 3A70A 2CNKA 3PYMA 4MV1A 3LQRA 5K3BA 5KX5A 1FNSA 4MI9A 2QQ0A 3K0AA 4OP3A 1RXEA 2DTEA 2QVGA 2H08A 1SKUA 1ZCJA 1UWKA 4MYRA 4ZO7A 1ACMA 4R2JA 3OO0A 3ZTWA 4Q7KA 4J2HA 4YRLA 3RAGA 5DJ5A 2ISSD 4LYJA 5EHGA 2Q21A 1LJUA 1SHJA 5CYPA 1T25A 3IE1A 3UFXB 4QT4A 1UPTA 1Q0ZA 4AWAA 2QQEA 4BQSA 5I4KA 4URZR 4B1FA 3CLSD 4RM3A 3OJFA 4WXEA 2FG5A 1EUCA 3K1AA 2F55A 4EG7A 1KPGA 4OI4A 2Z3WA 2NU8A 3REQA 1VTKA 1TX4B 2NVWA 2GOYA 3SU8A 4G07A 5K0CA 1QOPB 2L17A 1BE0A 1ZDMA 2YWEA 3NBZC 2HLPA 5BY2A 1II8B 1RAIA 3GD5A 3SQLA 1VCIA 3L1VA 3IKTA 3L4KA 1SD1A 4LF8B 2XXAA 4QC2A 1JFVA 1XWWA 1T2AA 2QJFA 5JNTA 1BG6A 3CG0A 5D5HA 3IA2A 2EBWA 1UC8A 5JCJD 2XDQB 4CKCA 1T2UA 4NMXB 4DCOA 1ISRA 3VZPA 2M32A 3OKPA 3PNVA 2PZKA 5GM2A 3C87A 4HZGA 2O7SA 5LYYA 1IN6A 1GPUA 2F90A 2GDZA 2QRUA 1UBFA 2G1UA 5TF4A 4EF4A 1PZNA 3ASYA 2DSNA 2Z8YM 3EXHA 4OQ4A 1RSZA 1I4WA 1XR3A 1LTHR 1ZS9A 1H65A 1ZSVA 3OQJA 3OT4A 4GR9A 4KIJA 3AEZA 3AK4A 4NFYA 5ALWA 1OIVA 3JARB 8GPBA 4ZYVA 2G71A 2YJ6A 1THMA 3NM5A 3WTCA 1H3EA 3HVHA 3MCVA 1N0VC 3DPIA 4FYYA 5CM9C 4YASA 3HHEA 3Q3CA 3UKJA 4F6RA 4CQNA 4LJ9A 2Q4TA 2GM9A 2HWXA 3DL7A 3QOWA 3R5JA 4JWTA 3UZUA 4BO8A 4BP3A 1I7QB 1OBOA 3AZQA 1UK9A 2J3IA 2ZRGA 1FDUA 2XOXA 2A8YA 1HSZA 2JIZD 1W96A 3KTAB 3KP1A 4NBVA 4M2LA 3SN6A 3VMMA 1K6MA 1UWLA 2IIVA 4TXJA 4HUQB 5BSRA 3C3XA 1Z38A 4O0MA 3Q2OA 3WQHA 5KTTA 2NP6A 1JAYA 4LAFA 5LKRA 4URFA 3QRWA 1T4CB 1OAOA 1KMNA 4IIJF 3K9NA 4ER0A 2QYOA 3B9QA 5DEOA 4OA5A 1RYFA 3OESA 4I36A 3TNDA 3T3MB 4F38A 4IBOA 4DB4A 3RFFA 4L15A 3FCXA 5FUWA 4ZYZA 4DLUA 1LVUA 4P7KA 2C8JA 1P29A 5E2IA 1IU9A 1AS0A 5FOXA 2IWRA 3SIWA 3QJYA 1E2BA 3OJOA 1TJ4A 2Q07A 2VXBA 1ZWLA 3PKZA 5KYVA 4L3OA 2VHTA 3NHMA 3F98A 3DMDA 2BF4A 4GVXA 4DJTA 1F9AA 4AQ7A 3THOA 4O3FA 5LZ4A 3MB5A 3T7AA 1G3UA 3F1KA 5CB4A 3Q9SA 1PYDA 1N2HA 1OPXA 2FF5A 2IY9A 1C8KA 3BXPA 3NHKA 4MEBA 4MZDA 3KPWA 5JD6A 4TQAA 3PUVA 4UVHA 3W4IA 3U7RA 4B6GA 1O97D 5FRDA 5TVGA 4AY6A 4E22A 3O95A 3Q9NA 4CIXA 3E9CA 4DVJA 1Y3BE 4IUYA 1GP2A 3AONB 4YMLA 1Q0LA 2F64A 4Q12A 3TZLA 3ZUPA 4DIDA 3DMHA 1GAWA 1ZLYA 4CQJA 3E48A 3GJ4A 3K1TA 4L2IB 4LF9B 1DC6A 1ZNWA 3NAQA 1Y80A 2D5BA 1LPNA 2BGMA 3KWMA 3R0QA 1GG8A 2H63A 4BPBA 3FUVA 4P0TA 3IUMA 3R3WA 1HZJA 2IGBA 4HYTA 1WXXA 4N5NA 4LYEA 5IM4A 3URMA 2UYGA 5BOSA 1RPJA 1C4WA 4P4SA 1OH5A 4S1TA 4JI6B 5BN3A 4D43A 2B98A 3GJ3A 2YVLA 1M5RA 1IONA 1CDDA 1JA0A 4M0UA 1XTSA 5JAHA 4BNTA 4BY9E 1Z0UA 2GN9A 1PV2A 4V39A 4EPWA 3L18A 5KX5B 4C5BA 1K3UB 2JLCA 4IMIB 4FE3A 3ZGYA 3ZX4A 5KYTA 1ODKA 3Q3HA 4LDRA 3C3EA 1V95A 1QHIA 4HPXB 2I55A 4MW2A 2GHRA 5IMBA 3ZK7A 2JAQA 4YRIA 1A50B 2LPMA 3UJ7A 3WWPA 2GA8A 4N3CA 2AT1A 4PM4A 3N53A 3H86A 1LK5A 3RS2A 1K8QA 1ZKDA 5HDBB 3ZLJA 3GEEA 4FHCA 1DUVG 1T29A 5C18A 1C7EA 1VCHA 1XCOA 2W6PA 3FWNA 5GGXA 3AR7A 1CEYA 2UKDA 1AA6A 4CLOA 1G7TA 3GVHA 4CF4A 3C3WA 1FTNA 4XLZA 4G81A 2R7NA 4FN5A 3F8SA 2XX3A 4RA9A 4PX3A 3VPXA 1GXSA 4NATA 4RDIA 4E15A 1B6RA 2JHGA 2Y71A 3D54D 5F1YA 1JAZA 2PKRA 1X86B 2GS9A 2VAPA 1QDEA 2CUTA 3EOBI 4DUZB 1WAMA 1EWRA 2IEGA 3OCYA 3Q0IA 3N86A 4OBBA 1CR2A 4F5ZA 4CKCB 3WL7A 3BGOS 4B6FA 2I66A 4NC9A 3AY7A 3QKWA 5AM2A 2O57A 3BWVA 4EEZA 1L7MA 4EFLA 3DZCA 3JYNA 5DYWA 4CLEA 4ESVA 1PVDA 1E94E 3RTBA 1ZGHA 3WLTA 3TX2A 4FNGA 4R1PA 1QV9A 1E2JA 4UTOA 1Y5NA 4I55F 3SHVA 1DKUA 5B36A 1P4GA 2XD9A 2VP3A 3CH5A 1ZH8A 2IOQA 2W6ID 2SICE 3OFJA 2WUFA 3OEHD 4HGNA 1SKQA 2AI2A 1RVDA 4TMXA 1TF2A 4AN0A 2FSIA 2QM0A 4FXPA 1XI2A 4P3OA 3ZWKA 2O8BB 2PA3A 1TUGA 2YVUA 4KVGA 4GX2A 1BWPA 3OTOB 3DXXA 2G5CA 2BAGA 4PYMA 4EQ6A 4KYVA 3CZCA 3CNBA 3K1JA 3KZCA 4HB2A 4S0XA 5E4FA 4MGYR 3BXGA 4BJHB 3BMNB 1V8ZA 3NTVA 3FOZA 1ZJ4A 2OG1A 1APBA 3QUAA 1MR3F 2QGZA 7GPBA 1JWAB 3PNMA 5IC5A 4LCBA 4DNPA 1IY2A 1UPFA 2CDNA 2W2NA 4Q03A 2ENUA 4CFYA 2O8CB 2G5PA 5FUVA 3O38A 5T6BA 2YXPX 2ZLBA 4LA4A 5A5DA 4CL8A 3AJ9A 3BIXA 1LPSA 3JQ9C 3IVMA 5DHQA 4JOCA 1O0CA 1MMFB 2MSLA 4CTOA 1Q1AA 4HXEB 1PG5A 2J3KA 1MTOA 5FD8A 3O1LA 3VO2A 2AJCA 3PPIA 4MVJE 4W7HA 1FDVA 1OIXA 4HH1A 2Q3MA 5GAJA 4K5QA 1JMKC 3G0OA 3GUZA 2O07A 3EZ7A 1AQIA 3P2JA 2RG1A 3SSNA 1Z6PA 3PGVA 1Z73A 1FUEA 1RI1A 4LJ7A 4MB2A 3SQWA 4NLLA 2W6JD 4RTRA 1V39A 3UBMA 1GGNA 1GNQA 3L0OA 4QNRA 2PL5A 1INLA 2R8BA 1DO2A 4KFTA 5ER6A 3UJBA 4KH1A 5LP6B 1SXPA 3A0RB 1J6UA 1T2CA 4BX3A 4UASA 1OHHA 1RR6A 5TQVA 3OX2A 4H0FA 4FDAA 3WK6A 5JC1A 2HA7A 4BBJA 2UZAA 5HXAA 2CFCA 2KB0A 2FUG1 1BHJA 1OT5A 2BONA 2DY1A 1Q1BA 1U0BB 3MWEB 3QTLA 4NDNE 1E1MA 1OI2A 2CLCX 4MGZR 2DR2A 3PTAA 1ZYUA 4BV8A 1I1NA 4GLFA 1TADA 4CIWA 1ZM2A 5CA1B 2PO7A 2YWJA 1ZXLA 3JZDA 3PNKA 4FYKA 5EZQA 5G02A 5D85A 4DF3A 5K01A 5EEHA 3DTYA 1SHLA 2JRCA 4DQXA 1PHPA 2FWNA 4YV7A 1ESNA 3U0BA 4GOMD 3K15A 4Q01A 1P9OA 2HX1A 1FJGB 3C3DA 1EQUA 3ZKAA 2JFHA 2QW8A 3AKYA 4XRRA 6YASA 1P61B 1W7AA 1UZNA 2WKRA 3THWB 1DAIA 3ITKA 4RZ3A 3ZU3A 4GECA 3VHLB 1YQDA 3BREA 4G0NA 4W9RA 1KAHA 1LF5A 3PSHA 3LOQA 2H5IA 2BI4A 5LXTF 3SEFA 1U7DA 3ROMA 3OE1A 3VJMA 3KTFA 1GPDG 5AK3A 4LHZA 4B3FX 1WQ1R 2X40A 3EK2A 1SURA 2NZUG 4UMFA 3X1WA 1OBHA 1P45A 3OJCA 3OZVA 3RUFA 1EB8A 3AOEC 4JI7B 5AFSA 1H4SA 4OSPA 2VN8A 4RJIA 4X94A 2F1HA 4K9LA 4JUAA 2O54A 3C5CA 2I65A 2BKAA 3E3OA 3O8NA 4M8LA 1X1BA 1YVUA 1JDNA 2DTXA 1QO7A 2GXSA 5EWMA 1GO2A 1P62B 1V16A 3C1UA 2RGYA 2HO4A 1M2HA 4RK1A 2QL6A 2R8ZA 3IEXA 2ZZNA 1ZNQO 5C2JB 2XRFA 4U7TB 3KJGA 1N0WA 4Z54A 3OOJA 3S1AA 3DWIA 4YRSA 1H23A 3IAEA 3QHAA 4KSCA 1HZZA 4NOMA 1HX7A 2BF7A 3B2QA 5J2TA 3QOYA 3PHLA 1Q95A 5H70A 4BXOA 4WZBA 2F8MA 2OHVA 4YCCA 2JGAA 3M9LA 1R18A 5EJ8A 2PJRA 2QU8A 1PQ4A 5AUQA 1LDYA 1KE2A 3OSZA 1TXGA 3OZGA 3FUXA 2HYDA 3KQYA 5AKJA 1ZJWA 3H75A 4FKBA 1ZBDA 2V45A 4FNAA 2IT1A 1H6DA 1KI3A 2RHMA 1GGMA 4JJ8A 5DYNA 4YMTA 3KQUA 2DC1A 1HG1A 3R6LA 4ZZ1A 4FEYA 2VPPA 1WMDA 5B58C 4XIFA 4CEJB 4MULA 3NOQA 1GQRA 1CUSA 1J06A 3KJFA 1ZRNA 4HEJA 4KQCA 4M6WB 1QH1A 1SZJG 3C97A 3EDQA 2Q2NA 3FPEA 3K09A 1JJ7A 4X5OA 4RVHA 4G1CA 4AX8A 4CEJA 1CYDA 2B1RA 2JEZA 1KAGA 2HQSA 3LCJA 1AUQA 3NDPA 2FP4A 3L4EA 5ES3A 4BBZA 4F9FA 3FTPA 1JQBA 2QYTA 1KQ3A 2C61A 4Y30A 2WAOA 3L7OA 2IOFA 2JDIA 1QX3A 3U7FB 3BS4A 1WCXA 3V1YA 3FE2A 4S1PA 3GP3A 4BOYA 5J1SB 1TC2A 2WIDA 1PTJA 1QTNA 3C7DB 3E3MA 4XYLA 1VHDA 4ZJZA 4IIVA 4ZCIA 3L92A 1C14A 3L0IB 4Q66C 3H13A 1LJ8A 4FW8A 4X62B 1OLXA 3K53A 1U7HA 5ANRB 5IBRA 4E2WA 4RTPA 1CG6A 1G17A 5CXXA 1V9SA 3CKYA 1PHRA 1NV8A 2KI5A 2VLIA 2HLNA 2IUFA 3K4PA 4ZALA 3QGMA 2HPAA 1HWYA 4INJA 3FDZB 3PXEA 2P8JA 1DWQA 2CC2A 4IIUA 2IRWA 4O4JF 4CF5A 5CFZA 3OJ0A 5J2UF 1G9XA 3C48A 1KC1A 1KIFA 1F4PA 1M6YA 4Y2JA 3TZ6A 4B9EA 4QQNA 4C43A 1ISMA 2NADA 3C6MA 3HNRA 2O2DA 5GONF 1XYYA 4TM7A 5TQ2A 1OXUA 5K4GA 3H87A 1GKIA 2JJ8A 4LY6A 4PBRA 2Y0EA 2X19A 3SJ7A 3BZBA 3TB4A 2OQIA 3DLCA 1PT8A 4MPDA 4DBZA 1JWBB 1I2ZA 2AF4C 3VSDA 2XGMA 3GO4A 5FNVF 4K8RB 2FPGB 5LDDC 4D4HA 2OO3A 1ZUNA 1R0XA 2PWBA 1Z39A 4ZPJA 5A05A 5BQ3A 2BFBA 3QYAA 1S6YA 2XXAB 3IEVA 2GK4A 4WECA 3RKRA 1E6UA 2Q8QA 5FOTA 2X8JA 3LPMA 4AM8A 1ICEA 4RE5A 1KO4A 1ZINA 4MGHA 4JC4A 4YGYA 3V2GA 3ITEA 2BSAA 4TTTS 2QN9A 4ILEA 3EVFA 3GV0A 1YR8A 1YQGA 3UK0A 1NE7A 3ZJYA 3X0DA 1W5TA 5BV0A 4PZAA 2JLWA 3FSEA 4PZUA 4RA6B 4KXXA 3CWQA 1XF1A 1JR6A 5K8JB 2X42A 1C1XA 3TZKA 2IPLA 1N2IA 3GFVA 3LSTA 1WVGA 4H7FA 5AJXA 3AFMA 4BGIA 3D1JA 3I4CA 5HHTA 4NE7A 1KI7A 3AJRA 2JFNA 1EDEA 1PLJA 2JD1A 1QDLB 4KK3A 3GCGA 4RXUA 4UMDA 4MW6A 4ZQHA 2APJA 2QAGC 4ZT3A 4MOWA 4JELA 2H18A 2WJ6A 1A8PA 1Q0QA 4NJEB 5TX7A 4RMHA 2PGDA 5DOVA 3WA6A 1S7CA 1TFUA 4XWWA 1QTQA 5UKDA 1SULA 4MKZA 1MHTA 3CTMA 3OT1B 4COKA 1GQSA 2JCGA 1LSOA 1NVXQ 1VL6A 3L77A 2C83A 2CLIB 2HU2A 1EWTA 2QMUA 5IC6A 2R4TA 4WLVA 5F51A 5I8WA 5AI9A 4QFDA 1DV1A 3WLEA 3I53A 2J3MA 3SMQA 3IEKA 1ZKMA 2W43A 2OYCA 4O2BB 1CUVA 1XQ9A 5HDQA 3NASA 4N3BA 4QBKA 3ML1A 2A6PA 3O31A 3OZDA 5JMTA 3QFHA 4MV3A 2JKVA 2WFLB 4NZMA 2Q6LA 3NX4A 4B3CA 4ER5A 3LFHA 4FSHA 1H4TA 1KHTA 1XCLA 2DM6A 2QN2A 3BHNA 3VX4A 1X1DA 2C3MA 5CCXA 3K30A 4DNOA 2NYRA 1ZESA 5FHRA 2UYHA 3M5DA 4G36A 3NEAA 4BJ5A 1S2GA 2VHUA 3E9DA 2W2LD 1ZLXA 4KP7A 1CRWG 3DW3X 1XLVA 1HTBA 4BWGA 4UJ3A 4D2IA 3GZNA 4JENA 3RIGA 1N9KA 2OV1A 3HJHA 4KR3A 4G1BA 1WUHS 4MTCA 5HW0A 3QV2A 1DTEA 2W2PA 3PWZA 1HLGA 2OKCA 2G76A 1AHIA 1R6TA 4PGFA 2IDMA 3UQZA 4CMKA 2R8RA 1KP9A 5HRCA 3R5TA 2MSNA 3HEMA 3IJ5A 5KTMA 2EKDA 3H0CA 3IPYA 3SKVA 1OFIA 2Q9UA 4KQJA 4D3XA 1KO8A 4DZRA 4EKYA 4X6LA 4EABA 4ZMBA 4P3PA 5IT5A 3R5HA 2D6FA 3R5FA 2R6JA 3PQ2A 5KJ6A 2I6SA 3NGXA 4KVAA 4MB0A 2UVDA 3B12A 3PGJA 3RHTA 1CR6A 1DE0A 2EBUA 4Z4QA 2QLFA 1A0OA 5B3AA 4D5EA 3BH7A 1TEZA 2WTUA 3KSBC 2WIFA 1MT0A 2VT7A 2HHHB 2ZR0A 3OZ7A 2ZT6A 2XT6A 1Z7EA 2WZBA 2BJVA 3V8MA 3WB2A 2J59A 3ABIA 1D7OA 4MS4B 1X8XA 3LQKA 3I9LA 2BFWA 1UKVY 3AFNA 1T9DA 1NC3A 2Y66A 3W2TA 2OCBA 4NFLA 1E5DA 4HF7A 5EA2A 4CM6A 4HH3C 1RPZA 2DBQA 1H85A 4NOLA 1IVNA 4H6PA 2KM1A 4FC7A 4E30A 3BC1A 3QE0A 4Z1MD 2X5JO 5G41A 5JH7B 2FW9A 3GLGA 2JBHA 2YHUA 3ZD8A 2C1ZA 2O2JA 4ZO9A 5JCOA 3ZCPA 1NLYA 4WDQA 4W63A 2RGGA 4ED9A 1ZICA 3AF2A 3LPNA 1XZJA 4J7AA 3VKUA 1DG3A 1MZPA 2ZYTX 3IVRA 2R47A 3EIQA 3NBAA 2O59A 2D5LA 4OV6B 1JHYA 1V8OA 3P2OA 4ARAA 3W9SA 3G2HA 4AG5A 3FROA 2VHEA 2OZLA 3MB8A 1IOZA 3ECAA 4KO2S 2Q8PA 2GYWA 2X0EA 2EKPA 3GN2A 1V9LA 1T8SA 2PANA 1NBIA 4H3SA 4RPIA 4DA8A 1B0UA 3OCZA 1C9KA 4EJ6A 4J4HA 4CT0A 1HDIA 1XQXA 4MWBA 5JAQA 3O21A 3F7MA 1QFSA 3IPLA 5J40A 2WJWA 2PN1A 2EGHA 5DI3B 1PK7A 2VIIA 4QREA 3L49A 2C2BA 1WB9A 1HNZB 3C41J 4MDFA 3WG9A 1S96A 3FOAA 3H5IA 2O06A 3IBSA 1XJCA 3IHLA 4PICA 5F2OA 1SVMA 2ZG6A 3GEMA 4O1MA 4QRHA 1CE8A 1KSHA 2RBEA 5TMBA 4E6EA 1RM3A 2ZTVA 4UEWA 1B3BA 1KZ9A 4YQFA 1TZJA 1FRNA 2V9ZA 4B4VA 5TEVA 4D8UA 2CSXA 3HJFA 3OLYA 1X8LA 2ECOA 3RJ9A 4QOHA 5WRFA 2BGRA 1W85A 3GLGB 2HREA 3QH4A 4ZV9A 4P4NA 3R9KA 5CFPA 3DO5A 3OX4A 1VRWA 4X92A 2B2NA 4TT3A 3M6VA 1REQA 4A91A 4YWHA 2FEAA 4K28A 2VUHB 2X3FA 3G02A 3WO1A 4PYJA 5LMUB 3SR4A 3O8QB 3TZHA 3U44A 4GS5A 1EWYA 1NX6A 5JC8A 1MEJA 3P32A 3T0FA 1KEEB 4CNBA 5HKKD 5C8YF 4WJZA 3O8QA 1G5RA 3MOSA 3E23A 2SCUA 3DV2A 1P1FA 3IKLA 4GLOA 4RF3A 4ENWA 1EK2A 1EB9A 3PPWA 1Y4ZA 4OSOA 4BV3A 1Q5PA 2W6NA 5AESA 1NC1A 1ZD1A 2D0PB 4JHXA 5IJWA 1L5QA 4UUMA 5BQOA 4WHMA 3EX7C 1ORHA 2NYUA 4BGUA 1SZCA 2GD1O 3OD5A 1F5SA 1PFKA 3P7MA 1PGOA 4EHJA 3ZVMA 5G0UA 1XXHE 3WHKA 3TPZA 1ZRHA 3A3PA 4PHTA 2VUTA 2BM1A 2YN0A 3GHYA 3KAPA 5FFNA 1HQCA 4KR7A 2YOFA 1ECJA 3WNVA 7ADHA 1GGHA 2QUKA 2YJZA 3H4IA 4M8IA 1P9NA 2QX9A 2ZQZA 3C3AA 4H3KB 4QUJA 1NAIA 4QWWA 4P4GA 5KAMA 3SKYA 4GM1A 1P1CA 5JS2A 3HP4A 3ZHZA 2CDBA 4U7DA 4D9CA 4FWIB 10MHA 1MRSA 1ATIA 1HKHA 4KGXA 3VO8A 1I10A 3ENZA 2P9YA 2FY8A 3U5ZB 1Z0FA 4Q3LA 1EE2A 1IDOA 4UVGA 5SICE 3ZBTA 1SHTX 3LDGA 4KO8A 4JDUA 4O8CA 4F2PA 1FMFA 1Y3CE 5JATA 2D5AA 2HIMA 5FI1B 4ZI2A 4U02A 1RAFA 1VM6A 1TI7A 1VMEA 2P6NA 1NVVQ 4BQRA 1RE1A 1WQ4A 2W48A 1FYFA 1RI3A 5E4YA 1XJ0A 1ZI9A 3KL4A 1EFDN 5DK6A 2GAAA 5ALMA 1DWOA 4HQFA 3KJEA 1WZCA 2ZT7A 4KXFB 3H1TA 1L5GB 2GBCA 3MCWA 4F8YA 2ZCJA 1DDOA 4BRZA 3I76A 2BD0A 4LDZA 2V7BA 1K97A 2PT5A 1FF9A 3GQVA 3LYHA 3ETCA 3UJ9A 2GCIA 1V2HE 2AG6A 2NSDA 3GB9A 2XUIA 4Z9FA 4WA7A 1PNQA 5C7OO 4UULA 2IHJA 2VP2A 4CM9D 4U2GA 1FW8A 2D2VA 2DUNA 3OZWA 3W4JA 2I7CA 1XG5A 1J8MF 3FM9A 4EMBA 4IP0A 5I4CA 4BHTA 3HVKA 4XB1A 4JR1A 4B6JA 3LK7A 3IALA 4ZT5A 4R1OA 4ESOA 4YPVA 1H4QA 1R10A 5BPHA 4CIBA 3SE7A 4E4YA 4E70A 1W36D 2P0EA 1PL7A 1WY5A 1WD7A 3RC1A 4OFWA 3A3YA 2PGOA 4NCAA 4OCZA 4HB0A 1TDJA 4Y2UA 2EQAA 4PRZA 3A6KA 5ALYA 4DLPA 2ACEA 3JYQA 3QEBZ 3T1TA 4L4UA 1N2EA 1E64A 4EHHA 1M66A 2FXVA 4ZC1A 1J0DA 4AU1A 1FVXA 1V48A 1ZH6A 5C5EA 1EIZA 3MVEA 2ROQA 2Y9MB 1GNSA 1IWOA 3PDIA 2RDMA 2ZRIA 4RF4A 4PO1A 5HZKA 4WY8A 2R6FA 1SO8A 1FS6A 4J1TA 1CY6A 5IH3A 2NV0A 4QWMA 4DSZA 4QDKA 2PEYA 1W44A 2GCGA 3KEFA 1CX9B 4L8GA 1LQ2A 3OEWA 2PBFA 3N74A 5CB4F 1V3VA 4ZDWA 4RL6A 2OK7A 5I5EA 2JZOA 2NV2B 4ND6A 3L4BA 3ZV7A 1XMOB 1N8KA 2VSOA 3MHPA 1LQTA 1TPZA 2GO7A 4P5DA 1STOA 3EDYA 4L8WB 1KR5A 4AQDA 3DEFA 1AF4A 4YAIA 1QHFA 4MV6A 2FDCA 1LVHA 3VR6A 3AU9A 3A9VA 3FNRA 4R05A 1G4AE 1GZUA 1THTA 5CH3A 1U2ZA 4FTWA 3D4OA 1KS9A 2BEUA 5EFZA 4ACAA 1VKNA 5L8VA 3HJAA 2OFXA 5CW1A 1KP2A 5HM6A 2RHWA 2I62A 1K88A 2PX6A 2G9RA 4H31A 2VTBB 5EWJA 4PQEA 3CU5A 3A32A 4FOSA 1XBTA 4ZU1X 3FSJX 4EMUA 3VYTB 4KXMA 3TG8A 4S35A 1UF9A 3JAKA 2KBEA 3TFOA 2Y1KA 1ONSA 2C2OA 2RH8A 3ND6A 1T5IA 4JA0A 1QTIA 2QR3A 4U9HS 1N5DA 1ZOLA 1IMJA 1HFJA 1ZA1A 2DKNA 5TGTA 3S0JA 4AJ4A 2Z09A 1ZNXA 4INAA 4KYIB 4RD0A 3FYSA 3O93A 4W5JA 3LOPA 4YDQA 4PLTA 5T4HA 2VA8A 3HYRA 4XR9A 1EUDB 4QXOA 4WXHA 1RKQA 2JGRA 4RHXA 3RYFA 3WHIA 4BQIA 2CLOB 2QY6A 3MERA 1JFRA 2FJPA 3ZBPA 2X1MA 2BFEB 4FFPA 3VC2A 4B75A 1X70A 1E59A 3JZFA 3W2GA 4FGSA 3OT1A 1KYYA 2E0IA 1GZ4A 2WYIA 2X77A 3M9XA 4O1IA 3SCZA 3CIFA 4DNXA 1Y8ZA 3IBCA 3MZ0A 4I8IA 4C76A 3COZA 3UCXA 1Q57A 2Z8ZA 3P2YA 2VHVA 2C78A 2V3WA 3CSSA 2O3TA 4ZP1A 5AKLA 2IHTA 3MTJA 5LLTA 3SFVA 4ZVQA 3LXUX 4G89A 4NE9A 3JD2A 4OOFA 1Q1QA 2Z9CA 1E0KA 1UMDA 3C8MA 1VE5A 1XX6A 4FMDF 5FH9A 1EP9A 1TJNA 1WM1A 4ZVVA 1F2UA 2WA1A 3BMCA 1QIIA 1X3SA 3EBOA 3IMFA 3J80A 1JKIA 2OXRA 4GQAA 1I7PA 4KPUB 3FKSD 3FKSA 1KQOA 3S2UA 2WP8J 3F3SA 3BERA 4G63A 3UG7A 3WGHA 4NBSA 5CIWA 4JLUA 4AJ2A 3H5NA 1KDZA 1Z5OA 5LB2A 4DVGA 4I3HA 3SQDA 3WL3A 4URWR 2GFQA 1E9BA 4YJGA 3S3TA 3LLCA 3MUEA 3LJKA 2W4MA 2X2FA 4XVCA 2FZKA 1TJ5A 5DLEA 4OPMA 1J4AA 4JOBA 3H1PA 2BFBB 1XLWA 3DAYA 3JQBA 1PEDA 2GPBA 4FKMA 4O4IB 1H0SA 1UEJA 5DGXA 2OBYA 4HDMB 3UHFA 3L3BA 5FORA 1L3CA 4EG1A 2QRHA 4QQRA 4XW2A 4NDZA 3RJ5A 3IQWA 2IYFA 3EDMA 5DYIA 1I3KA 2HLDD 3I04A 2EU8A 2IHKA 4J7UA 3FJ1A 4Y1FA 2I78A 2Z5FA 4B43A 3AQ4A 1JAHA 1SBQA 1EHYA 4GI5A 2H29A 3NYRA 2RG7A 1U2DA 3N07A 1U6IA 3VZDA 1KYWA 2R25B 3FFBA 2I4MA 2WTAA 4RD3A 5AKIA 4XDHA 4R8MA 4RZHA 1M2VB 2GN8A 2QMEA 5DT9A 4BO2A 3U4QA 3N7AA 5FBVB 2ADMA 2JIRA 4X8LA 2OM2A 1Y9ZA 1T3HA 1X7GA 1FZTA 4OM8A 1U1GA 1WU7A 1FQKA 3MTEA 1HNNA 3KOMA 4PXYA 1SCJA 4ZQCB 1BYIA 3BE8A 2IQIA 1IQUA 4PLZA 2V4ZA 4IJ6A 4NG4A 5KNBH 2QAIA 2R87A 3BORA 4FDLA 1ZH2A 2RHCA 1RPNA 2WWRA 2F8SA 2NAFA 3O8CA 1RM4A 1QP7A 2NV6A 3NEYA 1NVEA 4CG1A 4IIDA 2ZDHA 1NQUA 1QIJA 1DRWA 3ZEIA 1NF9A 1V9CA 3GFBA 4MHTA 1G8GA 4Z4GA 1R74A 5FBQB 3BTOA 1BS9A 1UQUA 2KE5A 3UOAB 1ZMTA 3JQFC 2NVUB 3EOZA 3R0IA 4FS3A 2II6A 3UJDA 3ERCA 4B35A 5JNWA 2R44A 1QQ7A 4KWEA 1K6IA 4IFEA 3WXMA 1COWA 1L7DA 2AE2A 4CKEB 1KBOA 2G0AA 3FPBA 3STUA 4LYGA 4JITA 3DG9A 4MITA 4O4LA 1J8FA 1IZ7A 2X2EA 1UT8A 5FX2A 2Z98A 4CLXA 1NUUA 5DU2A 3DB1A 4DEVA 3TX6A 3EASA 3MS2A 2OHOA 1KYVA 3K16A 4A6DA 2IP2A 1YS7A 2GBPA 3PQ4A 4YMHA 4PAMA 4KAFA 4G6ZA 4QQFA 1JAIA 1ZZEA 2A7XA 2UVPB 4R7ZA 3R6TA 5ALSA 3T7EA 1C9DB 3I5UA 2CVFA 2GASA 4Q34A 1QBKC 3RVDA 4AKIA 4L6AA 1CNMA 2DRIA 5D1NA 4O2LA 3FTQA 5KYXA 4CKWA 5KC8A 2Q3HA 5JH7A 3QA9A 2XQIA 5FV4A 2AVDA 3IMEA 3NJ4A 1YZUA 5FR2A 1TL7C 3D2AA 5HSGA 4UPVA 3DCNA 1QHHB 3PNOA 3OM1A 4OHWA 5TMPA 2CBGA 3RWBA 1L0BA 1PFUA 4AVYA 2PR7A 5KYYB 1JI0A 1QC5B 9LDBA 2GXAA 2NPIA 2FZWA 2CVOA 4IS3A 3T3PB 4IY1A 4KDCA 2DR0A 3VV2A 1DKOA 2O3QA 4Z6KA 1WG8A 2YFKA 5AW5A 3WB1A 2QPOA 4EHDA 4B84A 2WFZA 5IF9A 3O9ZA 4DJAA 3LYLA 4BTEA 2YWFA 2HDOA 4GBJA 3RT9A 4O63O 1XZMA 1TLFA 1LUAA 2B35A 2IXGA 2VWQA 3F2VA 3I8XA 3JVIA 3MILA 3N2NA 5F77A 5H3LA 3TTTA 1ILEA 2O20A 2VT6A 2YWCA 5T3UA 4L75A 4TKUB 2G8LA 3FVVA 4FXOA 4B8YA 2OGZA 2QIPA 3BFXA 3IP1A 4TL7A 3Q0EA 1E1YA 5AKGA 2FUG6 3LRTA 3SR3A 4FYXA 1Z22A 2XT9A 3H2SA 1LV7A 2H1SA 3ETNA 5I5GA 4F4HA 1CUUA 5BQPA 3S2GA 2ZRFA 3FF1A 1EFUA 3EIHA 4ALKA 4ARBA 3ZC3A 3QFTA 4LF5B 1O6FA 1JMYA 3FZGA 4IM7A 1GUBA 2DHDA 2JI7A 4IEIA 2HMTA 3MWJA 3SEZA 1Y8CA 2WJGA 4FDUA 2C1EA 4FHDA 3AEXA 1WV0A 1ZOSA 4JQSA 4A8HA 5AVJA 5J4HA 4TVSA 1E58A 1M75A 5C7LO 4E94A 1VLVA 3DYVA 2GBIA 4HH4A 4AYTA 5TJ9A 1OWMA 2ZWMA 3EPJA 2EERA 3B3FA 1Z56C 5EIOA 2VEOA 3E7FA 3MT9A 5LJIA 1K86A 1NW7A 1PV1A 3ZDXB 1TQ6A 3ZZUA 4DBLE 1ODCA 3QXGA 3A14A 4YRRA 2HR1A 3WLHA 2ZI3A 1LI7A 5BW5A 4GDMA 2BGIA 1VLQA 1XD2B 2WSLA 3BRQA 3JD3A 1HYHA 3L9XA 3OQBA 1KYXA 3EIUA 1TQHA 4MQUA 2SCUB 5LR6A 1LNSA 4MV8A 5FTNA 2CYCA 1ORTA 4QL3A 3MXOA 5NULA 2HB6A 1Q11A 2XMDA 1MZVA 5TNXA 3NBKA 1JL3A 1RAHA 1Y5IA 3NJRA 4EA7A 2HTFA 3BIJA 3VR6H 4BP9A 3U6KA 1Q77A 3A37A 2BHSA 2VH5R 2JBAB 3DFZA 2P8SA 2PZEA 1YRAA 1E8DA 1N3LA 2C4TA 3AKEA 1DUIA 2XTMA 1HDXA 4XFKA 5CVDA 3GLGE 4B31A 3U39A 1VE7A 4I3GA 1XTKA 1HFEL 4BFTA 4CMJA 4BU0A 1JHOA 3A6HA 4Y67A 1GLGA 3V4PB 2MOKA 2TRSB 3CZ5A 3IUQA 4F4CA 5JRDS 4QNMA 1R5BA 1IY1A 4W9NA 2O8CA 4NESA 3FUWA 4FGZA 4DEYA 2YOHA 4XEHA 1E7WA 2K7FA 2R9VA 2P91A 3GH3A 3ZGXA 4D99A 3EFOA 3KKPA 4J0KA 4WGFA 3TFWA 1JH9A 2IJGX 6ADHA 2ZJYA 1V5IA 1UODA 2ZBDA 1DELA 1FVFA 4C04A 3CRW1 1N5MA 1EI9A 1XDDA 2Q2QA 5H16A 4BKPA 2AI3A 2CHFA 4F93B 2GMWA 4UM7A 4RA6A 4XD7A 4PYRA 4RVCA 3PC6A 1IM2A 3C8DA 2Q0XA 1XXHB 5CT8A 3TZEA 1J25A 1Q92A 4R2XA 2BOVA 4GR4A 5DTRA 5DB4A 3DM9B 2LE0A 2OWEA 3QFFA 3H2HA 3CLUC 2FVYA 1JEJA 1ZI8A 4BFLA 4ZKDA 5BMOA 4LX0A 3HBMA 2ZUCA 1GSHA 1PFVA 1WQ3A 3B1VA 4P32A 5FP0A 4WN3A 1XA0A 4OH7A 1ND5A 1WZNA 1T2FA 3RWMB 3U40A 3ENVA 3HA5A 1N5KA 1S2NA 1SG9A 1ZIDA 3KR1A 4B3XA 5BRJA 3FXAA 5ITVA 1EX1A 3DFMA 3GVPA 4LDJA 4QYTA 2JAXA 4DHEA 3O4IA 1LW6E 4J75A 5A04A 4GM4A 2K5UA 2ZE6A 4JXZA 1R88A 2PV0A 3C6QA 4PC6A 3R5SA 3HN2A 1L4UA 2IPXA 4UXIA 3RUEA 1YOBA 5EUBA 2HJ9A 1M6EX 1DPGA 4J0HA 3FPGA 4KI0A 1TO2E 3OOHA 4KTTE 4S1OA 1SRRA 5JE8A 3UA4A 4PQRA 4R51A 5DXFA 1N75A 4OUKX 5M29A 2PFKA 2Q3DA 3EWAA 4CCYB 2GQ0A 3EXEB 3IR5A 2OFPA 4HN9A 3JXEA 2OP0A 5M04A 3NHSA 3V6MA 4B73A 3AVOA 1GUZA 1XU4A 4N54A 4U3JA 2RIRA 2FR8A 2DUMA 3TQIA 3CZ9A 1YHNA 3ZJTA 2O6HA 1KAEA 4DLLA 5E95A 1ULUA 4RD6A 2E5WA 2Y2VA 4U3JB 3VR4H 8ABPA 3AL0C 2Q6TA 4CCAA 1LQUA 4C29A 1MA3A 5COQA 1XZDA 1EFKA 3OFSA 4GD3Q 1TM1E 5HMLA 4HSEA 3KNZA 3Q6NA 1KQNA 4ENSA 4A82A 2J67A 4HG2A 5DTQA 4E09A 4K03A 1ODIA 2IW1A 2XODA 3QMWA 3AFHA 2W6QA 4Y6SA 1YONA 3MYRA 5DNEA 4LYFA 3C6BA 2QV7A 2QVXX 4OL9A 5FULA 1NVVR 2JLZA 4GKBA 3LBIA 3RVOA 1G2IA 3CRVA 3GPBA 1YI1A 4IZOA 3OAAD 2Q4BA 3ANXA 3KVNA 1Z8HA 3G9TA 3KWJA 3V1MA 1ZCAA 3IKJA 5JXIA 3N8DA 1CERA 4ZOLB 1AOXA 1QZ3A 5ELLA 1P2VA 3G79A 2P9BA 2C4MA 3BH6A 5T64A 4DJJA 1M8KA 1AH2A 3KKOA 3M49A 2NT3A 2N9UA 2QRKA 1E1KA 4M9RA 1C4OA 3R7LA 1SU8A 2VDOB 3PHIA 3ZY4A 1EFCA 1CNEA 4QELA 1H5UA 3O3CA 2HCBA 3ZI4A 4HGZA 2VS1A 1Y1PA 5ADUS 4AMBA 2RKOA 3T1QA 2IIBA 2D1FA 3ZE1B 1IQPA 4L95C 3FYUB 3KOZA 3ZCXA 2M9MA 1DOZA 1ZN2A 4W1SA 5F5NA 2OZPA 3WK5A 1EBBA 2XUJA