1NUQA

Crystal structure of human cytosolic nmn/namn adenylyltransferase complexed with naad
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
233
structure length
213
Chain Sequence
SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKSG76
publication title STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 213
sequence length 233
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2003-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nuqA00
1R6TA 4DNXA 2DEUA 1O0CA 1J70A 4Q93A 4QBTA 1Y42X 3X1MA 3MUEA 4UZEA 2WQ6A 5F23A 2QJTA 2A88A 1XNGA 1ILEA 1IFXA 1OBCA 1J09A 1KH3A 4U7JA 5DASA 1MB9A 3ILVA 1EUQA 2CSXA 1WXEA 3GMIA 1WZ2A 3K9WA 4MUFA 4MW5A 4MW1A 2CV0A 4JZYA 1N2HA 4Q16A 5HG0A 1MB2A 3DLAA 1A8HA 1EFPA 4NAUA 3SEZA 5FNZA 4KR6A 1JEEA 1BS2A 1HYBA 1N2IA 1NUSA 3IVGA 3KT8A 1O0BA 4ZCPA 3A2KA 2J08A 1K97A 3RK1A 4QRDA 2AG6A 4YP5A 4PY2A 1MJHA 3IMCA 4ZT7A 1J20A 1KP2A 3AFHA 1EUYA 1TYDE 1UFVA 5TEVA 1H3NA 2GOYA 1R6XA 2CV2A 1N1DA 2YXNA 5DB4A 2GM3A 2EL7A 1LW7A 2IELA 2V0CA 3CVVA 2CFOA 4MVWA 3PNVA 4JYZA 3IOEA 3L93A 4MW4A 3ZUGA 3VGJA 1OWNA 4L2IB 2OV4A 4J75A 1PFWA 3FIUA 3AG5A 4MVCA 2DERA 1O96A 3ZJTA 1O94D 2AZXA 1TYCA 3K32A 4ZT3A 2J5BA 4WNYA 1U3DA 1TQ8A 1O6BA 3H99A 1ZH6A 5K0SA 3UOWA 4KR9A 2QUIA 1QRSA 1WQ3A 2ZP1A 3IODA 4ARIA 1KH2A 1V47A 1N2GA 2E18A 3G59A 3TNJA 5HUJA 3ZIUA 1T9GR 2D5BA 2A1UB 4MAFA 2VTBA 2G36A 3ELBA 3IVCA 2WQ7A 1U0BB 3S3TA 2RD2A 4EF6A 3ND6A 1QQTA 1O5TA 2ZUEA 1COZA 1IQUA 1H3EA 2J07A 4DDHA 2CT8A 1QRTA 2A1TR 1G8FA 2PXHA 4RPIA 2DXIA 1VBNA 2DETA 4NAHA 5TGTA 1T9GS 2WB2A 3IH5A 2DLCX 3I05A 1EFVB 1NYLA 4MW9A 5HUHA 5DK4A 3CVYA 1N2BA 5KCMA 4ND6A 2CYCA 1ZH0A 1JIJA 2A1TS 1KAQA 4JFAA 1V8FA 5EKDA 4CT0A 4YP7A 5AHWA 1JIIA 3PRHA 3PNYA 4KPUB 4MUJA 4E1AA 1WXGA 3IUEA 3LE8A 4I6GA 1TEZA 4BWVA 2IJGX 1ZJWA 3HZRA 2QUKA 3D6VA 1MRZA 2J09A 1Q19A 4K0RA 4ZCQA 4NZPA 3M5WA 2A86A 3AG6A 3H05A 4TS1A 2AKEA 4JXZA 5J5AA 2QUJA 4PBRA 3H9CA 2CV1A 2C5SA 3AL0C 1KQNA 3UMVA 2D54A 2O8VA 3FNRA 4ND7A 1WXIA 2HMAA 1OBHA 3SZ3A 1I2DA 3Q12A 4MULA 1VL2A 1P7PA 1MOPA 2YWCA 1H3FA 1T6XA 2CYAA 1QTQA 1JGTA 4FZJA 4DLPA 4YP6A 1KORA 4H3SA 3CA8A 2E21A 2DUMA 1NSYA 4ZCTA 1EFPB 3Q10A 4MUIA 3G5AA 3ISJA 3CLSD 1O95D 1O94C 3A04A 3FY4A 1N77A 1N75A 3BL5A 2X1LA 4PBTA 5KHAA 4EG8A 3N05A 5J59A 2OQ2A 3KT0A 4EG1A 1WQ4A 4MUHA 1QU3A 1OWLA 1WXFA 4F4HA 1G59A 2XRYA 1WOYA 2X3FA 1LI5A 3IVXA 3L92A 3Q4GA 2A84A 4GU5A 4KR7A 2DPLA 4ZT6A 3N9IA 2IP1A 1IVSA 3SYTA 3CLUC 3INNA 1Q15A 1F9AA 3NV7A 4HJRA 3E27A 2DR2A 3HMQA 4DDMA 3DPIA 1PFYA 1NURA 4MUNA 1O96B 4ZCSA 4XSVA 2QJFA 1J1ZA 1FYDA 4I6EA 3RHSA 1GTRA 3QTTA 4MUGA 3G6KA 1MAUA 1U3CA 1YI8A 2X0KA 3UC5A 3SP1A 2O5RA 2E89A 4EG6A 1J21A 3FOCA 3FDXA 3CLUD 3IMEA 3UK2A 2YY5A 1M8KA 3KFLA 1D2RA 1KQOA 1K4KA 3ZXSA 4MWCA 3FETA 4WSOA 3QE4A 1IQRA 3NBAA 2VTBB 3IUBA 1YULA 1ZUNA 1NUUA 4ZT2A 3N2YA 1QJCA 4HPWA 4RUKA 2V0GA 2I1LA 4DE5A 1GTSA 3PXUA 3F3MA 3CVWA 5H7XA 3FWKA 1TYAE 4U8HA 4MW7A 4YBRA 2A7XA 2YWBA 3N8HA 4UZFA 4CDMA 1JMVA 1PFVA 4JXXA 3H9BA 1M1ZA 1VBMA 1I6KA 1GZUA 4ZCRA 4MVYA 3OTWA 2WSIA 3KT3A 3VU8A 1F4LA 1WY5A 1MAWA 3QTBA 2BTEA 4HJXA 4NATA 3MMXA 4MUEA 1OWOA 3HL4A 2H29A 5DEOA 2X1MA 4G5FA 1RQGA 1O97C 3CVUA 3OP1A 1PFUA 2B7LA 1N2EA 4R2LA 2GKSA 1M83A 3IMGA 3IOBA 4G6ZA 5FO0A 3CVXA 3IDFA 2BYTA 1F7VA 1MC1A 1X6VA 2NZ2A 3TQOA 4EFKA 2QTRA 2R5WA 4U63A 1N78A 3U1VA 3CLSC 3CLTD 1O95C 1XNHA 4AS1A 3NBKA 4MLPA 1NUPA 3DV2A 2PZAA 2Z3VA 2PZBA 4OUDA 3LOQA 4YMIA 3DO8A 3A4IA 3FG9A 3HV0A 1GAXA 1QRUA 3FI0A 1B6TA 1TYBE 1O97D 1M8PA 2ZUFA 3CLRD 4OJMX 1N2JA 3UY4A 3COVA 3MXTA 4EG5A 1T6YA 5JBNA 1IHOA 2QUHA 1X8XA 2Z09A 2H2AA 1Q11A 3HGMA 3RFFA 5J58A 3ZGZA 4G5YA 4AQ7A 3TZLA 3GUZA 1QNFA 4F3RA 1K4MA 1JECA 1OWPA 1KR2A 1IH8A 4P2BA 1KAMA 4ARCA 3RK0A 1KH1A 4R0NA 2PFSA 3MLBA 3IOCA 1NI5A 3GLVA 5TS2A 4EG7A 1G8HA 4MWBA 1N3LA 1U7XA 1XJQA 1H1TA 3P0JA 3X1KA 1PG2A 1VBKA 4CQNA 4NDAA 4X0EA 1U7DA 1YIDA 5H16A 2JANA 4MW2A 4EG4A 2A4MA 1F7UA 2EJCA 1KP3A 1YUNA 1K92A 4NX2A 4MVXA 1IQ0A 5IJXA 1R6UA 3COWA 3ZJUA 3A05A 4K03A 1NUTA 1Q77A 2E0IA 1NZJA 1FFYA 3C8ZA 1QU2A 4L2IA 4PBSA 1N2OA 4MW6A 4DJAA 1YIAA 3ZXIA 4QREA 1OWMA 2PZ8A 4ZT4A 3TS1A 1WJGA 1GLNA 1M8JA 4MWDA 3AKZA 4S1OA 1LI7A 3RJZA 4CDNA 3LCJA 1VLHA 1KQPA 4XFDA 4I6JA 3P52A 5IHXA 3SEQA 5LLTA 2QTNA 4XFJA 3P0HA 1ULHA 1DNPA 1EXDA 1JZQA 2Z08A 1J1UA 3HFJA 1OD6A 4GRIA 1I6MA 2PG3A 1JIKA 3VRHA 5LM3A 3CLTC 2JAXA 2A1UA 2HZ7A 1JZSA 1S4MA 4EGAA 3MLAA 1NUQA 1WXHA 1PG0A 3FH0A 3KT6A 4ZT5A 3TQIA 2JA2A 5FO1A 4A91A 5BNZA 1GPMA 4MUKA 3RBAA 1EJ2A 5TEWA 3CLRC 4MQ6A 3COYA 4MW0A 1JHDA 2D13A 4HK4A 1KKUA 2J4DA 2NSYA 3JXEA 2QJOA 1EFVA 1I6LA 3SZGA 1XNJA 4KKVA 1NP7A 3COZA 2QTMA 3H97A 4DDKA 5K0TA 2XRZA 1M8FA 2HGZA 1EE1A 2PIDA 1SURA 4J76A 1YUMA 1WKBA 4MWEA 2TS1A 3X1JA 3ZJVA 1MBZA 4OUDB 2CUZA 3AIIA 4KPUA 3SDBA 3FHJA 2CYBA 2RE8A 1TFUA 3PNBA 1JILA 4R2MA 1T6ZA 3TZEA 3ND5A 4EG3A 3CR8A 1M8GA 1CT9A 2VXOA 5KWVA 1GN8A 5LFAA 3D6UA 1G8GA 3P0IA 3ND7A 1JEDA 1IRXA
chains in the Genus database with same CATH superfamily
5MN6A 2ZQ5A 3CRMA 1JYEA 3ZLBA 1P1KA 3GL9A 8ATCA 1XVLA 1C0EA 1TLLA 4MCIA 4BWGA 3H87A 5LQMA 3O90A 3MJDA 2GR9A 4H1HA 4GC9A 1IFXA 4J1TC 1ISHA 4UCQA 5K3BA 3WO1A 3T1HB 4O4LF 1G7SA 3IV9A 4PCVA 5LB4A 4Q18A 1H0KA 3KCNA 4CI9A 4MUFA 1B15A 2JEOA 4UATA 3CWCA 1AZLA 3TLBA 1HX7A 4HCJA 4GICA 2H85A 4HB3A 4JZYA 4OHZA 5J4KA 1KK0A 3RU9A 2QLJA 5J2TB 4EKGA 2JLWA 5KYXB 3A3NA 1JTEA 1BQEA 3I9JA 1CEQA 2P9JA 4D9CA 4YRGA 1GCIA 3CUUA 1ULBA 2YZNA 4LYEA 2O8BA 3RJ9A 1TUGA 3U17A 3RVKA 4EZBA 3OM0A 2HOQA 4QU5A 4AY2A 1YZVA 2EKBA 4GXNA 4YMHA 1MQSA 1QE5A 2Q2NA 1OI7A 3LS2A 4FFBB 4KR0A 2EKQA 5ALNA 3UFXA 2I80A 2Z04A 5JVDF 1I1NA 1KXZA 4Y18A 4KLRA 1JI0A 3TB4A 1AQIA 3D2BA 2XZDA 4P93A 3WYDA 2B8TA 3AUAA 4B17A 2V0CA 5LN1A 3KETA 4LXYA 3E9EA 3TLXA 2G40A 2WTAA 3AOEC 5EA2A 2FV8A 2LWIA 3HN7A 3PWTA 2IKSA 4U6NA 4TKVA 3ILHA 5HZGA 2ZWPA 2DBYA 2RGCA 3I53A 1STOA 3IP6A 1P31A 1A4UA 1U8UA 1VE1A 3O7WA 2EV9A 1O94D 2IXTA 2PXAA 3OZAA 2IV3A 3JSAA 3QVLA 2PNJA 4QZVA 3R7SA 1K7CA 1V37A 2PUDA 2A6PA 3GNTA 3AJDA 3MNFA 3NJ4A 4HTAA 5EP1A 2Y0BA 3SXJA 4Z51A 2R96A 2F9FA 3L82B 3WGMA 2C3OA 2R8XA 3UM9A 4LK3A 1TQ8A 3HSKA 3QE3A 5JS1A 2OBLA 4GF5A 3SVZA 1YAHA 3AVYA 3ECCA 1LX7A 2C2HA 3AGPA 4W9RA 3GJYA 3HB1A 3QXHA 3VR2A 1TRKA 1QIJA 4EDFA 3CKMA 2ZRMA 2XUZA 3W1EA 1WQ3A 1KOFA 2GF2A 1W1WA 2IOHA 2ZETA 3DZGA 4IDBA 4QULA 4XA8A 4ZAFA 1IRIA 3RF6A 1KKLA 4GOND 4HDRB 2VSFA 1UQRA 1KY3A 3UJDA 5CM8B 1D07A 4ID3A 1UQTA 3B7PA 1W8DA 2PYZA 3GD5A 1QF7A 5BRNA 4B6SA 5FUMA 2PL5A 4MKXA 5A6SB 1IN4A 3PJFA 1T9GR 2QRKA 5IT4A 4UNNA 4XDYA 3H83A 3OI7A 4R1NA 3RHZA 4CETA 4K26A 1YA8A 3LX8A 3ACBA 4MS3A 2IXDA 2QM7A 4TWRA 1L5HB 1RXEA 2PS9A 4ZICA 4EY5A 4YRRA 3LG2A 1EGQA 3MWDB 4IIGA 2FX2A 1Z22A 3GOHA 1IQUA 1I5OA 3V1LA 4B32A 3VJLA 2K87A 3KEMA 4DLNA 2JGJA 1ZK4A 4DQKA 4Q21A 2CT8A 4B74A 1G8FA 5I51A 2ZT6A 1GFSA 3FOWA 2BTQA 1KO5A 1CVIA 3ONNA 4R2IA 2BM0A 2RIPA 2WMDA 1D9ZA 3ICVA 3P0RA 4FKMA 4WFIA 2IYTA 3W34A 1OLOA 4DIDA 4JJ7A 2BI4A 5EIAA 4ZRMA 2AN3A 4YREA 3W9YA 4D9FA 2P3SA 2NSLA 3EMDA 1YDMA 3A06A 3JTEA 5HS6A 2JIZA 1U28C 2UYGA 2XVAA 3OX1A 4WZ6A 5AVKA 3CG0A 4QE3A 1PD1A 1CW2B 3C14C 1P1BA 4FR5A 4GLJA 4HNTA 3DAPA 4URVR 5JCOC 3NXKA 4YB8A 3UWPA 2Y68A 1QCYA 1U3WA 2FWAA 1YS1X 3FTNA 1IL0A 4ACBA 3LE8A 1YR2A 2ADMA 5JZBA 5JCJD 1BFDA 5COQA 4I3FA 1SQGA 3DYIA 4E3WA 4N0EA 4DRXA 3QPCA 3QY0A 4QUJA 5DHPA 2C83A 1D0SA 2IYVA 4BQQA 3OUTA 3KPUA 2A86A 1XEWX 4BMXA 4PYKA 3PEUA 2RK4A 3WYEA 4PBRA 5I7UA 1N8SA 3KJXA 3R1IA 2CV1A 1SELA 1Z82A 3STUA 2V9PA 4TMTA 2XODA 2CNBA 2GB4A 3KHTA 5FH9A 1ZU5A 2J8ZA 2BMWA 2I6GA 3KU4A 2QUBA 3OECA 4HYTA 4M0LA 3RCBA 3RD5A 4MUBA 5FBHA 1C1XB 4IDCA 1VL2A 3A9VA 2Q2WA 3RIHA 4M9ZA 2ZIVB 4IVPA 3STXA 4ERXA 4JJFA 4OX9Y 2FVYA 4BB5A 1TVMA 4EFLA 3O38A 4OLFA 1ES9A 1NJ8A 4LC9A 3AI1A 1SUCA 2P3LA 4FD3A 1JR3D 2R6CA 4LJ8A 2GKGA 5FPPA 5KAMA 3TPZA 4NZYA 1NSYA 3KOWA 3ZNPA 4B9AA 1QF6A 3NYIA 2JFGA 1V5GA 1ZICA 2ZREA 3A4NA 3M33A 4JB0A 4PZLA 3CLSD 1T2CA 1IVNA 4E2FA 4ZYTA 3IE1A 3MTDA 1O94C 4MS4A 3IT1A 4A4DA 1H2HA 2GZHA 2I78A 3KTOA 3Q98A 2O20A 2JLCA 4YAIA 3IKVA 1YS4A 1FFDA 2WWHA 4RC9A 1IBRA 1ZI9A 2ZTLA 4G97A 2BCEA 4GR4A 4QWMA 4GOKA 1MC8A 3DDHA 1RZRA 4LF9B 1XZDA 3S99A 2G1UA 2J9FB 3NPMA 3ROTA 4CKEA 3LVRE 3C1OA 4UJ3A 2O4CA 3QVWA 1Q0QA 2C9DA 3WMFA 4MXDA 4FGKA 4RADA 4Z5XA 2JC3A 5EUQB 4CKWA 3GLHE 4QPDA 3N9IA 2JAHA 4R3NA 3CXUA 4BATA 4ERNA 3N6RA 3G2NA 1ZVMA 5EN4A 1W4CA 1V16A 1SQ5A 2ZR7A 2E5LB 4YYZA 4M87A 4QOFA 5A3VA 1EUCB 1AQNA 4ARVA 4L9RA 1QVRA 1NYRA 2X9GA 3EGOA 1AF4A 2Y99A 3H6KA 1DB3A 3L05A 3ONWA 4Y2SA 3M89A 3SFTA 5BR7A 4BNMA 4PZ0A 4FE7A 3R0ZA 5EZYB 4IJUA 4CLOA 2VP4A 2HDHA 3I23A 4LDZA 2WBLC 4TSRA 5C5CA 4GX5A 3EWSA 2PPLA 4O4HF 1RHRA 1OW3B 3G6KA 1H4SA 4FCTA 4WXEA 5EHXA 4AECA 4HWPA 2E4VA 4OYRA 1MA3A 2IE0A 2R4QA 2UVQA 2A14A 3HVIA 1HFKA 3AEXA 3L7OA 5C52B 2V03A 5KO2A 3OOHA 3SJUA 2J0UA 3C3YA 4RE5A 1TMGE 1T43A 2PKCA 2RC6A 3FLBA 1YNSA 1QRRA 5LR6A 3OQJA 3KFLA 3MN1A 2O19A 5K3EA 4PSDA 4G0WA 1E6CA 4X6UA 4F2HA 4BMNA 5KC9A 4A8JB 3LT5A 2PO7A 3PDJA 2F8LA 2NT3A 1WZEA 3KKNA 2VUHB 3BJZA 4O1IA 4R5HA 4JYBA 4WNAA 2F8TA 1K08A 2XMZA 1P75A 1SXPA 4YQYA 2C59A 2DWPA 2CHGA 3BMXA 5D3MB 3JD4A 1TX4B 1T1GA 1WP4A 1S9DA 1LLFA 1H4VB 2KM1A 3LX4A 3M6MD 3M83A 1MAVA 2R8BA 2NV2B 4NFSA 4H4CA 1NI3A 1RZUA 5LP1A 3T5AA 3ETLA 2HQ1A 4TRNA 1T34A 4YBRA 3HM2A 4OI1A 5DYWA 2BEJA 3AFGA 1C0PA 3MCUA 5E9JA 1CNMA 1VJRA 4ZANA 2QMHA 3CU5A 3K9NA 2ZIEA 5DLQC 4KAAA 2ET6A 4I4TB 4IS2A 1WIWA 1IMOA 1P91A 4BN0A 1UXOA 3DTVB 3K0CA 3PEYA 2HJSA 4JASB 4U5QA 4QDUA 3JQEA 3O4GA 2NSDA 3UUFA 2ACEA 1OUMA 3LBIA 4LHZA 2QPAA 3O7MA 5FQNA 1GRRA 1NVVR 1X77A 3PFWO 4EVQA 5A1JA 4A2CA 1MJFA 4Q9IA 5AH0A 3GJ3A 3GJSA 3AB3A 3HL4A 4A6PA 4BYGA 4C3ZA 4GFDA 1J8VA 3MB8A 3S1SA 2X1MA 3R6DA 4U0KA 1T2VA 2DRIA 5KWIA 2GKSA 1XAIA 2QRHA 3IOBA 1YE8A 4CQMB 3Q6NA 4EWLA 4ZEOA 1TU4A 2GEDA 3NG1A 4EQ6A 1L5NA 1X6VA 4WRRA 1J0EA 2O2EA 3FPJA 3TBKA 1ZWKA 4PG8A 3CWZA 3HKEB 4URWR 2RHMA 4ZVUA 3CLSC 1A2QA 2VYQA 3LBAA 3MMNA 4J6FA 4DVJA 4V1CI 5EWMA 1NQWA 4FGZA 3OM9A 5E3IA 5KVCA 2HPZA 1LVGA 2XZTA 1Q0TA 1XVIA 1DZ3A 1Q2XA 2QW0X 2VG8A 3A4IA 4H0FA 1X94A 2VSYA 3K0SA 2PX8A 2V7GA 1G8PA 2ZR8A 1HRKA 3K1JA 3TX6A 4BOYA 1KEUA 2I5PO 5BMVB 1V9SA 2ZDGA 1VIVA 4N0MA 2YFKA 3ONDA 4JBGA 4O2BA 4N18A 5GMOA 3EQZA 4UOEA 2CF6A 2P9EA 4L9AA 4TVBA 4X60A 3T41A 2P9GA 3A25A 4QHTA 1JHXA 1XRSB 3AQIA 5HF8A 5J2UB 5I4CA 3AJ8A 8MHTA 4F3RA 3WVNA 4K9DA 3SSOA 3HO8A 2Q3HA 1T3GA 1XKTA 2I1QA 3AJ9A 1IZ7A 3D3JA 3HBAA 2FQWA 3T9EA 2XVXA 4DILA 2ZOSA 5F77A 1ISIA 1FFBA 1CU1A 3TNYA 3VPCA 10MHA 2YIDA 3DB1A 4P2BA 4S04A 5HCUA 4A8TA 2G0NA 1D3AA 2P9TA 5KOJB 3U3MA 3TSAA 5DZSA 1WMEA 2ZI4A 3N8KA 3PHLA 4Q24A 1LQUA 5AI6A 3G13A 3AGQA 4OYLA 3AY6A 1VYTA 2V5AA 5DNEA 3FM9A 4BO3A 4JT9A 2HA6A 2ZG6A 4ZAZA 1XD2A 1EWKA 2JB9A 3FMVA 3PXXA 1MQAA 2Z30A 1WD7A 3IJRA 4Q37A 1SQ6A 1L6RA 2ATVA 2Z95A 4J91A 4DWOA 4HDMB 3D1VA 2APJA 3ZWQA 1XPOA 4PONA 1DQSA 1JWBB 2JANA 4PPYA 1JDZA 3ZCQA 4H17A 2PBRA 1SIUA 3TVYA 1EE9A 4IQ4A 3ZQ6A 5FJIA 1XRLA 3DFMA 1YQQA 5IAEA 2YS6A 1KAEA 3HI6A 5L3SB 1Z16A 3RUFA 1KI4A 3CT4A 2B36A 5B64A 2H4XA 2ODEA 4O4IB 4JLAA 2JNWA 4Q1BA 5AK4A 5FIUA 3ZJUA 5IK2A 3A05A 4BTEA 3PC8A 3RUPA 2IDZA 1MABA 3WMWA 1UZAA 2RK3A 4D0NA 1MG5A 1XMJA 3IT2A 1CRPA 2I1VB 1NQAO 5EUMA 3UK0A 1N2OA 2LP4Y 1ZJZA 4KX5A 1JQDA 1NR1A 3BE8A 1UFQA 4RTJA 4JOQA 3QY9A 4PYIA 4FINA 5JFGA 2DFNA 3B51X 4P9NA 4Q3LA 5J4LA 2G82A 2YZMA 5EHNA 1X3SA 2JAWA 4WDRA 5D86A 3U9LA 3WSTA 3BWVA 1W9HA 4AF6A 5HKKD 3DAFA 4J7XA 4ZI7F 3CM0A 3UW1A 2HF8A 4P86A 4KKXB 5LLTA 1DWUA 3M4NA 1RI2A 5C80A 4XDHA 4EJ2A 1WW8A 4IIEA 1KDVA 3PZRA 1IBCA 4J03A 4MA0A 4OSEA 4NECA 1DDGA 5IN5A 3ZX5A 1JZQA 2OBMA 3HYNA 1SKAA 4XX0A 2Q07A 4CKBB 1O6ZA 1ZEMA 3AF2A 2PV0A 5CCEA 1QGYA 3KOXA 1JE1A 5DBHX 2X3UA 3IV7A 3B8HA 4Q7LA 2I0FA 1OI3A 4F2PA 2DKFA 4CEHA 1W29A 4XJTA 2C82A 3C7CB 1YVUA 4XM2A 2A1UA 1XEWY 2OFPA 3TVDA 2NPIA 1BN6A 4NEQA 4JN6B 2JZOA 4OB8A 2MMCA 4JLUA 3DE1X 3LW7A 5FI0B 4DIMA 1SQFA 1Z2OX 3CS3A 1HZZA 3M4ZA 3M6WA 1NWHA 1TRHA 2QNRA 3OA2A 3SD7A 3I04A 3GFTA 2RAFA 1P8JA 1G20B 2NU7A 3WRXA 3VKHA 3RAGA 2XLCA 1CQXA 2KE5A 4LNHA 1A9PA 4O4LB 2KYRA 2ZKIA 1K4YA 3IAEA 3JXEA 4F1WA 4M46A 4HBZA 2E5WA 1MH9A 1OILA 2C0CA 4H27A 1KERA 2OAGA 4JT2A 4HR7A 1OLXB 1C9KA 3T4EA 4W82A 1ACJA 2BZ1A 1DT5A 3PRYA 4P54A 4Y9SA 3ZV3A 1V4NA 2W0MA 3KKZA 3MIIA 1WEHA 5LDDC 3A1DA 4LJAA 5HIJA 1QR6A 1M7BA 3DULA 3O9ZA 1P0MA 1L4HA 2UZ4A 1PGQA 3QU2A 1AJEA 1DAGA 2VHCA 5KU1A 1K66A 4RHFA 1ZHOA 5F73A 2IZZA 3T3IA 5JVDB 1JILA 3WKEA 1VLMA 1WEKA 4XIIA 3U3XA 2JLXA 3OAAA 4BECA 1GL7A 4FGLA 3RUHA 4N3BA 3W7AA 1M8GA 1RQ2A 3CEHA 4FCCA 4GVLA 4IWYA 3ZWVA 1E1MA 1S2NA 2NZWA 2ZWIA 3C24A 3DMFA 3GRVA 3KD3A 3LC0A 4RHEA 1L5KA 5LFAA 3T6KA 1HQYE 2I6QA 4RGBA 5EHGA 3OUZA 3R3VA 5JNUA 3ZY3A 1J2EA 4IGKA 5HMLA 3GCWA 1USKA 3GEHA 3OM8A 2X22A 4JGGA 1A9OA 3UCXA 2PZGA 4L78A 1Q3KA 1XTVA 4D9GA 4KIWA 5LD2C 5B12A 3WYBA 3KQWA 3Q72A 1MX3A 3KKLA 2YCLA 3I04M 3JYOA 4C2UA 2X4DA 4MV6A 2OB1A 5AHRA 1MB9A 1EUQA 4OQQA 3HTXA 1Z4JA 1KEEB 1SCKA 4G1VA 1AK9A 4AJ1A 1EXNA 1W73A 2JJYA 1XROA 2ZVPX 5JECA 2Y6UA 1NVVQ 1YBMA 2XEXA 4HGRA 4JD5A 4PV7A 1RP7A 1ZGCA 4EY7A 1BS2A 4FOTA 3U4AA 4LOJA 3U60B 5EIXA 1JVNA 4XD7A 3NT5A 5E9AA 3N2IA 1XT6A 2IUEA 3P26A 3R23A 1C4KA 4MEJA 3KUUA 5TR9A 2WJYA 1W88A 1JSRA 2PJUA 1SB9A 3AZQA 1HT1E 1I7LA 4DA9A 2WUVA 2EHDA 1JEYA 5DTEA 1M6HA 2C0PA 2X7JA 3KIPA 4I50F 2XCIA 4NMMA 3MGKA 3QVMA 4N3AA 4G4JA 5A05A 2YWRA 3AEUB 5T67A 4W5JA 1ZNXA 1ZNQO 2OVFA 2YHBA 4I3GA 1JLHA 4ZVNA 4DZTA 3W8DA 4JA0A 3NFRA 5FWNA 2BH2A 3EEFA 3ZHYA 2V7UA 3GPCA 3JATA 3EDYA 3OPVA 4MJXA 1BQ3A 3ZWYA 1BX3A 2XOXA 5ED0A 3U49A 2K6GA 2HIMA 3KZNA 4C0SA 1FNBA 1LTQA 1E9FA 3LU1A 3LVQE 4Q3NA 3W9UA 1KYWA 2NNLD 3E81A 1XV5A 3BIOA 2OV6A 3NV9A 4HAZA 5H82A 4WL0A 3QKRA 4XYEA 1RBYA 3H8WA 1MO6A 2O8NA 1W59A 5FF9A 4ZT3A 3OQHA 1YZKA 1A5ZA 1OT5A 4YO8A 1SXJD 1WMSA 2JASA 2IU3A 4AS2A 3WFJA 2I7TA 4FZVA 2EFHB 4I4NA 3VAZA 2CFRA 1O6BA 4L5BA 1FRFS 1FDSA 3RS9A 1EP9A 2CL6X 4IF4A 2UUBB 1O3YA 3L0CA 3MCVA 4LKRA 5KTOA 3D7SA 1YF3A 4CG1A 4W8HA 4Q7MB 2V54A 3QBTA 4TWIA 2FPSA 3JS5A 3EZ7A 4JDUA 4OU5A 5TGZA 4AD8A 3TQCA 4DCMA 4L4RA 4OJTA 5HUJA 3FSEA 2LCFA 2BR3A 4C76A 3EC2A 1T5SA 3FNBA 1RWKA 3G9XA 1RWWA 1T13A 3UT5A 4MO9A 1FFXA 5A3SA 3H2SA 5BR1A 2F4VB 5CW1A 1ZEJA 1EEXB 1W49A 3DBLA 3QNUA 1TZBA 1D7AA 1EG2A 3OZVA 2JLQA 1RKXA 3HSSA 2Q1XA 3HCNA 1SCUA 4IDNA 2A1IA 4P7JA 5DSZA 3B70A 3I5UA 3UN1A 3SSNA 4DNPA 3CNBA 1NJ1A 1EHCA 4UTXA 2OBBA 3T5PA 2A1TR 4N01A 4KH1A 2X19A 5LQJA 1SKYE 2UXDB 3TQSA 3R75A 4EIWA 1WSWA 1E2JA 4HNRA 1W87A 3WLLA 3WYGA 4DJ5X 4OFWA 1HO3A 1BIFA 3BXEA 3M7IA 2WIKA 2XF2A 5TB5A 5CFZA 1N0IA 3GMDA 5HTKA 1RS0A 1Z6QA 1UQUA 1VL6A 1DUVG 1UFRA 3WL3A 1PEDA 1YAJA 4J16C 1J9GA 3VKFA 5I7VA 5REQA 3QFRA 2ZIZA 2ZU6A 1M3SA 5BVGB 5IKPA 5EKDA 2TECE 3BXHA 3VR3A 2WSMA 1P8AA 4HAWA 3S2SA 3HJHA 3HFSA 1EINA 4KQWA 3PRHA 4DREA 2AOTB 2X2PA 1TK2A 2FK8A 5B6JA 4AY4A 1H6CA 4OREX 5T3UA 2PSJA 3MWJA 3TAHA 4EPYA 2I9KA 1BKYA 2HK9A 3K9BA 3H5NA 4JOSA 5IASA 3GAFA 1Q74A 2G4CA 3RSQA 4A9AA 2EBUA 1JDBC 1SUEA 2R6AA 4MDFA 1VL8A 5JQWA 1QIKA 2XAUA 3THXB 1AKRA 5JYCA 3IEUA 5C7OO 4BLVA 3N6VA 2IGBA 1ZRHA 5AI4A 4TQ9A 3UGKA 3O8QA 4CM1A 3EFHA 4IUDS 4Q9AA 5JEDA 1S2GA 3VH4A 5F1OA 3NHKA 4UNPA 4ATNA 5AW2A 1BU8A 2AC7A 2VT3A 4UEKA 3W78A 1G38A 1Z0SA 4QUKA 1ZP6A 2REQA 4B3FX 2JJ8A 4JU9A 1MVNA 3NS7A 3A1EA 4OB6A 2E21A 4XWGA 4H60A 5NULA 3TEMA 3FIJA 3HFRA 4Z8YA 5KX5F 1XF9A 1ZXXA 4MS1A 2O3JA 4KVGA 1ZJ5A 1W35A 3K5WA 1H1LB 2HSDA 2ZRKA 2A5GA 3IA7A 3I1YA 4FDTA 1WO8A 3T52A 3EPRA 1U2EA 3JZIA 4NMLA 3N53A 4X91A 2IZ5A 1X7ZB 1U7TA 1XMQB 1KDOA 2ZI7A 5D5PA 1CP3A 3SC6A 1JNYA 2CVZA 3V1NA 1BE0A 1TZMA 1OWLA 1SXJC 2DLDA 2WU4A 5DCYA 3TCXB 4ZV4A 3PI7A 5KNLA 1FYWA 2PRJA 4L50A 3I2GA 2XRYA 1W4BA 3KZ1E 4HUJA 4PSCA 4LOAA 4Y1EA 3SQWA 3L43A 1ZCFA 4LXGA 2A67A 2LPMA 4FDLA 4ZZ2A 2H4HA 5CXQA 3WDMA 2VJCA 3ZDEA 4EOGA 1SVIA 4UM7A 1E2DA 1BXKA 4N1AA 4PX9A 3T3MB 3G1WA 4YXFA 3FWZA 2AR7A 1A82A 2WJZB 4OQLA 1F9AA 2R65A 3PGXA 5DVZA 3ZCPA 1V3VA 2GZ2A 3DPIA 3NHLA 1DRVA 5LB2A 4TT3D 4UHCA 2XNKA 4LGVA 3RUCA 1NURA 4P6VF 3EUEA 5E1OA 1Y89A 1O96B 1E6WA 2QJFA 5MN5A 4RPJA 3IAS6 5BO5A 3S2UA 4I6EA 5LWQA 1ECGA 4MKGA 1WMDA 3HB7A 4NENB 3U7RA 2R0QC 3U6KA 3L7LA 4YY3B 3N2LA 3AZOA 2NWQA 4P53A 4FUTA 5CJ2A 2Z4TA 3A6JA 3C7KA 5E4YA 5K8VA 5DRTA 3E9CA 3BA1A 4HVAA 1C8VB 2I34A 3KQUA 1EMDA 1IUOA 1LA2A 1UKVY 5G53C 3A9SA 2BC9A 4MV7A 3N2GB 4C89A 5HQ3B 4C7KA 5I4IA 5JNRA 4GWLA 4F2GA 2QG6A 1NIJA 4BJ5A 1F2DA 1K4KA 1U2GA 3ESAA 4EJSA 1YVPA 1AGRA 1KA9H 3KQHA 2QPLA 1YZTA 3AXSA 1M2VA 3ELUA 5FORA 4AKTA 1VE5A 1WY7A 4KQJA 4CLEA 4EHLA 1IQRA 1MD9A 5ILGA 2CW5A 2C1XA 4K6CA 3NKFA 4MLZA 3V8RA 5IJ0A 3OZWA 3VOSA 3MHPA 5THXA 1DEXA 1XYYA 3KQOA 1PEAA 1L4KA 3CCFA 4HYYA 1T2DA 2VPIA 2NUTA 3H0CA 2GFQA 5A02A 3PXUA 1KQ3A 2BW0A 1JLMA 4MMXB 5K8JB 3FWKA 4Y6PA 1JF8A 3OQVA 4L22A 4NV1A 4LDQA 4B4KA 1F8YA 3MGCA 4TT8A 1R6BX 3GHHA 4R69A 1JHUA 2HC9A 4A03A 1GUFA 1E2EA 2VSQA 2P5TB 4J2TA 5IARA 1JG6A 1PJRA 2RGGA 4PF1A 4UD6A 3UMCA 2G83A 3A2NA 2BKVA 1SC6A 1DQNA 4KLNA 4DCGA 2V59A 2DVMA 3BXZA 4LJ5A 4RLQA 4DIFA 4JODA 4BO5A 5E7JA 1PUXA 3RVMA 5ITZA 4S12A 2AOWA 3AFNA 3LSTA 3CLHA 1I4WA 2BH9A 3KQQA 1NDHA 3N75A 2ECQA 1OAKA 1S8OA 4JJAA 2X9NA 3C2QA 2UVDA 3QPWA 4MUEA 4BKPA 4EPXA 2PEZA 1NM5C 4TTVA 4BNTA 1JJ7A 4QG3A 4FYMA 5FNVF 5ES3A 1G3IA 1XTKA 1M6VA 1PKXA 5D8DA 1TAQA 3G6WA 3OFND 2R9VA 3SWWA 1RVDA 1BGVA 3M6FA 3NAZA 5F3DA 5J40A 3EYWA 4A0QA 3FPKA 5JANA 1PDVA 3OKFA 3RHTA 1CSEE 4G37A 1UPTA 4Q3BA 5KYGA 5FCDA 4GPEA 3SBDA 3UGTA 1PLJA 2AE2A 3HY3A 3NBKA 3OU7A 4E15A 2EKDA 4CEJA 5DTQA 1ADCA 3B9RA 1HR0B 2D4HA 3PPXA 4G0ZA 4QNRA 3ZHQA 1OFVA 3FZQA 4QXRA 2VK8A 2WWWA 2Q6TA 4C4TA 3FB4A 3FG9A 3HV0A 4ZKDA 3CEJA 5F2KA 2PUJA 4L76A 4BFXA 4ZRNA 3CUEF 3OJOA 4KVAA 5JJLA 3EY9A 3W5VA 2XAAA 4R8MA 3ELDA 4F6RB 2P2NA 2BEVB 2QSZA 5IH3A 1P4GA 3UAYA 4UZSA 5HF9A 4OJMX 2I67A 1C81A 1WM1A 3TAUA 3I2IA 3KEQA 2JGLA 2ZT7A 4BXOA 4NU8X 4ALMA 4OJNA 4M8IA 3AR3A 5G4LA 5IEBA 4DSAA 2AN5A 1AK2A 2J3JA 2VBGA 5TPWB 4O6VA 4E88A 4YN3A 2JIPA 1OVGA 3BSFA 3PTAA 1ANKA 1W85A 3RU7A 1KSGA 4QDJA 7ABPA 2R1UA 1KBOA 4XKJA 3D54D 2ZJ6A 4HN9A 4L73A 4LMBA 3ZCRA 1LY1A 5DTRA 1Z2EA 4R1MA 2QW1A 4CMEA 4P0PB 2V98A 3K3PA 5T7BA 1DUIA 2VZLA 4G5SA 4ZI7B 1NOJA 2R48A 1GGFA 5JXIA 3GZ4A 1LSOA 1M1YB 4MKIA 4DANA 2O1WA 3UW3A 1FA9A 2X8AA 1S4QA 2ZIGA 4RF3A 1DWOA 5DGXA 1RQRA 4E13A 1DXOA 4FX5A 1NW9B 4DM3A 2BGRA 1Y4SA 2GMWA 2PSEA 2Q5IA 3L5KA 2QLNA 1N0VC 2CVFA 2I7DA 1GOTA 1KARA 1NRJB 2CY0A 3DPUA 5AVWA 2R1TB 4NDAA 4ITUA 2HMUA 2EJVA 2DTXA 2N1BA 2ZQZA 4ZOCA 1T4BA 2PGXA 3A1TA 1YSCA 2Q5FA 1X9GA 3QWFA 5DDIP 5DX8A 4RXUA 3SYMA 3WK7A 2YMQA 3X1DA 3ANNA 1RYDA 3C1AA 4HBGA 1NVEA 3EVNA 2A4MA 4WN9B 1HMPA 3GPDG 4OJQA 3MJRA 2A9RA 3W9SA 2GJ8A 2V7TA 2Z2KA 1K88A 1B3BA 3KLMX 5CHYA 3U62A 4AMBA 1NLMA 2KWIA 3G02A 4HXYA 1NSFA 1R6UA 5KPDA 2X9QA 3ANXA 1Z75A 3A32A 5EPEA 3FGPA 3FUTA 4ZQHA 2E0IA 4AMUA 2Y1GA 1K7FB 3OPMA 4C7OA 1OX4A 4W4TA 3D7RA 2CHUA 3WJ7A 3GHYA 3M6IA 3D2LA 3NWPA 2AQKA 1AZWA 1EFUA 1R3UA 3OLCX 4P08A 4QREA 4U2FA 2HSWA 5ALUA 3LT4A 1Z62A 3GXBA 5BT8A 5C5IA 4UMEA 2J9YB 3TL2A 2X76A 1ECCA 1MXHA 4A6DA 4QQ8A 2DOKA 2I76A 1CUZA 1NYTA 4Y7DA 1NFFA 2ZBQA 3H13A 2WDZA 3IKMB 4NHOA 3WK5A 4CDNA 5JS8A 1E2PA 4R81A 2VBFA 1Y1TA 3F8SA 3F3SA 4ZALA 5HM6A 5CVJA 3UAWA 2AF3C 1U2TA 2I8CA 3JTMA 3OIWA 4F45A 4U2EA 1DNPA 4JKOA 2FUEA 3B8EA 4ARSA 4O8ZA 4OI0A 2C2KA 3OC0A 1J1UA 1PNRA 2WU1A 4R8RA 3E22B 3KZXA 1G6HA 1E7MA 5AHXA 1PF7E 3E0QA 2EEZA 5M29A 3NAQA 3TKLA 4ER3A 2X1HA 4YXWD 5HQTA 3AO0B 4D0RA 2OGTA 4M8NE 1LFDB 3AKCA 4HXEB 2HFJA 4IDFA 4HVCA 4D8UA 3A1VA 2DT5A 1FBNA 2AFIB 2JK1A 4EVSA 2EZ9A 3KK0A 1UBGA 4AZ0A 3E3AA 4A91A 4JL5A 3TNFA 2ZUWA 2VHTA 5TJHA 4QICA 5EWJA 3ANMA 1M6YA 2BGIA 3OIYA 2R8PA 3JSXA 5BXQC 3CJQA 2XVZA 5ICGA 4FC6A 4Q7KA 4A0RA 3THRA 3D8TA 1Q7CA 3LY5A 1Q0SA 4UBIA 4NHEA 4UBOA 3PDWA 3R4CA 4FEAA 4TUYA 2Q9UA 3I9V6 1E3WA 2X41A 1VIAA 1LC3A 3HU1A 2AOUA 4OLBA 3H97A 3GRFA 2CEAA 3OEHA 2I7CA 2A33A 1T1SA 2R2AA 4KBFA 1BHSA 4D81A 1GNSA 4Z7QB 1R9NA 2OFOA 3ENQA 3LK6A 3LUHA 2Z83A 4UXJA 4ZMRA 1J0CA 1P0IA 1PLKA 2P67A 3PGLA 3TCNA 3DHEA 1L7AA 1RPZA 3GT4A 3N8GA 3X1JA 1KZ9A 4OGLA 2WHRA 3MJSA 1VKJA 1KOJA 1WCV1 3SNKA 4KPUA 4DUYB 1X19A 1AS2A 2PMWB 1KNQA 2CYBA 1BKSB 4R1SA 4I50B 3SZOA 1FFEA 2YRFA 4X1OA 8ADHA 4LRYA 1I0IA 1GFWA 3NBQA 3EQ8A 4R2MA 3EWIA 4NE2A 2J46A 4P5PA 4U2CA 4LNAA 4YJGB 1U65A 1AG9A 1ZNWA 1KF0A 3PUXA 4LY3A 2Z2ZA 4CQJA 3FA2A 2NU9A 1Z6PA 4M1OA 4A5SA 1BEZA 3U16A 1VPDA 2SECE 3A6PC 4YRZA 2WF7A 4RK7A 2JIQA 4DV1B 3ZBQA 5MDHA 2W6ZA 1P45A 2J9RA 2REXB 1L7MA 2QG4A 3VTZA 1NKVA 2AB0A 4G8DA 3CF2A 2UZ1A 4J7AA 2UUPA 2QZ9A 4KN5A 4UZEA 3GVIA 2LV8A 2H2FA 4L95C 1A9YA 4WQMA 3X1MA 4DWVA 2Z6QA 3ER8A 3MPOA 3V7NA 3FYUA 3RG2A 1HFJA 4KDCA 4QHSA 1RADA 4O4JA 5C8XA 3CUWA 3GG9A 3HS3A 4IHQA 3JVUA 4MW1A 1RFGE 4UE2A 3UJ7A 2HSJA 2I9PA 4M83A 4ND8A 1C41A 2OM6A 3WRXC 4B73A 1B8OA 2YN4A 5C53B 1GCOA 1D6MA 2VRNA 1HV8A 1UWVA 1MC5A 4N65A 1B3RA 3CGGA 4L1KA 3R9KA 1DDOA 1KMMA 2BFEA 1A5SB 4KXYA 3M4YA 4CU5A 4F4JA 4ZCIA 5JSUA 5JJKA 1E6MA 5T3YA 2QA5A 4TLDA 1LLQA 2C2MA 1QGZA 3GLTA 1XZLA 1D1PA 1FNDA 1KP2A 3AFHA 3MGBA 1KQFA 5F1KA 5F2EA 1CY4A 4BYMA 4UXIA 3W7BA 4AT1A 4C5AA 1I7SB 1V9LA 2GFIA 4MYRA 1Y81A 2QMOA 2FPPB 4ALJA 2VRCD 3V9PA 3ZU4A 4O02B 1NV9A 4FB4A 1YH3A 5C81A 1KK1A 1RYFA 4Y98A 5EQJB 4ITRC 1GU1A 2CFOA 1YRQA 3IRVA 4QG7A 4JYZA 3IOEA 5F64A 2PTHA 2AMYA 3ZUGA 2R5FA 4KXXA 4JITA 5CFMA 3GNLA 5U4QA 2R6HA 1EVJA 2IH4A 1R4MA 3Q85A 2HJWA 5I9NA 3OF3A 4NS4A 1YC5A 4H1UA 1MO3A 3K8OE 3N6XA 4W9NA 1EFLA 4YP9A 1TJYA 4EEKA 5FUVA 2CNOA 5DGHA 3NHPA 2CHVA 2D8AA 2VYVD 3LWNA 5DEIA 5IP5A 2BR5A 2OE2A 2ATIA 2EGUA 4ABYA 1OH5A 3QXJA 5K0FA 4JZKA 3KWMA 1U3GA 2JFVA 5ELMA 3PSAA 1LF0A 3H99A 4A16A 4BNKA 2L2QA 3UOWA 2YWHA 3LJKA 1J8MF 4MKZA 3S1AB 4DV2B 3C16C 2R7AA 1Y7TA 4IDEA 5AUQA 2H2IA 2MJLA 1QRSA 4FFVA 3RT9A 2NYVA 2ECOA 2Y93A 3HZHA 1YASA 2OFWA 1T8TA 4FFOA 2EFYA 1A4RA 2Q1WA 1CUYA 3OCCA 4IL5A 5EXSA 4P3YA 2O8DA 1THGA 4C06A 3C6ZA 4HYQA 3TO5A 2YY7A 1J6UA 2A9KA 3NTLA 1L4MA 1YWGO 2ISCA 2M6RA 1CJSA 2CC2A 4TMZA 2ORIA 4YLGA 3QWIA 1F5NA 1I2MA 2J0QA 1R37A 2A58A 1Y7HA 3D3KA 1KC3A 1UT6A 3GEDA 3P1JA 4JQSA 13PKA 2G9ZA 1H3EA 3IT0A 1CG6A 1RCFA 2CXOA 2GAAA 2R751 4HDNA 3FVTA 4I0WB 1L8XA 2X86A 1ZC4A 4HQNA 2J3EA 4MYTA 1FDOA 3DM9B 1BOOA 5GZ3A 2OBNA 2Q28A 4CRWB 1RXCA 1D6JA 2I2WA 2ZDHA 3CZMA 1E3TA 3OT1B 3I05A 2QTVB 3MA0A 4I9FA 4MW9A 3VR5D 1QK4A 2O2ZA 4ZWNA 4JI3B 3DL2A 3VR0A 1XAHA 3TW6A 3I8OA 5JZ9A 1CHNA 3Q88A 3SMQA 5KX5B 4RDXA 1N2BA 4BFUA 3EEBA 5P21A 3KJQA 3IA2A 3IKJA 1PYGA 4DV0B 1CIPA 2PZFA 3SJBA 3ZHOA 3ENZA 4IINA 1TTTA 2C4TA 4M7OA 3VC2A 2ICAA 2OK7A 4J0IA 5CVDA 2HIHA 1ZQ9A 3F98A 2YCBA 4DBZA 3BRWA 1RRPA 2O0LA 1MB4A 2O6HA 2AJBA 1V5EA 3QWHA 4I4LA 2M1ZA 5BUZA 1U1CA 2XQKA 3HZRA 1LK0A 3KSDO 3RRMA 2XUKA 1BW9B 2FE1A 4UU1A 5JBQA 5EJFA 4ZA2A 1OHHA 4FILA 4NZPA 4L8GA 1N4AA 5IZCA 2YDXA 4TL7A 1U90A 4WKNA 5L95A 1PGOA 3U56A 4YQFA 3IXQA 4KI0A 4OTZA 2ONZA 2FSHA 4PYQA 2YC2C 1FS6A 1H23A 4KZPA 1ICIA 1U94A 3AI2A 1KE2A 5AVQA 3ZCSA 1AHHA 3VSCA 5L4SA 1WXDA 1CE8A 2WA1A 2GNOA 2HKIA 3UJPA 3CNLA 3H86A 4Q3AA 3Q3HA 5BW8A 5I9IA 1U2SA 3D8UA 4FXPA 1B73A 1M34B 3WBKA 5H5JA 2Z1MA 4G5QA 4LOIA 1HTWA 1MP0A 2V7QA 4LJLA 4XVCA 2HLPA 4YUYA 4YK7A 4JV5B 1WZNA 3D7KA 4ABTA 5GVRA 1OC2A 2XCLA 1VGQA 2O2IA 1PK8A 4XIYA 1BCRB 1V8DA 2F3UA 5LP6F 1VBFA 2XTZA 1N2ZA 1A1SA 3NM4A 4NCJA 4BQPA 4MUIA 3PJEA 4RV5A 1OZFA 1OMOA 2C97A 2O50A 1U9IA 5AUOB 4B81A 4LF5B 3DVAB 1XWFA 1OTYA 3FUUA 1V2HE 4UREA 5D00A 5G1PA 5C1DA 3PQDA 2DJ5A 2VFAA 1I0LA 2ZYIA 1V11B 3K0FA 4ND3A 3CCBA 4DOMA 3AJAA 2GF0A 4MUHA 4WBNB 3ESYA 4TYYA 1M2NA 4EA8A 4RJIA 3LWDA 1UM9A 4S1PA 3IUMA 4DS3A 2VBCA 1LI5A 1PGNA 1N5RA 3CPJB 4Z0TA 3G2QA 1FF9A 3E9RA 3TZQA 4D8WA 1WZCA 2F3PA 4RKYA 1OBOA 5SZKB 4P58A 4QXAA 3V00A 3CH7A 3VH1A 2F3RA 2XOKD 2WAXA 5GGYA 3WGYA 1HDXA 4HJRA 3REGA 4LRXA 1DBWA 3PKIA 2WHXA 3TQFA 1IDN1 1BEUB 1XB2A 2B8JA 2QE7A 5IMBA 5C4GB 3T3OA 3DJFA 3F5MA 4JBNA 1NOIA 2QRJA 3S1LA 5E6SB 4CR7A 3ZYZA 1HLPA 3IP7A 3P2OA 3IIIA 1NMQA 2VH2A 3LHDA 4GS5A 4PLVA 2YX1A 3VI4B 3G9TA 1G8MA 3OHSX 1GSHA 4JUIA 4BBPA 3VJMA 3RADC 5IDXA 1NQTA 2X77A 3WKAA 1XMXA 2NVUB 4TX1A 4MUXA 1RWPA 4NG5A 2YWFA 2CF5A 1SGWA 5FNVB 5HIIA 2P40A 3BWBA 3H9EO 1XHEA 4JYMA 2BD0A 3UOAB 3W8NA 1G19A 3FDXA 3JALB 1VLQA 2ECKA 1GCGA 3KS9A 2LIPA 5F7ZA 2RARA 3ZI7A 1U0OC 1I01A 5FWYB 5HQJA 1QB7A 2XCRB 2RI1A 1PZFA 4MROA 5B37A 3WLEA 4WSOA 2FRXA 3FBWA 5G02A 3IAUA 1U0FA 1V9CA 4RH3A 2AFHB 4QFDA 5DYGA 4QC2A 1EVEA 3WYCA 1L4LA 4IZIA 4MRRA 3FWYA 4OMUA 2X23A 2LR0A 3OE4A 5ENDA 3RQIA 1Z47A 4A0SA 4AWAA 1FTSA 3TUJC 2I1LA 1VMKA 4EY6A 3BUSA 5LBUA 2FQXA 1Q7GA 4JNKA 2XUQA 3U19A 2XMPA 2Z6VA 3R24A 5FBZA 3OOSA 3GJ0A 2VNIA 2AK2A 1ZHHA 3CQ9A 3INGA 1Z39A 4C6HA 3RIGA 1SKQA 4U7TB 1GU7A 3IQGX 4XWKA 4M76B 1GZ3A 1U2RA 4P0QB 1P62B 4I5IA 2OP1A 2CUKA 2IEGA 5LVAA 2WSSD 1QDEA 2OTCA 2OORA 1E8NA 4JJ4A 2C9BA 1T5IA 3PHHA 2YYAA 1QHGA 1QYWA 1X86B 1T1EA 2ZE8A 4L5JA 4DY4A 5L3VA 1G63A 5DEOA 5DHRA 4YAUA 2FYTA 2MHCA 4WZBE 3HN6A 2TMKA 4EHJA 3IGFA 3L6EA 3OP1A 3O31A 3SVTA 4GSKA 2QLMA 4J90A 4BFCA 5LYJB 4QNMA 3E7FA 2OFFA 4HVLA 3PCTA 5DYYA 3VPSA 3IDFA 1QFZA 1NE2A 2FRDC 5HEKA 2D6FA 3HDGA 1EZ1A 2R5WA 2X8WA 4XPIA 2ODNA 1FYEA 1YR9A 4ETWA 2PUAA 1GYQA 2FPUA 3QVSA 1EHIA 3DM5A 2F3QA 2L19A 3G0GA 4TV9A 3W5UA 3LECA 5BOSA 2OXEA 4YH1A 1PJZA 4QOIA 5KQMA 4B3IA 5LIPA 4HGZA 4JXKA 4YMIA 1FQJA 3WP1B 3QNMA 1TF2A 2VHXA 3O3OB 3RSGA 1WMBA 4KR3A 2G77B 3GZJA 4EHNA 4GYWA 1QRUA 5AOCA 1I9CA 3IS3A 1E6EA 2F59A 1CUIA 2BY4A 4FEGA 1F6WA 3I92A 4B71A 1K6MA 3H5AA 1E1QA 1Y34E 1O97D 3RVPA 5K1ZA 2Z1NA 5C4IA 4FCVA 2ZUCA 3IB6A 4HS4A 3ZKWA 4W5WA 3C1UA 4CKXA 1XTPA 3U39A 3RV4A 1J07A 1P1RA 4D9NA 1Q11A 1LEHA 4PNHA 1BDMA 5BURA 4G5YA 1IK6A 1IYZA 3O95A 4PHGA 1XFAA 2QXYA 5COBA 4YRAA 1NW3A 1ZJ4A 3P20A 5JSZB 4Q6WA 1UFOA 2AZDA 3AT1A 1W5SA 4WH0A 3KHUA 4UQOA 1XJ5A 3A4YA 3V1UA 3OURA 5EXPA 2JG3A 3EY4A 4QDZA 2Y66A 5EIBD 2JGDB 2HSGA 2NW6A 2IYEA 1AUVA 2ZSHA 3D6HA 2FRVA 4XYBA 3U44A 5WRFA 4Y9DA 3LUKA 2GEUA 2NU6B 3X44A 3SJAA 1A4XA 1E7RA 1I14A 3F74A 3C4QA 3MJCA 3TW0A 2DBQA 2EYQA 4H1TA 4OMDA 4P4TA 4QD3A 4TV8A 2HTEA 4NFLA 3W1WA 4BMVA 3Q6IA 2QNBA 1NI5A 3CVOA 3OLWA 3HY6A 3LF2A 3NBFA 3RIEA 4YRNA 3VNRA 4XWOA 3QBDA 4G67A 4PNPA 1U7XA 2JBAA 5K20A 3P0JA 3X1KA 3NI2A 2B3TA 2VF8A 4IZ6A 2QBYB 3E8XA 4X6XA 2B2XA 1SXHA 4HAXA 4QDKA 1QB8A 4PXYA 4MRAA 3KQLA 3DAYA 2B9VA 5ANRB 2J3MA 2GRJA 4AP5A 2IEZA 1IHXA 1SRRA 3RH0A 1ZH2A 4FNOA 3WAJA 2ID8A 1DINA 2HN9A 5AJXA 1T9BA 2ZU0C 1UJ6A 1FX1A 3SCZA 1ESDA 2G9VA 1RWOA 2WZDA 3PS9A 4N3CA 4AX4A 2HHCA 3PQ3A 5EJGA 4R41A 5I9BA 3I0MA 2WAOA 3QV2A 1XAJA 3TMAA 2PFKA 1QO0D 2B7BA 1QDUA 3BFVA 2OL4A 4KUEA 4BNZA 3FJ1A 4YJ3A 1CCWA 4DBVO 4PRZA 2HGSA 2YUTA 3WHLA 4FPXA 4RTNA 2HT6A 4KO3S 4ZQGA 3OZDA 3CNQS 3EGXA 3FOEC 3K0BA 3EQ6A 3VDQA 1VRVA 4HQKA 2K7FA 3DL7A 1MO4A 4X90A 4W1PA 2Q4EA 4LKOA 1NXWA 3BTSA 4O29A 3RR2A 2E85A 1NX9A 3TZHA 5LQKA 1VLHA 5KNBD 4TVOA 1II8B 3BAZA 3NYWA 2AKYA 1AUOA 1RIFA 1XMVA 1B0AA 2P2LA 4JSRA 1G60A 1VCMA 1ZD5A 5FUYA 2QT0A 2J3DA 4MRMB 1EFKA 2QN3A 3PQ4A 5AQ1A 3U09A 2Q2VA 1MUUA 3P19A 1DP4A 4HTFB 1B1AA 4X94A 2O8CA 1C9DB 1UC5B 5I7AA 4D92A 1RYMA 4P4GA 1E66A 4A7PA 1CXZA 2F17A 2G88A 2J5RA 2B1RA 5U4XA 1E9BA 3JQ9A 4J29A 4N0QA 4V0LA 3JQFC 4QEZA 1VL1A 2WNIA 1V39A 2JJQA 2VUSA 3AF0A 4YWJA 4DY6A 4BV9A 4LX0A 2FSSA 3MAGA 1DC4A 1QKIA 1IOZA 3LHFA 4D42A 1NKSA 1FDIA 2W2MA 4ZO7A 2P65A 3RFTA 3WL5A 5C0OE 4ICIA 3SS9X 4JUFA 5CITA 4HWOA 4J0DA 4CKCB 5K0BA 1EJ2A 1YJ5A 2JDID 3CZPA 4GM0A 4GPBA 3Q15C 4HK4A 2L42A 4C08A 1XL0A 4TMKA 1F06A 3FKSA 3JAKB 2W70A 3WOVA 3W3AD 4UBJA 3L1JA 4LCJA 2DF8A 3OETA 4INAA 3OOWA 1CR6A 4I7EA 4GLOA 1GAJA 3KFXA 2J0VA 4R2HA 3RVQA 5BYBA 3E48A 4BKQA 1MN6A 2BFFB 1D4FA 3NHJA 3ROGA 5TQ2A 4XCQA 1LLUA 3KUDA 1L7OA 2IBSA 5EIBC 1DGQA 1YUMA 2KJQA 2TS1A 5T8KA 1YA4A 2JHPA 3GEBA 4RF2A 4XH9B 1MBZA 1EK6A 1Z74A 4WESA 4Y6GB 3CEAA 3HUFA 4O0MA 5CRIA 1PCXA 1O2DA 2I29A 2WD9A 3AP3A 5GV7A 1Q83A 1D2HA 2H1IA 3BGWA 1XRPA 1YRWA 1PHRA 4GLBA 5IBRA 1Q0UA 2FSVC 1VKNA 2ZCVA 3DZFA 4N41A 4EPTA 1C1DB 1DFGA 3CR8A 3H9UA 2A9FA 4AJLA 4EELA 3AY7A 4XEUA 4KV7A 4A2QA 2GXUA 5T4EA 1FUKA 1ML3A 1E5QA 5FOUA 4EUFA 1XHFA 2BKUA 2R3SA 3MVEA 1GQ2A 3AFIA 3RV3A 2WM8A 1SOWA 2DEUA 3DEHA 4J3JA 5I7OA 2NNWB 1AZTA 1MTZA 2LCIA 4B4VA 2WQ6A 1KO4A 1DJMA 2PNFA 4DMHA 4LWPA 2FHPA 3WADA 5B4UA 2XD9A 4QTUB 2VXBA 1XLVA 3ZS9A 4OKSA 1GO2A 5IEJA 2VH1A 4QYMA 1Q0HA 5BUQA 1ZO8A 2JFBA 3IXLA 4I3HA 3I2YX 3K9WA 1ATZA 5BYKA 5H9VA 3EQ7A 1A8HA 2OCBA 3V7WA 2FWNA 4PC1A 3SJCA 5FNZA 4KO2S 4II2A 4KP7A 2GASA 1H9CA 2B82A 1DIAA 1L5WA 1SK8A 2QN2A 4G24A 3WXMA 2GEBA 2Q5HA 3H1FA 1U1IA 4LVUA 1OU4A 2J3LA 1Z36A 2X7HA 2PUCA 1AC5A 1Y9DA 4N6GA 4D0SA 1PJBA 1WAMA 2IH2A 1YMQA 1IM8A 2DP4E 2PVSA 2JGIA 4DCUA 3TSYA 3IBYA 4FYVA 4HAIA 1R0SA 4LECA 2DHDA 1ONBA 5AICA 3ORQA 4C30A 5IWAB 6Q21A 3GA7A 3T54A 1UT5A 1TT7A 1WW2A 4AZVA 1NG9A 2R4TA 3V4FA 3KXLA 2GM3A 4OGKA 2QL5A 1II9A 1TU0A 2Y0EA 1JBEA 1S8NA 1SR8A 1P73A 4ILEA 3TH5A 5BQXA 2O5EA 1OZGA 2ZDQA 4O2BF 4DMUB 2H3EA 3DHNA 3NAGA 1R0XA 3PNVA 4IRUB 4W8GA 2IYYA 3DLIA 4WCFB 4HHEA 5K3FB 3P9RA 5K7SA 3K9FC 2QI9F 4Y9UA 2BMFA 2EW2A 2BDEA 3C97A 4YDSA 4DLZA 1OASA 4DCNA 1XTIA 2GQ0A 2XSZD 5IRCD 1CS0B 3QVGA 4DXHA 2C2BA 4UAJA 4F8JA 1JMYA 1OREA 4MVJM 1RVV1 3ETGA 3T5CA 4B40A 2ZRLA 2EX0A 4HAYA 3ZI0A 2GJ4A 3EUWA 4YFYA 4E94A 4GP9A 2Q29A 4MVJE 2X8JA 4RPGA 4FWTA 2CLOB 4ZYZA 2PS1A 3PQ6A 3PNMA 1SUIA 4UBKA 3PDCA 4B82A 4Z7NB 5BVHB 2ENWA 3VKVA 3AINA 3FZNA 4X1IB 1P1HA 5JWRA 1XEAA 1JHOA 4JBWA 1JB9A 1N9ZA 1E4VA 3PDUA 2F67A 2Q5QA 3QLVA 4QPZA 1K98A 5KQRA 2RB4A 3R76A 3W5CA 1U63A 1G8YA 1KYIA 3JPWA 3R0JA 1NXQA 3VZCA 3TW4A 1H6BA 3L1IA 4KB5A 2X14A 1SU7A 5F7OA 3NOXA 1E4EB 1K8QA 1G64A 4CEIB 4M4SA 5BWMA 1YB4A 3N2KB 1E58A 5HCNA 1X7WB 3KRTA 3OLXA 1SUBA 5CYPA 2QXUA 1OYOA 3C3XA 3B6JA 1BMTA 2DQKA 4H7IA 4S1OA 3DTVD 3OD5A 5EMMA 5TGTA 4KVZA 1T9GS 1Z7WA 2C7VA 1XC7A 3IQXA 3OO0A 1ZK3A 3EULA 3RS7A 4ACAA 2XE7A 3N0WA 4TRMA 3UJ6A 2I4MA 2HHJA 4PAGA 4ZJYA 1VYHA 5LP6B 4FS8A 4QXOA 1YJ8A 2J87A 2OSBA 4JKYA 1PTKA 2GZDA 2Y92A 4DC1A 3ZIAA 4Q4JA 3NHZA 3DUWA 1ISFA 4R7ZA 4L7QA 2CYCA 4ZDWA 2C2WA 3BN3A 1G9XA 1TAHA 4CQMD 1JAHA 3F47A 1GILA 3ORYA 5F2NA 2B3DA 1OCEA 2P2GA 3Q8MA 2ZSUA 3AKDA 4RYLA 3SICE 4BCDA 4Y0NA 4U9HS 1TEZA 4BWVA 1F6BA 3BG5A 3N0RA 5E6UA 1DBQA 3HLYA 5KCZA 3QXXA 2YWGA 1XRQA 3OX4A 4FOPA 2ADOA 2VQEB 1Q84A 3Q9UA 5I9SA 2XLBA 4HQFA 2MYUA 2XCUA 1QYRA 4GHWA 4WDQA 4WLNA 4BKUA 2B99A 5IU6A 5EKSA 2WJ3A 5AW8A 4C4AA 3CISA 1PNVA 4TWJA 3ZZUA 2AMLA 2VF4X 2R85A 2OCGA 1DL5A 3NWOA 4O3FA 4GKKB 3VGPA 5TF0A 1TKAA 3VDXA 3G0DA 3I34X 3KQSA 4P81A 3EVZA 4BEVA 4CG0A 2FF5A 1FDRA 4OQNA 4WNIA 4AAYA 4OL9A 2QAJA 1T0BA 3PXBA 1PVDA 1SZCA 2MTBA 2P5UA 2ZBDA 5JNTA 4WADA 5AVJA 2AS0A 3CA8A 4AURA 4BP8A 2E9SA 1FX0A 1ZK2A 1A7JA 2JRCA 1WSBA 3E9ZA 3CT6A 3FHOA 3M9WA 3LXUX 4ZCTA 5KMGA 3BHIA 4IO0A 3SX2A 2PPVA 4HRVA 1J2TA 2CXHA 2VBIA 4Y6QA 3QUSA 4ISBA 4Y2YA 3K70D 4D80A 4QT0A 2FZ5A 4Q82A 2A94A 2UZ3A 5SZHB 2C4MA 3FY4A 3QNWA 3L6UA 1FNNA 4FDUA 4IY1A 5KHAA 1SCBA 1U0JA 2XGMA 3SLGA 3TWOA 4YPVA 2GARA 4FXOA 4BFWA 3EXIA 5LA6A 5DFAA 4R9UC 2O8BB 2VLIA 3UV3A 1TKCA 5BQ3A 3D7LA 1TL7C 2IYQA 4K2HA 4BZPA 1TM7E 3NAMA 3UFXB 4RM3A 2HYDA 2BKAA 2X3FA 3PDHA 2QVBA 1CNFA 1J5EB 2VL7A 4GU5A 3JQBC 1UDXA 4IYJA 1Y3AA 2C61A 4NBVA 1TFRA 4NE9A 5E9WA 5FD8A 2Z2XA 4FQ7A 1VECA 2R62A 5AM4A 4O2RA 3VPAA 5CJJA 4A8JC 1Y8RA 4NNPA 2QLFA 1VPTA 2C95A 2FI1A 2OECA 3EIWA 4KW7A 4PWZA 2QZPA 2OV2A 4Q4HA 5A4FS 4TKVB 3PFKA 1BKDR 3RYCA 1CYEA 2CXXA 3DGEC 3S29A 5F3WB 4FDVA 1UKBA 4KRXA 3VAYA 2I7VA 1GRVA 2QN9A 1E6UA 5KSOA 3BWYA 1YB7A 2O8FB 3GDFA 3PXCX 4P38A 1AUXA 1FYDA 3D8SA 2J48A 2OQIA 4PNZA 3WB0A 1X8JA 4RPKA 3GA5A 1X7YB 4I99A 2FVXA 1GNPA 1A97A 1Q16A 4PEVA 5A4DA 2M6SA 2GD2A 2X6QA 2ZE5A 3F8WA 3SKXA 3WGJA 3ZHRA 4F4IA 5B3KA 2A59A 3HWRA 4D82A 3DA8A 2C4UA 2LDXA 2OFXA 3IESA 3KVOA 5ELXA 1I36A 3B1KA 3JYHA 5A7FA 1XPRA 1H2AS 4G4GA 3FOCA 1QE0A 1TLTA 1Z5UA 1AV6A 3IMEA 1HZJA 3FPBA 1M8KA 3K6KA 1DMRA 2C7PA 2IY8A 1JU4A 2Z98A 4GMHA 4NYMR 4EK9A 1R5JA 4ZVKA 4AY3A 2BI7A 2WICA 3BFPA 3Q5EA 3FSJX 3Q7RA 4PC6A 4YVFA 4B8WA 1PZNA 2SKCA 1X0XA 3IKTA 1KMCA 2WG0A 2ZIUB 3I1IA 3KB2A 1GT6A 3Q3CA 2ZXFA 1CF2O 4RMGA 3IUJA 2Y1KA 2R97A 3OFVA 4CODB 2WTMA 4MS3B 3TUIC 4ARUA 3IELA 1CY8A 3DE7X 4ECAA 3T3NA 2CXSA 1GZ6A 1FZQA 1VYUA 3CRQA 3EC1A 2JHGA 1QG0A 3L79A 4LY6A 4DE5A 3AU8A 2V0GA 2OAEA 4IV0A 1JQBA 2AFRA 2F1JA 4G4IA 4L74A 3TNDA 5I7RA 2V1UA 1HNXB 1C7JA 2V74B 1K8XB 2BTQB 3I3SR 5GPBA 3WB2A 4XOUA 2GD0A 1J00A 1Y33E 3VC1A 3HR4A 5KPJA 3IIEA 1G5TA 4ZCRA 4LC1A 2LDBA 1GA4A 2A5LA 3LOPA 4M9QA 3BSYA 1XELA 3OM1A 2B94A 4AC9A 2WIFA 3KKMA 1KZGB 4TS4A 3T1YB 4YRMA 3JD3A 4OEHA 3LZ6A 5F9MA 4RMIA 2NM0A 3V1YA 4R1QA 2BWJA 1UBEA 1OF1A 1Q0PA 5KYYA 3FPHA 1X80B 4L27A 4OAQA 2UZIR 1RAIA 5F21A 2H4YA 4WOPA 1M83A 2OY0A 4WASA 1EFRA 2VPYA 3IOYA 1HDGO 1PFQA 4DHEA 1V5FA 2VPPA 4QYSA 2ZIFA 1CHDA 2IRWA 2NXEA 4OXNA 2WLSA 4YRDA 1ORDA 4G9EA 2E37A 4JLJA 2P3OA 4DRXB 4IIBA 3B1ZA 1GTMA 3K70C 1ZONA 2FGKA 2FOLA 1OB2A 1OBVA 3HXTA 4Q7JB 1XNHA 5BQ5A 5JMPA 4AKEA 5B7PA 3TGLA 4UU7A 1M0EA 4US0R 1QCZA 4P4NA 2PCJA 1V8OA 1WUYA 3IHTA 3QQ5A 4QJ4A 4R9VA 3E1GA 4MVJP 3MD9A 5L8VA 1R7RA 1BJRE 1VG1A 1N5JA 1XDDA 4RHYA 4TTTS 4WN3A 3B2QA 5C7YA 4MDYA 4OJYA 2YJ5A 3NJRA 4CM4A 1OTHA 3QF7A 1FNCA 2JGKA 2ZJ2A 1T3LA 2YZ7A 3K0AB 1EQAA 2YN2A 3QYJA 1NP6A 1OFUX 3LUJA 4XFKA 3OZGA 3ZU6A 5JCXA 1KZ4A 2CMDA 3BHJA 2OXIA 3K53A 1HY3A 4C87A 521PA 1QXSA 3CX4A 3O84A 5HIAA 5JBNA 3RJ5A 3S2IA 4LE1A 1G66A 2ZI6A 3K5IA 2MINA 5JY1A 3HMKA 1W9MA 1W34A 3AEQA 3JRXA 3OJCA 3KYCA 3LT0A 1MX1A 5DIFA 1NC1A 4EKEA 2EG5A 4LE0A 2PKWA 3TZLA 1NT2A 2HU8A 1XX6A 4NBSA 3SFZA 2QVYX 2OXRA 3AR4A 2OKCA 2CL0X 1SCAA 3B20A 3MBOA 4GBGA 4XJXA 1QF9A 1Q1GA 2UAGA 1DQPA 4ZGBA 2I3AA 3HB9A 3TOCA 4UW9A 4GR9A 3RK0A 3IBTA 2OUKA 3KYIB 5A5VA 1E5XA 2ZJ3A 2VDWA 4NJEA 2DTDA 2C9OA 4V2IA 4CKEB 3DOOA 2BGUA 1U80A 4HO1X 1WUKS 5DGIA 2CNWD 3RABA 4B8YA 4CKWB 3HKDA 5ALXA 1V41E 5T64A 3R5SA 4JEUA 3HUTA 4PGAA 1XF1A 4AO8A 1J7JA 1QVWA 3DOHA 4WE3A 1V16B 5BV8A 4PXSA 2LNDA 1M74A 4YPFA 1UJCA 1F20A 2QLLA 1JQ3A 5DISB 2YJTD 1JAZA 4KXWA 1D4ZA 1GXSA 1YIDA 2PQMA 5I01A 4G1CA 1KR5A 3T5TA 1AQUA 5E4FA 1K5PA 1WNTA 4PO1A 4HLDA 2YJZA 5ALJA 1YS2X 2V45A 2UYCA 1P4AA 3EMBA 2FPXA 2GT1A 4CLOB 4BLSA 5CVTA 3O1LA 4IRMA 4K87A 2AH5A 4FYYA 4Y2UA 4DUGD 5HZHA 3SIWA 3ZDCA 3P2EA 1EVYA 4Q4DA 3GRRA 4HX5A 2UUCB 2FXVA 3UA3A 2CLDX 2RAPA 3PQ2A 4I1RA 4PFQA 2VLBA 5JQGA 4OXIA 1KVQA 4DJAA 2J0UB 2RH8A 3HJNA 3ZXIA 1ND6A 1P4RA 3GGGA 5CIQA 4MEAA 5LOVA 2WQZA 1FDUA 16PKA 3DBHB 4OGGA 3BH7A 5EGSA 1FCJA 1T24A 1GLNA 1P0PA 1SXGA 3KVNA 1UP7A 4KYIB 1JR3E 5FUBA 5IAGA 5BNWA 3ND8A 5JZMA 1OFGA 1YA6A 1XLTC 1RLJA 1I5RA 2EWMA 1JTVA 2IOYA 2NZJA 2X6RA 2EJBA 3BMNA 4RIGA 4UE3S 1NVBA 3RJZA 3UAXA 3W79A 4CFYA 4CCSA 4WNAB 1PWHA 2IHZA 4HNHA 4IMRA 4I6JA 4B84A 2C4HA 3M70A 2GZ3A 5F5LA 1YL5A 3V48A 5FX2A 1AB5A 1BDJA 1N1EA 2WYUA 3QF4A 2ZPAA 4MQUA 3ANYB 3O1HB 5IVDA 1QHXA 4AXXA 5A3QA 5DMHA 4TVSA 2Q62A 3QJYA 1UP6A 2QVZX 1AK1A 4XUEA 4ZJZA 4AO7A 1KVTA 2IUYA 3EAFA 1XGKA 2V6IA 3H0KA 3EZFA 3HDYA 4JEIA 3O8CA 3I61A 1U9CA 1JALA 3O8DA 3S0JA 4X92A 2XMQA 3IUSA 4WKCA 2IW1A 4J1SA 1R9JA 1GGMA 2GDZA 3Q9NA 3U4DA 1A9XA 2P4HX 2ANCA 4CVNA 3RVNA 4C88A 3VO8A 3LP5A 1UPXA 3DXFA 4MI9A 3TTTA 5GM2A 1CQPA 2HLDA 2OR3A 3AHCA 4JLSA 4UEOA 5P8WA 3T7TA 2AF4C 2RB5A 3ZXYA 4E1VA 4XGIA 2WJWA 2WHQA 4HOYA 5BSTA 3R3YA 3E70C 2XBMA 1INLA 1U3UA 4HL6A 5ULLA 5H8WA 3HCCA 2CWWA 1D9XA 1UJNA 4JA2A 1JHDA 4A27A 2WVHA 4KFCA 3P2KA 1TT5A 3SZGA 1KO1A 2J5KA 2YASA 3B1FA 5BW6B 1PZMA 1CKEA 2M6KA 3W8RA 4C9BA 4YDQA 2G09A 2V6MA 2H2WA 4EQ6B 3EJWA 3PDIA 2NO6A 4CMJA 1MW8X 3FJOA 3RSHA 2XXAA 3O8OB 2HUPA 5KQPA 1GG5A 1C7FA 3UB2A 5I4KA 4XM0A 1VHDA 3LOUA 5B53A 2LBPA 3ZZMA 4PYNA 1SCQA 4J0HA 3ZJVA 2BFPA 1NNSA 3QMVA 4D6PA 3FFBA 3HA7A 1MPTA 3HZZA 3VSBA 1WP9A 4ZAWA 3H0EA 4ZJUA 7REQA 5AVZA 3RYHA 3VISA 1JFSA 3MTAA 1MEJA 3PK0A 4AS3A 1FMFA 1N2CA 1R00A 1Y5IA 3ZJ4A 2VWQA 4NYMQ 4XRRA 1W8IA 1Z08A 3D3QA 4YI5A 3MYRA 1N6IA 4IFBA 4ETIA 1TZ2A 2W6JD 3C6KA 2CK3D 3WA6A 4CMIA 1M2FA 4O2BB 4YAEA 1GN8A 4MR8A 3O2JA 2QVLA 3P0IA 3NETA 4IHJA 3O6VA 1T0JB 3U1BA 3UJNA 4U7DA 1YHZA 4ZP1A 1SVOA 2EP7A 3D3NA 4N49A 5DGDA 1UKAA 2AK3A 2MR5A 2YFQA 2YV2A 3LPNA 4TLLB 3QA9A 1RACA 3RPEA 4BZXA 4IXWA 2UVPA 1LRJA 1MKYA 1EKXA 1XNGA 2I6FA 4LJ4A 4TTIA 4IMPA 5K6AC 4X24A 5GVSA 3O8RA 4MHTA 1M6WA 1ID1A 4PC2A 2ZB4A 2B61A 4RK6A 3KDPA 2MU1A 4CEHB 1FUIA 1GD1O 2HSZA 4J3NA 4K9KA 2HDWA 2FKAA 4BFSA 3X0DA 1M2GA 4CI0B 1JRLA 2XNSA 5CCDA 1NN0A 3WLPA 3ZVMA 1U5BA 1ILWA 4LFAB 1O5OA 1JEEA 1EB9A 2QVGA 1XD2B 5BMOA 1JDTA 3LDHA 5J5CA 2GHQA 2BFNA 3QHAA 3K09C 2OHXA 1MT3A 1PJ2A 1ENZA 3FCSB 3IMCA 4O25A 3NHUA 4K3UA 4L08A 2ATXA 4FQ5A 4B5LA 1VJCA 3AESB 4BB6A 4OA8A 2OC4A 3EHDA 4RK4A 1XZNA 1RBMA 2CBXA 4FM9A 3FRHA 3QU7A 4IJ5A 1I2BA 4ZO6A 4CUJA 2QE6A 1HQCA 1Y8CA 3EEQA 1IZ0A 2HK7A 3Q3EA 4IM7A 1XVUA 1VI5A 1JB1A 1MAAA 3URMA 3DW1X 3HBLA 1MABB 4DWWA 4QEDA 3A1UA 1X38A 4NU5A 5DW0A 2ZJYA 1KIFA 4L8YA 1K27A 1OWNA 2W2LA 5K3AA 1U8ZA 2HV8A 2I2CA 2PGNA 3PV0A 3FTPA 4IEFB 4DABA 1XRNA 4X8LA 5BNTA 3GLFE 5KREA 3GGSA 3BMOA 3GRZA 1F12A 2PX2A 2OCXA 3B1YA 4CCYB 5C5DA 4TTSA 1F38A 3IAHA 4LJYA 3R7DA 4NFYA 3AUSA 4FFRA 4I2VA 4JC4A 2WUWE 4LQCA 4QQKA 2NXCA 4TOIA 1KS9A 2WABA 1Y82A 2MR6A 3W8EA 1XVTA 2JLRA 4OOEA 1C9JA 3PUYA 1U8EA 4P33A 4DPMA 1FRVA 2VP3A 1Y6RA 1ZH6A 1CRLA 4CM9A 2HQSA 2A57A 3T34A 2BJVA 2HA4A 2X5NA 4GZ5A 3NALA 2WG2A 3VTKA 1EX1A 4FJ1A 5HE9A 3AVQA 4BAGA 4TYWA 4PQRA 3FKQA 5AI8A 5JXJA 3J7AC 3ZH9B 4XX0B 1PV2A 4FR0A 2IPAB 1F8UA 1QV7A 2PA3A 1IATA 3UWDA 5INTA 2WWYA 4J0KA 1CDDA 1ZX1A 2FZEA 2ZKLA 3C3DA 4QU9A 4QUGA 3PEEA 3DEKA 3HA3A 5JPCA 3ABZA 3NASA 1JPVA 1KYYA 1FB5A 3PPIA 4F5ZA 2A1UB 1RP1A 2G36A 4RQBA 3EZLA 2WQ7A 2P6RA 3X2FA 3DKRA 3ZD7A 1GVHA 1K3FA 5ALDA 1KFKB 4GX2A 2GN2A 2JATA 4C0QC 1H22A 4FLEA 4J49A 2NXNA 3F7MA 2VA8A 1X74A 3CEMA 3NDRA 5CBPB 2ZUDA 2DR0A 3REOA 3HABA 4JIMA 1UZNA 1O89A 3O92A 5BORA 2Z5LA 3CO0S 4OBWA 2GPNA 4XWTA 5JDIA 3BSSA 5DP1A 3H3FA 4D79A 3AC0A 4DVGA 3GVXA 1I4DD 3QIAA 4KQIA 4AMVA 2MDTA 1DJPA 2BZGA 2E4YA 2XWJI 3DWFA 4HLUC 5B3AA 4AF7A 5DK4A 2GWRA 2FSFA 3U0BA 1C3OB 2HXYA 2O9JA 5CIYA 4HRXA 2FWJA 5HFAA 4QGSA 4UCWA 3BJEA 2YN0A 5KCMA 2RGEA 3AR5A 5F7XA 3QFFA 5EE0A 4NV0A 4ONEA 2C2YA 4M1TA 1ORWA 2A1TS 3V2HA 3NLLA 3FHTA 3I30X 4UOZA 5C46F 3W06A 1AHIA 3O1JC 4OXRA 2M6LA 4HWTA 1DRJA 2ZSIA 4YUZA 3KLNA 4JI6B 1IN6A 1DARA 1NTOA 1TVKA 2C3UA 5SV2A 1P19A 2A7QA 1GA6A 4E33A 3H05A 2PT9A 4JXZA 1YB1A 1Z26A 1I0ZA 3E0XA 3N2ZB 3G89A 3MT0A 5HSGA 3PC7A 2O3TA 4L9SA 4DZZA 5JRJA 1CY1A 1R6VA 3RS5A 3R0QA 1N1MA 1U3TA 1I2DA 2JW5A 5DT2A 1YFJA 2H2GA 1DKNA 2PU7A 4M1EA 2EKZA 3PNKA 2PGDA 3E7XA 5FBLB 3DXYA 2B78A 4J16A 1J56A 3GUHA 4RY8A 5J43A 4AUKA 1H3FA 1CUHA 4EJMA 5ITWA 3HJCA 1UXHA 1GYRA 1IEVA 3NU1A 5F78A 4URZR 4TL6A 1H1DA 4KK3A 4KQ1A 2D62A 1ZI6A 4LYAA 4J7UA 3ZQ4A 1ETUA 4TUYF 2XT0A 4HN2A 1H05A 1XTSA 1GJRA 1L8OA 1L5VA 2WPDD 3SX4A 3O47A 4E08A 3SQMA 1EAYA 4BZQA 3NCTA 1QV6A 1KSJA 4JLVA 1CZNA 3SJ7A 1BE8A 3NHSA 3FVRA 4R51A 3STWA 4PGGA 1XMIA 1A8IA 1IJBA 1X7GA 1C7QA 2XQVA 1QU3A 3V8PA 4EZIA 1JEYB 3OOJA 4C6SA 2PVCA 3CCCA 2C3PA 4M99A 3ZUPA 2O54A 3PYXA 1JPUA 3GUUA 1N1GA 3O82A 3OY2A 3VNAA 1H5UA 2J6BA 3CSSA 2HA2A 4KR7A 2PR2A 1OA1A 1T1JA 1V8ZA 3MXOA 1IVSA 3AY3A 4QUAA 1JXMA 3QBVA 3RAPR 4E03A 4RZHA 1PN3A 2YOGA 2PWAA 3HG7A 3G2OA 4HFRA 1F0KA 2OZPA 1TF7A 4Q6BA 1ZIOA 2O4UX 2F62A 3RYFA 2VVTA 4DBLC 3ICCA 4HT3B 1T6NA 1QORA 2VYNA 4EJ6A 3EODA 4I1YA 3MGAA 4KLZA 4M9XA 5DTMA 3SR0A 4E31A 3IHLA 3LYAA 4KPEC 4AUMA 2IHJA 4LHSA 3QKRB 4FS3A 3RJMA 1YK1A 4F5YA 3ZOKA 2WOOA 2JS7A 3QXGA 4FIZA 4GZ6A 3KXIA 4O4JF 1KVUA 1UEJA 4DUGA 5CDSA 1M9NA 1RXVA 3AMVA 5K03A 2WV7A 2X0KA 4NCXA 1OH6A 3GLQA 1NC3A 2VDPB 4L6AA 2O5RA 5JNVA 3UMMA 1KHTA 1O0SA 4OL0A 1IC6A 2AYXA 5EMLA 1R18A 3U31A 4OIMA 3UHFA 4PSKA 4M55A 3A14A 1W0JD 3PHIA 4H77A 3WMRA 4IH1A 3QU4A 1VP9A 1B42A 3INRA 1E60A 4U02A 2DAPA 1HQKA 2G07A 4B6RA 2H92A 4IEEA 4H6PA 1SUAA 5L53A 4DB2A 4Q3KA 5CLHA 5CT8A 4R7GA 1YCFA 1NXOA 1TYEB 3IUBA 4M0PA 4ZXPA 5E7IA 3R7AA 1RD4A 3DF7A 3WLRA 1TYZA 4NBRA 3UT5B 1FFXB 1AA6A 2CL5A 4KOEC 4ZZIA 4RUKA 3WGNA 4MARA 1KU6A 1Z8DA 3RB8A 4EP1A 3CVWA 1WX1A 3B5IA 3MWKA 3MWGA 3LBFA 4JHXA 3AVVA 1K0UA 2A7XA 1HE4A 3IEIA 3QW2A 2PRKA 3VNBA 2EFDB 1JLRA 1JSLA 3VZBA 3P9CA 4G1MB 1K6JA 2X40A 4LF6B 3H9BA 4MB2A 3EDMA 3OCWA 5F12A 1IY0A 1GPYA 5BPFA 1PO7A 1Q95A 2EWWA 5MGBA 3PBKA 2GPAA 2IY7A 1P39A 1ZGZA 1F60A 2CUTA 5BV1A 3CO5A 2YKGA 4IGFA 2VN8A 3OLYA 2FLVA 4LSZA 4BU1A 1YDEA 3B78A 3WISA 1ZK1A 2P6PA 1S2MA 2RH5A 3QG5A 5EJ6A 2G0AA 3HCWA 1DOAA 1K86A 5IBPA 5REQB 1DG3A 1JXAA 3BMCA 2CDNA 3MWLA 4P5DA 3DWEX 4ZU3A 2QTLA 2A92A 3UAGA 4PTZA 1GUZA 4TM7A 5JU6A 1HL3A 1RC8A 1FFWA 3OZUA 4JVNA 2GEKA 1NY6A 1YB5A 4NR0A 3GRYA 4RKWA 1N9GA 3WGLA 4GM1A 2VK2A 3LAWA 3QU9A 1SXJE 4DLYA 2BYTA 3WYFA 2IBMA 4L3WA 2CXQA 1OAOC 3THSA 2JLYA 2NUAB 3TQOA 1GG9A 2WNHA 1UZLA 1JFLA 3R7FA 2W93A 3PEVA 1PS0A 4NULA 4BJ6A 4DNOA 1DKRA 2VZ0A 3CRNA 3EIEA 3KQVA 1DHTA 4MLPA 4B87A 5CH5A 4C22A 5FAKA 3AR6A 3KOZA 4B3SB 5HE8A 2HPHA 3PJDA 3VAAA 1B43A 1PHPA 5CDFA 2Y3IA 2R00C 4Y7CA 4B9EA 1HNZB 4IDDA 1Y80A 5KJCA 3O8QB 3NVKI 4AM8A 1NUAA 2LKCA 3QEKA 2L69A 4E6PA 5I7EA 3NB0A 5EE3A 1W4AA 3SEFA 2ZUFA 2IEYA 3LHKA 4PX2A 2REQB 4QOJA 3D0RA