1NUTA

Crystal structure of human cytosolic nmn/namn adenylyltransferase complexed with atp analog
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
232
structure length
212
Chain Sequence
b'SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKSG76
publication title STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 72
structure length 212
sequence length 232
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2003-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nutA00
2DUMA 1JZSA 1N2GA 1K4KA 3K32A 4ZT3A 1OWMA 1QTQA 3GLVA 1NUQA 2WB2A 2V0CA 1G59A 1KAMA 1NUSA 3MLBA 4MLPA 3CLSC 3FHJA 4YBRA 1EFPB 3VGJA 1N2BA 3KT6A 4CDMA 4EG1A 2DERA 3IVCA 3FI0A 2A7XA 2VTBA 4KKVA 3RK0A 4JXXA 5F23A 3COYA 3INNA 1XJQA 4Q16A 1EFVA 2JANA 2CSXA 1WKBA 4MUNA 3VRHA 2CUZA 4ND6A 1F7VA 1TEZA 4EG8A 5J58A 5KCMA 2YY5A 3COZA 2PIDA 1KQOA 1KP3A 2X3FA 1JMVA 1PFYA 1TYAE 5FO1A 4ZCPA 1J1UA 1IHOA 2AKEA 3COVA 3AL0C 1LI5A 1U3DA 3Q4GA 1QQTA 3COWA 4MQ6A 1N2JA 3IUEA 4MAFA 3DO8A 2HGZA 3SZ3A 4QBTA 1N1DA 2O5RA 3UC5A 3IMGA 3CLSD 3ZGZA 5KHAA 3A2KA 3A05A 1MAUA 2A1UB 4U8HA 2C5SA 3HZRA 2PXHA 2IJGX 4MW5A 3ZJVA 5DASA 1TYCA 2DETA 5H7XA 1YULA 2E0IA 1O5TA 2J08A 4QRDA 2H2AA 2BTEA 3PNBA 1S4MA 1KKUA 3CLRC 1WY5A 3OTWA 2A1TS 4YP6A 1F9AA 1B6TA 5FNZA 4E1AA 2G36A 3KFLA 4GRIA 3QTTA 3VU8A 3AFHA 1YIAA 1OWLA 3TZLA 5LM3A 4JXZA 3DPIA 3PXUA 1J20A 4PY2A 1CT9A 2Z08A 3CVXA 5BNZA 3SYTA 4MW7A 3FIUA 1WJGA 2CYAA 1WQ4A 1X6VA 3CLTC 4AQ7A 2WSIA 4ZCSA 3H9CA 4XSVA 4DDKA 1QRUA 5K0SA 4YP7A 1KAQA 1GPMA 5DEOA 1KQNA 2D5BA 1NUPA 3H99A 4XFJA 1IQ0A 3BL5A 4MWBA 1V47A 1KH3A 3IODA 4ZT2A 1H1TA 4KR9A 4DDMA 1KORA 2AG6A 1T9GS 5H16A 2BYTA 2V0GA 1WOYA 3E27A 1U3CA 2A88A 3N05A 1DNPA 1I6LA 1T6XA 1WQ3A 4ND7A 2X1LA 3CLRD 2GOYA 3P0IA 1JHDA 3HFJA 4HPWA 4NAUA 2AZXA 3IUBA 4G5FA 1MRZA 3JXEA 4MULA 1JIJA 1TYBE 2E89A 3P0HA 4EG3A 1GTSA 1HYBA 4DDHA 4MWCA 4J76A 1WXHA 3SEZA 4JFAA 4NDAA 1XNGA 1I6MA 4ZT7A 1GZUA 1KH2A 2JAXA 2EL7A 1LW7A 4L2IA 1FFYA 4K03A 4MW6A 3HL4A 3CLTD 2X1MA 3MMXA 3FOCA 1R6TA 4UZEA 2IP1A 1NUTA 4KR6A 2X0KA 3G59A 4KR7A 5K0TA 2D54A 4NAHA 1N3LA 4MUGA 1O94D 5EKDA 1EXDA 4ARIA 4ZCQA 4MW4A 1OD6A 3H97A 4FZJA 4OUDB 3M5WA 3C8ZA 3AG6A 2A1UA 2VXOA 3ZUGA 4MUFA 4PBRA 1PFWA 5LFAA 5TEWA 2A1TR 4HJXA 3U1VA 3NBKA 1BS2A 1IVSA 1T6YA 1NUUA 4MWEA 3DV2A 3L92A 1EJ2A 3HGMA 4EF6A 1X8XA 5DB4A 2YWBA 3PNYA 3TQIA 5TGTA 4L2IB 2J4DA 3S3TA 2CFOA 3CR8A 4CDNA 2PZAA 1G8GA 3FWKA 3MUEA 2J09A 1J09A 1EE1A 4ZT5A 1J21A 1K92A 4RPIA 1OBCA 3RJZA 1EUYA 1O96B 2E18A 1IRXA 4YMIA 3CLUC 4MWDA 4KPUB 1PFUA 3FY4A 3AKZA 3FNRA 3P0JA 2CV2A 1T9GR 4MVXA 1TYDE 2QUHA 4I6JA 1Q11A 3ZXIA 3UOWA 1O95D 1T6ZA 3ZIUA 5J59A 4UZFA 1O0BA 3OP1A 1ZH6A 3IVXA 1M8KA 1JECA 4RUKA 2RE8A 4MUJA 2GKSA 1JILA 3A04A 1N2IA 2DEUA 1PG0A 1V8FA 1J1ZA 1GN8A 3G6KA 1NZJA 1O6BA 3HMQA 1GTRA 2J07A 1J70A 2A4MA 1XNHA 1YI8A 4J75A 2YWCA 1YUMA 4WSOA 1F4LA 2A86A 3SP1A 4EG6A 2QTNA 1M8GA 4YP5A 1UFVA 4DJAA 2O8VA 3N2YA 2EJCA 1KP2A 2XRZA 1QNFA 3L93A 1D2RA 3LOQA 1NSYA 1R6XA 4ARCA 3SZGA 1Q15A 3RHSA 3X1KA 1QRSA 1NP7A 1I2DA 1OBHA 2HZ7A 1K97A 3CLUD 1H3EA 3UK2A 1O94C 4F4HA 3F3MA 3DLAA 3ZJTA 4NATA 4OJMX 1N75A 4R0NA 4ZCTA 1QJCA 1WXFA 2PG3A 1YUNA 1P7PA 2CV1A 2DXIA 4X0EA 2GM3A 1WZ2A 2NZ2A 3FG9A 4QREA 1JIKA 2ZP1A 3GUZA 1I6KA 3IMEA 3ND5A 2NSYA 4OUDA 3RBAA 3CA8A 1TQ8A 2QJTA 1A8HA 2IELA 2TS1A 2CYBA 5JBNA 1OWOA 3CVWA 2ZUFA 3HV0A 1PFVA 2PFSA 2R5WA 3QE4A 3P52A 4NX2A 1WXIA 3ZJUA 2OV4A 4NZPA 3KT0A 1O97D 4R2MA 2HMAA 3IH5A 1PG2A 1MB9A 3SEQA 1O0CA 1M8JA 2B7LA 4MUHA 5IHXA 2CT8A 3UY4A 4MVWA 1N78A 4ZT6A 3NV7A 1U7DA 4XFDA 2WQ7A 4MW2A 4I6GA 1KR2A 2PZ8A 4HK4A 1JEDA 2WQ6A 2I1LA 3IVGA 4HJRA 1O96A 4G6ZA 1COZA 4MW9A 1N2HA 1O95C 3H05A 4MUKA 4KPUA 1MJHA 2PZBA 3PNVA 4PBTA 3AG5A 4EFKA 4F3RA 1VL2A 3ND6A 2D13A 1U7XA 4CT0A 1ZH0A 3ILVA 1H3FA 3UMVA 1VBKA 3IDFA 3IMCA 2DR2A 1NURA 2OQ2A 3X1MA 2QUJA 2XRYA 5IJXA 5TEVA 4AS1A 1VBMA 3FH0A 1EUQA 4WNYA 2QJFA 3SDBA 4S1OA 1OWNA 3GMIA 3KT8A 3TQOA 1MBZA 4K0RA 2J5BA 3KT3A 3MXTA 5LLTA 1WXGA 2YXNA 2DLCX 2RD2A 3TNJA 1H3NA 1Q77A 1ZUNA 5FO0A 1G8FA 1SURA 1K4MA 3IOEA 3G5AA 2JA2A 4EG5A 5HG0A 1MOPA 4CQNA 1VLHA 3K9WA 3CVVA 4ZCRA 3CVUA 1XNJA 3MLAA 1IFXA 1OWPA 4G5YA 3X1JA 3ZXSA 1QU3A 3N8HA 2VTBB 5DK4A 3CVYA 4GU5A 3D6VA 1RQGA 4A91A 1LI7A 2CYCA 1EFVB 1ULHA 5TS2A 3IOBA 3RK1A 3TZEA 4DE5A 1FYDA 3D6UA 5HUHA 3LE8A 1KH1A 3N9IA 3QTBA 1VBNA 3ISJA 3PRHA 3ND7A 4DNXA 4JZYA 1KQPA 4I6EA 1F7UA 3FDXA 1O97C 1N2OA 1IQUA 4EG7A 3TS1A 1ILEA 1IH8A 1JZQA 1R6UA 2H29A 2ZUEA 3I05A 4R2LA 1JEEA 1Q19A 1M83A 1WXEA 1Y42X 2QJOA 1N77A 4BWVA 2CV0A 4MUEA 3IOCA 1N2EA 1MC1A 2E21A 4TS1A 4DLPA 5J5AA 3AIIA 1U0BB 1QRTA 4MVYA 1IQRA 1JIIA 3Q12A 4MUIA 5AHWA 4U7JA 3NBAA 1QU2A 2Z3VA 3LCJA 4MVCA 1EFPA 2QTMA 3Q10A 1MB2A 4H3SA 4MW1A 1M8FA 5HUJA 4MW0A 1M1ZA 1GAXA 3ELBA 5KWVA 2Z09A 2QUKA 1MAWA 4EGAA 4EG4A 4JYZA 1NYLA 1M8PA 1ZJWA 1NI5A 3H9BA 4PBSA 2DPLA 2QTRA 2A84A 4Q93A 4ZT4A 4P2BA 1TFUA 2QUIA 1GLNA 1JGTA 3A4IA 3FETA 1G8HA 1YIDA 4U63A 3RFFA
chains in the Genus database with same CATH superfamily
4WN3A 4D4IA 1L5HB 5D01A 2DH6A 1RPTA 4EB0A 5JXHA 3K32A 2M32A 3L49A 1H1LA 4HUQA 2B8WA 3REQB 4D6XA 4AAYA 1NQTA 1ABBA 1CJBA 5HRAA 1DG3A 5F33A 4LI0A 3N2KA 4GEGA 2X22A 4MAAA 2ZAIA 5T8KA 4MQLA 1BRMA 4MLPA 4EA6A 4ENPA 2VQFB 2Q0QA 2V7UA 5FBZA 4PZPA 2HLDD 5T4BA 4B17A 1Z0AA 4PCLA 1S4QA 4EG1A 3WWOA 5K01A 1BVRA 2JAOA 2JAWA 2ECOA 2PT5A 3GLHA 3H7AA 4CKYA 1ZGCA 1LFDB 1TM1E 4GM0A 1KWKA 3CRW1 5C1PA 1VHDA 1PGOA 1Y8ZA 3VPBA 2I7VA 3A3KA 2JIOA 1W4RA 3SJAA 3ESCA 1GQQA 1ONPA 2IGTA 1ODLA 2XOKA 4PFKA 4PINA 5AHOA 5E6RB 1PZXA 5I7SA 3TOXA 2QRVB 5JNTA 3NIGB 2ZAMA 3F5FA 4FDTA 4ND6A 1ZD4A 2J8ZA 3H8SA 4EG8A 1O8CA 4RIFA 2FUG1 5A04A 1VYHA 1OE0A 3UJ6A 4EGCB 1OH6A 4ZAGA 1FSFA 1VLZA 4QDZA 2ZI5A 3PHBE 3T5AA 3PS9A 4AY2A 1XCLA 3DAGA 3HY4A 1KP3A 4F6RB 2LCIA 1YI1A 2R1VA 2VDVE 2FPIB 4K3UA 3W2FA 3PPYA 1P6QA 3HCFA 1L4UA 2Q1WA 1YDHA 3B6MA 4QXRA 3UKDA 3JWIA 3L7JA 4UEQA 5HKAA 3M89A 3ZDDA 3QGMA 5JXIA 1X8LA 5HXAA 1M1YA 2OKGA 3BJMA 1AQLA 1L5WA 1E3IA 3ETNA 5K20A 3COSA 4JJGA 3L0CA 1D3AA 1H66A 1L7EA 1QE0A 1ZOOA 2BMFA 2FW6A 4CKBB 2X3UA 4Y0AA 3UOAB 5C1IA 3BC1A 2FLVA 3VO1A 3EW9A 3K72B 1PJRA 4BU0A 5KVAA 4X44A 3BE5A 5BR8B 2PQMA 3VSCA 3P0EA 1IOVA 1KZHA 2OP0A 4MOWA 5T3UA 4QT4A 2YCLA 3DAHA 3SEFA 2JRLA 3UMMA 4QUHA 1E1KA 2O5CA 3FBWA 2QU8A 1F0PA 2A1TS 4AICA 3KR1A 4FFBA 4F0JA 4R71A 3WO1A 5P21A 3DZCA 3EA4A 4KRXA 4ZJUA 1DCTA 2QPTA 5JJ5A 3WL6A 1H9CA 2Q9AA 4V1CB 2ATCA 4KQ9A 1CT9A 3O03A 4EYOA 1NU6A 3PNMA 3T94A 2HQRA 1FTNA 1GNQA 3ZLVA 5IVHA 3O84A 3M2TA 4IFEA 2R96A 1CIVA 5C1BA 2A5JA 2WHYA 5KQSA 5IRCD 3PFKA 1KVRA 1PWZA 3PPIA 4KQCA 4YP7A 1Y8RB 2QVGA 4RYLA 2AQ8A 2PX3A 3VFDA 1XDDA 4AW9A 3C7TA 3DVAA 3LWZA 3HKBB 3QFFA 4QNNA 5EHXA 4XFJA 5DMXA 4JI0B 121PA 1PBTA 4GPD1 3IODA 3V33A 2PE5A 2HCJB 3WQRA 4HXEB 5FDFA 4LRWA 1VIDA 1TE2A 2QRPA 4C7XA 1XTQA 4EMSA 5JCZA 5LIPA 2V0GA 2H2WA 1CF9A 4DAOA 2J46A 1KYYA 4HDQB 1I6LA 1EDEA 1T6BY 3GT0A 1LZLA 2EATA 3RS5A 3WDSA 2DR0A 4CIXA 2X1LA 4TLMB 2AFIA 5ECWA 2V55B 1F12A 2X6QA 3AW9A 4DJJA 3CVOA 4HS4A 2GD2A 3U3ZA 1MRZA 3RJ9A 1FYVA 1QQ7A 1OAOA 2QI9F 2ZK7A 3PNPA 3HYNA 3P0FA 2FDRA 1FU8A 2XAUA 4MDEA 1FMLA 1MW9X 2NZUG 2X8WA 2GMWA 1T8RA 5KCZA 4IIGA 4MWCA 1V7ZA 2H5EA 4F2PA 1FDWA 2H7XA 3CZ4A 2W0SA 4CUZA 1N5MA 3PWKA 1DUVG 1LW7A 4MVJM 3CISA 4CN8A 4D42A 3GB9A 2WHQA 2RJ3A 3LCVB 3N5CA 3X2FA 1C3JA 1IUKA 1MGOA 2PWAA 3CMMA 3MEQA 2CXNA 2GZHA 5IXSA 5CW1A 1RMYA 2CLHB 1PUJA 3P97A 3TI9A 3P9YA 3TJRA 1TIPA 3M6FA 5CX1A 4M9RA 3V4LA 1CF4A 1Y8CA 4HDOB 5F2NA 2O8DA 2D2IA 1XLVA 3OE4A 3P9SA 4IMJB 5EKDA 1VIMA 3M7IA 4Y1RA 5BN3B 3U56A 5LSAA 2HYIC 2VJDA 1EGMB 1CS0A 4G86A 4TSFD 3RR2A 4OI1A 1GWNA 2PS1A 4FYKA 4UUOA 2H1FA 1WV1A 5DV9A 1N0HA 4BO2A 3BXEA 3CO0S 4RJTA 1KMHB 4OM8A 4DGQA 2WWYA 3QUCA 1ONSA 1YBVA 4ARAA 2O7QA 8AT1A 1Q7RA 4N0PA 4P4SA 2R4QA 1FQKA 4IVNA 4KWEA 3IJPA 1EVZA 4X1KA 3V2HA 4A6XA 4EYGA 2QYOA 3K1AB 3WMRA 2D59A 4RQAA 1J49A 1FJ2A 1K08A 1GUFA 5AOVA 1AUXA 3GJTA 1XI2A 5AI9A 4CKEA 5HKKD 3GMDA 4BVGA 2QBYB 4F8JA 3W5SA 4AJLA 4MYDA 2WJ3A 1NOKA 2EFDB 2P9YA 2ZOSA 3ER9A 4W1SA 2GAJA 1EQAA 1OI3A 2WE8A 3CURA 3EVTA 3M6AA 2P5SA 1YR1A 3FPBA 2Y77A 4U9IS 2FHPA 3I9KA 1PLKA 4H1HA 3KSDO 1QFZA 1FFAA 2D0DA 1SHJA 3JWHA 4O1HA 1SQ0A 2FR0A 3OOWA 2AF3C 4E30A 2Z3ZA 3B52X 2AVNA 1QO9A 3MGBA 4P36A 1ZSNA 3CV3A 1L1RA 4J1NA 5FLYA 4BE9A 5DM4A 1JN0A 4ACBA 1H4QA 2A9OA 1KGSA 2WNIA 1C7RA 1TYDE 4Q1CA 1A9OA 1U0SY 3A6KA 3PJEA 5IBCA 4PAQA 3H6KA 1KEVA 3FRJA 4XI9A 3VC1A 4DJEC 3AEZA 3E8XA 2Y1KA 1YL7A 3OP1A 3K6RA 5K3FB 1GYQA 1U7WA 3HU3A 3QSGA 1KS9A 4KYUA 3NT2A 3ELYA 3LQYA 4DW8A 1YZHA 4JT8A 2PV0A 4Y18A 3KQOA 1ZHHA 4YCBA 1MPXA 1Z9BA 4ZP1A 3LPMA 1UXIA 4JI8B 2PLFA 2F48A 3CZ5A 2WU0A 1MV5A 2OLKA 4DMMA 3THXB 3W4IA 2ATVA 5CA0B 1JT2A 5IAAA 2PKXA 4MX8A 1FXUA 3VH2A 5BUSA 4RY2A 4BNDB 3QEJA 2BHRA 4DJAA 2O8VA 3U3MA 1W2GA 4HAYA 1VHJA 1IE3A 2VDOB 3PYLA 2YUTA 3L93A 3UCFA 5DYTA 2QVCA 3H2GA 1CD5A 4G1UC 4R2HA 2BD0A 2FPGB 3GCWA 4ND5A 1XCBA 4WK0B 5EJ7A 2BISA 4R8KA 3OJWA 4R1SA 1ML4A 3W2GA 3ESBA 2HY7A 2P27A 4MVJA 3LZCA 2G8NA 2Z9BA 1CDOA 3DXFA 4IZ6A 4OM7A 3O2SB 1O94C 2C54A 4UAVA 1NL3A 4BFWA 2ABWA 1ZW1A 3M6MD 3HJGA 3KKMA 1AVTA 1UFOA 3C2QA 2BBWA 3IHWA 1PVDA 4FJ2A 4QPNA 1RT9A 1P4HA 3AFNA 3ONWA 5ALZA 5CFMA 4KG7A 1P7PA 2OK8A 5ALMA 1VJ5A 3TG8A 4R31A 3E05A 4HFNA 1OROA 1R2QA 2FP4A 2XV1A 1M6WA 2MSKA 4ZYLA 4WY8A 4ODIA 1C1DB 1RYFA 2AUNA 1WY7A 1E2MA 1QIIA 2LKCA 2JIDA 2QM7A 4M86A 4KQ6A 1O77A 1L7MA 2JPDA 1MQ9A 4K9NA 3G2IA 3LUHA 5CYFA 3HB9A 3L04A 3M4XA 2JLQA 4LX0A 1DAMA 3RYCB 3EDCA 3GQBA 1XZ8A 3W4JA 2ZRPA 3FKSA 3TRIA 4DA0A 2IXAA 2OFOA 4C87A 1WXIA 3EDMA 1Z7EA 2G40A 3I5AA 3A6FA 3UK6A 3C8HA 4CV3A 1QYWA 4QDXA 3E3AA 1CLEA 2D8AA 4PVCA 1CR2A 1MHPA 1Z5OA 2GARA 5FULA 1E1QA 3O47A 4DJDC 1E6EA 2VPTA 2V7BA 3F6RA 3QVGA 4AROA 2QLJA 4YRLA 4JBGA 2MR6A 1FRQA 1XRMA 2QUAA 3OSZA 5F5XA 3SEQA 5C7IO 2AR0A 3N7AA 2B7BA 4O2BB 2E48A 5EYPB 3DEJA 4ZMBA 5C9ZA 2E37A 4J0HA 4AVYA 1U7DA 1BWSA 2NZXA 3RHFA 2WWHA 4LJ5A 3DFMA 3EW7A 3G49A 1KE1A 3TNFA 2O9JA 4YRTA 8LDHA 3GRAA 1DBQA 3ITEA 1NRJB 4BIMA 1O95C 3CNLA 3R76A 4MVJP 4OBWA 1X7HA 2IZ5A 4OV6B 3RS8A 3GUHA 4BVEA 2F7SA 3RSZA 4YH1A 1YCHA 1ZL0A 4MI6A 1RHUA 2FJ0A 3KQSA 3H1EA 2YL2A 2XA9A 2GAOA 5M7EA 4JITA 4BX9A 4X20B 1JHPA 3GPIA 3IDFA 3MSXA 1XK6A 5BSTA 2BBTA 3GZNA 2OQ2A 1LNZA 3ZXXA 1J5PA 2CKDA 13PKA 3L7KA 1P0PA 2PGOA 3KQMA 1FDTA 2GDZA 5AVKA 2I6QA 4OL9A 3IDZA 5D3MA 2NUBA 3EGOA 2FW1A 1B1AA 4UC0A 1NMSA 1OXTA 3IPCA 4GGOA 2QW1A 1X2EA 1WHSA 3T1OA 2AHRA 3AFIA 4ENRA 5KYKA 4XLTA 1L5NA 2CVFA 3UN1A 3IQIX 3PD1A 3JAKB 4TWZA 4I2NA 5LZ9A 1WZIA 1X7XB 3HN7A 3WLMA 3KUXA 1JFLA 4CKWA 3C3MA 4MQFA 2CLFB 4G09A 3V55A 1AHHA 2LR0A 1XLTC 3D7RA 3KOWA 1QAMA 3EQ9A 3AHGA 5HG0A 5J9FA 3GCGA 3MTQA 1E6CA 5HJEA 1Q12A 5JU6A 1EM8B 1XMJA 3KJHA 5HIKA 3OIFA 1Q1EA 2IHTA 3DC2A 3JD2A 2Z9DA 6REQB 2XQKA 3LQ1A 4KOAA 2B94A 3WB0A 1XQ1A 4BJ5A 3U4MA 1X19A 2JFWA 2SKCA 2ROQA 3IPYA 1JZTA 3OBBA 1UWVA 5BY2A 1WEKA 4LDZA 4R2JA 4CWAA 4BVJA 2E85A 1SC6A 4N6GA 1GDDA 4ZMSA 3BA1A 4DWOA 2A67A 5ENVA 4F4JA 2C5FA 1VB3A 1ZCFA 4M87A 3SSAA 4DCMA 1TOAA 4B2YA 4DLYA 4ENUA 2ECPA 3V8VA 1ZC3A 3NBYC 3EEIA 4ER5A 4EVQA 1AHPA 3NXKA 4JB8A 1KDVA 1CVLA 4JJAA 2SBTA 3N86A 1MJ5A 2YNMA 3R3YA 3CLVA 2WJZB 4UNPA 4UNIA 3CUTA 4H9GA 4WK6A 2BJWA 5D5QA 5JAUA 1DWPA 4QEKA 2EZUA 4LVOA 4D5GA 4DADA 1OZFA 1SBTA 3OPYB 1AK2A 4OQEA 1QH9A 4V39A 4BX8A 4A10A 4HV4A 1DKRA 2XF8A 2NXEA 3IOCA 2V6GA 1ULUA 3ENQA 1PD0A 4YQEA 3SZUA 2RKWA 5FP0A 4DFDA 4CF5A 1ADBA 1U2SA 3KJQA 1ANKA 1VHWA 3HB4X 2L82A 1MO2A 1YZQA 2OAP1 2GPJA 4OYRA 5JQGF 3GX1A 4E3WA 1I9GA 2PIAA 2RKOA 1R0WA 2O7SA 4ZHQF 2HJWA 1A72A 4FCVA 1RXEA 2VRBA 2X2EA 2ZTVA 4LXUA 4U7JA 1I4LD 1NF8A 4V0KA 3FTCA 5ALPA 5C8YA 3WA6A 2PTGA 1ZIOA 4MA4A 4RVFA 5IMBA 1FUEA 1H2RS 4QT0A 2XRMA 2HTEA 3GLHE 4FQ8A 3H8VA 4X3PA 4PPQA 4MVCA 5KX5F 1JQDA 2C7GA 1LDBA 1EFPA 3OZUA 1E79A 1MB2A 2AMYA 1A27A 2C3OA 4X71A 3W5JA 4D96A 3THWA 2QY6A 2GB4A 4DYHA 4CBVA 4CEJA 2DJIA 2JJ8A 2WR8A 3JR7A 4K6MA 4WINA 1QGDA 1R8JA 4IV8A 3L8GA 1NP3A 5FR1A 3U13A 4MQ5A 2CDBA 5GP1A 1OFGA 3ZGOA 4LF5B 4J4BA 2Q27A 2IYWA 2IUYA 2HREA 2VJPA 3HP1A 4Q82A 3UHJA 4DIFA 1IZ8A 4PBSA 4YPVA 3RUAA 2EP8A 1U7OA 3F7NA 3MAGA 2QE7D 1LB1B 1TFUA 2BTQA 4O59O 3A4IA 5HYVA 1NN0A 2C2KA 1D09A 1M0SA 1Y3HA 4JBWA 4N7JA 4OOEA 4OQFA 1KI3A 3ELUA 3G9XA 3H19A 2FVXA 1DDGA 4KUHA 1E8MA 4RA9B 4YXFA 2JW5A 1QPGA 1ZVKA 4R40A 1LBEA 2VDPB 1Q1BA 1A7AA 2IYYA 4LE1A 3X44A 4CW7A 4X6UA 5FTLA 2WB2A 4J1TC 3ZGLA 4RJ2A 2P68A 2ACVA 3W1EA 1M1YE 5CB8A 1DBIA 1EAYA 2ZI9A 1ACMA 2Q41A 3AB7A 4OHWA 2HD4A 8MHTA 2R2AA 4QXOA 2DFLA 2C7QA 1JU3A 2G76A 2OMEA 1ZOIA 2X0EA 2CZGA 1II9A 2PD6A 5EUMA 4KKVA 1X7WB 3D6JA 2P75A 2FU5C 1RQXA 2FEPA 3AKDA 1B0PA 2I66A 3FCAA 1XJQA 3DOIA 4G0YA 3RRMA 4YV1A 1OU4A 2M6KA 3KEFA 3SKYA 4V0QA 5AVZA 1NP6A 3S0JA 1OYVA 3VRHA 4IYJA 1F7VA 1K1EA 1V43A 4TUYF 4LZNA 1AU9A 5J58A 5J40A 1QZ3A 3AVVA 3TGLA 4RSGA 5JI3E 1W5BA 1PL0A 3NANA 2QPLA 3LPCA 2MMCA 5JS1A 3AOEA 3RD5A 1E1YA 2QTWB 1PUXA 4FUTA 4RTKA 2ADFA 4RY0A 2VR1A 2ZB8A 3BAZA 3D7LA 4UULA 1GARA 1PS9A 2P69A 3PGMA 4MS1B 1WWKA 4ZOLB 5DPMA 3T4XA 4JEUA 2IV7A 4DQDA 1Y6FA 5HF5A 3AL0C 1WW3A 2QI9C 5F1YA 1GGEA 4F93B 4RTOA 5KOIA 3DPSA 3CC8A 1L1FA 5FL7D 1JSXA 3PXXA 4W5WA 3CG0A 3A3PA 5SY6A 2HA5A 4LZJA 5BQOA 2GYYA 2NYUA 1NXWA 3QVTA 3AC0A 3OAAD 3HLKA 4NMHA 5FTKA 3C70A 1Z37A 2ZYAA 5CH3A 3K9QO 4IX1A 2WABA 3ZVMA 5FUQA 4TT3A 3SWWA 1Q0HA 1IJEA 2FW8A 1GRVA 3T7CA 1E5DA 1ULSA 2QG4A 3BK7A 4U5XA 1ZJZA 3H5RA 4PSDA 3DMDA 4D3DA 1N4DA 4LC1A 1VCOA 3KKZA 3TOZA 3PQ4A 1RBZA 3C7KA 2UV8A 5EL0A 1BJKA 1V3QE 2ZYUX 3KSMA 2XTAA 2OORA 3L40A 1NKVA 4PCUA 4PHTA 1PGQA 5CJPA 4DIUA 2WF6A 3QVVA 5IAOA 3A3NA 3C5WP 4F92B 3DR5A 2AFIE 1FDSA 1JDBB 3DEAA 1NMEA 3ELWA 4G2TA 1DRUA 1YT5A 1UP7A 5KUTA 2ATXA 3I9MA 2JS7A 3NGMA 1CR4A 4NRDA 2W2XA 4BS9A 3FYTA 1E9EA 4HQFA 1T2AA 5EESA 1MABB 1NUHA 4C0BA 1P1KA 3NHYA 1WDMA 1MNAA 1W25A 3AV3A 2I6TA 1RDFA 5DH9A 3LWBA 3LM8A 3ZDYB 4YGYA 4ENSA 4IIYA 1P5ZB 3W5IA 1ZGAA 4XGQA 4HX9A 5DI3B 2WKSA 1ZVMA 1PW7A 3UB3A 1DOAA 3TOVA 5CFRA 5AW8A 1ZA2A 1X86B 3VHLB 4QQRA 5AVOA 1DTWB 4A8JA 4J0KA 2HA6A 1KQNA 1ESMA 5IDWA 1NUPA 4ACAA 3AY0A 1AOXA 1ZI8A 4YRQA 5DXJA 3ZHOA 4OGKA 2YZ7A 3UGKA 4DJTA 3U39A 4DSTA 1XDZA 2B30A 3HO6A 3N58A 2D5LA 1ADCA 2O3TA 4M0LA 3HKDA 2WWXA 4N82A 4BEJA 2WUWE 1Z18A 2IT1A 4B87A 4DIKA 1FU4A 1QCDA 2PL5A 1RFLA 1S2DA 1P5FA 2RHWA 3DDWA 2ZYWX 2CCKA 2CNOA 4BNLA 2O19A 5TGZA 1YS6A 3P0IA 3DAPA 5DSTA 1UBSB 3GAFA 1DIRA 2QNBA 1O6CA 3BCSA 3LUAA 3VOAA 1AGNA 4DCNA 2Q3HA 4F5ZA 5CT4A 2WT4A 4LJ8A 1G1MA 2AL7A 1N5RA 3QH4A 5IAKA 4D6PA 4DDHA 3E5RA 5EJ9A 3QELB 1VE6A 1YB4A 4R9NA 2O8FB 1Z74A 4EIWA 5C8VA 1ZYUA 4FMPA 5FYDA 4I1IA 4YXWA 3WL3A 4PEVA 4IZOA 4LXQA 3WSTA 4AXXA 3S1SA 2GJ8A 2EL9A 2I7DA 1A1SA 2CGEA 4P3PA 3HM2A 2HOQA 3M83A 4ZKEA 2WUFA 3NDJA 4TVSA 1NGSA 3W9BA 4BAGA 3GLKA 3OA0A 3FOCA 4UZEA 1DCMA 3LZ6A 5WRFA 5BSRA 4UPEA 1Q0ZA 1J90A 2I67A 2F9FA 2X5NA 3G59A 4RSRA 4JB0A 5IDYA 3EN0A 5BN4A 5EHGA 3RYFA 3LUDA 4H1VA 4GRDA 4PPGA 5ALHA 3RYHB 1CY1A 4G0PA 3FNHA 3ZK9A 1WSBA 1I7QB 1ID8A 5J5CA 4Y2QA 2P4QA 4QYIA 2TYSB 1C3OA 2J41A 4ICIA 3H97A 1KEEB 4PYKA 2ZRHA 3GJQA 2VXOA 3BIWA 4J1QA 5COBA 3ZUGA 1B7GO 3CNNA 4FFNA 1O1YA 2JZCA 4LVCA 1T0PA 1ZD5A 2OHVA 2VH2A 4BXOA 4M1ZA 3MG9A 3NBKA 2X86A 1BS2A 1D6NA 3JQFA 3QKSB 1PJ2A 1T6YA 5DBIA 5K3EA 4UASA 2ZYGA 1DHTA 3L92A 4XVQA 1PL8A 1A98A 4G1FA 4JKOA 1RXUA 1M2VB 3ZNPA 2ZKLA 5JSFA 1NR1A 3RREA 4BHTA 1W85B 5BWLA 2F3RA 3S3TA 3G5TA 2BN4A 5DCUA 3HPRA 5B5SA 5L7TA 1IZZA 1CRWG 4L8FA 2PZAA 2RG1A 4ISBA 4O25A 4BNGA 1ZIPA 2OO5C 3PQFA 1WULS 4F7DA 4ZDKA 1HDOA 1AKEA 1U4SA 3D59A 4FR2A 4DKJA 3TR0A 3ZHUA 4QUAA 4RDHA 2HCTA 4F96A 4YCMA 4M1EA 3V7FA 4RPIA 3KLOA 1B6RA 4EGJA 4JBYA 3AYXB 1NW5A 4H0NA 4Z86A 2Z57A 3WB1A 1NVKA 1KO4A 1U3TA 3CSDA 2PGXA 3BFXA 4TSRA 5AOCA 4D45A 2E18A 3U7IA 4ZI5A 4AJHA 4CCWA 4DPKA 5E8JA 1EVLA 2WWVD 4HAXA 4CEIA 3JPYA 4MVJE 4ED9A 2C2GA 2I6FA 3E2IA 2VFAA 2AT1A 2C5BA 2CNWA 1DXYA 1SK9A 2ZWMA 3IUMA 3QX7A 4OHVA 1GGJA 1L8QA 1N3BA 2Y68A 5BUQA 1W5TA 3RM3A 1YDGA 5GQSA 1WP4A 2BRUA 3O2NA 2PKWA 4Q3EA 3WWPA 4PIMA 3UMFA 3ZIUA 3VXKA 2G7MC 4UDNA 1D1QA 1F48A 4XM2A 5F98A 1Z17A 2LCFA 3A0UA 4KN5A 1SVWA 1DWOA 4ZRNA 4B83A 4DUYB 4QODA 4DCPA 1D6MA 4PYQA 2JF0A 5EE5B 2P78A 4PIPA 1TLTA 3MJ4A 4OFBA 4PO8A 4L8GA 1YZUA 3KUKA 4N9WA 1PG0A 2PLRA 2X58A 5FORA 3DEIA 4OSEA 4RPHA 3EVZA 3F9CA 5I9MA 5CBKA 2C2HA 5IDQA 1A9RA 2Y05A 4B6OA 3EEQA 3G5LA 1S7CA 1NJGA 1F2VA 5ITSA 2QTNA 1KPIA 1URPA 1Q3TA 1Q3KA 3DOUA 4G4SO 1AXGA 5D85A 4Y7DA 1AV7A 3MS2A 4GOOD 3F4KA 4QUEA 5B6IA 1J56A 1PNVA 3L1IA 5AHXA 5EPEA 1D2CA 3VO2A 2DPHA 1QK3A 1NX6A 1I5OA 1Q15A 3RHSA 3SZGA 3AHCA 1VSUA 1NVGA 3UAYA 2PEYA 2AN9A 2P5YA 4IXDA 4NG4A 4LDRA 3GDGA 1UR5A 3PIDA 5I45A 1G3UA 4PR0A 4YJ3B 2FPXA 4CETA 5HQ3A 4RJJA 3DAYA 3K9LA 1W5AA 1FCJA 3KLBA 5LUAA 1T5HX 3VNRA 1AKUA 1MLDA 1TMOA 3FR7A 3OT1B 5BMVB 2CEAA 4JVOA 5E4JA 1EB9A 2CJWB 3QKTA 2O2ZA 3RTCA 4C0LA 3G82C 3ND5A 3W8EA 5GOTA 3ETGA 2AFHB 1A4UA 1A9XB 1WMEA 4RQBA 2F59A 5IEBA 1N1MA 2V7QD 4XH9B 1P2TA 1U5AA 4JP3A 1R37A 3W2TA 1CNEA 1K8YB 2HMYB 1KC3A 4CR7A 2CLDX 2IP4A 2VLIA 1SR8A 5DX1A 4N47A 4H3VA 2ZT6A 3I1JA 2BKLA 1ZR4A 1EVKA 4B75A 3ANLA 1GRCA 4M8IA 4MGEA 5ILOA 3SQXA 2ILTA 3MCTA 5AW9A 1NDUA 1LEHA 2PPVA 1QIMA 5IN5A 4AJ1A 1NI4B 4RZHA 5AM4A 2DR3A 1SKQA 1ZNWA 3KT0A 3LPNA 5CIQA 1BKYA 2NSJA 3W8FA 4KQ2A 3EMBA 5DBGA 5IJ0A 3NVMB 4PC2A 4IJMA 1U7ZA 5EEGA 2E4XA 3GFPA 4J1SA 4WE3A 1TF5A 2CT8A 1CUCA 3MMNA 4G1MB 2JIRA 1IZYA 1RKBA 2BUCA 1AXRA 1PT5A 2OVFA 4L5AA 3RTAA 2DM6A 3E61A 4OB7A 3FLBA 1JG7A 1TECE 1P1IA 3OZFA 2HJ9A 2FPSA 4II7A 3JD0A 1MJHA 4MH0R 5BXYA 1R00A 2VLBA 3RJMA 3E5MA 2WU1A 3PG5A 3T1YB 4Z9FA 2YMQA 3UJPA 4AB1A 3SG0A 4AI6A 1EG7A 4H4EA 1JHZA 4HLNA 1F0KA 1YQGA 2I3BA 1XMSA 4F3KA 5BNIA 3KQUA 4LFAB 2LTAA 4X41A 5GY7A 4M36A 4HCJA 4AWAA 1NURA 4HL6A 2ISCA 4OFXA 3WGIA 2XPCA 5AKGA 6NULA 1BN6A 1DHRA 4LWOA 3OCJA 4RELA 4BRZA 1GCAA 3DF9A 1GPDG 4HYQA 4CFZA 2J3DA 5EIXA 1I94B 5K8UA 2X0DA 3PZRA 2WVHA 2NO4A 3LYHA 3I32A 1IN1A 1OLUA 4RV9A 4A6EA 2IS6A 4FK8A 1XV5A 5LOVF 3IQEA 4GLJA 2VPXA 4Y6SA 5JJBA 4HOYA 1UKAA 2XIQA 4G8CA 4MI1A 2IX9A 1X92A 1CUUA 2XSZD 2ZM6B 4PLTA 4DSZA 4AJPA 1P19A 3DTYA 3R3ZA 3RANA 3VHQA 1EYZA 3GIWA 4MWTA 4GR9A 4HC4A 4MK4A 4OYHA 2SCUA 3DBRA 4BEVA 2C3UA 4EX7A 5C8ZA 3JALB 1MIOA 4MV5A 2ZJYA 1MB3A 4LZPA 3P71T 4I66A 4GSKA 3MYYA 2GCNA 1ZITA 1USGA 3K1YA 4WKPA 1U3FA 3C6ZA 4P22A 3WE7A 5KNCD 4D99A 4G5YA 4X85A 2V7EA 2WICA 4F11A 4R7ZA 3L41A 3MTDA 3RRNA 2HRQA 3WNDA 4BBAA 2WG2A 1NW7A 2XA2A 4A91A 2XHZA 3L0OA 3GC6A 3VKVA 4DILA 1NHWA 3OCUA 3WX0A 5FV4A 4Q9DA 1Z4KA 4LY6A 4N5LA 4O4JF 4RK5A 4RQUA 3NH9A 4XB1A 4C43A 1YVRA 3I5MA 5KOHB 5C5IA 3ISJA 3QPCA 2QD2A 1CULC 3H9GA 5JMWA 3RIYA 5AI0A 3ANSA 1ZMBA 2X7XA 1LWNA 3EFOB 3I72A 5DM1A 4H27A 4W5NA 1KTVA 1QIHA 5AXCA 3NHMA 5AJUA 5DX0A 3SHQA 4EUHA 1P18A 5I9SA 5SZJA 5JAOA 3AESA 1BMTA 4INPA 2PVCA 2VHJA 3DZGA 3GJZA 4HNAB 5JG7A 3IP1A 4MQUA 2JHPA 2VPZA 2GK4A 1PS0A 4DR4B 3SLKA 5B58C 4MTLA 1Q92A 4Q05A 1SAYA 3G68A 4ZVRA 4DC1A 4JVLA 4K1LA 2CV0A 2PUAA 4QPJC 3ID6C 3I6IA 1N2EA 3KAQA 4FYWA 4K26A 3U7RA 1UADA 1JHMA 1V6SA 4D0SA 1FNCA 1T3SA 1RM0A 4Y2SA 3QHAA 1CUVA 1B6SA 3HJCA 4P84A 2R1UA 4QFBA 5TMEA 4B09A 4KH1A 1E9DA 2CFRA 1TZJA 3D2CA 1C8VB 1IAVA 4TXNA 3MWEB 3NORA 4HB3A 4MVYA 1L5HA 3H75A 1ZS9A 2WJJA 3IR5A 2OO3A 2NU6A 3EUAA 4WLVA 5F64A 1OAKA 2G9NA 3UAZA 5I7VA 1TQ4A 3O83A 3OCXA 4RAQA 3G9UA 4BN0A 3B3JA 5DBFA 3QJGA 1UWKA 4MR9B 4EECA 4HNSA 2O2DA 3MCVA 1EX9A 1CRZA 4R8LA 5DNDA 3P4UA 1VJTA 5HP4A 3LUFA 2PRZA 3CTPA 2JGRA 3HLTA 3GR6A 4MV8A 3N8NA 3D0QA 2PRYA 3HBFA 5ECGC 3K8ZA 3OFND 5HF8A 3T7DA 1ZKDA 2RHJA 4O4LF 3G02A 4TWBA 4UU7A 3G2PA 1R50A 4TMZA 4JYZA 4DCCA 5G2OA 1E1CA 8GPBA 2WIBA 3PEWA 1KVSA 2VK8A 3W78A 4BMXA 1Y3CE 3P20A 4P1ZA 1LK7A 2QRVA 2YUIA 4XVCA 3RT7A 3E0XA 5DU2A 1WCIA 2ZBPA 3DT9A 2D1YA 1JDZA 1OUMA 2R97A 3F3KA 3DYVA 3T54A 4AF7A 3R6LA 3X0DA 4JROA 3IJ5A 1Z39A 3DZBA 1MU0A 2WPDD 1WOMA 3SNHA 4C3OB 3KCQA 2VJNA 4AJ2A 4ABTA 2ZWIA 4HFJA 2G1AA 5J1SB 2V9CA 1PV2A 3DHEA 1L6IA 1NQWA 3H0EA 3NT5A 4FKMA 4K9KA 3HXLA 3L8HA 1L5KA 2XQFA 4EVRA 4F97A 4BBZA 3H3XA 5K0CA 5KWEA 2G70A 5FFMA 4V0LA 1ZHFA 4KOEC 3EZFA 3BZBA 3FGPA 4DCTA 5KYYA 4TROA 3VYUB 5AW5A 2PS9A 1BWRA 3U4DA 4AKHA 1WZEA 2BMVA 2QSYA 4GH5A 1UBCA 3C1TA 4BTEA 1OJLA 2DQKA 3MTBA 4WCDA 1EDOA 4L9AA 4I5GA 3FBGA 2AW3A 5K4HA 5BT9A 4HQKA 4OJQA 2MSWA 1Z0DA 1XRSB 1ZNYA 4TTAA 3R7FA 5JLJA 2DFVA 1QKIA 3D7NA 1CDDA 2VQ3A 4REOA 3CPEA 3FGOA 4M1WA 1V1MB 4MUNA 4CKBA 1T0JB 4C7JA 1HX7A 2YXPX 4Y1GA 3Q1KA 4TL7A 2PYZA 1TZKA 3JQ8B 3OZIA 1GTZA 2CUZA 3EPHA 2CLIB 1N34B 3UNXA 3ZBUA 4D74A 5HHTA 1OX6A 3UUEA 4QELA 3B89A 4C0QC 1XQVA 5JCJD 5E3JA 5LQKA 3SQDA 1UJBA 1U94A 3KKPA 2PIDA 1QHXA 2ZPTX 2CLSA 1KQOA 1LX7A 5EWMA 4LF4B 3DF7A 1C9YA 3K53A 4ZOEA 1WD5A 1MAHA 2EFJA 3FHTA 3MWLA 1J1UA 4RVOA 1XHEA 1DKUA 2P2GA 1Y9AA 1IWPB 3T95A 3TLMA 4BFVA 1BX0A 2F8LA 4TV8F 2A9JA 2O2EA 2J0SA 5FLXA 3FYHA 3R75A 1QZTA 4KUEA 3D6AA 3ZLUA 2RAPA 3WZ2A 1YFLA 3NU1A 3R09A 2BGTA 3NNDA 5HTKA 2BFEB 2A3RA 1OZAA 3Q0IA 4IM7A 4UATA 4ZMRA 2OC4A 2YY7A 5J23A 3SHVA 1WU8A 5ITVA 4OYLA 1VCNA 1LJLA 4DLUA 5PGMA 1HG1A 2PUTA 3A2MA 3I34X 5EI5A 3UC5A 2Q1SA 3MMSA 4D0RA 5KHAA 1EB8A 3RS0A 3E23A 1CZUA 1MAUA 4BY9E 4BLPA 5KDOA 3UXYA 4NIMA 1O2DA 3ZD7A 2UVDA 4ZCIA 1M54A 1Y8RA 4O4IF 4LJYA 3PPWA 2QD4A 1VKRA 4PSUA 3ROMA 1V5FA 3ESZA 3O75A 4TS9A 3TNLA 4TYYA 4LYHA 3N6VA 1JLMA 1E9VA 2YZMA 3DZ8A 2V5UA 3NOOA 1BQEA 3PEFA 4KXYA 5FI3A 2R87A 5DVZA 2VJAA 4YREA 4CUJA 2CKMA 3IR7A 1ZMXA 2GZSA 1Q0LA 2RKBA 1MZVA 2CVOA 3EGDA 4Q15A 1TD9A 3GGDA 3A4LA 4W5JA 2BEVB 4YQZA 4A73A 1DRJA 1ZCZA 3NAMA 1HF3A 4ND1A 4YEDA 4DC9A 1R27A 2YN2A 3AFHA 3FUCA 2V5AA 2DWQA 1Z3CA 5FUBA 4RTQA 1V39A 2VPPA 3IAS1 1E3EA 4NHOA 5HBRA 5H4HA 2ZTUA 1RHQA 1Y1RA 2JGLA 2DKOA 4FYPA 3GFVA 2XJ9A 4J0EA 4ALNA 3HHPA 2IPNA 4HSGA 2O1SA 4HX5A 1E9AA 3ZY4A 1Y6GA 3BMNB 4JU9A 3JYLA 3VSEA 3ZZ0A 1TCUA 3ST7A 1DEAA 4C04A 1A8UA 1KY5A 3HNOA 1CRQA 3RJTA 2OLEA 4K81B 3CF0A 3DT8A 3NYIA 5LQSA 2FKNA 4P8RA 3VZRA 1Z5VA 3OIDA 5JATA 1NZFA 1S2GA 2NPOA 1NY5A 3VO9A 1I4TD 4G3XA 3L8MA 5IZCC 3KB1A 3SHOA 4NYJQ 2ZZMA 3GRRA 3IIJA 1TGVA 1KRWA 2LPMA 3QW2A 5F4BA 1W1IA 4A36A 1E98A 1DC3A 5TRTA 1WRBA 4GG1A 4UDXX 5H16A 4KXLA 2CLOB 3T3NA 4OOFA 1BQ4A 5FA6A 4ZI7F 4W5QA 3CRRA 4OB6A 5DXAA 2G1PA 3MCZA 4NBWA 3D8UA 2YYSA 1KDRA 4PHCA 1GV0A 3LT5A 5IKMA 1J6UA 1MVNA 3LTEA 4MICA 3MJCA 2ZB3A 1TU0A 2UZ1B 4BFXA 4KNWA 4P7JA 4HPWA 3A6GA 5GM2A 4CM3A 1PTJC 3DXXA 4GMKA 1RZUA 3ROTA 4WKCA 1TYBE 2CLEB 2HC9A 3X1YA 2E89A 4DKXA 4N03A 4D92A 5K5EA 4YP9A 3M4NA 2H17A 1I30A 3OE5A 2BV3A 2D4AA 3EVEA 5C3MA 2ECFA 2N1BA 2JFYA 3TR5A 4A5OA 4HAIA 2AA3A 5JYCA 1XVTA 3VV2A 3ZHSA 4PSKA 4NU6A 1FE8A 4NDAA 1IJKA 2WTMA 4IEFB 3UXHA 3FSEA 3Q8WA 5JSUA 3V8BA 3K09A 3K1AA 4GSYA 1CNFA 2VYND 3A10A 3GDOA 3IAUA 4U1RA 3TTWA 2E6KA 3W8RA 5BW5A 7REQB 3ICWA 4GOND 3OEEA 5E1DA 3WK9A 2XB4A 4YCAA 4N3AA 4H7HA 1WF3A 2EKPA 2FZ4A 3TMYA 4UFPA 4KVAA 1FX1A 2UVPB 5JZMA 4ZAZA 1FNNA 1DU4A 1UFRA 2G25A 2PDAA 1J7KA 1Q1QA 1W36D 2R2GA 5CMLA 4UU1A 5A9SB 1Z75A 3CWQA 3SJBA 4NYIQ 4DV1B 4OGLA 1JH9A 4RK6A 2MYTA 1UM9B 5ENDA 2XUDA 3QE9Y 5ENZA 4B84A 1OKKD 2H1LA 3RG8A 2FPRA 3BULA 5ARCA 5HJ5A 2QLBA 2B5WA 2Z1NA 4EB6B 5K05A 3JVUA 4I9NA 4GLOA 2J3KA 4MUFA 4PQRA 3Q9LA 3ZE0B 4PE5B 4ARUA 1JQEA 4GKKB 2AXQA 3VR4D 1RR6A 2IU4A 1P1FA 2OD2A 4EJMA 1FXWA 1NQVA 2VSXA 1P61B 3TZCA 3VR6D 3DVQX 3EC1A 5J1TB 2GSWA 3AI1A 4B3RB 1FNDA 1IXSB 1YDEA 1ZNZA 3EFEA 4LOIA 2WMDA 5F1OA 3LQKA 5K3FA 1HPLA 3RC7A 2R84A 2BFDB 1GADO 1T36A 2NU9B 4RYDA 3WLNA 5LOVA 3FWKA 1IHPA 1BA3A 1TNDA 3CX4A 1FZTA 4OFZA 1WL8A 2F43B 2W42A 2IEAA 4AWXA 2UYCA 2Q2WA 2HX1A 4XLZA 1BVHA 3DKRA 1N1GA 3OMXA 2XEDA 4IQFA 1CUIA 1T1RA 2H08A 1N1EA 3U3XA 1YKSA 1A76A 2Y67A 2JGIA 1LCIA 1T5OA 2IIQA 1XAGA 4KBFA 1RC0A 4KQGA 1IJBA 5EZ6B 2C99A 5D1NA 1EFKA 5J4LA 1ONBA 4HBZA 4KXUA 4YO8A 2RHTA 3A28A 2YWDA 3S8MA 1XF9A 1KYIA 1Q50A 1EK0A 1KBQA 1SG9A 2XUPA 2FPGA 1RKVA 5C5DA 2O7RA 1EK6A 4AYXA 4WKGA 2CXSA 4WFKA 4XJSA 3OQIA 4DPMA 3NWPA 5BSFA 2WQZA 4K9SA 4DA6A 5CPFA 3N8KA 2VUIB 2OXRA 5ALLA 1OX4B 2FQWA 4F06A 5KYWB 1RJDA 1SEVA 1NG1A 1TPZA 1U0LA 2OM2A 4QEDA 1NNUA 4OFWA 1NPTO 2EDAA 1PEDA 3GGJA 3B1YA 4HWPA 1BH6A 1FA9A 1Z28A 2OQVA 5BSWA 3WGHA 4GGMX 2DEUA 4AXBA 5SY4A 3WA7A 1T8WA 4R8RA 3BHNA 1I24A 4X45A 1NZJA 4YA6A 1C1DA 1J24A 1N2CB 4NNJA 5FLEX 5BN5B 3W7BA 4IINA 4ERNA 4EYQA 4WACA 1VMEA 3JWJA 1PN3A 1ISMA 4J29A 2PVSA 3PQ3A 2I1VB 2PKCA 2R6CA 4JSYA 5CLQA 1M8GA 1NSFA 3MINA 4LN1A 1CY8A 1Q6ZA 1RJWA 1BSVA 1GAQA 5AW4A 1IPEA 2ZSJA 1T1EA 4OG2A 4E2ZA 1J8QA 2KW5A 3I0NA 3ILSA 1U2DA 1C9JA 1TKCA 2W6JA 4BN5A 3EDYA 4BECA 4ZGWA 3EC7A 1B2LA 3EODA 4S35A 3C24A 4EX6A 4Q12A 3SPXA 1HWYA 3N2EA 4NHEA 3S7ZA 1H69A 2YHIB 1K97A 1SEPA 1GZ4A 1UPXA 2EF1A 4CQMD 3UK2A 3F6BX 4Y1EA 3LO5A 3M6WA 2O5VA 4JLJA 2FMXA 4LHEA 1VIYA 2D5CA 3SHTA 1C3EA 3ZHCA 3ZJTA 2O1WA 4I9FA 2C9ZA 4ZCTA 3GW8A 4UBKA 1S0UA 2IYNA 1UC5B 4MRVA 1YUNA 2J3MA 3U9SA 1R4ZA 2LKDA 4ADSG 2JGDB 1DT5A 1XZDA 2GPSA 2P91A 2ODWA 2WE7A 1TQ8A 2X23A 1QF9A 3YASA 1LS6A 3WIEA 1SXHA 1T9BA 5BMOA 5CAEB 1ESZA 4JVSB 4JV5B 1C14A 1QPBA 3M3HA 3RH0A 2J7PD 1OB2A 5JWOA 1QYIA 2EQ5A 1GZDA 3FROA 5EPOA 3BAFA 1GAEO 3DVLA 3P7MA 2E82A 4LJSA 2V54A 2ZAYA 5F2KA 5E38A 3UJDA 3AEQB 5DWQA 1G8PA 1MH9A 4YUZA 4I4TA 4C08A 4G4IA 3DLCA 3TL2A 3OLVA 2BI4A 5GOZA 3AOGA 4RHTA 1YK0A 2BP7B 3W2HA 1NXPA 2H92A 4Q4CA 1FNBA 4S1WA 2WRZA 3ZK8A 2GSDA 2UYGA 3D0KA 3ECSA 2SHKA 4B3CA 5IHXA 4IG4A 3GRUA 5IJZA 4KO2S 1RMQA 2OGTA 4WNAA 4A9AA 4DBLE 4XFDA 3GGPA 3H65A 5U1PA 3GLTA 1BMFD 1G7CA 2YS6A 3UAXA 5LD2B 2DFKB 1BDIA 2ZYTX 3JAKA 4X3CA 2TMYA 1X7XA 1GG8A 3E8MA 2I76A 1DAOA 4G6ZA 5JSHA 2PKRA 1POWA 2VCYA 4MYRA 2PLNA 1KIAA 4R68A 4XVRA 3RTEA 3K9CA 3D5QA 1VIVA 1P7ZA 4MUKA 3ZWXA 5HVNA 1CQWA 1LPNA 2GBGA 2FUNB 2O05A 2D1RA 2PZBA 1CQIB 2ZSBA 3C5VA 3EGVA 3PNVA 1QTRA 3CRZA 3DDUA 4PZ9A 5DNVA 3SSMA 3WIUA 3NHAA 4ER3A 5DHQA 4EFMA 4M88A 1SQSA 1OXKB 4ONEA 4KQEA 3SQOA 4MRRA 4BO7A 6REQA 4NZZA 1YU6A 3TWOA 4XUCA 1XTTA 3FTPA 1PQ4A 4HAUA 1JVNA 3UGTA 4FWIB 5LP6C 5K09A 2QUJA 3KM0A 3KOUA 4HLQB 3M8KA 4UTRA 2ZUDA 5BSVA 3EGEA 1MRNA 1N0VC 4FKZA 3KR9A 4WFIA 1ECGA 3HYCA 3I2KA 1IWOA 3N8IA 4S1OA 5KSWB 1YB6A 1BJTA 3BB3A 2OXTA 1MFZA 1NJ6A 3NIBA 4BNFA 4LFBB 4RFLA 4QSMA 2IXFA 3QYPA 1Y48E 3PDIA 3UJ9A 3WRXC 4EJSB 4YRZA 2HHHB 1NW3A 3V4ZA 4KQJA 3S68A 1I33A 3R8FA 2NMVA 1MX3A 3FUVA 2V1UA 4W7SA 4B3MB 4KRYA 7MHTA 2VDWA 5MN4A 5BV0A 3LQQA 1VJGA 4IO1A 1E7MA 2PKQP 2XCLA 4BIIA 2GRUA 2O7NA 1EP3B 1HDIA 4QTZA 5A6SA 1UBOS 3TK1A 4D9FA 4EG5A 1DJLA 1F06A 1MOPA 1RJFA 3JVVA 2Z9CA 4GXTA 3OTQA 4FGZA 4HYTA 3VX3A 4YCCA 4B2LA 3B6JA 5KU7A 2ZLBA 3TO5A 3FZNA 2FN8A 3U2QA 2HSWA 3X1JA 3ZXSA 2REXB 4D9KA 1Z08A 5K9ZA 1XR3A 3B48A 5MN6A 2VTBB 1J0AA 2A1IA 5J4VA 4TTQA 1ODKA 3A0RB 5KHLB 5DTRA 3H5WA 1EXNA 4EQ6A 4L3VA 3BREA 3U37A 4DBZA 5FLKA 3FCXA 5KTSA 3KWFA 4MV7A 1G3IA 3TW8B 5FADA 2ZITA 1NWHA 1VL0A 3ETCA 3GLFA 3QFSA 1X13A 2GCGA 3BDVA 3PCTA 4OIFA 5LXTF 1QB7A 1E3SA 1K27A 1BHSA 2Z1MA 3K73O 3AUUA 4MUAA 1B0ZA 4MHSA 4E1BA 4EK9A 2F8MA 5ALIA 3D8HA 1B0AA 5JMOA 3QV1A 4P98A 4NCNA 2XMRA 4BV8A 2BFAA 1Q20A 3TS1A 2JH3A 2Q1UA 2OBYA 3PQCA 3IP9A 2O2YA 1JI3A 3IALA 1AO0A 3DMRA 3OP4A 2NG1A 4RTPA 3O4IA 3GUYA 3JQ7A 3U3RA 3WKAA 4RHUA 2HK6A 3FCOA 4UE6A 4EJFA 3B3FA 2P90A 4LYGA 4Y2TA 5JYBA 4DMFA 3EF1A 1FPQA 3NHJA 4G5RA 5L7YA 4ZOBA 2AOXA 5G0TA 4YLYA 3O8QA 2ZRLA 1HH4A 4RWZA 2CF6A 2RGUA 4ZYWA 2MYUA 1RWQA 1B76A 4N9QA 4KSCA 4D0NA 3IXLA 3PD7A 3GROA 2Y0EA 1Z36A 4YJ2F 2BONA 2G88A 2ZULA 4DLVA 1VPTA 4EPYA 3K0FB 4NESA 5AVYA 4KRGA 1G2PA 4RS3A 1KPGA 1XQWA 3OQPA 2D62A 2AN3A 2BF4A 1IEWA 5EA2A 1I3OA 5TLSA 3IUSA 1QHNA 4H3SA 2WT9A 1Z29A 4BO9A 1K3UB 1PR5A 4MS4B 2RH5A 5AKYA 2ZANA 2OC9A 2Z09A 3Q2KA 1ZJJA 1MF7A 1CY0A 1VOTA 4YT2A 1JHQA 1VP9A 2DQSA 2IPOA 5HFJA 3OF3A 4HSEA 4EGAA 4Q48A 1NU8A 3DJFA 1USVA 4GPBA 3AF6A 1JEYB 4G4JA 1AC5A 2DPLA 3QUTA 4ND2A 1WPXA 1RCFA 4QTYA 4HLDA 1YJQA 4BP8A 5EP3A 2CF5A 1UUFA 2J9YB 4LPKA 1SXGA 5BSHA 4I4CA 4MR7B 3QEKA 3S1AA 1Q95A 1QR6A 1V5WA 2YASA 3BTVA 4JB3A 5AQEA 3RABA 1Z5ZA 4MKRA 1N2GA 3TJMA 4BE4A 3ICPA 3FFAA 5DP2A 4NEGA 1CF2O 4PNEA 3V8PA 2VK4A 3ZS8A 3IFSA 1A9SA 1I36A 2AUMA 2HIMA 1TVEA 2HRCA 4U7HA 1JWLA 3CZRA 3MLBA 5A3RA 1Z3IX 3GUCA 2O23A 1ESCA 1FBNA 1Z7GA 1E2NA 4PC7A 4RJLA 1A5ZA 4Z99A 3A7EA 1U5BB 4CDMA 1T13A 3KOZA 4C4TA 5DGIA 5ICGA 4JI4B 1OH8A 4UXJA 3NKLA 3TTUA 4MAMA 1E32A 1A3CA 1VPDA 4TYNA 1L7BA 5TARA 4D5EA 4MLZA 2XIJA 1PQPA 4QU0A 4M89A 1R0KA 2Q21A 2Q29A 4BNXA 4DLTA 1TKRA 4D6YA 4NBUA 1J8YF 1SUWA 2X4IA 3TH5A 1TMGE 1Y3DE 2RB4A 3H5OA 3CXUA 3DUFA 3ZI0A 3EMDA 2F6RA 1SIUA 2OV8A 3UK0A 2YVQA 4PO9A 3ITDA 4HZGA 3PLRA 4HH4A 4L6IA 2Q8NA 3OLYA 4Q9JA 4D9EA 1A5SB 5TMBA 4E5YA 4Z4GA 1ZW6A 1CJKC 4I50F 3QENA 1L8XA 4D56A 2X9NA 2R8PA 4C4PA 1N8TA 2QTLA 3AKCA 2X15A 3WAKA 3ZH9B 1JB1A 4UMVA 3COPA 2WFLA 2QTVB 2WLTA 1EWKA 3E3NA 4HB4A 2R00A 4JK3A 4N5MA 1PJSA 4DQLA 2UYHA 4C2UA 1E9RA 1OXVA 1HRKA 2QQ5A 3HCAA 4HVTA 2P0EA 4P38A 4TV9F 1FOEB 5CYOA 1MABA 5DTJA 1G4UR 3KSRA 1J8MF 3L5OA 2V4ZA 2QD3A 2NVWA 1ISPA 3DO8A 2AK2A 1GPYA 2NO5A 2YN0A 3LC0A 2WU3A 4KK3A 4WMLA 4Q1AA 4Y30A 3W2IA 2VNIA 3B9BA 1QQAA 3UFXB 4PZYA 4PTYA 2Q1XA 5IBPA 5DI3A 2GCIA 2ZYSA 1E0SA 1O94A 3KOYA 3ROPA 4CQJA 3TKLA 4QJ5A 4DUZB 3VYSB 1BA2A 2C9OA 5DASA 2B36A 1UC4B 2CXOA 4K05A 1CRLA 2G83A 2QGZA 4FDLA 3WGNA 4C89A 4NULA 1AUQA 3UATA 3OJLA 1HDGO 2ZRIA 1O5TA 1KY3A 2HN9A 3MNFA 3KXDA 3IS3A 3NRCA 1V8BA 3CT6A 4L74A 4Q24A 5BPHA 3OTWA 1ZN8A 2EW8A 1OV4A 2VF7A 3DCJA 4AY3A 4ZEVA 3QJ5A 3U80A 3VYWA 3NJ8A 1W93A 3G0DA 1OBOA 1YSCA 1CQZA 2WYIA 4OP1A 4U4AA 4MEJA 5FNZA 2EU8A 5C81A 1ZESA 4HXFB 5K8JB 2ANCA 1NRWA 3TZLA 3UC9A 3PNQA 3CMCO 1N0IA 4DWJA 5DRYA 3PXUA 4TS4A 3TF5A 4MYUA 3JQPA 4M2LA 1QLHA 16PKA 721PA 1EX7A 2IOHA 4H7IA 4UBJA 5EERA 3HXMA 1H9BA 2QSZA 1F6DA 1Y7PA 4JAVC 3KQHA 2YXEA 2XKAA 1RM5A 2QROA 3MM4A 5K3OA 3KVRA 3AEXA 2J30A 4WVFA 3MS7A 4DLBA 1S3GA 4B45A 2CHQA 3OH8A 4TMXA 1XO1A 2QE6A 2XUZA 3FMVA 4EDFA 4ZU1X 2Y0PA 4DLNA 2GBLC 4PX5A 2VWQA 4TM8A 2FAXA 5H02A 1DKOA 3HG7A 4RORA 2XWBF 3A27A 4K8RB 1O95A 3GEHA 1GUAA 1TYEB 5B1SA 3E27A 4IDPA 4L0MA 3RYHA 4YMSA 1R6AA 1RBYA 4NMWA 1SXJD 2A0FA 1ATIA 3PEUA 4JQZA 2NVUB 4N5IX 3PYMA 1W0KA 1BYUA 4MQBA 2XKKA 3FCEA 2AZXA 4NAUA 1I01A 2ZVQX 4QQ8A 1R6BX 5LZ2A 1KFJB 1KYXA 1IN4A 4FE7A 4LQCA 5PNTA 5J47A 1V6AA 3HSSA 2GZDA 1XNQB 1ZAKA 3MJDA 3ZCPA 5D6OA 2CNDA 1K2WA 1Z4PX 2B5VA 3ZDCA 3TRFA 5IW8A 5KHOC 4RJIA 4NYMQ 3AFGA 3RS9A 1MO6A 3SEZA 2BKAA 4NE9A 4O2AF 2IEYA 3EXHC 1SKAA 4CJXA 4K9RA 1IEQA 1M2VA 3GDWA 2R8YA 4ZJZA 3R2JA 1BRTA 5ELXA 3DKVA 5EJEA 2P3LA 3WLQA 1OVMA 1QH0A 5L3VA 3LCUA 1T4DA 4DA4A 4C7VA 1M2FA 3HCOA 1R6TA 1B1CA 1Y3FE 3PJDA 1AD2A 1REQB 2X0KA 1FP7A 1KDPA 4IIHA 4QAQA 3RNLA 1DLIA 1F2TB 5JSZA 1PT9A 5ES4B 3COJA 5B7PA 3EF3A 1H23A 1TFRA 1XLTA 2CFSA 2GBPA 5IS2A 2CVQA 1QH1B 1HE1C 1P2GA 1W29A 3NETA 4ZCQA 5A3JA 3BRSA 1G20B 1GDHA 2OUIA 4IKEA 2ZT5A 2VCHA 4R0MA 4ZICA 3DBVO 1LC3A 2I87A 3E4DA 4YX9A 4KIUA 1I2ZA 5LP6B 4OQQA 4C7OB 1EIZA 4LV6A 1TYZA 4FIZA 1IN5A 3RS4A 2LZ0A 1I3MA 1YS2X 1FVHA 3S2FA 2HL6A 3V46A 2X5KO 1Y37A 1T6NA 3KB6A 5DHSA 5KI6A 1GPAA 4DJ5X 3NHLA 3MUEA 2HXYA 3B13B 5IM4F 4PZDA 3LY5A 4ALMA 4OAOA 2JFVA 3LSTA 3VDMA 1ECPA 5EIEA 1SVMA 3ZHTA 4L3WA 5KTNA 1LJUA 5DNWA 1H42A 5TJ9A 1FF9A 2CE2X 3SR4A 3FHLA 3QF4A 1UPBA 5DDIP 1PJ4A 3VU9B 3UT6A 1DX9A 1SU7A 5GMOA 3RHZA 3URMA 2IH2A 4WY2A 1HG0A 1YKGA 4HDSA 1VCMA 2QAGC 3CBGA 1SCUB 4B3DA 1HA3A 2A35A 4G9EA 4G5QA 1SU4A 4P0TA 1JTFA 5I6DA 2CV2A 3ZU3A 2PT7A 4G8JA 1EVQA 1THGA 1QH8B 2CMGA 4MB6A 4TQGA 4MV6A 2NT3A 3MRXA 2FX3A 4FIDA 4NCIA 2DUUA 4US2R 4P3YA 1UKEA 2VJYA 2ERXA 3PV0A 5IC5A 2IODA 3WO0A 3T5MA 1M0WA 4ZVVA 4ECEA 1Z8DA 1WVMA 2G06A 3U62A 4BGUA 2F17A 2PHZA 3K96A 4ZEOA 5BMVA 4ARZA 1ZIXA 1KZYC 2QTGA 2BZ1A 2R6HA 3KDSE 1MUUA 3A04A 1OILA 2QL7A 2CJWA 1TMKA 4D43A 2ORWA 4LEIA 4EARA 1ML3A 3NPAA 2CXTA 1J70A 2LXNA 2PA3A 4Q7KA 2A4MA 2XYVA 4IH9A 1DBRA 3S81A 1F4LA 1R64A 1XB2A 5BRNA 3WVNA 3VR5D 3TRJA 4W99A 3GYBA 1QX4A 1ES9A 1PI3A 3S8EA 2NT4A 3N7TA 3I92A 1C9DB 1NDHA 1ICIA 4KPFC 1DOHA 2HDNB 2GASA 2JLYA 1YCGA 2P6NA 3ICCA 4HB2A 1BHQ1 1SVIA 1RI1A 1NASA 2HXSA 1G6HA 1EWVA 2JZNA 1EFRD 4G07A 1QHSA 2GCOB 5T64A 3UENA 4KGXA 5KNDH 4KQFA 1QRSA 4UEJA 3WK6A 3LBAA 1UJ5A 5EE1A 2FPUA 2K7ZA 3PDHA 2GN8A 3O90A 2PSJA 2X41A 1YZFA 2Z5FA 4C30A 2OTCA 3QXCA 1FDRA 2QPAA 1A9PA 4WPGA 4ZV9A 2ACEA 2YINC 3UMJA 1DJNA 1F1BA 2H8KA 1T8SA 3HABA 3QU7A 3F2IA 1QXSA 4J1TA 1D8TA 4YJFA 1PDOA 5NLLA 4EPRA 4QREA 4F7WA 4XPIB 1R74A 5I7EA 3THYB 4N41A 1TF2A 3GUZA 1GYRA 1XZPA 3BZUA 3TCKA 1AMOA 5CURA 1IBMB 3E3LA 4JT2A 1I3KA 1A8HA 1GD1O 1QQ5A 3N2GB 4BNKA 5BURA 5KC8A 2B35A 3MB8A 3KYDA 4HHEA 2HV8A 3RIEA 4MP8A 3ITNA 2AV6A 2ID9A 3E48A 1OREA 2GKOA 4NV1A 1MC8A 2XB9A 1HKHA 2J0UA 4D8UA 2OHJA 5T67A 2HNAA 4Q18A 2ONZA 3TGWA 3SIRA 5HGXA 3TIIA 4E2XA 3G7SA 3WP0A 2XTJA 3H9UA 3EDQA 1V5GA 3HFRA 1KMQA 5ALUA 2ERYA 1FMJA 3TQQA 4AMBA 2CCGA 2EFCB 5FV7A 3RLIA 2RHDA 5LYJF 4PZLA 3S8YA 2OGZA 3BQNB 5F3DA 4H60A 4IFIA 3OIVA 2O3SA 4HN4B 4UMDA 2DZDA 2LV8A 2QRJA 3UH1A 4PHHA 3CUKA 3WGYA 3OE7A 1IULA 3GPDG 4P08A 1IXKA 1D8AA 2ZROA 3C1UA 3GOQA 3ORRA 3V8QA 1B15A 3CS3A 5FOUA 3VR3A 1I2MA 4MVJI 5JWHA 2ZRAA 1PR9A 2PM8A 1TVKB 4FI3C 4BNZA 4CIDA 3NBQA 1I0LA 2FN3A 1E4OA 4JOBA 3EIFA 4CIYA 3KVNA 1QHGA 2W6IA 3JALA 2CMFA 4UUMA 5IYZF 2AF4C 4EB3A 4DDVA 3FNBA 1NVBA 4GLFA 4BKUA 4QYWA 4KHPB 4Y6OA 1IN7A 2K87A 2CVZA 2HXGA 1ENZA 4V0RA 4MV1A 1BS1A 1VBKA 2DCMA 3QNUA 5HMMA 1KE2A 1R5NA 2FYTA 5HIMA 5JH7F 2C9CA 3DBHA 2DR2A 1VMDA 1LTQA 1N3IA 2AIRA 3WQBA 4C6HA 4IWNA 1P0MA 3REOA 3WBFA 4UVDA 2GXSA 2ST1A 3GLFE 5EJGA 1EUQA 2QX7A 1NV8A 1O5IA 5DGHA 1FFDA 3H9EO 2VPQA 5KOHA 4W63A 3D3EA 4LBZA 2ZU6A 4LSZA 1KNXA 3PJFA 3ZDFA 1WXGA 4CYMA 3EZXA 2D0OB 2ZRBA 4HN2A 4FS8A 5C1DA 1VJRA 3F3SA 3UBMA 3K0AB 4HZIA 5I4CA 4B3XA 3HLYA 1PTKA 1JQLB 3LFHA 3DM5A 4G24A 4NVRA 2FOLA 4XGIA 2VJQA 4K9DA 5C53B 1XMIA 4CQNA 1VLHA 4NJEB 2FV8A 2BJHA 1XXHB 5E3HA 2YY6A 4UOEA 1VA5A 3HV2A 2W71A 3U4HA 1YD7A 3H2JA 1FFEA 4EOGA 2ENUA 3HO8A 3O8NA 3EXEA 4P5DA 2DFDA 2REQA 1QU3A 5DK4A 2IIVA 3O4FA 4ER6A 3FGNA 4FP9A 1U8AA 2Q5IA 1VB5A 1T15A 4JMPA 3BGVA 4R98A 5K3CA 3O1LA 5F3WB 3HSYA 4EFNA 2OE2A 1N6KA 5FBLB 4DIMA 1KH1A 1O9HA 2O3RA 3I6YA 2RAFA 3IP8A 3N9IA 4IGKA 5KREA 4BO0A 3R9XA 2KHZA 1UH5A 2EHDA 1YJ5A 5D3KA 2C5EA 4FEAA 3PC4A 4V03A 2HB6A 3S27A 2PO7A 1YBHA 3A6ZA 2YMLA 4UTPA 1XMQB 4QJIA 3ASYA 1JZQA 2AMFA 3RWMB 1IBKB 5TQ0A 4A8TA 3DCIA 2DT8A 1OFIA 3BXPA 3HRHA 4TWAA 1X1BA 3EC2A 3GK3A 3ZLTA 4CKZA 1V5EA 4IOJA 1ZM9A 2WT8A 4PX9A 3INRA 2WIKA 3IGFA 1FP6A 3R5SA 4GZ6A 4DREA 1YO6A 4QOHA 1UCFA 4N40A 2ZSKA 5GAJA 3WV4A 1T5TA 3OZWA 4BDSA 4Z6KA 3I9V6 2EFEB 3PFFA 4I5IA 5IDVA 4DLRA 3AF5A 3U7QB 3AU8A 1OB5A 1SUAA 3QX9A 1RXVA 3QHQA 1EGAA 1GNVA 1NRIA 5EN4A 3PRYA 4KR0A 1AUOA 2JHCA 3GXBA 4YN3A 1ZRMA 5G0WA 1EZ1A 2YJGA 1JIIA 3P19A 2YWFA 2P4SA 3B36A 3L18A 3NAGA 1W19A 1SPXA 3I2YX 1JEOA 1TRHA 3JZFA 2R7LA 2ONCA 2NO7A 3L4SO 4JR0A 2PUDA 621PA 1F8UA 1I5EA 3DA8A 3GAAA 3IMKA 4TTSA 2GHIA 1O8BA 2G9UA 4L27A 4K1XA 3U5ZB 1QU2A 2J3HA 4IGIA 4HVCA 1V95A 2H4YA 3LCJA 3ZR4B 3WGVA 1YS9A 4JXJA 3T3OA 4V0NA 4KODA 3PI7A 3LUPA 4ZV7A 3OT4A 2PUGA 2EKDA 2P2ZA 3GRZA 3FLEA 3ML1A 1K8ZB 4G67A 2A5YB 1EDDA 2L42A 1EGQA 2FZWA 2D1FA 3N74A 3T06B 1SUPA 2YYAA 3CFYA 4M9ZA 3L01A 1UM8A 2VRCA 4WV3A 2I22A 5B2FA 1ISHA 3BTSA 4MQ4A 2C9DA 2G9ZA 2GHTA 3Q87B 1Y6RA 5K8TA 4WHMA 4MDFA 1NI5A 1Q91A 3OESA 3W3AD 5JNSA 1R16A 4MI3A 5D8DA 2DFPA 4KTTE 3EXHB 4ZT4A 1DKLA 3ZZUA 4B0OA 2VSNA 1XG5A 1QZUA 1J1IA 1P7YA 3DM9B 3K9BA 3ZIAA 1OSNA 2FE4A 3J7TA 1C7IA 5AJYA 3M81A 1Z6GA 3I09A 4EY7A 1Q7TA 1K0FA 2C0PA 2D06A 2OO5A 5EZQA 4K9OA 1Y4ZA 3AK4A 3GLVA 3CZPA 4PIVA 3SF0A 4CLDA 2I9KA 1D4AA 3AHDA 3E03A 3IKVA 4G5HA 4REQB 1D4FA 3N0VA 1EK2A 4XCQA 1NLMA 2XD4A 3MTIA 1G5RA 2RBKA 4E6EA 1NJ5A 1YZTA 1KA9H 4RHYA 4YBRA 2EJWA 2QRMA 2WYVA 1ZM3A 3FPJA 3CKKA 3JVDA 4Y2XA 3PGJA 3RAGA 3TD2A 5LDDC 3VH3A 1IXYA 1V8DA 3BTUA 2A7XA 4JLSA 1D5CA 1E77A 2Z2ZA 1S1MA 2DT5A 4N7RA 4JLKA 4FD3A 2IOFA 2FFBA 3MWKA 4QQNA 1Q7CA 1ST3A 4RBNA 1Z5WA 2OV2A 1DIOB 4L5IA 1DB3A 4ZAXA 1XZIA 1MG5A 5B3JC 4KVFA 2PL3A 1F0YA 5H59A 4MO2A 4WESA 1AB5A 1UJ6A 2NVOA 2IC5A 2W2TA 3PI6A 3I4FA 3SQNA 2ENWA 2YV4A 2XT9A 1JQKA 2CJYA 3AWIA 4TTJA 3LUGA 1YB2A 3RFVA 5H68A 3MB5A 1CQJB 3E58A 3GVIA 2IF2A 2ERCA 2R5FA 3PGKA 4TN1A 5FD8A 4B7XA 5ALQA 5FO1A 4G37A 4ZCPA 5EHIA 4LISA 3KJZA 5TPZA 4YRBA 4GM1A 4ARBA 3R9KA 1HV8A 5FUWA 4GOLD 3HVHA 4FSXA 1Y5LA 2GZMA 4JOSA 5KJCA 4V0SA 1K7EB 1PFGA 2VAWA 3F5QA 5HDQA 4X65B 4Z0NA 1B74A 4LXYA 2PUJA 2YTZA 3LT0A 3KPVA 4L50A 4OX9Y 2QAGB 1N2JA 1V8ZA 3D8NA 4L8WB 4YRRA 3AVYA 1C0EA 1PR2A 1X7ZB 2NN3C 2QAIA 4LC0A 4MAFA 1U8YA 5I7OA 1IBRA 3B7WA 3E35A 5AFSA 4IJ6A 3JQRA 3IMGA 1FSPA 3BMNA 2NXWA 3JZMA 5CDTA 1RQPA 2RGGA 4U8HA 2C5SA 2JFGA 3AHEA 3KJXA 3HWX1 2JAUA 5DLYA 4UMEA 4BQFA 1U80A 2QVBA 5JV5A 2HHCA 2R1TA 2NTVA 4WGFA 1DBVO 2AQKA 2V1XA 3ZWVA 1J97A 1VMAA 3CEPB 3DQPA 3I30X 4URZR 1C8BA 2E0IA 4XWTA 4CR8A 3HVUA 4US0R 1KK3A 2EZ4A 1RMTA 1NJ1A 2BLNA 2X5OA 3GHHA 4HRXA 3WK4A 4B31A 3ZTTA 1OZHA 1RU3A 3I9OA 4X1IA 1TK9A 5F77A 4PVDA 2UZ0A 1U5CA 3QOFA 4OYYA 1SVSA 4XWGA 1ONNA 3T8YA 1GG9A 1SULA 2K2WA 2QL6A 1OT3A 1Y5RA 1YIAA 3MPUA 5BSGA 5HZMA 5LM3A 4GMXA 5TQVA 1C81A 1R5BA 1T8UA 1XA4A 5KZMB 2HCRA 4BEWA 3L6CA 4BEBA 1AE1A 3WLHA 2B8TA 1X8KA 5FPPA 1L8LA 1QTNA 3JTEA 3LT4A 3MFYA 4K6GA 1GKIA 4WOKA 3STXA 3HYLA 3VKHA 3C3BA 3OEHD 4C2TA 4Q4JB 3DP7A 3FUUA 2NWQA 1M6VB 1YJBA 4X24A 3RUEA 4Z4QA 5H3CA 1QRUA 2QRGA 3D3QA 5K0SA 1PX2A 4BNHA 1GPMA 5DI9A 2VSOA 1Y1KE 1SUEA 1RPZA 1WKCA 2PUBA 1FRFS 2H1RA 3ROFA 2XLCA 4NQZA 3BWEA 3EVDA 2YRWA 2JHAA 2H9YA 3FOAA 5F7JA 4ZT2A 1T8PA 2DLDA 3LP8A 5E6UB 2BSQA 3V97A 5DGDA 1TUGA 4B80A 5TVKA 4GOMD 5EWLA 5J4HA 2Q2QA 1X3SA 2ODNA 2A9QA 3IAM1 4ANFA 3QQPA 3RIMA 1DNPA 4YI5A 2QX4A 3BBLA 5EJAA 5DWDA 3ZIDA 1WW2A 2C5AA 3FVQA 1U65A 2GOYA 5YASA 2AS0A 2JFPA 2VBIA 1PZGA 4I4IA 3TFWA 3VSAA 1PEYA 1QHHB 1UKYA 2FRVA 1K2VN 2JCXA 2SICE 4MULA 4UARA 1PW5A 2NAPA 3HVKA 1M6NA 1DKPA 1TK3A 1UMKA 2FF7A 3MPOA 5I9IA 5F51A 3C7CB 3VX4A 1DJPA 4KV7A 4O3FA 3KZKA 1YR7A 1NBMA 2GTHA 1VJCA 3RGGA 2VJLA 3QITA 2WWWA 4NMMA 3U4QB 3LXUX 3RO7A 2VHVA 4JYMA 2BUAA 2J6CA 3BXGA 1Z34A 1ZEMA 3DB2A 2GGSA 4OA8A 4F3YA 5KX5A 1IK6A 2QRQA 4KH0A 3PL5A 1NN1A 3OTIA 5LBTA 4KLZA 2JASA 5K3AA 2B69A 1UXHA 4M53A 4Z2AA 1RYYA 4RVHA 5HW0A 4D9CA 1KI9A 3FB1A 3H6HA 2BTOA 1E5TA 2Y4OA 4LWPA 3RVQA 2NTJA 3EZ2A 1EBUA 3DMHA 4W5HA 2VSFA 1PJ8A 3F90A 5JYDA 3E1SA 4GD3Q 1XU9A 4IOLA 1U11A 1FRVA 1MB0A 2L0XA 3BXXA 4HGYA 4QUGA 1XTKA 3VSBA 1HM5A 1T5LA 1VLQA 2KS6A 1EKXA 2HSZA 4HRYA 4E2YA 3ND8A 3SXJA 5IFLA 3RG2A 1G8JA 1DL5A 4J0JA 4KL8S 5AVRA 3SF8A 5DN9A 3VR5H 4CL3A 2RI1A 1E4EA 1XCJA 5H9VA 3V2UA 4OI0A 1AK1A 2GUWA 3V1KA 1YRQA 1M5UA 5KYWA 2YWBA 1WMFA 4WZZA 1Y1QA 1T4CB 4NPCA 1SKYE 3SD7A 1D2MA 2LP4Y 4LZOA 1IG3A 1G8GA 3C8DA 2H57A 1GGHA 2GA9A 1KI6A 1O03A 4LZAA 5FBRB 3UG7A 1EGVB 3SJ7A 1L4BA 3HBMA 5EZYF 3FW1A 2ZZNA 4D57A 3VJMA 1KHTA 1MAVA 1SD2A 2R7KA 4RCVA 4PQYA 3RT1A 2Z58A 4NENA 1YB5A 4ASUD 2LVBA 3EZLA 4ND8A 3NNSA 1V3VA 1RBQA 3DCYA 3RJZA 4BRSA 4UREA 3CEJA 1XKXA 4YMIA 1QIKA 3C98A 4YCJA 3TPCA 4C5CA 3MD0A 3F1KA 4FE3A 1V7QA 4TUYA 4C4ZA 4BL5A 221PA 3EIXA 4HN9A 3K0EA 3U3KA 1V8OA 2P4EA 4C07A 2R8BA 1VG8A 1T9GR 3CN9A 3E2MA 1B3RA 5FA5A 4LOKA 4P5EA 1M2KA 1SBHA 1ZEJA 2ZRGA 3RSFA 3GAMA 5C35A 1DEHA 1EA5A 1OLSB 4PGFA 3T12A 1CLUA 3BM5A 5IVKA 1GTL1 2I80A 1L7PA 1W44A 2Q5CA 3O2QB 4QU9A 3ZCXA 4MPJA 9LDTA 1U1CA 2NNWB 5A4MS 4DLXA 1XRRA 4TPKA 4KDRA 4IF6A 4YMGA 5ALVA 2RSLA 2CUKA 2G09A 4XX1A 2BDEA 1AQYA 2GM5A 2W2KB 4U2CA 5DYGA 3TXXA 1M10A 1OXBB 2GNAA 4ZOQI 5A0TA 2JGDA 4IIJF 5JI2E 3I4CA 3SXUB 1GG2A 2KMLA 4LDNA 2Q3DA 3DLHA 5JIBA 3D54D 4RHFA 3VM6A 1YZ3A 1USKA 4N6OA 1C29B 1NN3A 1E3TA 2AI3A 2YWCA 4IUBS 2A86A 4DLSA 3KZXA 4WUVA 3GMSA 4GPEA 5CAEA 4B40A 2XQGA 3SVLA 3SOPA 5F12A 2XXBA 1UFVA 4YONB 4JUDX 4ZVMA 1GA6A 3N2YA 1LD3A 3CUSA 3BF8A 3ZJ4A 3PX2A 1E0JA 1LDYA 4M7RA 3AEQA 1R6XA 1WG8A 1WR8A 2R85A 1OC4A 5EJ6A 1W36C 2AN1A 2XUQA 3EQ6A 3A9TA 1NP7A 1S2NA 4CTNA 5GTDA 2JVJA 3TX2A 1LSOA 1QYDA 3W5UA 2DQYA 2BP7A 2ZIUB 4DUPA 3V80A 1M7GA 3SYNA 2Z1DA 1GGVA 1DZIA 1QBKC 4NATA 4PLVA 3KXIA 4QBFA 5E2AA 1XVLA 3QLTA 4YPFA 5IARA 4HAOA 1X0XA 1MFPA 4DSNA 4W7IA 2PG3A 4NWIA 4RMNA 2MCFA 3A2NA 3GOHA 4FU0A 1L4NA 3ZY6A 4OGWA 2V3VA 2FWRA 3G0IA 3QQ5A 2ZUBA 4Q3KA 4URWR 4N5DA 3V1YA 3EIUA 1QMGA 3L84A 3OT1A 3S2ZA 1SIWA 4LNHA 5CA1F 1TQ6A 1CQIA 2WYHA 4FQ7A 5LUBA 4FM9A 1ZMRA 3GGOA 2CXHA 3HV0A 2AJTA 1DO8A 1XDWA 3C97A 1VSQA 2W2PA 2E4WA 2I2CA 5CX4A 1XLWA 4HADA 1DQZA 1M2JA 2FPKA 2XZPA 3TLAA 1JJIA 5FPKA 4UEWA 4PQEA 2VI5A 2W2OA 1FFSA 1XMPA 3PKJA 5CUQA 5F1PA 4DV5B 3ZE9A 3L7YA 1A4XA 4XR9A 3UTCA 1PG2A 4JD5A 5ALRA 4F3CA 4QGSA 5EHQA 2QP3A 1BXKA 1AF7A 4FJ1A 3LHSA 3LSYA 4HFMA 3WXMA 3ZE6A 5J2UB 3AFOA 2W2LA 4JKIA 1GZ7A 4P32A 3M3PA 1BW9A 2DBQA 4R2KA 5A5EA 3C3CA 1JEDA 2IH4A 1JXAA 3DWFA 4ZIRB 4LFCB 3UXEA 2R0QC 1Y9JA 4MW9A 1A04A 1NX9A 1U0HC 4MQEA 4V24A 3R7DA 3WYFA 3UMYA 4Q03A 3H05A 1NMQA 5GJCA 2X8BA 1GPNA 3DH0A 5IBRA 5A0FA 3GJYA 4AUKA 3Q15C 3ZDXB 2PX5A 2I8AA 1PCXA 1D7OA 3E7WA 4JYCA 1EINA 5LZ8A 2P2CA 4DM3A 4WXYB 4DBVO 1J2TA 2O2HA 4G84A 2WC1A 1F17A 4HFRA 4R9UC 1YMUA 2WJWA 5EJ4A 2F1OA 3OETA 3IAAA 4M8LA 5JZOA 5C8DA 5IJXA 3GRFA 4J4TA 4EG0A 3M5PA 3SSNA 4IX9A 4MKGA 2FJPA 3A9SA 1GGNA 1JLLA 3DDZX 5JNUA