1NUTA

Crystal structure of human cytosolic nmn/namn adenylyltransferase complexed with atp analog
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
232
structure length
212
Chain Sequence
SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords FKSG76
total genus 72
structure length 212
sequence length 232
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2003-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nutA00
3M5WA 1WXGA 5JBNA 5TS2A 4TS1A 4MWCA 3ZUGA 4MUJA 2H2AA 3SDBA 1EFVB 2JAXA 4KKVA 1S4MA 5F23A 1YUMA 4MW7A 1JIJA 1MJHA 1EJ2A 1O95C 4NATA 4WSOA 1I6KA 3N2YA 3SZ3A 1NI5A 1X8XA 1EFVA 1NUSA 1WXFA 2DUMA 3IMEA 4YP7A 1J20A 1H3EA 2D13A 3FWKA 4HK4A 4CDMA 2QUJA 1VBNA 4MAFA 3X1JA 2HMAA 1YULA 1IHOA 2XRZA 1N2BA 1GTSA 2IJGX 1O5TA 3COZA 3IOCA 4EG4A 1Q11A 1Q19A 2EL7A 2GOYA 3AG6A 2RE8A 3H97A 1M83A 3ND5A 5HG0A 1EUQA 4JXZA 2A4MA 3S3TA 3UK2A 4HJRA 3TQIA 3HL4A 4G6ZA 2NSYA 3SP1A 3AIIA 1K4KA 3K9WA 1HYBA 3A04A 4ND6A 2TS1A 1PFVA 3ZXIA 3L92A 2YWBA 2Z3VA 1IFXA 2A86A 1JZQA 3K32A 4NAHA 1NUUA 1IQ0A 1OD6A 1PFUA 3NBAA 1VBKA 1OWPA 4PY2A 1R6TA 4J75A 3A2KA 4KPUA 1J1ZA 2QJTA 2J09A 4I6GA 3ND6A 3CVWA 3IMGA 5K0TA 1PFYA 2A84A 2GKSA 3ZGZA 1PFWA 2H29A 4DLPA 1K92A 3IH5A 1KAQA 2X0KA 2GM3A 2HGZA 1QJCA 1NZJA 1F7VA 3PNYA 4OJMX 1K4MA 3FHJA 3TZLA 4DNXA 2PG3A 4JZYA 3SYTA 1GAXA 3P0HA 4NZPA 1YUNA 4CQNA 2EJCA 4FZJA 4QBTA 1N2IA 1KKUA 1MAWA 1MBZA 4ARCA 3P0JA 4JYZA 3INNA 4ZT6A 3IUEA 1H3NA 4NX2A 1KR2A 4EF6A 2A1TS 4OUDB 4ARIA 3QTTA 4EG5A 3FNRA 3C8ZA 2PZBA 1LI5A 5TEVA 1KP3A 3D6VA 3FDXA 3IMCA 4MQ6A 3FI0A 2CSXA 2QUKA 5BNZA 3ZJVA 1WKBA 2CFOA 3ELBA 4EG6A 1EUYA 4YP5A 3TNJA 2J4DA 1G59A 1R6UA 3I05A 1MRZA 2YY5A 2DERA 2X1MA 4PBRA 4GU5A 1Q15A 1JIKA 4E1AA 4K03A 3HV0A 1IH8A 2DLCX 2PIDA 5K0SA 4OUDA 4AQ7A 5J58A 4R0NA 5IHXA 1GN8A 4YP6A 2OV4A 4ZT3A 2Z08A 3KT6A 3NBKA 3IVXA 2CV2A 1N2OA 1N2EA 3N9IA 3UOWA 3AKZA 4UZFA 1KQPA 1ILEA 2DPLA 4RPIA 4MUGA 4YMIA 4MVXA 3IUBA 1O0BA 2QJFA 1QQTA 4CDNA 2A1TR 3PNBA 3COVA 3JXEA 3RK1A 1F7UA 3COYA 4MUFA 1M8PA 4U63A 2VTBA 5FO1A 1G8GA 3FIUA 3ZJUA 1OBHA 1WXHA 2VXOA 2ZUEA 2XRYA 4PBSA 2HZ7A 3AL0C 1NURA 2JA2A 1U7XA 1PG0A 3PXUA 1T6ZA 4KR9A 2WB2A 4KR7A 4ZT4A 5KHAA 4BWVA 3Q12A 1V8FA 4ZCSA 3HFJA 3COWA 1QNFA 2OQ2A 3TZEA 4MW4A 3N05A 2J07A 3G6KA 4HJXA 2PFSA 1XNHA 2DEUA 1JEDA 3L93A 1N2GA 4U8HA 4MW9A 3UMVA 1F9AA 4XFDA 1O95D 1JIIA 1JZSA 3SEQA 1I6MA 1U0BB 1T9GS 4EG3A 2J08A 2AG6A 1TQ8A 2RD2A 2R5WA 2AKEA 1H3FA 1FYDA 4ZT2A 3CLSD 4Q93A 2IP1A 1XNJA 4MVWA 4GRIA 2CT8A 1U7DA 1OBCA 3RK0A 2DXIA 5EKDA 1H1TA 1G8HA 1OWMA 4EG1A 4MUIA 4DE5A 1Y42X 4DDMA 2WQ6A 1I2DA 1ZH0A 1DNPA 3GUZA 3HZRA 1TYBE 1CT9A 3IODA 3ZXSA 1IQRA 3KT8A 2AZXA 1WZ2A 1N2JA 1NSYA 1EE1A 1O97C 4L2IA 1V47A 4CT0A 4KPUB 1M8GA 3IOEA 1IQUA 1M8FA 1JECA 5KCMA 4MW2A 4JXXA 4R2MA 1B6TA 3GLVA 4XSVA 3X1MA 3AG5A 4JFAA 1WY5A 5HUJA 5IJXA 1O97D 4MW5A 2PZ8A 2PXHA 3OP1A 5DK4A 1G8FA 3TS1A 4Q16A 3FY4A 4R2LA 3UC5A 1OWLA 3LE8A 2DR2A 3IVGA 2G36A 1A8HA 5DASA 3CLTD 1OWNA 1ZUNA 5TEWA 1IRXA 2Z09A 4DDKA 4MLPA 1IVSA 4MWEA 3MLAA 4MWDA 1J70A 1UFVA 4ZT5A 5DB4A 1QRSA 2E89A 3CLRD 1NUPA 3AFHA 4U7JA 3VGJA 4I6EA 1JGTA 3TQOA 1TFUA 1VL2A 3RBAA 4EG7A 1U3DA 1QRTA 2CYAA 1WOYA 3CLSC 2E0IA 5DEOA 3NV7A 2QJOA 3Q4GA 4ND7A 1TYAE 4AS1A 3HGMA 2CV1A 1U3CA 3D6UA 3X1KA 1WXEA 2CV0A 1R6XA 2JANA 3OTWA 1TEZA 2X1LA 5J59A 2E21A 3ZIUA 5LLTA 2QTNA 3F3MA 1O6BA 1D2RA 2QUIA 1O94C 2D5BA 4P2BA 4RUKA 4ZCPA 1WJGA 1N75A 2CUZA 3CR8A 1O96A 3G5AA 3QTBA 1KQNA 4KR6A 2PZAA 4J76A 3P0IA 1MOPA 2ZUFA 3DV2A 1J21A 1FFYA 1MB2A 1COZA 3FG9A 3VU8A 2E18A 1BS2A 1QU2A 3GMIA 5HUHA 1J09A 4MUNA 3FH0A 2WSIA 2WQ7A 2CYBA 3ILVA 2A1UB 5KWVA 4MUEA 1GLNA 4G5FA 1VBMA 2V0GA 3ZJTA 3LOQA 2CYCA 1GZUA 3A05A 5FO0A 2C5SA 1EXDA 2BYTA 2V0CA 1MC1A 5H7XA 4F3RA 1M1ZA 3MXTA 3A4IA 1M8JA 3MLBA 3IVCA 4MULA 1KQOA 4F4HA 3G59A 1VLHA 1YIAA 1GPMA 1NUTA 2VTBB 1WXIA 2YXNA 3KT0A 3LCJA 2QUHA 3CLUD 3CVUA 5H16A 4MUKA 3CLUC 1YI8A 5LM3A 3FETA 1KH1A 1NP7A 3RFFA 1K97A 3HMQA 3ISJA 2D54A 4NDAA 1P7PA 2A7XA 4G5YA 4MW1A 3SZGA 1X6VA 4MWBA 4UZEA 1KAMA 1NUQA 3MUEA 4ZCRA 1N77A 1LI7A 4X0EA 3SEZA 4EGAA 4MUHA 4XFJA 1QTQA 3IOBA 3E27A 4DJAA 3MMXA 4EG8A 3H99A 3KT3A 2ZP1A 4H3SA 3U1VA 1SURA 1T6YA 1F4LA 3PNVA 4L2IB 3RJZA 1O0CA 2DETA 1N2HA 1KH3A 3H9BA 4PBTA 4WNYA 1GTRA 4MVCA 1XJQA 3DLAA 2BTEA 1QU3A 1NYLA 4MW6A 1JILA 2O5RA 2QTRA 5FNZA 1MAUA 3H9CA 4QREA 3CVYA 3ND7A 3DO8A 1WQ3A 3CA8A 1O94D 3N8HA 3P52A 1JEEA 1JMVA 5AHWA 3Q10A 3CVXA 2J5BA 2I1LA 2B7LA 1O96B 1Q77A 4K0RA 3DPIA 4MVYA 2YWCA 4EFKA 1TYCA 2O8VA 3VRHA 1N3LA 3CVVA 3KFLA 1T6XA 5J5AA 1N78A 4YBRA 1JHDA 1TYDE 1KH2A 4A91A 4I6JA 1RQGA 2NZ2A 2A88A 4NAUA 1KP2A 3UY4A 1M8KA 4ZCTA 4ZCQA 2A1UA 4DDHA 1J1UA 5TGTA 2X3FA 1QRUA 4MW0A 4ZT7A 1LW7A 2QTMA 1ZJWA 1YIDA 4S1OA 3H05A 3CLRC 1N1DA 1ULHA 3CLTC 3BL5A 1EFPA 3QE4A 1PG2A 3IDFA 4QRDA 1OWOA 1KORA 2IELA 3FOCA 4HPWA 1T9GR 5LFAA 1WQ4A 3RHSA 1MB9A 1XNGA 1EFPB 1I6LA 1ZH6A 3PRHA
chains in the Genus database with same CATH superfamily
1V9LA 2QE7D 2TMYA 5DYNA 5TS2A 2BDUA 3T9EA 4HAVA 5GJBA 2H2AA 3EDCA 3CRNA 2R8EA 2VXYA 4DNOA 4Y1FA 2W48A 3UOGA 5D3QA 2RHCA 4RMGA 5FTKA 4CW7A 1ZVVA 3OOSA 3F8WA 3BQNB 3H2JA 4N5MA 3KS9A 2PUGA 2NUPB 4D8WA 4NNPA 1QH1A 4G1FA 3FTFA 3MAAC 2AH5A 3KWFA 4PN3A 4X63A 4IVPA 1UFRA 1QYRA 5DXFA 3TB4A 1Z9BA 2DUMA 4GPEA 1ZMOA 4XJVA 2GA8A 3FCUB 3RAJA 1CUVA 1TGVA 5IDVA 3EJWA 3KQPA 2R1VB 4OMDA 4YJ3F 5CLHA 1OA0A 3OF2A 2F9MA 2GNPA 2VA8A 1V7QA 5B37A 2DFVA 2NU8B 3ZWPA 2UUOA 5AOAA 1DTWB 1V8PA 4LHSA 4JBLA 1FFAA 2QN9A 1GTSA 1RRKA 1PRYA 3QG5A 5K4AA 2F1JA 1JAYA 2H1HA 2SKCA 2W8BA 4BC1A 1C1XB 2O2HA 5HFNA 1P4AA 3RSHA 5CYGA 2AR9A 1L7PA 2OYRA 3WLKX 3VR2D 3KPYA 1XU4A 3TSAA 3W1VA 3DBVO 3RSCA 5T8KA 1QKIA 2BY4A 2QTLA 4QDKA 2W2OA 3OZTA 3EE6A 4OHOA 1L0BA 3EY9A 4YO8A 1QQ7A 3T7KA 4B4VA 1K7FB 2OVBA 1WMFA 3UK2A 2ZYRA 1KZ1A 2HBRA 1DC5A 4Y1GA 4TS4A 5BMVF 4FOTA 3ZXYA 3T7JA 1Q3TA 2H06A 3ZEAA 4QVKA 5D7NA 4NG4A 5EUCA 3RVNA 1Z15A 2ID7A 3VYUB 3T0FA 3GD7A 5BP7A 1H1LB 4ND6A 2IXGA 5K3CA 1OH5A 1Z0AA 4DR6B 3BB1A 3MJDA 5GONB 3IAXA 3RPEA 3K2EA 2Q45A 4EJFA 3L7JA 3TRIA 2ZBQA 5CFLA 1G3MA 5A7FA 3B52X 1FXWA 5IU6A 1PJAA 1JIXA 1P2UA 3VVBA 3ZCRA 2UZ1A 5TMBA 4EFDA 1DX9A 2YQ5A 2OP0A 2QIOA 1Z38A 2PLAA 3V2HA 5DNEA 1JG6A 3HVRA 4YH1A 3ZWXA 3AZQA 3I04A 3BMNB 3F7NA 1N0VC 3NUZA 5G4LA 5H9VA 4I0WB 4F1JA 1NDHA 3LOPA 4A1OA 1UBSB 1XHLA 2BT4A 2H48A 4L9AA 3BL8A 3DLIA 5KJEA 5KREA 1MXHA 2C7QA 1U3WA 4X5OA 4YMLA 3L0CA 2C2OA 4TYNA 2XCRB 3FUWA 1KAQA 2HD4A 3EBLA 2GM3A 2DAPA 1ISIA 4OJNA 4MMXB 2C4TA 1KFEB 2NLOA 4F3NA 2F1RA 2JAOA 3PNYA 4XPZA 5BQPA 1TW2A 2IYRA 3F7MA 3M9WA 3UMBA 3W9SA 2ZRDA 3L8EA 2FAXA 4BEBA 2PMFA 4GC5A 2ZIEA 3JRXA 1B1CA 5F2EA 1J97A 3ONVA 3KQHA 1XAJA 3NOOA 3ECSA 1FVHA 4FZJA 1Z7GA 1P81A 2K2QB 2I5PO 4BS9A 4NJEB 3EIOA 1OC2A 1CE8B 1ZRNA 3L6OO 3M1AA 4WDQA 3T3GA 2C8LA 4M37A 5ULLA 2HDWA 3ZGNA 1DELA 1DC3A 3QUAA 3FUCA 2MSWA 1EA7A 2PK3A 3K0FA 4ZT6A 3ZOZA 4IXTA 1XMPA 1A27A 4R54A 3KOZA 3B3GA 3PRKE 4GOMD 4QATA 2WHPB 1E6EA 4YJ2F 7MHTA 1GRNA 3QBVA 4DWJA 5HK9A 2JJ2D 2PZGA 3P8ZA 4DBLE 1UOQA 1DWUA 1W2HA 2C4MA 3FNRA 3O4HA 1KVQA 2B7BA 2H1IA 2I2XB 2OMKA 1TD9A 5DBIA 4DWWA 3TUZC 2YXLA 4FKBA 1NY5A 3FI0A 5F4ZA 4MVJP 2Y8EA 2VBCA 4GS5A 3ZW9A 1KKMA 2OCBA 4UTNA 3JQBA 1WAMA 3DVQX 4MI3A 1D09A 2EZ9A 1NF8A 1EUYA 1UKEA 4H6XA 2D8AA 1FXUA 3EARA 4AYXA 4P7FA 1KMQA 4B6SA 1Y5IA 1E7YA 1CUUA 2ABWA 3SXJA 4V0LA 1PIWA 4Q39A 4A8JB 2QTGA 4JODA 3V32A 4A5OA 1U6IA 2JF0A 3OLQA 5HRUA 3C1TA 2W6JA 5DH9A 4X1YB 4KODA 2JJ8A 2ZR9A 2G3YA 4D4LA 1WXXA 1VE7A 4KNVA 2DLCX 4OUDA 4CFZA 2RGAA 2XCUA 1T10A 1SXPA 16PKA 4MV4A 1JDTA 3O4FA 3KT6A 4A9AA 2Q7DA 3AVWA 5E6SA 3TPZA 5FA6A 4AROA 1NRJB 2ZI7A 3B48A 2JDID 5M3BA 1HYHA 3D7KA 4LCJA 1J2EA 2GEUA 3ROXA 4EYKA 4TWZA 1EK0A 1V16B 3BWVA 1O5OA 2VF4X 3CURA 4R41A 1XMOB 1JQDA 3DZIA 2ZB4A 4RESA 3JYHA 5K3FA 3BRQA 3IIIA 3UBTA 3K94A 4L15A 3WGZA 3SQNA 1UXGA 5HWSA 4X6LA 4F4JA 2TSYB 1GDDA 3K09C 3RC3A 3VAZA 3DTYA 1GT6A 1V8ZA 1XVAA 2NPOA 1G18A 3QYJA 4UBMA 2YXEA 4PLVA 4KW7A 5BN1A 3LUHA 4BO2A 4NARA 3B6MA 2DF8A 5AVTA 1JDUA 4H1VA 4PFSA 1SXJC 2ZYTX 3AF0A 1YVUA 3I3OA 1M8PA 1PF7E 4F11A 2GM9A 1HSOA 2AJ8A 1WUYA 3T7RA 2QQEA 4WBNB 3VSAA 1EA5A 2L17A 3A06A 2CF6A 3DB2A 8AT1A 2R6AA 4FI3C 3AL0C 5T3UA 1U7XA 1UMCA 3T3IA 1DRUA 3IVRA 4FMDF 2PD6A 3UWDA 3HXMA 2ZATA 4PG7A 1F5NA 2GYWA 3TZBA 3S4YA 2PUEA 3RBXA 4XLTA 4Z1OA 1P1CA 4DL9A 3IX7A 1B8OA 4CL8A 3PDWA 4M0KA 3QLUC 3HYCA 4BWVA 5TLSA 5BV8A 3OLWA 1GGHA 1VLVA 2EJBA 4MV0A 2WG1A 1Z83A 1ENPA 3RS4A 4PSUA 2W93A 1X42A 3TLMA 5K3SA 3TLGB 3TXAA 3HDVA 2D5LA 2WWGA 1CD5A 4TL8A 2JLYA 4CMAA 4L6CA 4AY4A 1H0SA 1RJDA 2NTYC 2IX9A 3H42B 2WVGA 4KACA 5HKKD 1N2GA 3O8CA 4I19A 3ELWA 3UMVA 4PWZA 1U0BB 3F6RA 1JZSA 1WE2A 3SQLA 1NJGA 1T9GS 1OBFO 1I33A 3CHYA 1TVCA 3GFSA 3NIDB 3GJ7A 3HVHA 2R00C 2C99A 4WNIA 3TZQA 1OFGA 3ETJA 3TMAA 1WHSB 2CDRA 1H3FA 3I1FA 4M7OA 4TTSA 3TR5A 2EF1A 1FYDA 1CYDA 1S2NA 5AW9A 4ASUA 1XXHB 1JQKA 2WWRA 4RQUA 1E0AA 2HU8A 4NYIQ 5JAQA 3UCEA 5FHQA 1X9GA 1YZNA 3QX3A 2IOFA 4YFVA 1NBWB 4JVLA 4KWHA 5HBGA 3B20A 3E05A 5A06A 1LI4A 1AE1A 4BVLA 1Y42X 3QF4B 3WK6A 4C89A 1M6NA 1NIJA 4LI0A 1CY6A 1UBNA 1ZSNA 3EEOA 1MC4A 2AXPA 2FWIA 2IITA 3DFUA 1GGEA 4JJ7A 1Q21A 5EZ6B 4F2DA 3W06A 4UXIA 3LQYA 2HAEA 4FGSA 1FTQA 4A0QA 2AZXA 1VIDA 1FEZA 1M1UA 4LE1A 1F2UA 1Z5ZA 3ABIA 1DOHA 4BMXA 1KR5A 1UXHA 3VPCA 1BN6A 3LUBA 1YJBA 3TGLA 4BXOA 1GGVA 4B8YA 2VPQA 3U13A 1UPFA 1SKYB 1U0JA 3RLIA 1EP2B 4A4DA 1XMVA 4Q9NA 2NU6A 3GLIA 4UNSA 1RXWA 1HNWB 4EVQA 1QKKA 1I9GA 5TJHA 4URVR 1F60A 1H0HA 3UAXA 5EIXA 2M6RA 2PZ8A 4Z9XA 4P36A 2WOJA 2H51A 3TS1A 3JD4A 2PA3A 3DTNA 5K7SA 4F7WA 3G9XA 2OZVA 3UC5A 2JCYA 2HF7A 1XYGA 4PZLA 5KYYB 3NX4A 4UE6A 1OMOA 2FMFA 2G9VA 2V98A 3EZNA 1XE3A 1CRWG 2FN4A 5E7JA 1H4TA 2JIBA 5HYVA 4MWEA 1IUOA 1PQWA 2XXBA 2CEAA 2YWDA 3Q8MA 2PY6A 3HJUA 3KOXA 4XASA 2IH2A 4OK5A 1Y81A 1YBMA 2BHNA 2WT4A 3AFHA 4U7JA 4ZRDA 1Z2PX 1BC5A 4EDHA 2QVYX 3AUAA 1NULA 2ZRAA 5EC8A 3TQOA 4DLYA 3U49A 2E4AA 2Y1LA 1VHJA 3WZLA 4M9CA 4MKRA 5FUVA 3ZX4A 1IOZA 1JWBB 1QRTA 4RZQA 1OV4A 3IJEB 4UTZA 4DT1B 4J7UA 4YRIA 1W0KD 2DHCA 1U6KA 4FLEA 2J5QA 1TYAE 3D3EA 5T67A 1OI4A 2JI4A 4IH1A 3P4YA 1YRAA 4RPKA 2WYIA 3GGSA 5TF4A 3TL2A 4D02A 5AUNB 5L3SB 1D1SA 3KLBA 4M0EA 2VAXA 1BGVA 2V54A 1TO6A 3K2QA 2XXAB 1FP6A 1BXRB 1Q7BA 3E81A 3R7AA 1DRKA 4IVNA 1O6BA 3V4FA 3WJ7A 2J4CA 4NU5A 1RKVA 3E3OA 3N1UA 4MP8A 1Y9AA 4RUKA 3C5EA 5FP0A 1NYRA 5ABPA 1MB0A 3H6GA 4LDAA 5BMOA 4WV3A 1YJAA 5CH8A 1RPZA 3LA6A 4M9SA 4EB8A 1KFCB 2CLOB 4B6EA 4WZAE 4AS2A 2G1UA 3GUVA 3QLJA 4RVCA 1XNRB 1QJ4A 5EMKA 2B4QA 1Q0ZA 3GRYA 2QXUA 3KR1A 3LT0A 3RUAA 1CUDA 2HHCA 1QGUB 3NKFA 2WFAA 1CZNA 1NIPA 2O3JA 3C48A 2VAVA 4D6PA 1RM0A 4R5MA 5IN5A 2PCJA 4FNGA 3HUTA 3DCJA 1OLXB 1VHQA 1N5RA 3UXHA 2EX4A 5HHTA 2ZSEA 3A1WA 4LFCB 1L5VA 1V4VA 3JASA 3DHEA 3LVQE 3LX5A 3ESZA 3M2TA 5E2AA 1LBTA 2YVQA 2G9ZA 1PX2A 2ZUTA 4B3JA 2V0GA 1I5RA 2CYCA 1ZEJA 1ZC4A 3D0RA 3PC3A 4ID9A 4TMXA 1BMDA 5EQJB 4JI5B 4CM7A 4NJOA 4ITVA 3LLVA 4JA0A 4MROA 1J2JA 3K9CA 4CKZA 1E6KA 5CFPA 1URPA 5EVCA 2WTAA 3EZ7A 4ZC1A 4BQEA 2D4HA 5FI0B 1CS0B 5EKTA 4A23A 1WEKA 5JDCC 1M8JA 3HWSA 2ZBGA 3IVCA 3B6ZA 1TT5B 3GD5A 3KAKA 5ENVA 1N8NA 4F4HA 4GIBA 1SHZA 1O95A 1VLHA 4HSGA 4W1QA 4EOGA 1ID8A 3TCNA 3V4OA 5DRYA 4JYAB 3QBJA 5CFZA 3EVGA 3VO1A 1D1PA 4EJSB 1PQYA 2O50A 1JQBA 2C8JA 1JHVA 5FWYB 3V7WA 1VC2A 3IR5A 5HCUA 4FYJA 5D3MB 3DXZA 3Q2KA 4GLBA 4E09A 2BHTA 3DDHA 2YCBA 5DK6A 5CBPA 3WB2A 3R41A 4AMGA 1OH7A 5E3IA 2QGFA 3EXEA 2H9AA 4I08A 3X0DA 3S1AB 3GLFA 2GDZA 4XWKA 4B3TB 5AHRA 5BSVA 3W79A 2CN1A 1QYVA 3WGMA 3FHCB 2P1RA 3G13A 3GUCA 3DTVA 3DFMA 1FDSA 1SKAA 1EG7A 1J0EA 1XK7A 1NU8A 4F60A 4UZEA 4X6YA 4B5KA 4YMVA 4ZCRA 5C8YB 5CA1F 4OJTA 1EB9A 1XDZA 1XZKA 4LJ7A 4OQQA 1JG2A 5HKOA 3MWDB 2IS1A 4I36A 2WOOA 4XGKA 4V2IA 3IQEA 1NG1A 5AM1A 1WCIB 3ST7A 4EG8A 4KH1A 2O8EB 3K1ZA 4HRAA 4WZBE 1LA2A 2BEVB 2OKCA 1S2OA 2ZP1A 1WNFA 3EC1A 1AUPA 1LTQA 3L6CA 2WD7A 5LLSA 1T6YA 1E96A 3LQRA 1PJ4A 2H07A 5JAMA 2INGX 5EIOA 2C5GA 1P3Y1 1O0CA 1N2HA 1NMZA 3NLLA 4IDGA 4J3FA 4K6FA 3WLMA 4C20A 3KEFA 1XJQA 4FX5A 4MVCA 3G9ZA 4HQOA 5FUYA 4WEQA 2WJGA 5BUQA 4DDVA 4J9VA 4D8TA 4JB3A 1OXKB 4YJGA 1QSGA 1E60A 4TMTA 5EGNA 2OSBA 3M82A 1WOMA 4BPRA 4OK6A 2VG8A 3VU9B 2O5EA 3O1IC 5B6PA 1EUCA 4OI1A 4CEIB 1IUNA 2R6CA 3D6HA 3NBFA 4TVKA 3UB4A 4AJKA 3BSWA 1H05A 1GZ5A 3IHKA 3STTA 3JWIA 3OO0A 4NYMR 1X9HA 3HDJA 4XM1A 4ON9A 4XJSA 3T9AA 1U4NA 2R4TA 3OPNA 1ZU4A 3OQOA 3ZH9B 3REGA 1YCDA 2Q46A 3V6MA 1EX7A 4EITA 3PEEA 2YNMA 4IO1A 1WVGA 1FIUA 3ZCTA 1Z16A 3CRW1 4R68A 4XCXA 4XVQA 4CEHB 5DKFA 2JJQA 3FUXA 3R24A 4IDBA 1JH9A 3HYTA 4RJJA 5AK3A 1RJGA 2IPAB 1WPGA 2A88A 3EVCA 4FEYA 1QC5A 1P45A 2PBRA 3GUYA 3MJ4A 5KDOA 4KH0A 2EFGA 2HL6A 3QVVA 4CLXA 2O2ZA 5CDGA 2W4QA 3VJLA 4MGEA 3RDPA 1E2LA 3R0XA 2I3GA 4JLBA 5I7UA 1YIDA 1W581 4QJ4A 3JQ7A 1J5PA 4XEHA 3CLRC 4ZVOA 4BO9A 3ZLUA 2ZBRA 2V7UA 4I1RA 1PZFA 5SZJA 3HUDA 2C7OA 2WSYB 5EKXA 3FDZB 2FWBA 4XSGA 3GFRA 3CZMA 1YDFA 4J49A 1NNSA 3T1YB 3LY8A 5A6SA 2PO5A 4ZIRB 1IDN1 4RU1A 3IIEA 1FLAA 2IP2A 2H54A 4JGGA 2KE5A 1ZH6A 2HU7A 2XVYA 3B7GA 3M5WA 4QBIA 1UQUA 2WAXA 4V0KA 4AS3A 2WSLA 1HFEL 2V7EA 3W04A 4QGBA 1HUQA 3E1GA 3HO6A 3P2YA 5FA8A 4NH0A 5G0WA 1EX1A 2VNJA 4MW7A 2VF5X 1SHKA 4NATA 4AJPA 1ZN7A 3ZV6A 1NI5A 4YMSA 4KQEA 5DWDA 4BPBA 1V35A 3OD1A 3T4EA 2P30A 2YS7A 1PS9A 4OL0A 4RCYA 2OZKA 3AIOA 4N3BA 4YJFB 5LA6A 1QK5A 1ECFA 4RHXA 4CDMA 1PR9A 2OCDA 1Z37A 1TQ6A 4UHKA 1VBNA 2I2FA 2W8BB 5FH9A 4YONB 3ELDA 3LLUA 2BP7B 4CKEB 2XDQA 5EMLA 1N8TA 2XMCA 1AZSC 3NONA 1CQPA 4MVJG 5KS2A 1SBCA 2R97A 5D8DA 1ISSA 1FZQA 2ZE7A 4CWAA 2LVBA 4E5DA 4L73A 2O23A 2ARKA 1QTIA 3G68A 3OHMA 1C8BA 2WZBA 3DBLB 1QV7A 4UCWA 4X3CA 3SE7A 2XZDA 1U2PA 1CHNA 4EW1A 4R9RA 4EHJA 1R2QA 2G4LA 3ED5A 4U7PB 2PUFA 3B38A 1UFOA 4JI4B 3RUIA 2A4MA 4K46A 4XM0A 4AX8A 5IFKA 2PD3A 4Y2XA 5AM3A 1E3WB 4CTMA 1KEKA 3R1IA 2X0FA 3AIIA 5JBQA 2HSEA 5DLDA 1Y1KE 1M2VB 3BBLA 1IWBB 4O63O 4RM2A 3I6IA 3VO2A 4EY6A 2EU8A 3GU3A 3QQPA 4CG0A 3ZDZB 2W5UA 3PFNA 1ONNA 2Z3VA 4G4SP 4UULA 4ABYA 3NGXA 3RYCA 1JZQA 3NCTA 3SHOA 1GZHB 5ISMA 1MEEA 3WGOA 1DKOA 4N0MA 1A5BB 2P77A 4CXMA 4R51A 2BM9A 1XDWA 3V4ZA 4BO8A 1ZMXA 5HQJA 2XCSB 1T8PA 2IEIA 4KXMA 3UIEA 3QU4A 4MYDA 4ZV7A 4K9NA 3E22B 1BMQA 3DMDA 4I6GA 1VPVA 4MRMB 4HC4A 5HEKA 2YC2C 3TINA 4JLSA 3NRJA 5KTRA 1Q6YA 4X8MA 4HNAA 5TPZA 3R9XA 1RI5A 2FEWB 3DAFA 3VSBA 2O0HA 4RPCA 2Y1OA 3A9TA 1SIUA 3JQAD 3QWAA 3JQ7B 1PNQA 2QTCA 4B1FA 1LC3A 5BR7A 4DUGA 5BQXA 4IV0A 2W2TA 1YQGA 2Q5LA 2B1QA 1RYNA 3UG6A 1CUWA 1K5PA 2I87A 4Q3BA 3L6RA 3TTUA 2Z98A 1HM5A 4C3OB 1E8DA 3L05A 5KVSA 1Q91A 1J56A 2QPOA 2RI6A 1QFXA 2AK2A 4N6OA 1RC8A 2GMWA 1K4YA 2XUGA 3KYCB 4QNNA 3ZHSA 2F3PA 4HH1A 2HV9A 2XKBA 4R2WA 4LVNA 4R4JA 3CNHA 5BSHA 1M2WA 3H4IA 3THSA 1C8KA 1PT6A 1U9IA 4RZHA 4ZJUA 4JYZA 1MDBA 1XA3A 3QGMA 4WT7A 3BHJA 3JQ8A 1OY1A 4Z54A 4WE3A 3RSLA 4RTQA 4GLLA 4MDFA 3A28A 1VOTA 4WCVA 2GXQA 3LX8A 5CG1A 1QP7A 1AK9A 2AC7A 3RIGA 3MBIA 1ATZA 1VPDA 4KQ9A 4CKWB 3QP9A 4M60A 1YOBA 2YWRA 3FDXA 3P0EA 3RTAA 3IPAA 4P3XA 3HXPA 4AY2A 4AWXA 4PICA 5ENDA 5E38A 2IGTA 1M9NA 4O0MA 5GM2A 3X3HA 3OUUA 2SICE 1YHYA 3L46A 4RD4A 2QX8A 4WOBA 3VM6A 4Z49A 4BGDA 1SXJE 2C2GA 4Q7QA 2RJOA 2DFDA 4M8IA 3PSAA 4BAZA 3M4NA 2IYAA 4LCBA 4B46A 1VL1A 3K5WA 4MDHA 5U9CA 1HNZB 5A1TA 1SG9A 4FFBB 5DTMA 3SIXA 3H3FA 5KSPA 4DTIA 3RYHB 2WI8A 2RGNA 3BFPA 2ZSJA 2ZI4A 4UW9A 1XQ9A 4LTDA 5CPBA 4UJ3A 1R50A 3DMPA 3UJ7A 3CPSA 3J81k 1TEVA 5HJ2A 1T35A 5J58A 2X22A 4G25A 3GEGA 2OV4A 1C80A 1KOFA 4B3HA 5FOVA 2QZSA 1WV0A 2D59A 2EJVA 1ZGCA 1L5NA 4IMPA 4NONA 4W8GA 5AM4A 5A62A 2LWIA 3I3SR 4NJMA 3KXIA 2QMYA 3MGAA 5DM0A 2PUTA 1KXJA 1OLUB 2GBLA 2QX6A 4OLFA 1FMCA 3ASVA 5ADHA 1OV6A 3K1JA 1SKBA 3JWPA 4R1MA 2PH5A 2HCJB 4ZVRA 2IUFA 4GOJA 4YRDA 1U2RA 1NNI1 2JD1A 2DPXA 4XWAA 1L4BA 2F3QA 1Q95A 2ZJ5A 2IDMA 3C2QA 4Q9KA 2R8OA 3DF9A 1YK0A 4JDUA 3DDZX 3ZZUA 3ZWCA 3DOUA 3NM6B 4Q1BA 1HFWA 3WGIA 4XXHA 1BDIA 1D5WA 4BV8A 2FMUA 3BH7A 2IF2A 4K40A 1M33A 5IC4A 1Y82A 4KDCA 1U3FA 1LLDA 2BFMA 3IP6A 1II8A 1V11A 5HIMA 3JQPA 3UXYA 1K5GA 3QNWA 4ZGWA 3AR4A 5I5GA 5D6OA 2O20A 4O1IA 4LGMA 5E9WA 1OBHA 2C94A 2HXSA 3PS9A 3BFVA 3K0AA 2X8AA 4WERA 3U80A 1SELA 3W2EA 1NW7A 3IA2A 1SXQA 2HDOA 4DLZA 3LYHA 2GZ2A 3ZNOA 2O6HA 1E18A 3I2GA 4MPRA 1IK6A 2I6QA 2JEYA 2RGBA 3WQHA 3L1KA 4IGEA 4YMTA 2IDZA 2VWGA 4KPEC 4F2HA 3DHWC 5LYJF 1ZK2A 3AILA 1J39A 5KHAA 5A5GA 4BV2A 3CZRA 3BJZA 1WULS 3IJRA 4NABA 1SVUA 1GUZA 3HFJA 1J22A 2ZDHA 3HKBB 1LLCA 1XTSA 3NTRA 2YXPX 3N2EA 1PD1A 3HUFA 3WMXA 2JC3A 2H63A 1OPRA 2E1RA 4FN4A 5I9LA 1NUAA 4TWAA 2IXFA 4PO8A 3RYCB 5EKUA 2ZSDA 3CUUA 3KYIB 4P4TA 5TT0A 4BTLA 5KHOC 2APJA 3OCUA 3UAVA 1GSHA 1KJQA 1H6CA 2KHZA 3OT4A 1O95D 2YZGA 2BM8A 3SEQA 4N6NA 5CXXA 1TQ8A 4BQOA 2HA4A 4E70A 3BK2A 3AGPA 2FSGA 4KVFA 3SU8A 4PX5A 5EKSA 1D7AA 1FQOA 4QQNA 2R60A 3CLSD 4F71A 1RI1A 1YZYA 3WYFA 1W93A 4Y2JA 2YV4A 2AEJA 1RU3A 2CXUA 3IRUA 5C7YA 1MOSA 1SEPA 4FT4A 2IBSA 5EPOA 2JAPA 1DSSG 2HRCA 4ATNA 3FFWA 4QGAA 4S2EA 4LFAB 2P8SA 5FL7A 2BBSA 3E9EA 1BXGA 3TKLA 3WK4A 1EUZA 1F0KA 3ZZ1A 2DTDA 3K9NA 3AESB 2GSWA 3KBBA 3RTDA 3T9BA 3A2LA 4KRYA 1U8FO 2PGIA 3KT8A 5ARCA 1R4AA 3TQCA 3TFOA 1XU7A 5KQPA 4HWGA 1GV1A 2OCYC 3GEBA 2IU3A 5AR1A 1SH7A 3HB9A 2H17A 5JFOA 4YXWD 2PYIA 5NULA 4AJJA 2DR0A 4RD6A 4FUQA 1ZNXA 1ZUIA 4AVYA 4ZJZA 1R0RE 2JKZA 3TNFA 4GNRA 4IGAA 3V9PA 2HREA 2OHJA 2PVSA 1JFFA 2ZWPA 4XUCA 4ZYWA 4H6WA 1MNQA 3GNQA 1MORA 4RTSA 2PS1A 3O9VA 1TUIA 2ASEA 2C0PA 4WKGA 3SYNA 5IG2A 1XZHA 2K4MA 3GRUA 1A8HA 1J0DA 3NAGA 1DC4A 2DT8A 5DASA 5LIPA 3CF2A 1GL7A 1ZUNA 5A9SB 2ID8A 1IVSA 3H86A 3TO5A 5SYAA 3LDAA 4P54A 3USCS 3F78A 2P62A 3KTAB 4FSXA 5B3JC 4FCCA 1UADA 4MTCA 3FDFA 2YYSA 2I9KA 3FTDA 5A6VA 4Y6SA 3P2IA 1YVRA 1YKFA 5D86A 1KDYA 4TKUB 1A69A 4QBGB 3WDSA 4ARUA 3EC7A 2I2WA 5DOVA 1T3SA 3D4LA 1RXUA 4G8CA 1ZQ9A 1AUXA 1RYMA 5CEJA 7ABPA 6ADHA 3NWOA 4P80A 3JQ9A 4ND1A 3NC1C 1BCRB 2VYNA 1H6BA 3BTVA 1H94A 4ND7A 2FQWA 3VKFA 2WMDA 2AFHE 4UBKA 1PJ2A 4M0CA 3D6UA 5IZCA 3LWZA 1AUVA 4XZ3A 3KXLA 2YHAA 1IHYA 1C8LA 1F1BA 1R6XA 4UHJA 1B1AA 1BO6A 2JW5A 2WUGA 2ZJAA 3IFSA 4EB6A 4MKHA 3W5JA 1XEAA 3AVYA 1D07A 2XLCA 5CVUA 3WB0A 1FS5A 2NAPA 3DXFA 5KWJA 2CMDA 1X0XA 2G76A 1PDVA 4O1MA 2ZUVA 2AN1A 1OKKA 2OFPA 4Q37A 2BFPA 3RRBA 4J29A 5ALHA 2C9MA 3DSRA 3BHIA 5HFJA 2X58A 1J8FA 4O2AB 5CA0A 4WZZA 3V4VB 2H8GA 4UATA 2I7CA 2BONA 2OB2A 4F1KA 4ZEVA 2YMPA 2P35A 3SLRA 2JI9A 1P5ZB 2DH5A 3H5LA 4OOEA 4LZLA 4WFKA 5ESRA 3QEBZ 4YAWA 1FTGA 1MB2A 3QA3E 5IH3A 1OGIA 1W0CA 3BWXA 3QKIA 3I0NA 4I1SA 3ZHVA 4DRXA 1E92A 2VK4A 2ZRQA 3AI1A 3ID6C 3OFVA 1EVYA 3OQBA 1L5SA 1P1BA 4YWJA 1L4FA 3FPKA 2ZCVA 2Q6IA 2A1UB 3N2NA 3KVNA 2OUKA 2P9CA 3LRPA 5KDLA 3TRDA 5CNIA 2R8YA 1RQ2A 3RVBA 2CXOA 3BD6A 3M2PA 2HNBA 5DX0A 5ERXA 1KRXA 5TC4A 1L5FA 2PSEA 1WSBA 1R9NA 2QJWA 3DLPX 4GHWA 5DI3A 5DX8A 2XCIA 4N76A 1XRJA 3GGOA 3LI2A 4MQ5A 2X4LA 3MXTA 4RZIA 5IAGA 4FYPA 1P2VA 1Z47A 2MMCA 5LXTF 1RJ9A 5TARA 4DNFA 2YJTD 2OFOA 3GUHA 1E61A 4DDWA 1EIZA 1VE1A 3QLVC 2ECPA 4WZBA 5GV8A 3WRWA 3V3KA 3FYUB 1NUTA 4H4DA 3HBJA 4O59O 4J0IA 2YXNA 4OI2A 5TXGA 3HKDB 1SNYA 4D2IA 4OHYA 5LUAA 2OGUA 4H77A 5IASA 3EXEB 2PXXA 1K6IA 1LNQA 1QV9A 1QZXA 2YXBA 3G7NA 1J6UA 4RHEA 4Y2SA 3PDIB 5JV5A 4LX8A 1NP7A 4Z7OB 1I8TA 3AI2A 2E4VA 1PYGA 3IOYA 3MUNA 4JUAA 1P62B 3WR5A 2ANCA 2V55B 1ID1A 4KQGA 1E5XA 3IL2A 2J6HA 3IO3A 2PN1A 3G88A 3P9YA 1LS6A 5JH7B 2JA1A 5JYDA 4F3TA 2FMHA 4H6PA 2V8BA 4A6PA 4DHEA 2V74B 2A0UA 4TV8A 5BUCA 1WUTA 1B3RA 4MQFA 1NM5A 3UQYS 2ONZA 2BEKA 1BOOA 4XFJA 3O7MA 4B32A 2HFKA 2IYZA 4KV9A 5ALQA 3LVRE 2OHHA 1T24A 3JALA 2IW3A 3PVZA 3L7IA 1XXHE 1BE0A 4REQB 2X6QA 4AG3A 4MVJM 5TIIA 2QEQA 1Q20A 3CX6A 3Q87B 4KOAA 4EA6A 3JAMA 2NX2A 2CZGA 2NXWA 3MJHA 3OU6A 4M0FA 5CNKA 4RZ3A 1Q1NA 3DYIA 1KH3A 4NZMA 3O7WA 4CLRA 3DUWA 1LEHA 1GRRA 3H9BA 5CLJA 1UBRS 5F52A 2ZBUA 3H11A 3RUCA 2ZI6A 2PANA 4IQ0A 1M1NB 1NYLA 1RPJA 1QU3A 4RVGA 4JJAA 1JILA 1M34E 2KSQA 4MAAA 4RCVA 4X7RA 4B5LA 4KDRA 4LPSA 4AJ9A 2EKLA 1B8PA 1FFGA 3OU2A 4PX2A 3MWEA 3P9RA 1MC5A 4DLUA 4EFNA 2WJPA 2GRAA 4HLQB 2CXSA 1EU1A 3GT7A 1P5HA 1X2BA 3OPVA 4DIEA 4UHHA 2PCLA 3WYCA 4CM9D 3CX3A 5IK2D 1HYEA 2C2MA 4YCAA 3SJZA 2YC4C 1XUOA 2VHEA 3B9RA 4K0RA 4LY0A 3JVIA 1TCVA 1G5QA 2O8VA 4MV5A 3S8MA 4CCSA 1X1EA 1AG9A 1LXCA 5LA6F 3RVOA 5A4FS 3COSA 2Y3IA 2DBVO 3AI3A 2AZ4A 3GAMA 3OZ7A 2EKDA 2BPOA 3FVWA 2WUDA 4I81A 1KH2A 3BE8A 5K6AA 4GI1A 4KQFA 3O8QB 1DXOA 3NC0C 4KVGA 5BW5A 3UY4A 2FFHA 2XZLA 1TKCA 3VYVA 4ZCQA 3N8IA 3LT1A 1ECJA 1G0NA 1X3SA 2ERXA 2WHQA 4GI2A 2QQGA 4IGFA 2FOLA 4KGXA 5KQMA 1ZJWA 2ACEA 1G7TA 3AJRA 2ZI5A 3QF7A 2JFOA 5BMVB 1UC5B 3U4QB 5C34B 3ORHA 2I76A 3BKXA 3ILHA 4Q05A 4KE7A 3T5MA 4HNRA 3AHJA 2ODWA 3AERB 4D42A 2OLKA 4D98A 3H18A 4YAUA 2WJ4A 4MS1B 4FW8A 3U9LA 3ER9A 3V4SA 1MABA 2P4EA 2R3SA 4ILEA 4O4HB 1N5JA 3ITDA 5CGZA 2HEIA 2VQ3A 4DLRA 3PQ4A 1H4VB 3BIXA 4M9ZA 1RKUA 4Z4HA 5AUPB 1JHRA 2FWAA 5HDQA 5AI6A 1FFXB 3E9DA 3NC4A 1Y7PA 1JIJA 3FPSA 1AB6A 1O95C 3FX2A 1IEWA 4JP2A 4YJFA 4B7AA 4WSOA 5BNTA 5IM4A 3EJ6A 3W4IA 3ZGYA 1ZGZA 5CFOA 4O4JF 2DU8A 2N47A 3Q7QA 3Q7RA 2I2DA 2ENWA 4ARBA 1V25A 1GVNB 3LC0A 1Q7RA 1V8DA 4K9MA 3A58B 5HM8A 1KWGA 4UUAA 3NM5A 3HDHA 3I2JA 4LF9B 1EEXB 2DQKA 3HC7A 5FOWA 2FFQA 1ESMA 2WYWA 4Q3KA 1JR3A 4DV3B 2A59A 3D8BA 1KJ9A 3MCWA 1MO5A 4IFTA 4U6QA 1I2CA 3LL7A 3ZDYB 4JR1A 1YTUA 2P0YA 3GXOA 3Q8XB 5DNYB 4DC9A 2Q3HA 3CZAA 1T9KA 1XLWA 1RDFA 5KYKA 1O5TA 5ALLA 1J33A 4FCTA 4D3YA 4L76A 5JASA 4RH0A 2BGNA 2HBQA 3EZGA 2AFIB 4MV1A 1QG6A 4HNQA 2H7CA 3CU5A 3ND5A 4BN5A 2PGDA 1ECPA 3B5JA 4NCIA 3FPEA 1IMOA 2J5RA 1TLTA 1DKMA 2YJ4A 3OQIA 3WNBA 1MOZA 1PBNA 4OP3A 3JQQA 5JWHA 1G6HA 4BLQA 1K3UB 1SIOA 1I7NA 4GO1A 5I51A 4CEJB 2ZXEA 2HRDA 3GLHE 5CVJA 1PFVA 1XO1A 2CCJA 2M1XA 2XH8A 1SD2A 3VJRA 3W2HA 2FN8A 4GECA 3RRNA 3GLGE 1HDCA 4GF5A 4AJOA 2ZWOA 3BRCA 1XCBA 4YRJA 3SIRA 1G17A 5GZ3A 2C5LA 1O87A 1YB4A 1NWHA 5MFZA 5DHAA 3QUBA 2FQ1A 2RH8A 3MFQA 2OOKA 2GZ1A 2X7XA 3BJEA 1L5KA 4LF6B 2O2YA 3UH0A 1T8TA 4PYMA 1IUKA 4LGVA 4TQUS 2WBLC 5KAMA 2LE0A 2IODA 3JW8A 3OZWA 4M1MA 1RCFA 5KNCD 2I80A 2PBZA 3UM9A 1E9VA 1P1JA 2R7MA 3IHTA 4TN1A 4Y18A 3C24A 3UGQA 3UMSA 3I8XA 1EHCA 2GKSA 1M6EX 3FTNA 4TT3A 1K92A 3NETA 1XCJA 1Q0RA 3ILSA 4BRZA 4OMCA 1HF3A 5JZVA 5K6RA 5KTKA 1QE5A 1N7HA 1T9BA 4OJMX 1HV8A 3AR8A 4NENB 2GESA 5K8IA 3GNSA 3OLVA 3SYTA 4RD3A 5I4KA 4E6EA 2XB6A 1Y3HA 4QFMA 3L0IB 3W5UA 2Q9AA 1CJCA 2ZYWX 3VZBA 3YASA 4I4TF 4U2GA 4U2KA 5HCNA 5KOHA 2W6IA 1F6DA 4NCAA 2ZJ7A 3KZVA 1MOQA 1MPXA 5CDSA 4V02A 2AIRA 5F76A 1B73A 3INNA 1ZJ4A 1ZN2A 1EPUA 4S24A 4TMZA 3QVSA 2Z0MA 4C06A 2W6MA 3OPQA 4TUYF 1CE8A 521PA 1J7JA 2VCYA 1W94A 4YNBA 1GSAA 2JKYA 3H4MA 4KWEA 4YP1A 2JK0A 2R6FA 3WTBA 1E6WA 3W2TA 1SCDA 2EJUA 1NW8A 3VAYA 1K8XB 1B26A 1MHTA 1JU4A 3USZA 1W87A 1UQTA 4HB3A 4E14A 2XVMA 3I6QA 5G4KB 4BUZA 1RYDA 3LBFA 5IYZB 1UDWA 3RYHA 1RWOA 3H84A 4M9RA 1NNEA 4LDNA 2QLLA 1BDHA 3CUEF 2GLUA 4ND8B 3LHSA 2G0NA 1TW3A 2WVAA 4RMJA 3QMVA 2R00A 4BYGA 2GCOB 4P38A 4IRXA 5GVRA 3E3MA 2RHTA 3NHMA 1FW6A 1GNRA 1ZI6A 1PR6A 3EN0A 3KKPA 2QRQA 1FLVA 1GUYA 2BJVA 5LYYA 4PQRA 2X0EA 5AK0A 3UKOA 1CR2A 4DNPA 4A16A 1JG3A 1RC0A 3KQYA 1ICIA 3D5QA 5CJJA 2WP8J 3SZRA 3LVFO 4PPGA 4EK9A 4I1PA 1NX9A 1YUBA 2B83A 2Q50A 1ZISA 3O9ZA 4BQNA 3MWJA 4UOQA 4WLOA 5LNK1 4X91A 2I99A 2EFJA 5IBCA 1YIOA 1XXLA 3BTOA 4ENUA 2I4MA 3CRVA 4YI3A 2HC9A 3IAM6 1XZQA 1OXUA 4CDNA 4YFYA 3MYYA 1TOAA 2V9PA 2CL0X 2LCFA 4JA2A 3LYUA 2RK6A 2XYRA 2XRFA 3W5VA 4FDLA 4GI3A 3K0AB 2KBEA 3O2SB 1QGDA 3KR9A 2VRCD 1QHYA 2CXRA 1DHRA 3R3HA 4CFYA 4UCXA 2ZJ6A 4E46A 4ZMSA 2IYLD 3STHA 4S05A 4ML3A 1S7GA 4NWIA 5THKA 1WBDA 5AI4A 3TCKA 5FOSA 1L7OA 4WACA 4QNRA 1B14A 3IBGA 2L19A 4IX1A 3UG7A 1E89A 4D9NA 3SNKA 5FNVF 3C6KA 3PPYA 2CNOA 1WLYA 4QPNA 3T5CA 4DB4A 1T6ZA 2BFNA 3OIWA 3EUEA 3ABRB 4BCCA 5DGHA 5JS7A 5C8VA 3ZVNA 4J0FA 4QUGA 2A5FA 3NTXA 5KVQA 1A9OA 4X1YA 4MR9B 2QTZA 2QRNA 3JVUA 3RIMA 4IJ5A 4P4NA 4OQFA 1KGDA 4BB9A 3GCGA 2GEKA 3WWDA 3OCCA 1L8LA 4JBYA 1J90A 1W5FA 2BJHA 2WIFA 3WNVA 3CJTA 1QTNA 2IU6A 4EHFA 5LD2C 1D2GA 2RG1A 2WJJA 2ZRMA 2F55A 3RU2A 2V7GA 5ALTA 3TTWA 3DONA 5DBEX 3R9KA 5L4SA 5TE9A 5LYJB 4X9XA 1YB2A 1I6MA 2K6GA 2WFZA 4ZVPA 1YZFA 3HJNA 2A30A 1DX4A 2OL4A 3SZOA 2ZIUB 4Q3DA 2W7TA 2W37A 1ZI8A 3HJRA 1DBVO 1MA3A 2EXXA 1GIAA 3A6ZA 4V39A 4Z4GA 3T1QA 3MGBA 3HXQA 3X1ZA 1JH8A 3PA6A 1GUFA 1NRIA 2ACWA 2GM4A 3RS2A 3IALA 1XTQA 3VVMA 4EG1A 2LDBA 3VR6D 1CX9B 2RGDA 4PSKA 4LVCA 3V1KA 3EGCA 3ZWYA 4TVBA 4L08A 4DDMA 1Y6JA 2WJAA 4G4SO 3ZDQA 1QDLB 3FZGA 1RWPA 4G07A 4LYYA 2QZ9A 1H6AA 3RS5A 1FNDA 3UB2A 5GIPE 4E5SA 1MZPA 1IQRA 2B92A 4IWNA 4EUFA 4BMZA 1FUKA 5JYEA 1T5TA 2WTMA 3ME5A 1O97C 1XCGB 4PYOA 1R64A 4OHUA 2WABA 1SVOA 3T52A 1P91A 3CWQA 1USWA 1E2UA 2M32A 2B1IA 4R69A 1B6GA 1U02A 2P1ZA 1UM9B 5DXAA 5C32A 1A8IA 5JSQA 2O2SA 3M0EA 5K0BA 3KLNA 1WY5A 3K6JA 2BFEB 2FDRA 1XSEA 3BK7A 3I2FA 3QPDA 4M53A 3I4CA 3ZWMA 4N5IX 4XIYA 2Q5QA 4RIFA 3UT6A 3RWOA 1ZM3A 3C87A 3L4KA 2VDUE 3U3JA 2BE7A 1ODFA 5K0ZA 1STOA 2HMYB 4R8MA 2JFZA 2B5OA 1DZ3A 1Z2AA 2ZR8A 3ITEA 1WB5A 5C8ZA 2NZ8A 1KEEA 3VR0A 1UFVA 5EINA 4GG1A 2RHBA 4RA9B 2A9FA 3OM9A 2IYQA 3WG9A 3VGJA 3FWYA 3Q5DA 4CTKA 2IEGA 4NU6A 5FFNA 1KAEA 4RPJA 1OC4A 1U3DA 3C1OA 3O3OB 1HQKA 4IEIA 4BNFA 4ESVA 4V0OA 1KNXA 2IHJA 4JHLA 3TN7A 1WVMA 3GEDA 4L75A 5DW3A 3RC9A 3HKCB 1JSXA 2WLTA 2R8PA 4KX5A 4M3NA 3ND9A 2B35A 5EWJA 4BE7B 3CSDA 3T5GA 1GTVA 4AAYA 1MW8X 3C3AA 4IG9A 4MVJA 2FG6C 4FUTA 4F06A 4BNKA 3G23A 3R44A 4QQFA 2XVZA 3F3MA 3KD3A 4TTPA 1D5CA 2NUAB 1OTHA 2DULA 1JWAB 5CCEA 1XRQA 1WPXA 3LP5A 3P2MA 4WCFC 4TVOA 2HI0A 3T1NA 4B44A 1TC1A 4G1MB 3AF6A 2ZIVB 1QZUA 3F6EX 2QF7A 4S0XA 2R1TA 4MIKA 3VR5A 1D4AA 4E13A 2PYDA 4HFRA 3MTGA 4F3CA 1E4EA 4F9TA 1D0IA 2VTVA 3U4MA 1MOPA 4CQLA 2ZUFA 5TPWA 4RO0A 3JRWA 2ZAYA 1ZRMA 4G5SA 1J9ZA 2YV2A 5JRZA 5KQGA 2W71A 1DV1A 3QPBA 2YV3A 3TEFA 4KGDA 3OHPA 1M1YE 4IXDA 4DKXA 2WRZA 1WKVA 2ATEA 3WIEA 5BV7A 5K8LA 3AFIA 5B3LA 4BDTA 1MX9A 1XVUA 1ZD8A 1U99A 3P0FA 5DP1A 4ZZ2A 4KO1S 1L5QA 4J1TA 1UPAA 2OCPA 4G2TA 4LZNA 1NQOA 2C3YA 1D8TA 2QAIA 3G89A 1OREA 3H5NA 4LWQA 1PQ4A 1WKCA 3M3DA 2O8FA 4FZVA 2XYGA 5AFSA 2WPDA 1FMLA 3W34A 1GARA 5ALVA 2OG1A 3HFGA 4QBKA 2O3SA 3VR4D 5EXXA 1DMRA 5DHFA 2MMGA 5C3UA 4EMUA 4N48A 3TL3A 2VTBB 2JRLA 2G7ZA 2H3HA 2HWWA 4OEHA 4WWHA 1DG1G 3JQEA 1T2AA 4U6NA 3FNGA 1ULUA 2IGBA 3OY7A 2DR3A 1XEFA 2HSGA 3B89A 3PFFA 3BHNA 2CXTA 1CUFA 5LLDA 1DGQA 3JWGA 4RXMA 4YT2A 3EHDA 4J6EA 1CERA 3PC8A 1BYIA 1JDVA 2Z3WA 4FZ5A 3WWEA 1NI4A 1NF2A 1WU8A 3VHLB 5EJFA 4YIHA 1I4DD 3MXOA 2D54A 4YRBA 1RHRA 1V4NA 2CFTA 4FFSA 5EZQA 2X15A 4R1PA 4JYBA 5CDTA 2NQ2C 1EQ2A 1W30A 2C5EA 1ZLXA 4GPTA 2EAUA 2PGJA 4QFDA 3CH6A 1EFAA 1VPTA 3ICEA 4NOJA 2JI6A 3C4QA 3BWEA 2NYRA 3EXHA 3H17A 4XA8A 3F5SA 1E2FA 3ET4A 1JVBA 1WZCA 2HCRA 3SEZA 1TIPA 3QFFA 4BNDB 4S1TA 3G0OA 1W6RA 3H5OA 4AX4A 2OXIA 4EVSA 1FDUA 3V1MA 2XADA 2XGMA 1AMUA 2BEWA 2BF4A 2SECE 2IF0A 4OB8A 5ALEA 4M0LA 2W11A 4CU2A 4W5TA 5EJAA 4FD2A 4CRWB 2QVXX 2ZRFA 2O8DB 3G9QA 3HCCA 3PGXA 3PNVA 4UVEA 2Q8NA 4HRYA 2Z5FA 2NYUA 3FDJA 4C4PA 5JARA 3CN9A 3AHFA 5EIBC 1ZGJA 2J9RA 1WF6A 1U65A 1V4BA 3LGXA 1RLIA 3MJFA 4GLFA 3NXKA 2ZYAA 1YC2A 4NBWA 4BMYA 4E4TA 1LFDB 1NV8A 1QGZA 5IJAA 2NQTA 3CVYA 2GHIA 1N7GA 3SHFA 4QG3A 1LK7A 2Z6AA 2X23A 2VP4A 3L8GA 1X8KA 2Q3DA 4FILA 5AM5A 1WMBA 1YU6A 3L8CA 2ZYDA 4KSCA 3RLFA 4MQLA 4ZMRA 3M4XA 4B4OA 1XRPA 3V4RA 2PSJA 2E4UA 5FX2A 3TLAA 4MR7A 2Y0DA 5FQNA 5CYOA 3UBMA 1TYCA 1QB7A 3O8QA 3ZCPA 4EYEA 4BB5A 1VG0B 2VJNA 2ZRBA 4HGNA 4EEZA 3TLBA 1M0EA 5J5AA 5TVKA 2VTDA 1UKCA 2ZT5A 3HN7A 3P7MA 2QM7A 2PSDA 3DWEX 4U00A 4Y6QA 5CLLA 5SICE 4C14A 4RVSA 4F8JA 5KVVA 5JZBA 3FOBA 3QKSA 2QRLA 2IYVA 1NW3A 3FRJA 3LPCA 1X14A 2XWSA 5F21A 3WNDA 1QRUA 1NLYA 1YC5A 2AI2A 3A14A 2Z4RA 5CT4A 2PAAA 1LW7A 1ODSA 1U90A 4RTLA 1M5RA 3SHWA 3MTIA 3ZDCA 3SC3A 3TQQA 1NV9A 4PYJA 1UBTS 3IEVA 1QHFA 1XEXA 1SA0A 2EZTA 3CLTC 4X84A 3F5MA 1XR3A 3EXIB 4FQ5A 3VTKA 5MDHA 1QFJA 1A5ZA 3VGPA 1E20A 2FPWA 3IEIA 4A6EA 3QENA 3ZD7A 5CVVA 3T4PA 2XA9A 4FFRA 2KBFA 3T95A 2UZAA 1KETA 2IHNA 1CK4A 7MDHA 2BOVA 4DA8A 3TYXA 5K9ZA 3AR2A 1U2SA 4GBMA 3ZN2A 3ZUGA 5EIHA 1ZRSA 1PX0A 1Y3CE 4D9KA 3PC6A 3HLKA 1E9CA 2QL7A 1SOWA 4BZPA 1QO7A 4U7FA 5B4TA 2R1UA 1NVMB 4RY2A 4R98A 1M34B 1U1CA 4EVIA 3LCMA 4EQ6A 1AQUA 1F17A 2VJMA 4TWJA 3WGUA 3HM9A 1X38A 1ONSA 3HJHA 4TTTS 3U7GA 1U8EA 4DADA 2EP8A 1G6OA 2IFTA 4YGXB 3CF4G 2C7BA 2QYOA 2QUJA 3RROA 1M2HA 2V8OA 3S7TA 1UIRA 1CW2B 4EB3A 1OSNA 5HPYB 1JHXA 1G5TA 1R5BA 2RCNA 4Q1FA 5GJWC 1PQUA 1YULA 3PGJA 1Q17A 2OD7A 3NUGA 2RB4A 3FCOA 4D8UA 2OB1A 1IY9A 1GTZA 1LDNA 3T12A 3ICOA 1AY0A 1RS0A 4TMWA 2GFIA 2CCKA 2MCFA 5LKRA 5HXAA 1H4QA 3OLCX 1ZP6A 2AG0A 1NOIA 4BMSA 1XC7A 1G63A 1TB4A 3F98A 2RE8A 1QHEA 2R1ZA 3EWSA 3K9LA 3WOHA 4BOYA 4IKPA 1OASA 3SF8A 3QMWA 3GDWA 3HDTA 4DGSA 2OBXA 3JVVA 3NDBB 3N58A 1E1CB 1W5TA 1PE0A 3RVDA 2I2CA 5D2CA 4G2NA 3UJ3X 4B3CA 4UVDA 1B8NA 3JQCA 2GPSA 2XLBA 1CC1S 3BMCA 3PPVA 4IG4A 4I46A 4ILKA 1BW9B 1T1IA 5JJCA 1IPHA 2FFRA 2IUSA 2PO7A 3AVQA 1JFTA 5BQ3A 2Q3EA 3BDIA 1ORHA 1PNVA 2AE1A 4B09A 1R8JA 1U2DC 2C4HA 4HY3A 1E7QA 3AF3A 3DEKA 3IP8A 2II6A 4MQMA 4E08A 2R7LA 5JLAA 4GR4A 4Z2AA 1NU6A 4ZICA 1GRCA 4GPAA 2P9JA 1Z35A 5COQA 1QZTA 5KNCA 1DIRA 1EVKA 2ZAIA 3VNRA 3NJRA 4BRUA 3LX4A 2R6HA 1J1ZA 3CLHA 2DBYA 1YOVB 2JBHA 3NRCA 3PUWA 4FOSA 9LDBA 1T3ZA 3LDUA 5EUBA 1JR3E 5LBTA 3O90A 5UKDA 3RSOA 4PPFA 3VKWA 4AMYA 2RKBA 3TFWA 2W2LA 3PXBA 1R3DA 2HKIA 3GA0A 1PT8A 2YZMA 4EJ6A 5FOTA 3F74A 4DEYA 4KI0A 5JTUA 4CUJA 3IUYA 1GL3A 1WL8A 3LYAA 1QGAA 3W77A 1ZOPA 3Q9NA 1V1JA 3U3RA 2VZLA 3C3BA 3ZI0A 4KEAA 1XZ8A 3VR1A 2IA5A 4L8WB 4K9KA 5H70A 1K3FA 2ZIXB 1CY1A 5EXPA 2IXBA 2V6MA 2NT4A 4MEJA 1Y5NA 4K88A 3ZE7A 1JJFA 2MYUA 3I45A 3ZLVA 3TLKA 1BCSA 2GS9A 3DXXA 2CWDA 4EF6A 4CLOA 1V3VA 3RG2A 4GPIB 2F43B 1TMOA 3U7IA 2CKDA 2EV9A 5BSUA 4B6OA 1XGKA 5C52B 4TXJA 1PNOA 2FSVC 1HEIA 3WIBA 3WK7A 5IVKA 4QBFA 2R47A 5AYVA 3WQSB 3MTEA 2P4UA 2ZSBA 3HB7A 1TZ2A 5JMOA 4TYYA 4MI1A 1MJGM 2HLHA 5A4JA 3CZPA 5BNZA 4C2TA 4DXDA 2IHTA 1LZKA 2PUJA 1YMVA 1SKUA 2UVPA 4JLDA 3KL2A 4LC1A 4TKZA 2Q7OE 3GR6A 4WZ6A 1FVXA 5BSRA 3TNJA 1LLQA 4QE3A 4B73A 3AEKB 1CG6A 2M6SA 5DI9A 1Z22A 2FDCA 3KRTA 1E9EA 3E5NA 1NW6A 1YZVA 3D0KA 4HN9A 4NEGA 3E22A 3FW1A 3RRJA 2XQGA 4RJ2A 3GXBA 1Q15A 721PA 1P77A 5A2QA 2PMEA 4BFWA 1SVIA 2FMXA 3E23A 3DE3X 3FIJA 4ERNA 3DD5A 3PQ6A 2WU8A 1TVEA 1NVXQ 4B31A 4DBVO 1W2WB 4KXUA 2O0LA 3OVMA 2NZVG 1BGXT 1X74A 3BJMA 4YP6A 4XB1A 2X5OA 1ZXBA 1RABA 3IQGX 3NBKA 3OEEA 3W1EA 3OFJA 4OIMA 1X8JA 3MTAA 5ADVA 1DAPA 2NNLD 3ZHOA 3PICA 1YR8A 1Z45A 5E9QA 3GP3A 3GVIA 1M34A 3QU7A 1Y4AE 4WL0A 4CGYA 2V7WA 4AP6A 3ZHTA 2QL5A 5E0OA 3N74A 1G9SA 4MVXA 3DYBA 3IUBA 3HRHA 3RGWS 2GWRA 3RTEA 2WWYA 2CFSA 4N5LA 3T5PA 3CT4A 3F3SA 2VJLA 3M89A 4II7A 2JLZA 1Y7IA 3EQ8A 3BXGA 1RAAA 1BD4A 1RXIA 2OENG 2YYAA 4OSOA 5J2UF 3KUCA 3MWEB 2JGFA 4FYYA 4FE7A 3T54A 1VL0A 4OGWA 4JBGA 1CDEA 1Q3HA 4Q1DA 3HA2A 1XCOA 2R6R1 4LXTA 1AKNA 4Y9SA 3WK9A 4V1CA 4YJ3B 3NYWA 5ECWA 4RVDA 4JLKA 3AUFA 2PZKA 2KX7A 1EYZA 2H16A 2YRXA 3K72B 5FB3A 3H6HA 4PCVA 3G0GA 1JEQA 4AZWA 3FYSA 3LP8A 4L5JA 3M6AA 2V4MA 2WIAA 2OHVA 5F5LA 1NBOA 2XRYA 3U62A 3ZY6A 3B1WA 4YK7A 5MFPA 5HP4A 1KAOA 3GAFA 1D2AA 4CPDA 2RJ3A 3S2UA 4DV1B 1AQYA 3MJEA 1YK1A 4I8XA 4M46A 2NACA 1N2SA 4GPBA 2UYQA 4BMNA 5K0FA 3L4SO 4RK6A 1DEKA 2VHUA 3BWCA 4QPPA 1UMDB 1AF4A 2ESRA 1XROA 2QT1A 3DT9A 3H2ZA 3OLXA 4JMLA 3TL6A 2P3SA 3WDLA 3SSAA 2RC6A 2R6DA 3B1JA 2J07A 4MVJH 3E9ZA 1LK0A 1U0OC 1HTTA 2AL7A 2GBLC 4O3MA 2I67A 4HGZA 5DGDA 5IABA 5ELXA 2ZB3A 3HO1A 1DIHA 3A9SA 3L93A 3OOWA 3W1WA 1NQTA 4PAMA 1GJRA 1U5AA 3LC1O 4IXWA 1DTSA 4JL8A 4JBWA 3HCRA 1X1DA 3U7RA 5AVXA 1V5WA 2JGKA 4HB4A 4MYCA 3BH0A 1I51A 1H2BA 3I9OA 4IVQA 3L1VA 3GPDG 4KZPA 4RKFA 2XBLA 1CUAA 1CIVA 4B76A 4GP7A 3E48A 4OHMA 3SVLA 2R6JA 2Z6UA 3EXG1 1RRCA 2BELA 1YJCA 2NGRA 4LSWA 3FSJX 2D2IA 2BMDA 2UXBB 1TVKA 2ZQ5A 4M6WA 2HWYA 1F0PA 3HU5A 3I9MA 5IEBA 5TNXA 3U31A 4ZI2A 3L8DA 4ZZ3A 4MRPA 3PPXA 4EUKA 1RRMA 4IUDS 3EVNA 3CTMA 2Z04A 4UE3S 2R11A 4JV5B 4MGZR 2R85A 4XYGA 5E9JA 1A1SA 4CQJA 2CKMA 4BGIA 2DFKB 4UEKA 1P33A 3FVRA 3LGSA 4AK9A 5CYPA 4BIIA 4YY3B 4OA8A 2ECKA 2VP9A 5L3QB 2WIDA 2GN8A 2D2EA 1ORIA 4H1HA 4KPUB 3IOEA 1M8FA 1CNMA 1ZL0A 1T4CB 4R6XA 5JI3E 2GD0A 3WRXC 2X0DA 3HSYA 1EBUA 4WCFA 1Y6ZA 3GGPA 4BO3A 2QX4A 2AQIA 2ZUUA 4M1TA 4O4LF 2P2YA 1SBZA 4LJYA 1YZUA 2RB5A 1GA1A 1PEYA 1UK9A 2DHRA 3UVEA 5IJXA 2QWXA 3UMFA 4W5JA 2WYOA 3AMVA 2GAFA 3IPYA 3A26A 1HQCA 3DFZA 3MIIA 4HYEA 3V1NA 4AYTA 4CMCA 1SQ6A 2EGHA 1T9HA 4L22A 3STXA 2OBNA 3BD8A 5AKKA 3FY4A 5LZ4A 4WW0A 3N39C 3IPCA 4C7JA 1ZK3A 1NTRA 3G7SA 4FCVA 1ORWA 3AOEA 1AZLA 4KXXA 1Q12A 3CLTD 1PYOA 1SD1A 2GRUA 2VT6A 4W7SA 3UJ6A 4EF5A 5CDFE 3OE7D 3PX3A 5JCXA 3R5TA 1Z5UA 1JIUA 4KUEA 4BECA 3LH5A 2ZUCA 4GR5A 1QH8A 1VXOA 2ODAA 3CV3A 3DVRX 1QRSA 2XAUA 2XE7A 1L8QA 1MUUA 1IPEA 1DBSA 5FUQA 1GTG1 4LBWA 5KJ1A 1BE6A 1IL0A 1YJXA 1R5OA 2F1IA 1Z2DA 5SZKB 1JLRA 1RZRD 1KVUA 1WOYA 3G79A 1H5NA 4G5QA 3G8DA 2IU0A 5E3HA 2QJOA 2W70A 2GSDA 3HRIA 1F8XA 2DQYA 2FP3A 2R25B 4HWSA 1EB8A 4IQGA 5CIWA 5FBRB 1VHTA 3MAJA 4FDUA 3F8TA 5J5CA 1NHWA 4EY7A 4JITA 1C4OA 1ZD9A 3D43A 2YR0A 3GG9A 2NU9B 4BVJA 5IF9A 2R1TB 5ALFA 3IV6A 4BWFB 4PZAA 2W00A 3QPWA 1NI4B 3L0PA 1E4EB 4L74A 4JKYA 2NSDA 1Q57A 1CDDA 4GAEA 1U7OA 2X42A 4RFLA 5T3YA 2ZSHA 4CMIA 4UTVA 2LGJA 1I80A 3G5AA 4XFKA 3UGJA 4LJRA 1E7SA 4J16A 2VJBA 3JY6A 4JJZA 1E2IA 1GVHA 5F7ZA 2R8XA 2A9VA 3GGCA 3OQNA 1DOAA 2JI7A 1H23A 2C9CA 3G9UA 4YVFA 1PJRA 2A0KA 1ESZA 1WA5A 4QLAA 4S3MA 4ARAA 1Q0UA 4LIPD 2D2VA 1R6AA 2OQVA 5BN3B 3V34A 4QHTA 2FZEA 3NG1A 3JAKA 1L7BA 4GPZA 2QTHA 3OE4A 1ICEA 4M9QA 1G2OA 1VKRA 3ZBQA 2FPSA 1DKRA 2BFAA 4OQNA 3OT1A 4MQEB 3W2IA 1Y9DA 2OPHA 3GZTB 2WAAA 3GLQA 3D1LA 4LRWA 4FVTA 2VDWB 5REQB 1EXDA 2DBZA 2PX8A 1KEVA 1PGQA 1Y5RA 4QUDA 1DE0A 4TV8F 5FULA 3VI3B 4GMKA 5WRFA 4BJ1A 4D0LB 1P9LA 2PBFA 3FMGA 1OB5A 4IINA 2W2NA 4M1ZA 5LQRA 1WB4A 1G4UR 5TF0A 2A2ZA 3R9IA 2RAFA 5A6SB 1BVUA 4JQOA 4ER7A 4G5RA 1XPUA 4WN3A 3PCRB 4DCCA 2GXUA 3G9TA 2QRKA 3K15A 3CKYA 3NASA 1OCEA 3FPCA 3KSMA 4DVGA 3CLUD 3IHLA 1NBEA 3B2QA 5B30A 5L9AA 2WSMA 4IIHA 2XA1A 5A71A 4AJIA 3P5BA 2DFLA 4Y2HA 4JSTA 4I14A 2WB4A 1ZCZA 2A0WA 1C2TA 1JR2A 2C00A 2G08A 3BCHA 3LPLA 2W2KA 1JJIA 4R2KA 5CPFA 3ROZA 5K8TA 4Z3KA 2V7QD 3EYWA 1GGKA 2G70A 3AKEA 4IIBA 3R9WA 1B6RA 3D6NB 3QK7A 1QAOA 1IG0A 1DAEA 3WIDA 3QMPA 3ZWOA 1RAIA 5FL7D 2WJYA 3QW2A 4QTYA 4QOSA 4FKZA 1JU3A 2B6NA 4U7DA 5FPSA 3OQ1A 1NUQA 1Q1BA 4HQKA 1DO2A 4OSEA 4WAUA 5EWLB 1ONPA 2XTMA 1H85A 1Q7CA 3Q2IA 4J07A 2P4SA 3U16A 1QTQA 3WL4A 4AWBA 4B74A 3FSRA 4DJAA 4D25A 4ZK6A 1TTQB 1IN8A 3W5DA 2LKDA 5LZ5A 4EUEA 4NCHA 2NM0A 1AOXA 3TW6A 1PWEA 2OLEA 3VAAA 3CO5A 1R88A 3BE6A 5I7WA 3L6DA 2AI1A 2R0QC 3IP7A 4M7PA 1ZCJA 2QNRA 3JWJA 4KIJA 1XKQA 4H1TA 4PLTA 1SC4A 1XB2A 4E2YA 3DLAA 3UK7A 4B8ZA 4BJ6A 3GCZA 3NANA 4K8OA 5MGBA 3D64A 4ZHQF 1PWZA 1SK9A 2GBGA 3TB6A 1MAUA 4QREA 4YHBA 2GBIA 2I7TA 4FGWA 3E03A 4IV5A 3LY9A 1O94D 2HADA 1KDVA 1V8BA 2RHJA 3EVAA 1I4EB 1G4HA 4I8DA 3U7FB 4WZBB 4D0GA 2EQAA 1C7RA 5DIFA 2P11A 1UMKA 1G20B 2VPWA 4H16A 3Q10A 4LPKA 4JVMA 1N5IA 3I32A 2YBDA 2QB5A 4J94A 1O96B 1CKEA 1V71A 4MR9A 4WK6A 1JG1A 5GGXA 2HLDD 2YQZA 7GPBA 5HRAA 3TW8B 5J2UA 1H6DA 2J3DA 1F2UB 1CV2A 1JWLA 1LBSA 1U7HA 4FINA 1N78A 1UJ4A 4ZVTA 3PYMA 5AVKA 4BE9A 5BRJA 2QVZX 5FEMA 4L0MA 2VHVA 4NVRA 2BMVA 1YNOA 1NQWA 3TLXA 1T4DA 3FJYA 1JLMA 5B64A 1T3TA 4H08A 3U6KA 3NBZC 4MQFB 2JHCA 1Y1TA 3RSZA 4PN7A 1SUAA 1IEXA 2QD4A 3GNTA 1VJ0A 3WMRA 4D80A 1QAQA 2L82A 1DEAA 1QYXA 2R9VA 4HBGA 1G41A 5G0UA 1PG2A 4Q21A 3VR6A 5CD9A 4K86A 4RAQA 2AEEA 3MWFA 2OXTA 2A57A 4EP1A 5EN4A 3GGJA 3T0GA 2DQ4A 2DTEA 4MB6A 2CSUA 3ZZMA 1ZMRA 3FTEA 4YJKA 3RS8A 1ZIXA 3WB1A 3P97A 4ZHQA 5EZ5A 2ATCA 5B4UA 1XNGA 3PPWA 1ABBA 3Q98A 1ESEA 2WFMA 4QYIA 4RK5A 5DYGA 3WGVA 5C1BA 2OO3A 3V8EA 4KQKA 1ATIA 4P0TA 2FRDC 2QD2A 3HKDA 4F6LA 3GBSA 2IV2X 4GOXA 2JAXA 4BU0A 3RASA 1OIVA 1Z0ZA 1T0IA 1YUMA 4GOLD 2AA3A 2H57A 3F7TA 2DSTA 2XGOA 3NJ8A 1LX7A 4DT1A 4ZI5A 2X1VA 1GD1O 5M34A 4W63A 1CJMA 3ZBPA 1EAMA 1Z3CA 2VKQA 1ZMBA 1YMUA 5L3SA 1ADCA 5A4DA 1E1DA 2JVJA 2VDJA 2FPLA 1DX6A 2UYYA 3DHVA 3GT4A 2YVAA 1JTFA 1ND5A 1YDEA 5F5XA 5JZOA 5K8CA 3BD7A 1YKGA 3PK0A 2ZRJA 2RC5A 3FZQA 3ZWBA 1TZJA 2CDBA 1TAGA 4WOJA 1GRVA 2FK7A 3WGLA 2D7DA 4RACA 5K3DA 3PPIA 1YQ9A 4V0QA 3OZIA 3HKEB 1BRTA 2EG5A 4QQKA 4WIAA 4W1PA 5F35A 2IZ1A 4Q24A 3ZDXB 4Z4QA 5BSWA 4J2HA 3ICWA 1XQWA 1KY4A 3M6FA 2Y1DA 4B82A 2VSQA 3GJTA 3KXPA 3NHUA 2YX1A 2PKQP 3FYDA 3PKJA 4GOKA 2R7AA 2OAGA 5AVWA 4EKYA 4BQIA 2YZKA 3FPJA 5EJ5A 1W73A 1QO0A 1UWCA 3ESAA 2Q49A 3RBVA 4YLYA 1EFCA 2RH5A 2XZTA 3HL4A 2PS0A 3DZKA 4IDOA 2QRVB 1O94A 4KYUA 2C07A 4LXXA 4N0DA 1KMNA 4N8SA 4PE5B 2WILA 1L3IA 4YAFA 3FYHA 2VP3A 3A04A 1P1KA 5EJIA 2CHEA 3DF7A 3HCAA 5EXEA 3ZZNA 3DLTA 4P5DA 1XN4A 2P2GA 2PNFA 3A2MA 4Y0AA 3KL4A 5JFTA 4WK4B 2PL9A 4LYGA 1KEZA 3H2BA 4YCCA 1P5FA 1FNSA 1WCWA 4PC7A 4PHFA 5I7RA 4TTRA 3FOAA 3F46A 1FFXA 5CM8B 4YQZA 1UXKA 3I53A 1DMSA 2QP4A 3OETA 4WBSA 1JQLB 1ZCFA 3FLAA 1RYYA 1W5BA 3MS4A 4P3KA 3TAUA 3VR5D 4Z2YA 1UCFA 4EKIA 2NO1A 1R0XA 3EOAI 1NXSA 1O58A 5E4FA 5FWDA 5JS8A 1OFVA 2AT1A 3EZ6A 2H18A 3OURA 4O4LA 4CYMA 1UZAA 3DC2A 1ZGAA 3LF2A 3D54D 2ZRHA 2BFBA 4HDAA 3IR7A 1BQEA 2UKDA 3WLRA 4C88A 4F72A 2PRSA 4YPOA 3ZGZA 4C7MA 4L78A 4R3NA 3HDQA 3U0BA 1ZICA 1P6QA 1WMDA 4TUYB 5BMVA 2UYCA 4JZKA 1C41A 1EBFA 3NWJA 5FBHA 4B83A 2WICA 3PQDA 3RCBA 4GUDA 3SKVA 4WRRA 1CQIA 2M98A 2GETA 2HJWA 4O4IF 4F2WA 2HYIC 1II0A 1KMCA 1E1RD 2WTNA 1NJ8A 1FBNA 2H1RA 5EZYF 4YQEA 3S7ZA 4DC0A 5ECGC 3Q3GE 3PUZA 2WM9B 2XYQA 4Y6PA 4AF6A 5HS6A 2PTGA 2CHUA 1N6PA 1BMFD 2HH9A 3DOJA 1KIAA 2I8CA 4ZCLA 4PYIA 5JYCA 1KMHA 2C3PA 2UUPA 3BXEA 4MEBA 3ZE8A 4BUJA 3ML1A 4PYLA 5DGCA 1F06A 1GNTA 3ADPA 5A04A 5IT4A 4GLJA 3CLKA 4MP3A 1JIVA 1LPBB 3HGTA 4U8GA 3F97A 1OZFA 4UM5A 4IR7A 3AZOA 1TF7A 3U3KA 4C29A 4CEJA 3QNUA 3LNTA 3RO7A 3W8FA 2AGVA 1DKQA 4R0VA 5ALSA 2FKAA 2IXTA 3DNPA 4JMPA 4W9NA 3DMRA 5TEVA 1DZIA 3NIFB 2H2HA 3CGWA 1Z4KA 4RY0A 3PEVA 3PT5A 2ZM5A 1LBIA 2A5GA 3ZGLA 2V0NA 2ZJOA 3R3JA 3T7SA 2I78A 3KJZA 4QEDA 4UMFA 5DM70 1JHQA 3C3XA 3ENZA 3MM4A 4ZDJA 5L40A 2WU1A 3ZJVA 4G26A 3DLBA 1K6XA 1D6SA 3H7AA 3E8SA 1NW5A 4B6FA 4BLUA 2VDOB 5EE0A 1A71A 1KFBB 1KI3A 3S2IA 1R6UA 3QPAA 4RSGA 2FHSA 2WIGA 2X1MA 5BNFA 4C4OA 5AVRA 1QX4A 2OCXA 5JDIC 5ER6A 5KPJA 3D81A 1EZ4A 1CZHA 1DIGA 1JLHA 2NZJA 2W4MA 4ANFA 1U7PA 1F6WA 3ADKA 5K0SA 4IWYA 1RLJA 2VKTA 3VPXA 4OY3A 4DWOA 2TMDA 1SVSA 4IQFA 1QM5A 5CJ2A 5L7TA 2LCIA 3DYVA 4FDAA 2FZ4A 3IVXA 1PGNA 2FW7A 2MT9A 3KIPA 3T8YA 4CFSA 4DGQA 3S2ZA 2XYPA 3DE2X 3H6KA 4RD0A 3IVAA 5EOVA 3IT2A 3VR6H 3EXHB 5AW1A 1Q0HA 2LIPA 3IUSA 4EATA 1RT9A 1I2ZA 4DLAA 1S5PA 4BV3A 3FJ1A 2CL6X 1CQJA 2JGEA 4KZKA 3UWOA 1QG2A 2ZWAA 3FNBA 1KVRA 3QYPA 1SXJD 1VLJA 1XMQB 2Z30A 3FVQA 4LF5B 3C3WA 3Q40A 6LDHA 3II6X 4HDNA 3L82B 1JXQA 3OD5A 2AZMA 1VG1A 3R74A 3T3MB 1ZH4A 2X8BA 4M88A 1PAUA 1HG0A 1QS0B 1CVIA 2JARA 2QL9A 3KTOA 2V5AA 1GRQA 2Q41A 1KI4A 3FZEA 3K2BA 1OYVA 5L45A 4B2PA 4MP6A 1C9KA 1JT2A 5J9FA 1RJFA 4ZQGA 5BN5B 4N0EA 3TLGA 1BQ4A 1ODTC 4PSAA 4IV8A 4TVSA 5KUTA 3GVPA 1IMJA 2AFHB 4HGYA 5AKZA 1OZ0A 2GCOA 2G63A 5E4TA 4AJNA 2BSQA 4J0DA 4ZVNA 2A3NA 3ZWNA 1EQUA 3Q0EA 2P79A 1TQHA 5ILQA 1K63A 3EZ9A 2PMWB 4QOEA 4KBGA 3ADOA 4XYMA 2YUTA 3NU1A 4MW9A 4PC2A 5F1KA 2R6GA 1T5LA 2O9JA 1QR2A 3JWEA 2DJ5A 2B2NA 3BL6A 1YRQA 1E58A 2EHDA 4XJXA 5GJVC 2B4YA 2QENA 1QGOA 1FLNA 1BRMA 1C9NA 1R0SA 4RVHA 5KU1A 4JLUA 1P75A 1Z6ZA 4GZ6A 4O4LB 3MMPA 1E2PA 4Q93A 2QAGA 5ED0A 3HYRA 2BR5A 2IP1A 3WGGA 4CM5A 5I4CA 2B8TA 4JQYA 2OHGA 4PQEA 5ILGA 3EXIA 1DBQA 4CKYA 4YDRA 2CF5A 1G8HA 2CK3D 5AP9A 4MYUA 3VR3A 1W1IA 1C29B 2WIJA 4ZEXA 2VDKB 2IHZA 3PGVA 3W2GA 4O29A 3B7WA 4ADSG 4BL5A 4DQUA 3Q3CA 4KLAA 2G5TA 1Q14A 4AKTA 3HZRA 3AETA 3HZHA 4XUGB 1X7DA 1TYBE 4MSUA 2BISA 2VQEB 3CWCA 3H1FA 4GL4A 2NP7A 3AOGA 3GL9A 5HMMA 3BZWA 1LK5A 4ARZA 3A6JA 4K7JA 4LF4B 4XQ9A 3ZWVA 2B4RO 4BEJA 4E31A 4MV9A 3RUEA 8LDHA 2CDCA 2VRWA 1M8GA 1DXYA 2HU5A 1O9HA 2WFLB 1E98A 1RCUA 4PO9A 5F77A 3OUTA 1ZL2A 1QQ6A 4CM3A 3S6JA 1NFRA 2H2FA 3KNZA 1GNQA 1O97D 2PD4A 3O21A 4FE3A 4M1SA 3MQFA 4MW5A 3REOA 3S5UA 1CZRA 2IOYA 3HXKA 5ANRB 2WWWA 4R2LA 4U7HA 1NP6A 5JH7A 1SQ0A 4U2EA 3FMPB 3KUKA 3IUNA 3T34A 3ZQJA 2IYTA 3HBNA 3VC7A 5CA1A 5GWXA 1II9A 2WJIA 3REQA 2ZDGA 3GP8A 1CUCA 3HR8A 3BA1A 4I50F 1KI1A 1PJLA 2YIMA 2CXNA 3B82A 2ZBVA 4F2PA 1LS1A 2ZCUA 4GGPA 3CNLA 4IUYA 1PP4A 3BYZA 2YIDA 3JARB 1RIFA 5BNWA 2F59A 3LQKA 4RK0A 2IBTA 1SZJG 3LJKA 1QCZA 1VL2A 1DU4A 1IUPA 5JHGB 3ZBTA 2F67A 2UUAB 3D02A 4L5AA 4GBJA 3H1BA 1J2UA 1JZTA 3STVA 2QNIA 1T1EA 4E5KA 5LMZA 2PA0A 5JS6A 1V45E 2WEKA 2BKLA 1CY0A 1GGMA 3ESXA 3LECA 3L5KA 3K9BA 3TM4A 4EKGA 2CJWA 2NVWA 4E3WA 2AXQA 3ZNPA 4OYYA 2EF0A 1EG2A 2ZKIA 4X1IA 2X1LA 3SNHA 4WUTA 3F7OA 2GHQA 1OXMA 3H13A 2QHXA 3ABQB 2RJNA 1JEOA 1NAIA 4NYJQ 2XMSA 5J4VA 3L49A 2LUOA 1FRVA 3FPBA 4N12A 1ZI9A 2XDQB 3VPSA 2XGJA 3W8RA 5ALDA 2MSNA 2A5YB 3WIOA 4YTEA 2CUZA 4HO1X 1ELOA 3RBZA 2G72A 2PX4A 4P22A 5E4YA 2D06A 2C29D 3HVIA 4BO1A 5LUBA 1GQSA 4FS8A 2AG1A 1Y5MA 1IBCA 1G8JA 1WUHS 2VZEA 3OQHA 5KKAA 4EPWA 1WUKS 3DOEA 3GT0A 3OT1B 2Q7XA 4MQEA 2IVFA 1RLOA 1Q6ZA 1H4SA 2A78A 5CRIA 1G2PA 3GOHA 2V59A 1NJSA 4DZRA 1AURA 1LSUA 1O8CA 1I3LA 3NKVA 3TFQA 4OAOA 3PTAA 2D0DA 2WUEA 3BJIC