1NUTA

Crystal structure of human cytosolic nmn/namn adenylyltransferase complexed with atp analog
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
232
structure length
212
Chain Sequence
b'SRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVSHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FKSG76
molecule tags Transferase
source organism Homo sapiens
publication title STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
pubmed doi rcsb
total genus 72
structure length 212
sequence length 232
chains with identical sequence B
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2003-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1nutA00
1OWPA 4XFDA 3SZ3A 4AQ7A 1QRTA 1GZUA 1NYLA 1PFYA 4YP6A 4DDHA 2CFOA 1ZJWA 3AFHA 2CT8A 4EG4A 3COVA 3TQOA 2VXOA 1ILEA 4KPUA 3UK2A 4GRIA 3FH0A 1NUPA 1PFVA 3U1VA 1V8FA 4Q93A 4YMIA 3COZA 3IOCA 1N2EA 5BNZA 3SZGA 2VTBA 4JXXA 1KP2A 1M8JA 3SP1A 1H3NA 4MWBA 3CLRC 2Z3VA 4EG8A 3H99A 2RE8A 4MLPA 2AKEA 1MBZA 1F7UA 4OJMX 1KAQA 3CLSC 1KQOA 4MWDA 3SYTA 2Z08A 1A8HA 5LFAA 2DXIA 2AZXA 3INNA 1EXDA 2TS1A 3IUBA 1K4KA 3UMVA 3X1KA 4AS1A 1MJHA 1G8FA 3KFLA 4RPIA 4PBTA 1S4MA 2YWBA 4GU5A 4E1AA 2J07A 3FDXA 2YXNA 3GUZA 4NX2A 1WOYA 4H3SA 1EFVA 3L93A 2WB2A 2O8VA 2DLCX 1N2HA 1O96A 2CUZA 3OTWA 4F3RA 1MOPA 2X1MA 4MWCA 2PIDA 3F3MA 2H29A 2CV0A 4ND7A 1EE1A 1WKBA 3BL5A 3H05A 1U3CA 4MW7A 1O97D 3H9CA 1IQRA 1YUNA 2ZUEA 1OBHA 2D54A 1XNHA 4XFJA 3E27A 1QJCA 1IQUA 4MUFA 5TS2A 3AG5A 1KH2A 1VBNA 2X0KA 4YP5A 4MW9A 3IUEA 1KQPA 2D5BA 3VRHA 3I05A 1XNGA 2YWCA 4QBTA 2DR2A 5TGTA 2C5SA 5FO0A 4RUKA 2A4MA 3IODA 2H2AA 1M8GA 4MUEA 1ULHA 1N3LA 1KKUA 3FNRA 3A05A 1O94C 4ZCPA 3MUEA 1I6LA 4G5FA 1O94D 1N2OA 2PG3A 1NP7A 1NZJA 4ARIA 3K32A 1KH3A 1X6VA 1GN8A 3ZUGA 1R6TA 1QTQA 2JAXA 2DPLA 1COZA 2J4DA 1U7DA 1ZUNA 4L2IA 3C8ZA 1WXEA 4KR7A 1EUQA 1H1TA 1V47A 1Q11A 1J20A 1WXIA 2XRZA 3RFFA 1M8PA 3UC5A 1HYBA 1YULA 2HMAA 3RBAA 4MVYA 2QUKA 4NDAA 1XJQA 1JILA 2CYCA 4ND6A 1K92A 3DLAA 3MLAA 1KH1A 4MW2A 3Q4GA 2DEUA 1NUTA 1O0BA 1T9GS 5IJXA 2CV1A 1NI5A 1U7XA 4J75A 1WXFA 4KKVA 1NUUA 3TS1A 4CT0A 4WSOA 5K0TA 5FNZA 1TYDE 3CVXA 1D2RA 3IMCA 1TYAE 3HZRA 4ZT3A 3SEQA 5JBNA 2DERA 1EUYA 2E21A 1U0BB 4MW1A 1TQ8A 4CQNA 2JANA 3CLSD 4P2BA 1IFXA 2QTRA 1F9AA 2PXHA 4NAHA 2VTBB 4DJAA 4EG1A 3KT3A 2QUHA 3FIUA 1KQNA 3DO8A 3SDBA 4ZCQA 5DK4A 5DB4A 2D13A 1NSYA 4U8HA 1QU3A 4ZCTA 2DUMA 1YIDA 4U63A 3CR8A 2G36A 3QE4A 3PXUA 4DDMA 2WQ7A 2EL7A 4K03A 3H9BA 1CT9A 2PFSA 3M5WA 3ZXIA 1EFPA 4XSVA 3COYA 3LCJA 3N2YA 4HJRA 2JA2A 2EJCA 4EG7A 2V0GA 5TEVA 4KR9A 4KR6A 2A1TS 4FZJA 1EFVB 1MRZA 4MUGA 3QTTA 2NZ2A 4YBRA 5KCMA 1TYCA 4KPUB 2J5BA 3S3TA 1M8KA 4MVWA 2CSXA 1N1DA 3N05A 3P0HA 1T6YA 1TFUA 3NV7A 3VU8A 1O97C 3X1MA 4MWEA 3ZJTA 2PZBA 2ZUFA 1N2JA 2RD2A 1Q19A 4MQ6A 1N2GA 4ZT6A 1MC1A 2CYAA 4DNXA 2GOYA 1JEEA 1TEZA 3FY4A 3P0IA 1KR2A 4DLPA 4PBSA 5DASA 3LOQA 4MUKA 2DETA 4MUIA 4QRDA 4R0NA 3ND7A 3HV0A 3ELBA 4I6EA 3RJZA 1NUQA 1OWNA 4MUNA 1DNPA 2V0CA 1LI7A 3KT0A 2A7XA 3UY4A 4PY2A 1JEDA 1PFWA 1R6XA 1JECA 4JFAA 1O96B 3AG6A 2XRYA 3IVXA 3G6KA 3FETA 4S1OA 3CLRD 4NATA 2QTNA 1K4MA 2GKSA 3TNJA 1SURA 4JYZA 1JIIA 5LM3A 2IP1A 2I1LA 2HZ7A 3DPIA 3KT8A 1IHOA 1OD6A 2E18A 1WXGA 5F23A 1MB9A 4MULA 1G8HA 2AG6A 1Q77A 3PNYA 4DE5A 3D6VA 1GLNA 1I6KA 1FYDA 2A1UB 1T6ZA 2WQ6A 2NSYA 3JXEA 5J5AA 1X8XA 4ZT4A 3ZJUA 3MLBA 2QUJA 4G5YA 2Z09A 1F7VA 3ILVA 3CVUA 1Y42X 1G8GA 1YIAA 2QUIA 4I6JA 3FOCA 2QJFA 3UOWA 4NAUA 1WZ2A 1GPMA 1WQ3A 5H7XA 3TZEA 4JZYA 2E89A 4ZCRA 3CLUD 4YP7A 5HG0A 1H3EA 4R2MA 4U7JA 3ND6A 3TZLA 1OWLA 1EFPB 5K0SA 4MW4A 1IH8A 4MUHA 1XNJA 4ZCSA 1MB2A 3ND5A 1IRXA 4PBRA 1VBKA 2CYBA 4DDKA 5LLTA 2OQ2A 2BTEA 4OUDB 2BYTA 4MW6A 1F4LA 1O95D 5HUHA 2IJGX 3IOEA 3DV2A 1I6MA 1R6UA 2ZP1A 4K0RA 3CLTD 3HGMA 5HUJA 1PFUA 3P0JA 3IMEA 1B6TA 3N8HA 3L92A 3PNBA 2QJOA 1ZH0A 1Q15A 4MUJA 4ZT2A 1QNFA 3ZIUA 4F4HA 3GLVA 3LE8A 1J09A 1JIJA 4UZFA 1YI8A 1ZH6A 3HMQA 3HL4A 1JZQA 3NBAA 3TQIA 1KORA 3MMXA 1QU2A 2B7LA 1BS2A 3AKZA 3ISJA 4MAFA 1OWMA 1MAUA 1QRUA 3ZJVA 1VLHA 3CVYA 4WNYA 4ZT7A 1O0CA 4EFKA 2PZ8A 5KHAA 2HGZA 3IMGA 4R2LA 3PRHA 3VGJA 1WY5A 1O95C 4MVCA 4CDMA 1PG0A 1G59A 3FHJA 4HPWA 3IVGA 4BWVA 1GTSA 1K97A 1NUSA 2WSIA 2R5WA 5KWVA 3A4IA 1PG2A 4L2IB 2J08A 1O6BA 3Q12A 2E0IA 2A84A 5J59A 1P7PA 3OP1A 4OUDA 1KAMA 5H16A 3CVVA 1N2IA 3GMIA 1N75A 5J58A 3CLUC 3G59A 3SEZA 1IVSA 3FI0A 3A2KA 4MVXA 2QTMA 2A88A 2X1LA 1VBMA 3KT6A 1JGTA 3PNVA 2X3FA 4MW0A 4X0EA 2GM3A 4EGAA 2OV4A 3N9IA 2A86A 1YUMA 3IH5A 5DEOA 5FO1A 2J09A 5EKDA 3IVCA 4QREA 2YY5A 5TEWA 2A1TR 4JXZA 3COWA 1FFYA 4I6GA 3RHSA 3Q10A 3ZXSA 3NBKA 4HK4A 3P52A 3ZGZA 4A91A 3AL0C 4EG3A 1WXHA 3IDFA 2QJTA 4MW5A 4Q16A 1TYBE 1IQ0A 3QTBA 3IOBA 3CLTC 3A04A 1OBCA 1WQ4A 1J70A 3CA8A 1JMVA 4UZEA 3G5AA 3HFJA 3RK1A 1M1ZA 1LW7A 1NURA 1MAWA 1I2DA 3FG9A 4EG5A 1M83A 4EG6A 1T6XA 4NZPA 4HJXA 1H3FA 4J76A 1QQTA 1GAXA 4ZT5A 1VL2A 5AHWA 1J1UA 3FWKA 1LI5A 1N2BA 1UFVA 3H97A 4EF6A 1N77A 2A1UA 2IELA 2PZAA 4CDNA 1JZSA 2O5RA 1JHDA 1O5TA 1WJGA 1KP3A 1T9GR 1N78A 3CVWA 1RQGA 1J21A 1OWOA 4G6ZA 1U3DA 2CV2A 5IHXA 3MXTA 1J1ZA 4TS1A 4ARCA 3AIIA 1EJ2A 1QRSA 3RK0A 1M8FA 1GTRA 3D6UA 3K9WA 3X1JA 1JIKA
chains in the Genus database with same CATH superfamily
4CEJA 3KR1A 4KOEC 1P2SA 4UEOA 3MIZA 4MV4A 5DM0A 2ZUVA 3TTXA 3K20A 1K6EA 4NJOA 2H4YA 4YRFA 2AQHA 2JJQA 2CEKA 3MIIA 2W48A 1LQ2A 2VXOA 3LVQE 3TSAA 2F9FA 4OQXA 3GBSA 4BATA 2NVBA 1XXHB 4A4DA 5B55A 5FPQA 2P9YA 5A06A 2Y1EA 4I5DA 2NADA 2IVFA 1N2ZA 1XRNA 2VJBA 3HCWA 3NT4A 4J7XA 1EB8A 4WY8A 421PA 1TGYA 2ABWA 2P2YA 4A0SA 5HBRA 2Q6TA 4HQKA 1LRKA 5HDBB 2XQVA 5TPZD 2JFXA 4KWEA 4NH0A 1EEXB 2YYYA 4F4JA 4WESB 4TUYB 1II0A 3DZFA 2AKEA 1LK5A 2GUGA 5ALXA 5I45A 4DR3B 1JR6A 1JE0A 1SK9A 1H05A 1I3LA 2WZQA 3DT9A 4Q82A 4QBIA 4WKOA 4ZVRA 4YREA 3WP1B 3T41A 3VNRA 4C7MA 3AEUB 3D7NA 2OCIA 1S8FA 3NCTA 3INNA 2EW2A 3NWPA 1RS0A 2CD9A 1IIRA 2H7XA 2JHGA 3IUBA 4G5OA 1SBIA 4JBGA 4KNWA 3UMVA 1ABBA 4UM8B 2VTKA 4BUJA 1P0MA 3NALA 3E1SA 4MX8A 5K2OA 4LKRA 2BDTA 1QGUA 1NNUA 4EJFA 1MRSA 3I9OA 3BTSA 4Q1EA 4EK9A 5HX7A 1DWQA 1H66A 1XZKA 2WU8A 3VUEA 2QRZA 3DYVA 1XT6A 1U3WA 1WHSA 3OJXA 4PRYA 4RHTA 4UBMA 2W4IA 4UNRA 3R41A 3MRVA 2WJHA 2Q7OE 2Y99A 4Y7DA 3TRKA 4F3RA 3WQSB 4P22A 3TEJA 2E87A 3HUFA 3N7TA 2B2NA 1W93A 4MKGA 4NNOA 4W82A 1NJ5A 1FJ2A 3ZS9A 1U2ZA 4MK4A 4BNHA 1WKBA 1Z2AA 5E0OA 3IALA 1IQRA 1PL0A 2EBHX 1X39A 1JEOA 2I29A 3I32A 1O58A 3OJEA 4XLTA 2PZGA 5EWJB 5GVSA 3LDHA 1EUDA 2P77A 5JS2A 3VKHA 4CM4B 2CMHA 4E2ZA 2VP4A 3WGZA 5H02A 4YRPA 3LPLA 3SYLA 1Q22A 1SHZA 4Z3DA 3RFTA 1ZRNA 3QE0A 3A58B 3H5NA 5JMPA 1OTYA 1O6CA 2BEWA 2CVZA 1L8XA 3MJCA 3QJYA 4IJQA 4E22A 5KWIA 3LH5A 1USUA 2D00A 5DHRA 1Z6ZA 2UYQA 3JQ6A 1RJGA 4OMCA 4CG1A 3PYMA 2GEJA 4G01B 4DDVA 2GWHA 1WKCA 3TEFA 3FNRA 3FDFA 2RBGA 2P11A 2V54A 2HKIA 4KAXA 2JGAA 4BX9A 1SVOA 5BUCA 1CQIB 5KNCH 5IKOA 3KEGA 3UHOA 4P9NA 2N1BA 4BO7A 3BE5A 2J33A 1GTVA 1A04A 2P4QA 2ZM6B 1AF4A 2QY6A 1R6TA 1GG9A 3ZCVA 1COZA 3DR5A 1U7DA 2ZIXB 4XDZA 2H1FA 4RM2A 1R8XA 3VNAA 1Z2OX 3I5XA 2QMYA 2W70A 2VKTA 5IKXA 4N76A 3DHYA 5KPJA 1GCAA 5JDCC 5AKYA 5LDGA 4R5MA 4YO8A 3KOWA 2QYSA 2QM0A 3WI7A 1GLGA 3MZ0A 4NK4A 3F2VA 2PMFA 4ND6A 4WMLA 4CMBA 5D7BA 3G02A 5EAIA 2YXPX 2CE2X 2J6IA 1SKAA 1W5TA 5DTRA 1L8OA 4WFQA 4IUCS 4MZDA 1W2GA 2C0CA 4UW9A 3RTEA 2GXQA 4FSHA 1NHGA 1DMRA 3K53A 2Q2QA 4Z6KA 1WXFA 2LCQA 1P4RA 5BV2P 5KJFA 1WPQA 1NNLA 1JLMA 1U8CB 4WSOA 3BCHA 3DAOA 3PIDA 1YI0A 2W2KB 4M55A 3AU8A 1LXCA 4GBMA 3GCGA 3I83A 1N34B 2HWWA 4B17A 3AL2A 3EZ7A 3FZEA 3PKIA 1YIOA 3Q3CA 5DHAA 2FWBA 5EVCA 3ZHOA 4XD7A 1QM5A 2CLLB 1DOHA 3HKDA 4CQNA 2Z1NA 4LHSA 4LV6A 4DPLA 1L5HB 3D8BA 3K2EA 3FCAA 4L4YA 2PVCA 3NV9A 3WL8A 3BAZA 4MVJD 2TMKA 2ASEA 4Q3EA 5JBIA 3ZDFA 3KEQA 5CX1B 4DA0A 5LZ4A 1TCBA 3NAZA 1JUDA 1I1NA 2PMKA 1FNSA 4LOJA 1VL8A 3L82B 2CC2A 1DBVO 4OKIA 1HDXA 2Z3WA 3ABSB 1G5RA 1ZMRA 1T24A 3E0QA 2HPHA 1L5ZA 3VYVA 5JALA 1CERA 4KPEC 3VJMA 5SYAA 1DZ3A 2WF9A 3PDIB 2D13A 3U3DA 5F9MA 4QDZA 2E48A 4AMZA 4O4IA 4RTMA 4DWJA 2EKQA 3GEBA 1PLLA 1BGWA 1JIUA 1GPYA 4LY9A 5GTDA 1AKEA 2W0SA 2G36A 3RBZA 5BMOA 5BV8A 5K4HA 1SKMA 1YKSA 4RF4A 1WPGA 5ENVA 2BF4A 2PUGA 1OFHA 2GNAA 2PS9A 2D2EA 2HRRA 2XADA 3IILA 1M67A 2J0SA 2PUJA 5JC1A 2EEPA 5BN5A 1V6CA 3LCJA 4XSVA 3OIGA 4GKVA 2ZATA 3DZBA 1ZIYA 3WX0A 1UKVY 4OSPA 4PONA 3GU3A 1Y82A 2B3TA 4B5LA 4WL0A 4XEUA 4DCTA 3U44A 7YASA 1KIAA 5DWVA 1XLWA 4ISBA 2NZ2A 3RRBA 1NFQA 1BZYA 1US8B 4ZCIA 4ZGWA 1KFKB 2WFLB 1XZ8A 2CSXA 3FNEA 3QSYA 1WEKA 4MGYR 1G38A 1VYHA 4LPSA 4Q0MA 4OGGA 5AW0A 4OLAA 1JHVA 1NT4A 4E5VA 1XCMA 5ALPA 2ZB8A 3ZGYA 5HYVA 4B0OA 5B3JA 9LDBA 4K81B 2OB2A 3OQOA 4KSBA 2QU7A 3RJTA 3SHVA 2NV2B 3HCEA 3KVOA 5DI3B 4LVUA 1R2QA 3LXXA 2XE7A 1J25A 4MQUA 2XA2A 3HDYA 1K98A 4DNXA 2OPBA 3RG8A 2GD0A 1XU4A 3A37A 3ASUA 3M6UA 4GYWA 5U4XA 5DI9A 4CF4A 1CJTC 2H31A 3TZHA 1DAPA 4EPRA 4ZEVA 4MS4A 5ITWA 4I6EA 2XYPA 1E4YA 4PF1A 4REMA 4BECA 1NVWQ 2PXAA 3DMPA 2ZRJA 3NG1A 2ZSAA 4R31A 4KV7A 4MUNA 3E5MA 3I12A 1B6GA 2BW0A 3GRRA 3HJFA 4OAOA 1EHYA 3H4IA 3UCXA 1FXWA 3FPKA 3V5NA 1RAFA 2A7XA 4MCIA 4TS9A 3RADC 5TQ0B 3GGJA 3U6BA 5JBQA 1X80A 1CUIA 4RY0A 1L5FA 2PRKA 1OI7A 3JD2A 4DSZA 3HDHA 1V0JA 2R6HA 3AUXA 5EP4A 1GPNA 5J9FA 1EUCB 5GZ3A 2BMDA 1ZNWA 3H19A 5U1PA 1YWGO 3T3GA 1UXKA 3FX2A 1Q7GA 1EK2A 4HGRA 1ACMA 4I8IA 1LS6A 1SURA 1TUBA 2NTVA 3QOXA 5IBQA 3HUTA 3UTCA 3V4FA 1CR2A 3ZW7A 1IG3A 4TTJA 2FXVA 4G3XA 2O05A 1QIHA 4YCAA 1MAHA 2RGWA 2FPWA 3G2IA 3ZD8A 2ZI7A 5F23A 4D25A 1JQBA 1ML3A 2UUOA 4M9CA 4OP2A 2W6CX 3BSFA 3TW8A 5FR2A 2VNIA 3DLPX 1OFUX 4XPIA 5TVKA 4YRLA 4NBLA 4G1BA 3H2GA 2G07A 5I7SA 3ZZMA 1EXVA 2R6CA 1T6ZA 5CU7A 2WQ6A 2DFKB 3KR0A 1YZKA 1W34A 3UWPA 1TM2A 5M2QA 3CRZA 1UFKA 1GPKA 2A35A 2OWDA 1PUXA 1M2HA 1TI7A 4HNUA 2PSHA 5E4TA 2VO1A 2Z8ZA 3MRXA 4YUZA 1G6KA 5DNYB 3QUBA 1RE1A 4WFJA 2OYSA 3CNEA 4A5OA 2DOKA 4WGGA 2P3LA 5H7XA 5ICGA 4XYMA 2XSZA 2XQGA 2NGRA 1AGPA 3EBOA 4J3JA 2O7SA 2NSLA 3ZBPA 3CLUD 1U7OA 3TIIA 5JFGA 4C04A 1C1HA 1PL7A 2VN8A 5ALNA 1MDFA 2FPKA 2P3OA 4MPPA 1FQKA 1RXUA 3FHLA 3ND6A 1G5FA 3TZLA 3WRVA 1E0DA 3ZCTA 3JYHA 4IVNA 1Z13A 3JAKB 1SD1A 4HQLA 3VU9A 2QJRA 1RMQA 1XNJA 4ZCSA 3BCRA 3AETB 3D7SA 3FSRA 2ORYA 1M0TA 4QBHA 2WIGA 2PAAA 4YRJA 2P9HA 3T3EA 1E9BA 2J0UB 1NXPA 4GPAA 1M33A 5E6UA 2BYTA 1QDEA 5TMPA 2ZCJA 1YCHA 3T9EA 8LDHA 5AKXA 4ZMRA 5AW4A 1YR8A 4LJYA 3PV0A 4CZ2A 5AK3A 1IG0A 2BKXA 2IJGX 4B73A 2O54A 1KXZA 1DQRA 3R75A 2IBSA 3LFTA 3IP1A 2CLHB 5TE9A 1P2DA 3ZD9A 4BL5A 2BDUA 3PFWO 3G8YA 5CITA 2R7NA 3HABA 4BVJA 4DHWA 1XLTC 2M32A 2XZTA 3A10A 4RXUA 1B1CA 1Z0JA 4HNSA 2A0UA 1G1AA 1IEVA 4I1IA 4NYMQ 5DHSA 1DARA 1TL7C 1UPAA 3JS5A 4M0EA 3RVQA 4H4EA 5LQSA 3ZDRA 3QIAA 4Z1MD 1QRDA 2PVSA 5D84A 3TCNA 4RFSA 2QU8A 1YQEA 3Q87B 4PX3A 1CXZA 1NTRA 1YI8A 1X8LA 4I55B 3GUHA 3DSRA 3C7CB 3S68A 4ALKA 3VA7A 1DFHA 4KNYA 3PLRA 4EA8A 4D02A 4ZDIA 2OKCA 3O4HA 2I78A 3G1TA 5K8VA 1HR0B 4BJ6A 1JFLA 2H1RA 1UBKS 2RB5A 2E6UX 3TPCA 4BNNA 3KXPA 3TQRA 1D2MA 1VLHA 4B3CA 1IVYA 1ENYA 3S8EA 1BN6A 1LBSA 4KFRA 1XDGA 2XNKA 3NTUA 4QFBA 1SCQA 2FW1A 2MHCA 3H1TA 4GVLA 3F5FA 3MTIA 4OYYA 5J4VA 2O2XA 3MFYA 1YZTA 5F7JA 4C20A 1CFJA 1KJNA 2WWRA 2P4SA 2DWQA 1GRCA 3A1DA 3H11B 3K0BA 3PF9A 4IIBA 1G1MA 4CIVA 2WF8A 1W9MA 1UIMA 5EXTA 3E9RA 5E6SA 1INLA 3M5DA 4DCPA 2AVNA 2EX1A 2RK6A 3C70A 3MUOA 3ON5A 5JCJA 1YA6A 1DKLA 2ZIXA 4UM5A 1I5EA 3LWZA 1POXA 2QE6A 1NPYA 1ZN2A 4TWAA 1YL7A 3SC4A 4Z9XA 5AVVA 3OM1A 4IMJB 5AI8A 1B15A 2OXEA 1SNYA 4ZU1X 3DFUA 6REQA 5IC5A 4EPXA 1P2VA 5JS1A 3BCUA 5H16A 1TF7A 3T6KA 3TOXA 1RJ9B 2VZ9A 4WAUA 1K8YB 1GT6A 2SHKA 4U5QA 1CQPA 3BFVA 4TQ9A 3SEZA 3TZ6A 1NUHA 4DDWA 4ZMSA 1IE3A 3GFVA 1XKTA 4B6EA 3IP9A 4HWTA 4RSMA 1JPNA 2SCUB 2F9LA 1JR2A 2ZRHA 3AHEA 3K0CA 4BO3A 3W5AA 2XDAA 1DO0A 1U1DA 3URMA 4C2AA 2WR8A 4NWIA 4X6YA 4RIGA 2ZYWX 1WHSB 2DH5A 2NAFA 3WWDA 3PNVA 3CUSA 5C35A 4JSRA 1W0CA 4B6JA 2EL9A 3LTEA 3NJ4A 3O8NA 2HV9A 5AH0A 5LVAA 4WXPA 2EP5A 3NBZC 4Q3LA 1FJHA 3WGQA 2ZI4A 2E37A 4AKHA 2VP2A 4GKAA 1N8NA 4R6WA 2CJYA 3NC1C 1N6NA 4QREA 3RANA 5C1PA 1EWRA 2Z0MA 4Y8VA 2WJAA 1FUUA 4V0NA 5HRCA 2WLTA 5EWJA 3PYLA 2XYHA 2QGZA 4LC9A 5K3EA 1GGJA 1CB0A 2XIQA 1L4LA 4HK4A 4AMYA 4RH3A 1Z2NX 5DLDA 3HS3A 1AZLA 4DG8A 1U3TA 1Y7TA 3BMNB 1XPUA 1ELOA 2BLLA 1DELA 4EG3A 3K0EA 2QLNA 4DEVA 3I9NA 3TTUA 5LIPA 1A1SA 1EFCA 2WA1A 3CT6A 4L76A 3A04A 2X2EA 3B1YA 3NWOA 1Z3CA 5FTMA 3FTDA 3NBMA 4HMOA 4JB2A 2IXGA 2GN1A 4MHOA 3G5AA 1H85A 4WZBE 3OM8A 3NANA 3PFCA 4UCWA 5KVAA 4KXWA 4ETIA 4EYSA 2OCYC 4FN5A 6AT1A 5D3QA 4EI7A 3A9CA 1V8BA 3B3FA 4CM4A 2P7HA 1B8NA 3JQCA 5D7NA 1VL2A 2EWWA 1TK3A 2GM9A 1T1GA 1U0FA 3IR7A 2CB0A 2IXAA 2X40A 3AEUA 3CKMA 4ZQFA 4CIWA 3EGEA 4OXIA 1PFGA 1PJ2A 2EKDA 4EF6A 1RYFA 2HA4A 4B6OA 5B57C 2A1UA 2ODNA 2VP6A 4BBAA 2HYDA 4TMVA 4B6FA 2WIAA 4LJKA 2X5OA 4GPZA 1UEIA 4YDRA 4EEXA 2JIZD 1MNAA 1JEYA 4BEJA 1MP0A 3CX3A 4EKEA 1QHXA 1KI6B 1E3TA 1V39A 1Y34E 4LF7B 3WWOA 4MOWA 3B78A 5H80A 2Q3HA 4GHWA 4G6ZA 4QG7A 3IPRA 1B8OA 4LTDA 2CV2A 1N0IA 1KARA 2VRNA 4Y6QA 3FCUB 1VMDA 2IYQA 1QQBA 4DKXA 2ORIA 3AVPA 3SSNA 1Y8QB 3WK9A 3A1NA 3P9KA 4Q47A 1Y37A 4BQIA 1QRSA 1H4QA 3TXYA 2FV8A 2Y0DA 3ICWA 1WHTB 3EXEA 3RARA 3K9QO 1G8YA 2KSQA 2VAMA 3SKYA 4UJ5A 2QVCA 4DDHA 4ZYXA 5DBFA 1KP9A 2RGDA 3CRMA 2ADMA 2WRZA 2EYQA 2AB0A 3ZGNA 3SHTA 2JAUA 4CPDA 5KWEA 3AOEA 3LSTA 2PUHA 1YNOA 2O7RA 3A6GA 5DFAA 1XAJA 2PL3A 4G1MB 2C97A 2ZUBA 1VBFA 4KX3A 4MB6A 2FZWA 5KOIA 4W5NA 1XEFA 1Z88A 4XZ3A 3VV2A 2QV7A 1WETA 1E5XA 2WWFA 4CIDA 4CQMA 2XNCA 2ZTUA 3BJEA 4S1WA 3ZWMA 3CLRC 2XKKA 4NV1A 4JUBA 4CKBA 2XVYA 4PRLA 1E1CB 4BNVA 4EHIA 3COSA 3ZW8A 3CTPA 3H17A 3E9NA 3K1YA 3KV3O 4X97A 1YTUA 4LNHA 4O02B 4GT1A 1NXSA 4OM7A 2JK1A 4F3YA 3BD9A 5JVDA 1E89A 4DIKA 3ZZ0A 5UKDA 1PF7E 4UBOA 3CLKA 3GRYA 5ITSA 1S96A 1QIGA 2VJQA 2ZDHA 2QD1A 4OOEA 3TRFA 5A1TA 5B58C 2C96A 3C3AA 1TO1E 2OFPA 1UBTS 4ARUA 5LWQA 2Q3BA 4ZZ2A 1W4LA 2H07A 4GI1A 1USIA 2PYIA 3LPDA 4W5HA 1FQOA 1QOPB 4JT2A 2G1AA 1L6RA 3R6GA 1QC5A 2FFHA 1GXSB 1N5RA 2QT1A 4Q4DA 2FJ0A 2ZYTX 3KPVA 4GMGA 1DXQA 5HKBA 2BCGY 5F21A 1P0IA 3AF1A 4F3NA 3AEYA 2OPHA 3AOGA 3T1HB 4P84A 4MW7A 5AT1A 3SXUB 4N8EA 2IEYA 4G67A 3LQQA 1OX5A 4B79A 3DVAB 3IR6A 3SHWA 2GK3A 4C4TA 5JZ9A 2YKGA 3ECSA 2WICA 3K72B 4TT3D 3V9AA 5JHHB 1VSTA 1ZNQO 1BQEA 3SJBA 2ATIA 1E1DA 3OJLA 1CQWA 2WOOA 2VAWA 5AKLA 2F2TA 3D8UA 1NF9A 1FUEA 2GJ8A 3DEFA 3QFCA 4JU9A 3KG2A 1VDMA 4HNQA 5AK4A 3MMZA 2XQFA 2PRZA 4FB4A 5D1NA 1TNDA 2GM4A 3DLHA 3L4BA 5FR1A 1TJPB 1KPHA 4MRNA 2A4MA 3DOIA 4RJ2A 3S28A 3SOZA 4DHEA 2RHTA 3G0HA 1N1MA 2HD4A 2WJPA 3MWEB 4XJVA 4Z4QA 1Z0ZA 1NR7A 1VPVA 3D4PA 4O08A 2BEUA 2OM2A 1N3LA 5DXFA 4L07A 4J2TA 1SXQA 3ZDEA 1Z6QA 4P32A 4YUXA 4ZOCA 5KSYA 3MUEA 1RYBA 3LVFO 4LXGA 2WTEA 4AULA 2H4JA 4RZUA 1DKUA 3DOHA 4S3MA 5BW8A 4TLMB 1YMQA 3INYA 4Q05A 2AXEA 4TTSA 4BPRA 3K32A 1G5QA 5EEHA 5HK8A 3JWIA 1UMDA 3NTLA 4JLUA 4QJ4A 1YD7A 2DMRA 1M10A 5LBUA 1NHWA 4TL9A 4F5YA 1CEEA 3ZV7A 1HK7A 3PPYA 1T4CB 1M73E 1YDWA 5G1NA 5A7FA 4BIIA 3LUFA 1N5MA 3ANNA 2TMGA 3G2HA 3MCAA 3PC4A 1GU0A 3AL3A 4RMIA 4DY4A 3VI3B 2I4NA 3REQA 4LRYA 1PUJA 3ZHQA 2D06A 3JQ8B 3BZWA 4UVDA 4BVFA 4CHGA 4B74A 3EAQA 4C3UA 4E07A 1KI8A 1Q0SA 3Q9SA 4QOIA 2WV7A 2DFDA 3P9XA 1P5FA 1PL6A 1JPVA 3QF7A 4GI3A 1O0BA 3CKKA 3DTVB 3G2NA 1AKYA 2GCOB 3OZCA 2JCVA 2F4VB 2FGKA 4NCIA 3GJQA 3MA0A 3ZDQA 5AQEA 1RAAA 1CZUA 1L4GA 1RM4A 1W5AA 3FTNA 3MMPA 3VC7A 4RKFA 1Q7RA 3LDUA 4M1YA 1VTKA 3LY8A 3V2GA 4A10A 2LUOA 1MH1A 2VA8A 5H4HA 2WZDA 2IV2X 3CX6A 2N9UA 2WP0A 4QECA 4C78A 3IUPA 5JFOA 3WOVA 2UU9B 3S2YA 3HL0A 1DZIA 1ZINA 1G66A 3H5LA 4XQEA 3OQIB 5ALFA 2ZKLA 4FT4A 3WMRA 4OJQA 5JXJA 1FTQA 2PPLA 4ZIRB 2XXAB 3RYIA 4IQ8A 2HCFA 1DTWA 3AP3A 2AC4A 3OTGA 1XKXA 4ISCA 1Z5VA 2GCIA 3RSGA 4QWWA 4BKRA 3OPYB 1HEYA 3ZV5A 3NM6B 3MTBA 2WK1A 4DUZB 2YN2A 4KQHA 3HB5X 4PSAA 5LXTA 3OTOB 3MW8A 2VTBB 4RVGA 4WNCA 2QUHA 2GBFA 4IEIA 3TWOA 3OZXA 1OQAA 1W88B 3R6DA 4JJFA 5KTKA 3DBRA 4DV5B 2HU2A 1C3XA 3CW8X 4YJKA 3X1XA 3G7SA 2WSBA 3PHHA 1YS4A 3M4NA 1GUBA 1Z5OA 2EYUA 2O2CA 2P0EA 2FMFA 4KSYA 5FWYA 2XBMA 5IAJA 5TB5A 3DAPA 4HGQA 2VDWB 2AWOA 1KMHA 2HLDD 3ND8A 1QU3A 1T8RA 1F4PA 4LUCA 4YI5A 4E5PA 4XOIA 3JWHA 1AUVA 2FR8C 2DPMA 1WMFA 1F6WA 1BDMA 1F2TA 1NBMA 4MWOA 5J2TF 4BFWA 4IJ5A 1B8VA 1SHLA 2FMUA 2JFOA 1D7OA 1BEEA 2XRMA 4AZ3A 1WZIA 1H9AA 2EL7A 4Z0TA 2LV8A 2PFSA 4AUEA 2W43A 2NVWA 3UB4A 2Z2JA 2XUJA 4LXYA 3N2KB 5IVIA 4OHBA 1GTJ1 3L0PA 2ZJ8A 4UVEA 4EF5A 3MTAA 1L7RA 3FE2A 1OIWA 1MC4A 4B7CA 4F4DA 4CLXA 4B2YA 2ZXFA 2BHLA 3DR3A 3P0RA 4PZPA 4IP0A 2I1QA 3E5NA 1G8AA 3MC1A 5EE3A 1U3GA 1R4NB 4UAJA 4A73A 2ZI5A 3RFCA 2PZBA 4R83A 1H1LB 1SCAA 5JD3A 4CQMD 4QUKA 3BGDA 1UODA 3QKTA 2OORC 1QGDA 1I1QB 1EVLA 4K40A 4WCVA 4ZTZB 4JUFA 1N5DA 4HTFB 3PGMA 3FY4A 1NYRA 2V9CA 3P0IA 1X86B 4DQKA 3D64A 1LSSA 2DETA 1WMSA 3QP9A 4E46A 4FW8A 3SS8A 5CPBA 3AEXA 1XU9A 3KTFA 4R3WA 3IPLA 3WYAA 2BGWA 4B3BA 1CULC 1K8ZB 4K5QA 4AN0A 5BPHA 1RC1A 3WNBA 1RRFA 2CNDA 1EG7A 4TSKA 4X20B 1TJNA 4DSNA 1BVYF 4ZJUA 1PNTA 2GN0A 1I14A 1JEYB 2IYUA 4BN5A 5JJKA 1FEZA 4PZ9A 5EYPA 2VOEA 2J3EA 2RKWA 1FNNA 2DX7A 2VNKA 1Y1QA 2WD8A 3QEJA 4MVJH 4KSCA 1FU4A 4CQLB 3CNLA 1XGKA 4YJFA 2GN2A 2VRWA 3KQNA 3C7KA 1FFWA 2J85A 1RQ2A 1C3OA 2QD2A 4QPDA 1QGOA 1KVSA 3DUWA 2C8JA 2DTDA 3K15A 3TAUA 1U2TA 1WHTA 1UQRA 2J9FB 3KR9A 2WKWA 2W37A 3KB2A 3E0XA 3P9SA 3P9QA 1XMVA 4PGGA 1RI2A 3VR2A 1B14A 3GEEA 4MR8B 3HM9A 2OBNA 3QF4A 1G5PA 3DFMA 4K8OA 2QTCA 1QRRA 3S70A 1LDMA 1GAWA 2OP1A 1S2MA 4KWTA 2ZRPA 3GFBA 2PZFA 3E70C 4BNWA 4ABTA 3D1LA 1YK0A 2VPYA 1PLKA 2H2IA 1W49A 1H5QA 3QELB 2RGBA 4C3ZA 5CTAA 2C78A 3I2HA 2X5XA 1P5JA 3TSOA 3C6XA 4JJAA 1N3IA 3PD0A 4REQA 2XGGA 1UBGA 3BZBA 3GLGB 4A5SA 1YRWA 4GX0A 3KJZA 4IJUA 3A28A 3OIFA 2HPAA 4Z4HA 5IAOA 2V6MA 1LGYA 3V2UA 4C03A 4BFTA 2Q4DA 2PBZA 3BRCA 4OF4A 1LDYA 3QFTA 4I6JA 3ZWVA 2VCYA 3GR6A 3GYGA 3WBBA 2PY6A 4XJSA 1E7MA 2OENG 1Y8QA 4LXTA 2R65A 4CMJA 4S24A 1IXZA 3A26A 3TZEA 4OB6A 4FHCA 1XDUA 3MG9A 4L3VA 1MQAA 4YT2A 4ZV4A 3PZRA 2JLUA 4LZAA 1T6NA 2HU7A 4P86A 2BFAA 5JNRA 2J5QA 2ZW9A 1RQNA 2E1PA 2WAXA 2WB4A 4DRXB 1P31A 1V3TA 2HNBA 4IGEA 5FYQA 1CPYA 2C1XA 5GONF 1T5LA 3W7VA 3CB2A 4WZ6A 4ZO8A 2ZUWA 4IXNA 3UT5B 2CJFA 4ZJPA 2ZI3A 2I4OA 4H7JA 3SBOA 1UBJS 1NFFA 2WYUA 4AO8A 4DDKA 5HKLA 1Z7YA 3GRUA 3PK0A 1RLTA 3KU4A 3WGYA 4H35A 2IYRA 1BC5A 2HNKA 1O95D 2HQBA 4FIZA 3W3AA 1GDTA 2GRJA 4TXNA 5ENZA 3CUEF 4NOKA 3GGPA 4US0R 3TEMA 3NBQA 1WWKA 2MT9A 3LY9A 3P9IA 3Q5GA 3ROEA 4UDYX 3WO0A 2Z43A 4HP8A 4G1EB 1OGYA 1GEEA 1X0XA 3PNBA 5LP6C 1KZYC 3GP3A 3MFQA 1A7AA 1JWBB 2C83A 3G3EA 3S5JA 3ZDBA 4IIHA 4F84A 2H00A 2HQOA 3HADA 4IIXA 3GLIA 4HEA6 1ZX1A 2WAAA 2Q29A 2BHSA 2ZJ6A 4GX5A 3D8TA 3HU1A 1ZRMA 2AOUA 4LV5B 3KEFA 3PA8A 2ZU6A 3HL4A 5IXSA 4PYNA 3K70B 2V7BA 2WUDA 1B3BA 2QT9A 4R7ZA 4GOMD 2OXIA 4EGSA 2GJSA 1B7GO 1YCGA 1AGRA 2BCEA 2CXXA 5JNTA 2QR3A 4GIBA 1NBMD 3GOQA 1QRUA 4IMPA 2HF7A 1YS6A 4Q03A 3LOUA 1A95A 2IXBA 2P3SA 1OTXA 4JYMA 2WSYB 3QVXA 3NB0A 4YP1A 5AVKA 3RC1A 3CONA 4YC7A 5BRNA 2H9IA 4R1NA 4DIDA 4LBWA 3RS2A 5JZOA 1QVRA 4PYJA 4O0LA 1TU0A 4C9BA 4IV0A 5K8CA 5MGBA 5KI6A 1NBAA 1GTSA 4KU4A 3T7SA 3D3WA 1H8HA 1ZCZA 3D3JA 1A5ZA 1AKVA 2GM5A 2WAOA 5AR1A 5KTRA 3WK6A 3L6RA 4M8IA 4QO8A 1CD5A 1JEAA 4FMCB 4XX1A 1L1FA 4CYMA 2XQIA 2ZJ3A 1MQ9A 1XL0A 4J1TA 5T8KA 2J0UA 5E6UB 2WUGA 3ISVA 3UWKA 4B3DA 4D6YA 4PRKA 4P7KA 4S1PA 3GLHE 1CLUA 3JZMA 1WDTA 5CVCA 2J7PA 3C3DA 3NH9A 2C42A 3A31A 3NKLA 4LYEA 4P0TA 4PINA 4F8EA 3VOAA 3I37X 1WCIA 2PMCA 5DI3A 2A88A 4TPKA 3EXFB 3EA4A 1OH6A 4CDRA 3PXDA 5KKNB 4NBVA 4CM3A 1B73A 1L5RA 5AW6A 1ESEA 2P0YA 2Y92A 2X3FA 3O82A 4EO4A 4DA4A 2CJWB 3RAJA 3B85A 4BJ5A 2WTNA 3F4BA 2WC1A 3RNOA 3CGWA 1G3MA 3BFKA 5FO1A 6NULA 1NQOA 1X1DA 1XX6A 1ZUNB 2ZJ5A 3P2MA 3PCRB 2F3QA 4O1IA 1HOXA 2H0RA 3HCPA 2Q5OA 4EMBA 1ITZA 2NT4A 1AKNA 1L3IA 1FCJA 1Z0DA 2D0DA 4I6GA 3PNKA 4URYR 5JWHA 3G0BA 3F49S 3RHSA 4AZ3B 4RD1A 4OJKA 4CM6A 3HCDA 3DXXA 3K1TA 1ZL0A 4UE6A 3O5AA 1PR4A 3EOAI 3N8KA 3E3AA 4I4CA 1D8AA 4JD5A 3OMXA 4LWOA 1ZHHA 2IV7A 2IIBA 3TW6A 3QTBA 1VSBA 5BYAA 1EUCA 1OBCA 1Z34A 3Q2IA 1D0IA 1XIVA 4LFAB 1JMVA 1QB7A 3TB4A 5C7IO 2BFOA 5JAHA 4RKYA 4QE3A 4DCCA 1OROA 4R05A 2DPGA 3GMTA 5HJ5A 1TTPB 2G5GX 1HNZB 2AOWA 1ZGAA 4N49A 4R6XA 5JPDA 3ZE7A 5F5LA 3LL4A 3ZHXA 2XNHA 2B61A 2GX6A 3R24A 3AI2A 3UGKA 3TGPA 1DTWB 2BFWA 2ZYIA 4UBIA 2HLPA 3UQYS 2REOA 1W96A 2IS1A 1N2BA 2QG6A 3O2JA 3DV0B 3OQIA 1NVMB 2PKRA 3DD5A 1I4LD 4IKOA 2YXBA 3ETHA 4IJWA 5JTTA 1G21E 1XLTA 5DM4A 1B8PA 5PGMA 4U00A 4JT4A 3EMDA 4F0JA 4E70A 4DR6B 4RE5A 4R7TA 4D8VA 4XOUA 1DC5A 3W5VA 4C08A 1VGQA 1LPSA 2ZR7A 3LM8A 1MX9A 1WZNA 4MI9A 2P9TA 5SZIA 3E8SA 2GK7A 4LOIA 2OD9A 3HCAA 3P5SA 1Z7WA 1XVVA 2HGSA 1P1FA 3D3WB 2YDYA 3IUYA 3O83A 1YJXA 2P2NA 3R09A 4OG2A 1X7XA 3GG9A 2EGHA 4YP6A 1P5RA 2BJVA 4CXMA 3AVUA 3LK6A 3A4LA 2IXFA 3GV0A 3HLTA 4JI1B 3AFHA 5LQDA 5D5HA 1A71A 1EVKA 3ESZA 1J0CA 3WFZA 4EG4A 4IZIA 3C3EA 4XYBA 1YR2A 2OOSA 3C7AA 1US8A 4O25A 2INGX 1W4BA 2PX5A 5P8WA 5A2QA 4Q1BA 3FPBA 1DS6A 2BBTA 3EQ8A 4HTAA 4JY7A 3MCTA 3KP1A 3W2HA 4AF7A 1T2EA 2BWJA 2PKWA 2CWWA 4M6WB 1YFJA 4PNHA 5BSHA 4EG8A 1KAHA 2YHSA 3K0AB 2RE8A 1DIBA 4Q9NA 2DULA 3NMUF 1I2CA 1D2EA 3R5SA 5ETJA 3L0SA 2FKNA 3QPCA 3QOYA 2QR2A 4BNJA 2GN9A 5GINE 1AQ6A 4WZAA 4P7JA 4D45A 4FILA 4ZVUA 4BZZA 3K6SA 2AJDA 4WECA 4YRBA 1FJGB 4PBTA 4FKMA 1P7ZA 1YZUA 4YXWA 2YWBA 4C0LA 1VIAA 4E1AA 4RNCA 3ZU4A 5LQKA 5C4MA 3EDRA 3U81A 1Y5MA 1YB2A 4K9LA 3D7LA 4TT8A 3UUFA 3ZDZB 1Y4UA 3C5HA 2BCJQ 5I7RA 4GFDA 2GBLA 1XLUA 4Y9UA 5A0FA 2QR5A 4B6PA 4KRGA 1YDFA 3IAM6 2Y77A 2A0FA 3UMCA 3ER8A 2ZRGA 4I4TA 4BCDA 4KACA 1YQQA 4RNDB 5BO5A 5CDFE 2JW5A 5BVHA 2NV0A 1C30B 1Z4MA 2CV0A 1C9JA 1REQA 4QPJC 2VXBA 3D6NB 4JL8A 1U0SY 1PSDA 4QARA 4B4KA 1BE0A 1L1RA 1OBHA 1P39A 3DOFA 4MARA 5DEIA 4F2DA 3OIDA 4GKBA 1P29A 4LJ7A 3NJRA 5BWMA 4I9UA 2WG2A 5TNXA 5CBPA 3HN7A 4EARA 3MBOA 4M38A 4BNGA 2I2FA 4LJAA 2DT8A 3KKMA 4FOPA 3T1QA 4BFYA 3TVDA 4DY6A 2B2XA 5IULC 2XYGA 4ATNA 1GFIA 1DBPA 1GZVA 1KJJA 1YBMA 2F1IA 3W1VA 2X4DA 3EXHB 2WKQA 1Z63A 5DNWA 3CNNA 1W8DA 2D8AA 3TQSA 4OX9B 4U6SA 4IRUB 3QFHA 3V8MA 3GW8A 2VF7A 3F4LA 4HZUB 2FSIA 4GWKA 4ZIRA 4X7RA 1JB9A 2HK9A 1U80A 4GM4A 3CNHA 3BGOS 2BR5A 3EVCA 5BW4A 4GYKA 4XVHA 1XAGA 4TYPA 2FPPA 3C8MA 2IGBA 1TEHA 3WXMA 2CFIA 5KNBA 3UVEA 3QV2A 3SM3A 2FOLA 4TSFA 2RJNA 1X7YA 3IT0A 4DIEA 1IHUA 3P1JA 4GG1A 3K0FA 3ABIA 4GBGA 1YRAA 1H6BA 3V8NA 1BMQA 3D6HA 3MWLA 4BUZA 1S2LA 1XD2B 3UK6A 3IS3A 1JX6A 1LPAB 2R11A 4FS3A 2OECA 3K2QA 3LLUA 5F78A 1V47A 1HI9A 4YJ3F 1HDGO 3UC5A 1QHNA 1Q1BA 4PG6A 3RBAA 1C7IA 4TV8A 1FPQA 4OM8A 1U7PA 4TTPA 2QUKA 1YJ8A 4NDAA 5AP9A 3BULA 1N0UA 3RT9A 1TA4A 3IESA 2GZ2A 2YWFA 1CIPA 4JP2A 3F6SA 3GEDA 3IBTA 1JLHA 3S2EA 4EVRA 4FYPA 2WWTA 2XMBA 2Y1OA 5FTJA 2QN3A 1V8PA 1YJQA 3QI7A 4J75A 1OR8A 2IGTA 2ZROA 4V02A 1TJYA 4ND8B 3ZH2A 3M6XA 4M7OA 4AMUA 1DINA 5K45A 2XMSA 2A5GA 5HKKD 5DHQA 4TKZA 2JZOA 3T94A 2XTAA 5EXDA 3Q85A 3CVXA 4O2BB 5TJHA 3O38A 3T95A 2GCNA 2A7QA 2R25B 4DMGA 3QUQA 3W9SA 3ONWA 2MDTA 1ENOA 1XVTA 3I9LA 3A2LA 3ODPA 1W0KD 1ZI8A 2WT9A 3EDQA 1QUEA 1WABA 2OBFA 4FMCF 3HBMA 2PS3A 1EWKA 2QTRA 5D3ZA 1JR3A 2WE8A 4DLZA 1EHCA 1SXJE 3AKYA 3R76A 3CXUA 2GEBA 3FN4A 2VYCA 3IBFA 3NU1A 2R4QA 4IDNA 4JMLA 2ZJ2A 1KJ8A 4ZVKA 3RT1A 5EIBC 4BRSA 5EESA 1G2PA 3U13A 2V7PA 3U17A 1IXKA 2XZOA 1CVRA 3STTA 1T8WA 5BUZA 1GA6A 2AUMA 2PS1A 5K0FA 3OECA 1GQRA 2GYUA 2X0NA 4DT1B 4A6EA 3AVTA 1ODJA 1FUKA 1GZ3A 5T41A 1XRMA 2Z5LA 3C5EA 4IH4A 5K7SA 1QFMA 2UZ1B 3U49A 4MCHA 5A62A 5DGCA 1YBAA 2OUIA 1GNTA 2FZGA 1C1DA 4NRDA 4PLYA 4E6EA 3WIUA 5AESA 7AT1A 4KLZA 3H75A 3U4HA 3WYCA 4BJ1A 4QGAA 3BDAA 4M49A 1RZRA 1X38A 3K71B 2O8EB 3ADCA 5A9SB 5E4JA 1Y9DA 3MINB 2M6KA 4N5NA 5EQDA 3MWDB 3Q3GE 4WXYB 1JL3A 1JKIA 4B83A 4ZI7F 2O7QA 1ZG3A 4YBRA 3OAAA 1EK0A 2FEPA 5FV7A 3H5TA 2CNWD 1W5EA 2JFWA 1W0KA 3DUFB 2JEOA 5A7HA 3GOHA 4U3JA 4P3YA 1M2WA 3CB4A 4C2TA 4GGOA 1Y9AA 1ESNA 2JLAA 3BXGA 3D8SA 5HP4A 1QS0A 5REQA 4C1NA 2D1QA 4LGMA 1VYUA 2HREA 1IRIA 1DBIA 1N2JA 1MABA 2GDZA 1UM8A 3F2IA 3GEHA 2RG1A 3RYCA 3ICQB 3O90A 2HFJA 3D5QA 4IXDA 3IA7A 3VYSB 3RGGA 2EZTA 2PZMA 4OH1A 5B4TA 2JDIA 3PA6A 1PFKA 3VJLA 4FEGA 4HWRA 4Y2XA 3S8MA 5IUKC 121PA 4D0NA 2NZ8A 4ABYA 4NY1A 2ZAGA 1BE8A 1EA5A 3IP3A 1B42A 3EG9A 4XX0B 4PSKA 5IH7A 3H9UA 3K6SB 3GRAA 4CCSA 2IRWA 4XM0A 3FAKA 3IQGX 1Z37A 1G3QA 1PWZA 4QTXA 1NAHA 1P74A 3SLKA 3N28A 3OF3A 3VTKA 1U8YA 2CNOA 1UOEA 1YOBA 3IQWA 1NVDA 4HDMB 3N5CA 3K5PA 4HNGA 2NZXA 5CVTA 1GVNB 1H2WA 1RFGE 2ZE5A 4AJHA 1T2CA 4BNXA 3G6KA 1VLZA 2IL1A 1XQ9A 1ZIPA 5TXGA 4FYHA 4KQ9A 4GOXA 5KOJB 3BEDA 4TMTA 4ETMA 4G4SP 4LF4B 2C20A 1AA9A 1HRDA 1P33A 2VRBA 5E7IA 1J56A 3PHIA 4L6AA 3UXHA 2IP2A 1L7DA 3ZE8A 1UDWA 1P7CA 1BVRA 1YQTA 1SU6A 1ZCFA 4H1VA 2ROQA 3B20A 3H8WA 2JJ2A 2QPLA 2Z8YM 2C7BA 3U39A 2FWIA 5ICEA 2JCSA 4UFNA 4HZUA 1EKXA 3ESRA 3CE6A 5KYXA 5JMTA 3HXMA 3D6VA 1V6SA 1EVIA 1I6KA 2R8BA 3OO1A 5IJWA 3EXHA 1SXGA 3E2MA 2B37A 3CBQA 3PRJA 2XQJA 4NS4A 4IL5A 2IOFK 5TF0A 3EPKA 2RHHA 1DT5A 1K7YA 1J9GA 1F38A 1XAIA 1X2BA 5F64A 3RABA 2SCUA 4C5CA 1QF7A 2VHJA 2PS0A 4C7JA 2EFJA 5AD1A 4X3PA 1LCIA 4NFLA 1EZ1A 2K7ZA 5KJ1A 1SRRA 4KFUA 4Z7QB 2GD2A 1A1VA 4BV8A 1NMSA 3PT5A 2P6UA 5I7OA 4K0KB 1T2DA 1G9SA 4OATA 4HNVA 5EMHA 3IIKA 4JZYA 2E89A 1EMDA 1OFIA 2DTXA 2R79A 3HMKA 3I5MA 3PXXA 3PT9A 3WR5A 1T5TA 5HF6A 4KR3A 1H3EA 4GPTA 3NUZA 4RDXA 3W7BA 3IULA 1N4AA 5KEIA 1JBKA 3OUZA 3W5BA 3H9EO 2AMLA 4UUBA 3RVBA 2R47A 3ASVA 3F6BX 4JBWA 4MUYA 5T3UA 1T36A 4W9MC 4OTZA 2WYVA 1QC5B 1ZOLA 2JHPA 3DKVA 2A67A 2EZ8A 5J3JA 2GASA 4B75A 1BU5A 2BGRA 2ZJ4A 3GT4A 1PBTA 4JS0A 4YJ2F 5DHFA 1J5XA 2H18A 4HLUC 4KH0A 5EWLB 4B33A 3OCCA 1B0UA 1F4LA 2BISA 3NDIA 1PV2A 1HFWA 4YHHB 3D5TA 2I5PO 5C31A 3K5WA 4JBYA 4FDTA 3BXHA 3A36A 3LUHA 4J0IA 2JL1A 5TDHA 3LCUA 2V4ZA 2FN4A 5FI1B 1S9HA 1WUTA 3HB1A 2QVXX 5LQUA 3PIRA 3FPFA 2FPPB 3VHLB 3G7NA 1ORHA 1P7VA 2QE7A 4LYGA 4JUAA 2FTKE 4PO3X 4K9QA 1YFKA 2KX7A 3AZQA 3BF8A 4F3CA 3HC7A 3UGJA 1SZCA 2ZJAA 1W6UA 3GUCA 2QMUA 3NEJA 4DMCA 2NTNA 2OG2A 1NNEA 1HL7A 1ISGA 4P4TA 1VPLA 1YFLA 1A7JA 2OORA 1YVPA 1L8AA 4GKJB 2W4MA 2QNBA 2VJLA 3PNLA 2PNJA 2KW5A 5EKTA 3RUDA 1X0VA 1LC3A 2H7YA 2HY7A 3OSUA 2C4UA 4F4CA 9LDTA 4Z4EA 2HMWA 4UEKA 1C3LA 2H1HA 3ZIAD 4LK2A 1W5SA 1WB5A 4YV7A 2W2LA 1WDMA 4FGSA 4LZPA 5KHAA 1MJNA 2HGZA 8ADHA 2J0QA 1CP3A 3IDQA 4CDMA 3M9LA 3L7CA 1XZHA 3VR0A 4KLAA 4LV8B 4B46A 5AXBA 1TTQB 1VJRA 3LFHA 4I4TB 4LECA 4BGEA 4EHAA 1AV7A 4PFSA 3VQTA 1ISMA 3C8DA 1KWGA 1GKKA 4LWQA 5KU1A 2Y6VA 2NU9A 4B6GA 1IWOA 1HZJA 1TB4A 1Y80A 2AW5A 3BDVA 3L7IA 3AO0B 4CM8B 4EI2A 1XRRA 4F11A 2CVHA 3GCWA 2VWGA 2II6A 4A15A 2QF7A 5IBCA 2XLBA 1EZZA 5L45A 1V1MB 3WK4A 5JW6A 1N5KA 1XYYA 4GMKA 1WW2A 3WRWA 2FJUA 1DX4A 3LIIA 3WIBA 2HRCA 5K8LA 2R1TB 3D5EA 1E3SA 1XZAA 1DIAA 2BDEA 2VJCA 3EGIA 5AXDA 4D4MA 1N2CB 3GXOA 2VRCA 4HNAB 4U9HS 3VHRA 3VOBA 1MB4A 3P4XA 5ERGB 3V4OA 1VKZA 2R4TA 4PC3A 5IZ4A 1R0LA 2QMHA 3L1UA 1XFAA 2DE0X 1T29A 2PUFA 4EGAA 2Z4RA 1ZXBA 4BKMA 3GGGA 3W06A 3IH5A 2XTZA 1KAOA 1TADA 3ANMA 2C9YA 2C5HA 1Q1QA 1UMCA 4QUBA 5EE0A 3EVDA 5EKDA 2XSZD 5HTKA 1SXJD 2ZKIA 2OHJA 6CHYA 1JSXA 3F8SA 1VP3A 2TMYA 1QCDA 2HWYA 2WJZB 1MDBA 1LJUA 3CMMA 3JR7A 4FFDA 4F04A 1WDKA 4C6HA 3HXOA 3ABOB 4H1HA 5IM5A 1QIMA 4PWYA 4DCUA 5LP6A 1XQWA 2Y2UA 1QKIA 2YL2A 4NBTA 2IF0A 1EX1A 3OEYA 1V4VA 5IK2A 3ZGZA 1OREA 5CX4A 4E4TA 1ADFA 2F3PA 1BEUB 3FF1A 4NU0A 1UBSB 1JE1A 1UK6A 1CWUA 1EUZA 1X70A 1HC7A 2NZJA 1IIBA 3L1JA 3Q5DA 4QTUB 3WBKA 3CLTC 1CEXA 2ZDQA 3HTXA 3AHFA 5E6RA 1SR8A 3EFBA 2YN4A 3NXSA 2VS1A 5IBPA 1N6LA 3F1KA 3QU5A 2QLFA 4EJSC 4L9AA 1NURA 4HYQA 1AO3A 3ICOA 3RAEC 3E2IA 1QUFA 2IPAB 4FN4A 3W78A 2Q21A 1RJEA 2PEZA 5TV2A 1Z2DA 3KQHA 4NZPA 2D2VA 2ZLBA 4QU8A 2Z83A 3OBIA 5AHOA 1JWAB 1KJQA 1N5OX 1UEXC 5FLXA 1N57A 3BRWD 3QG5A 3U0BA 4MVJF 1HA3A 4WOJA 1HYQA 3SVLA 3Q9NA 4QUAA 5IDXA 1XDSA 5HMLA 1U7WA 3H7AA 4G4IA 2ZPAA 4FVTA 1SOWA 3FFBA 2DP4E 5DCLA 1HYEA 4R0MA 1U8AA 3IEMA 1J5EB 5I7AA 4PEVA 3PPWA 4YTEA 3HSSA 3LQRA 2CF5A 4RYLA 2VUSA 2Q6LA 2X22A 2ZRQA 1OU4A 1ONNA 2RC5A 3L49A 3LXMA 1BYUA 4DWOA 4DYHA 3MBKA 5JNUA 1J21A 1N7IA 1C4KA 4I1UA 5HGJA 1COWD 4TWJA 4IDQA 2G9ZA 3WL4A 1ZR4A 1ZUIA 1NN3A 3AI3A 2D1TA 5FNVF 5C51B 3I61A 4UAUA 1BGVA 3NBUA 4C06A 3IXMA 5EQFA 1G2OA 2O2ZA 2ZK7A 3SEAA 1E5VA 1F60A 1N0WA 1F2VA 1CU1A 2AZ4A 2YJ4A 4MS3A 2AG5A 4HRAA 4XEHA 2YJTD 3DMTA 3F5DA 2Q0XA 4DYVA 2BKUA 1ANKA 1M3SA 3MOGA 4Q01A 4RAOA 1M2VB 1GIAA 4XD2A 3U1TA 5IU6A 5LOVA 3ZEAA 3CZMA 4GSKA 2NSJA 4FXPA 3HSKA 4F91B 4RKEA 4S0XA 2VC2B 3PEVA 3IAXA 3MB5A 1QK4A 1UXIA 4AP6A 2P67A 3P0EA 4KQWA 4FDLA 4YI3A 4DQUA 4ETWA 1M8JA 1PQUA 2OLKA 1KTIA 2Q3EA 1FTSA 3WRXA 1OAAA 6ABPA 1OBVA 2O0KA 1IN8A 1QIKA 2PL9A 2DZDA 2VK2A 4O63O 5FV4A 3LUJA 4J1TC 1SUEA 4IIJA 4MQFA 4OMUA 4WBSA 3UJ7A 1JDBC 3EEQA 4UFPA 5C5DA 2WA2A 3S81A 2V5VA 4WTOA 5FHQA 2EFYA 3FGOA 2R00C 3UB2A 4FE7A 1OXKB 1DTEA 1NVTA 1UM9A 3KSZO 1JJBA 4YAEA 3WOHA 4RMNA 1SB9A 2X1HA 1GCGA 4TTAA 3OZTA 4TRRA 2C2BA 1T9BA 2GK4A 2YWRA 3OCYA 3RS8A 4X20A 4DLBA 4DRXA 3QX3A 2G4LA 4GC9A 4TQAA 4PNZA 4Z53A 1PJLA 1ZONA 3I53A 3NLLA 1Y3IA 5CDUA 4UFOA 2OC4A 3JTEA 4J9VA 1NOKA 1SD2A 3H5AA 4JGGA 2BFNA 4Z0HO 2EXXA 1YVRA 2DUNA 4NX2A 3UMFA 4EBFA 3E81A 4BFUA 3C5CA 4EG1A 4R8KA 3E8XA 3LDAA 4G5XA 2O8VA 3K6KA 1V1RA 1WCXA 1O96A 3GVPA 2X86A 3FWYA 2X9GA 3O8BA 1YB6A 3PGJA 3CEHA 3FWHA 1M2GA 3KQUA 2DPHA 1N32B 2C2WA 3JYQA 3L7DA 2H29A 3CUYA 3AEKB 4RJIA 4MS3B 4FWIB 3GK3A 1MIOB 4A3SA 3BA1A 3H9CA 3UZUA 3JVIA 2FN3A 4MVJI 3RYFB 3DZIA 2AX3A 1FP1D 1HH4A 1O8BA 1SC3A 1W73A 2QZZA 4KVAA 3S2FA 2P62A 1R3DA 4UARA 3OA0A 4WIAA 2NSDA 1XN1A 2VPPA 3BJIC 4NYIQ 3TIFA 3QELA 1ZKDA 2AR9A 3ADDA 1E58A 4NAVA 3O0TA 2DBRA 3A3KA 4M0PA 5ALVA 1KQPA 2O9JA 2GPAA 2H9YA 1DAIA 4HEHA 5M04A 3IPYA 3L0CA 3TF5A 1I6WA 1GYRA 4AF8A 2AR7A 4BKPA 2YV2A 3A4TA 4D9FA 5G41A 3IODA 1V4BA 4MUEA 4MIKA 5H9WA 1T3GA 2BFMA 3NNDA 4MDHA 2C29D 1ZW6A 3BICA 3M1IA 4G5FA 4HN9A 2AUTA 1U0LA 1ACLA 2PG3A 2C9CA 2VJMA 4KAFA 1GY8A 1JRLA 3DEZA 1Z8DA 2HHJA 4LXHA 3GDHA 4IIGA 5AJTA 4EWLA 3HYLA 3RSHA 4QRHA 1NMXA 1YONA 1KJYA 2HWXA 1M1YA 2XKJE 1O4WA 2C7QA 5LMCA 3ZBTA 3DMTC 4BNDA 3QKRB 5D6NA 3C3PA 5FWXA 5EIFA 1EDEA 3RFFA 4PIPA 4MZXA 3U3ZA 4YAKA 4E5DA 1YBHA 1JXOA 2OG1A 3JPYA 1NJFA 3T5DA 3UT5A 4AT1A 1JBQA 1ODCA 3A1WA 4HQ0A 1SBQA 1GPWB 2FNAA 2F55A 2H2FA 1XVAA 2C00A 5AM1A 4EX7A 1ADGA 1V1MA 2OFOA 2VCHA 3BK7A 1IY1A 1G6OA 4LJ4A 1EFDN 3PP8A 3DFIA 4UMVA 4OHMA 5SZJA 3OWOA 5AOAA 5KTPA 3GRCA 3KTAB 3QYFA 2Z1MA 2J5XA 2JJ1A 2XV1A 2YIJA 4XXHA 4CT0A 1WAMA 3I3OA 3L7AA 3QF4B 2PD4A 2WWWA 2UZ3A 1SOAA 2GBLC 3W3AD 3EAFA 4MXDA 4QD3A 5CTJA 3KLNA 1EI9A 4QDXA 4U7HA 1ZM9A 2D2FA 4NEGA 4NOMA 2AD5A 4B44A 1EUYA 4JV5B 2VP3A 3CH4B 1VA5A 3M1AA 3OURA 5K0GA 4HSEA 4L75A 3G8BA 3K35A 2PUTA 3IX7A 1AGXA 2ZAOA 4IV5A 4OCZA 4P2BA 4RLQA 5ALYA 2DT5A 1XCJA 5BW6B 3UT6A 1K4YA 2DECA 3HJNA 3ZHYA 1OB2A 4H4DA 4BP1A 1KK3A 2OY0A 1QIEA 2WMYA 1TUIA 5BW5A 1C8LA 3FIUA 5KKAA 3G6WA 2QMOA 5CT8A 2KPOA 4DBZA 1AS2A 2ZSHA 3Q88A 3I4LA 3JALB 1C4WA 3GBVA 3OLCX 3IVMA 4UNQA 2JIDA 2JGLA 3U4GA 2XT6A 1U5BA 4ZCTA 2J59A 4XVQA 3C98A 4P31A 3TG2A 1E8NA 3NUGA 4I2VA 4RHCA 3WHIA 3R4VA 1DU4A 1RI4A 4FHEA 2NVUB 4F2PA 2BN4A 3OEHD 5L95A 2PU5A 2GRUA 1X1EA 3E4DA 3WBFA 2DF8A 1CHDA 3AR2A 4YJHA 5JG7A 1MRNA 3GAFA 4FE4A 4F2HA 4BXOA 4KBYA 2WQ7A 4CL3A 2GBIA 3ME5A 2G6BA 2IQ5A 5KQGA 3BWYA 3AIMA 1R50A 4NIMA 3L77A 4DLXA 4YT5A 4EMTA 2AJ8A 3DP7A 1RZVA 5HXAA 3OE1A 2ZJBA 1XZMA 4R41A 5EHZA 1LRLA 3V4RA 3OX4A 1RAIA 1E1YA 4MVWA 5G02A 3PQ2A 2YVQA 3CQ9A 3LHKA 4FDUA 4H3VA 1A2KC 2P4EA 3EGVA 1XUOA 3NV7A 5HOQA 1TK2A 1T8YA 4UXJA 4DVJA 3P2EA 1RYEA 3USCS 3DE4X 4QGFA 2WIFA 2OUKA 3U09A 4J0CA 3MPOA 3Q7PA 1KMCA 1V37A 3A11A 1KVQA 4RIIA 1U4OA 5CXSA 1ZJ4A 4K86A 2I54A 5D6OA 5L7YA 1T9HA 5A0VA 2HTFA 3OQMA 2OK7A 1OB5A 4LWZA 4OHXA 2B82A 2E4WA 3ZCRA 3TINA 3ZCUA 3F0TA 3WLRA 1S2GA 2I91A 1TLLA 5FPHA 4N54A 3RRJA 5CCBA 1UBFA 2VYND 3S55A 5HDQA 5NLLA 2CLEB 2YNMD 2UZAA 4BQEA 3TUIC 1E3MA 1G8PA 4HEA1 4MB0A 3C24A 3DBRB 5BV0A 4ZYZA 2WEKA 1IAQA 1WR8A 1J00A 1JQAA 4WK2B 3ORRA 3PDUA 1CUEA 1LI7A 4W1RA 4G36A 3S7ZA 1A27A 3M6AA 5FYDA 3TDNA 1CZNA 3RVKA 1Y7IA 2QSZA 5CAEB 1JEDA 4RVDA 4XPZA 1AB6A 5JQGB 1KU6A 4EY8A 1KMNA 3FKSD 3OTHA 4E0BA 5IX8A 1ISRA 3AXTA 1G5TA 1ZJJA 5LZ9A 1VKNA 3MMSA 3DVQX 1HGXA 4H7IA 3ZWPA 4ZODA 1R0WA 3EAGA 2AFHB 4WCFB 3GG2A 2UUPA 3CRVA 3KPUA 2GESA 1W4ZA 3KT8A 3MS7A 2J9RA 4MVJM 1U3VA 2XPCA 5JEDA 2UZ4A 1VECA 2OGSA 1P60A 4OMDA 5CB4F 3ANLA 3CH6A 3CYFA 5K5EA 2C7RA 2YBDA 4JGIA 3DWGA 3N3BC 5DJ5A 2JVIA 1T0HB 4JI7B 2P9FA 1NF3A 3ZU6A 1V4NA 2ILTA 3DKRA 3KQPA 5E7QA 4EY5A 5K05A 1G4HA 3CC8A 1FYDA 3GWZA 3NHWA 4JA2A 4G1VA 4YDSA 1E1QD 2C1EA 3H1GA 2LDXA 3FHTA 2ZWMA 1LZKA 2A9JA 4E14A 1EE2A 3JRWA 2YN0A 1X3SA 4JCCA 4TRJA 1UFOA 1Q2XA 4ZVNA 1LU9A 3H2JA 4GLOA 2QL6A 1RPNA 5K0NA 1Z35A 2B3DA 3DE0X 5JD6A 2FMXA 3VKWA 5DDIP 4UOEA 3H5IA 2OD7A 4ER7A 5EHIA 5EHGA 3OJOA 2M2IA 3IHWA 3JZAA 4ZQGA 3G2OA 1IUKA 2GFQA 3O03A 4ZVSA 3PPXA 3OIWA 4JBXA 5IWAB 3AP2A 1WMEA 4I50A 4EP1A 1MOSA 3V1KA 3IAS1 1CG6A 1FK8A 3JQ8A 4WLOA 5E1BA 3GELA 4Z51A 5K0BA 5EJ8A 1VBKA 2UYHA 5F9FA 3KJFA 2H85A 4EKGA 3H2BA 4AJJA 3DUFA 4DJJA 1DADA 2QVLA 5LLTA 2OQ2A 5I51A 4YRMA 1O4VA 2GJKA 1FRNA 3F5QA 8OHMA 2P5UA 5AI6A 5AVXA 1Y6RA 4XGRA 3QUSA 3I8OA 3SFZA 5CB0A 2AYZA 2FUKA 2PX3A 3I1IA 1I9CA 3JYOA 3QM1A 1I6MA 1OTHA 1NR1A 1ZW1A 3JQ9C 3OUTA 4TSFD 1ZM2A 2HBZA 2XXBA 3UJ3X 5HUJA 4RESA 1PDWA 1ZD3A 1BS1A 4HAUA 4D8XA 3B6EA 2B8JA 4C7KA 5SICE 2CLMB 4QLAA 4KQ1A 2DRIA 1XA4A 2BMEA 4L5BA 4C0KA 2L69A 3HYTA 4F4HA 2EDAA 1Y1KE 1QG4A 3ADPA 4J29A 4AQYB 1KDYA 1KSFX 3WL6A 2PGNA 3UWOA 2PR7A 1C8BA 1F06A 2O7NA 2PVPA 3CZ9A 4E2XA 4X85A 5ADHA 5KZMB 1RQXA 1Z0IA 3TQTA 2E4YA 1VB3A 2JBAA 2PX0A 2PNFA 2V4UA 1CE8A 2PWZA 3EIOA 4MAFA 4DXDA 4K9SA 4JKYA 2CMDA 2ODBA 1JR3E 1VHJA 2J4CA 4JH0A 3QLJA 4LJLA 5FUXA 5BWLA 3FAZA 5F4ZA 3H4TA 1H8ED 4U1RA 2CLKB 3HBLA 3VMFA 3OU6A 3I01M 4MVCA 1GPJA 2Q7DA 2QNIA 1YS7A 3C3YA 3NT5A 1V1RB 5EOVA 3SXUA 4EYGA 1OYOA 2CSUA 3N2GB 4FI3C 4BWVA 4BVEA 2WVAA 4R7GA 2IPOA 4B80A 1ZIDA 3K1AB 2XWPA 1ZD1A 1FDSA 1KI3A 1VXRA 3ST7A 4HMQA 4Q00A 4MVJA 3C74A 2DG2A 3LQFA 4PVDA 1Z56C 3G82C 4BNDB 5K0CA 1ZUWA 2QBYA 4I1PA 1NPTO 3OM0A 1CUAA 2ID8A 4YMTA 3ICEA 5EE5B 3ECAA 3NX4A 4OUDA 1GGFA 1T25A 1VG9B 3K0SA 5CPFA 3Q3EA 4RHXA 1WKVA 2PA0A 3AF5A 4Y7CA 4P4UA 3ED5A 4DQXA 2PLNA 3LHIA 1SG0A 2QI9F 4KQIA 4RLHA 3KYIB 2QS9A 1X14A 1NQ5A 2E85A 3KKPA 1XCPA 1HM5A 4B4WA 9GPBA 2P0AA 3RS3A 3CX4A 1ZUD1 3WL5A 2DHCA 4YP0A 2W83A 4EF4A 2NVUA 2VSYA 4YMWA 2BAGA 2RGNC 3L4JA 3HVUA 1C1DB 1NNI1 3M81A 1BX3A 5IWCA 1CY7A 4RTKA 1J7JA 3QQ5A 1MO6A 1KF0A 2BGTA 5SYNA 3VPGA 1T8TA 2WYHA 2ZYHA 4FR0A 4TKUA 4RS3A 4RHUA 1IPHA 1H2RS 3Q1LA 3FOFC 3FUVA 3W90A 4LMPA 1YL5A 4YT8A 5JRJA 4Q48A 1SEVA 2NSHA 3EVNA 4QOHA 1AKQA 2EDCA 5AJXA 1VRVA 3IKTA 3Q10A 4ND1A 4NPAA 2OM6A 3IKVA 5CEFA 3QW4B 2JHFA 5BSEA 5LZ7A 2DB3A 3P52A 1PHPA 2ZVJA 4PZDA 4CDGA 1OA1A 1Y4AE 2R8ZA 4NG4A 3ELUA 1Z22A 2P2GA 1QNLA 3OKPA 1TAQA 1TIPA 4CT5A 3H65A 1XMSA 3S8YA 5H82A 4JWTA 2PTGA 3JQ9A 2C5GA 4E33A 1BE6A 2ETVA 5C53B 2IS4A 1XR3A 1T15A 4BQFA 2VUUA 1SVIA 1TVCA 3N1UA 2IUUA 3I4FA 2V74B 1ENZA 1Y5LA 1YHYA 2XWSA 3FG9A 1M2NA 3VKFA 1Z62A 4MQMA 1NONA 3M3HA 1H3FA 4HFMA 3PHLA 4PPQA 4Z0PA 4AJIA 4OU4A 5AI9A 3CZ4A 1EQAA 5TQJA 4KDEA 5JNLA 2QJWA 2QQGA 3AHHA 3P2KA 1LI5A 3GDGA 3STVA 2IYPA 1YSCA 2O59A 2C2YA 3VZRA 1JIQA 1OV6A 3ZDDA 3EZFA 3AM4A 4HXGA 3TNLA 1D4OA 4WGFA 5F33A 2CVOA 2PJUA 1PI3A 2PZAA 3A9VA 3DYIA 3FFTA 3LVBA 4JA0A 1N1EA 2MR6A 4CKWA 3ZY6A 3KYDB 2R8XA 4JB3A 1WJGA 3EZ9A 3HI4A 4KVGA 1T1IA 2Q9UA 3OE4A 1QP7A 3M6LA 2CVFA 1FOEB 2RJOA 4U2EA 1U3DA 5JPIA 5EJ2A 4YJ2A 2FPIA 3W9BA 1HG1A 2FN9A 3ZN2A 2OMKA 4BMCA 3ZV3A 2NUTB 1XRPA 3RV3A 4LSGA 4GLLA 3GGOA 4FHGA 4RSRA 3A1EA 5SZHB 3VO8A 1P17A 3IBYA 3SX0A 1YZ3A 4CEIA 3ZX5A 2FW0A 2JJYA 3EGXA 1REQB 1JHQA 1OLSB 1SUIA 2FWAA 4F9EA 2E55A 3E9MA 3HP7A 1S01A 3LZDA 5CYPA 3T15A 5BYJA 2NXJA 4QOSA 4B31A 3DL0A 4N5IX 3PCTA 3P4YA 3DBHA 2CT8A 4HXEB 1P1JA 3QPVA 5F2OA 4P5EA 2GEDA 3WSVA 1KOJA 5LR6A 3OE7D 3S0JA 1P1IA 1PDOA 5CEJA 3U1VA 4B2PA 5JANA 3NNNA 1FJXA 2X5KO 1EP3B 2ZIUB 1LPOA 3D59A 1MKYA 4M7RA 2B5VA 4NE9A 4A0QA 4DUGA 2O52A 2QYOA 5A2GA 1SM4A 2GF2A 4C0BA 4E7PA 4KYTA 2BEKA 1JA9A 1CNFA 3N8NA 4OJMX 3SR3A 3GAZA 1KSGA 3E18A 2EARA 4YRRA 4HFRA 5LFAA 4D9BA 4FFBB 2BELA 2CL6X 2X6QA 3RHTA 3ZGLA 4AP9A 3NYIA 13PKA 1FRQA 3H5VA 3T4PA 2GZ3A 4RPHA 3HJHA 4WLUA 4K26A 4OY3A 2QGNA 1XYGA 2J67A 2ZT7A 5G40A 3GJ4A 2L42A 4OHUA 4GBJA 3Q3HA 3WIDA 2YXNA 5AM2A 1AQNA 1X1BA 3TRHA 4PQFA 3ROTA 1EFVA 1YAHA 3IDOA 1ID1A 1MEOA 1SHUX 2D1FA 2GHTA 3CO5A 4ZQHA 4HLQB 5EXPA 2PH1A 4LW8A 1W1IA 4Z3OA 3V9PA 4AKEA 1HE4A 3ACCA 4LISA 4YRSA 1OYYA 2X4IA 3D2LA 3R3ZA 1UT8A 5FKJA 5EPUA 4M3NA 1B43A 5TR9A 1E9EA 3F3MA 1IAVA 1UAYA 2J46A 3EIXA 4I14A 1THZA 5L40A 4ODIA 3SCZA 1YUNA 2QIPA 2Q2NA 1DWOA 2WVHA 2GR9A 5F77A 2D54A 1WB4A 3SSOA 2UUAB 1HE1C 1T9AA 5KB3A 2YIMA 1IQUA 5FJJA 5TS2A 1JZTA 2JD0A 3FUUA 1B16A 1G0NA 4M9UA 5T5QA 1I4TD 2GZDA 3LHSA 3TOVA 1C0IA 1Z2PX 4PCUA 3VRHA 1GT91 1VLLA 2DCUA 4COKA 4HADA 5KMGA 3KSBC 3WLNA 1MHPA 3ACBA 6REQB 3T5GA 2G06A 1OT3A 5I8ZA 5BNTA 2D1RA 4WHMA 1M8GA 3GAMA 1LLCA 3EZXA 2DUWA 5KYKA 3NHMA 2QMEA 4GL4A 2I33A 1EK6A 1C9YA 4HNAA 4HQFA 4X95A 5C1DA 2WV9A 1FFEA 3HV2A 1N2CE 2BGIA 1X80B 3WDMA 4BMDA 2XUDA 3PHCA 3ILHA 3KUXA 5M7EA 2CXHA 2QW8A 3WTBA 1Y3HA 1FX1A 3HACA 3ZQKA 1X6VA 1EXNA 3B3GA 5KTOA 4PLVA 3C3WA 3AHGA 1IBLB 3FDZB 5F9HA 5KINB 1MZPA 3I6ZA 1KQ3A 4RHFA 3GJRA 4GBED 3J80A 4A2CA 5FAXA 4KR7A 2M6RA 5LYYA 3NGXA 4DM4A 3UUGA 4BLQA 1DFGA 2XRFA 3N2EA 4QUGA 5KC8A 1E2QA 1SIOA 5JSYA 5H70A 2R00A 5F3RA 5KJ6A 1E2KA 3AESA 3CF6R 3RVOA 3F71A 1JILA 3G2KA 3AY6A 3GO4A 4XR9A 1P2TA 3HN2A 5GM2A 4NU5A 2AA3A 3GDWA 5D3MB 1NG1A 2H2WA 4B4DA 1CS0B 2ES4A 4PYIA 1GR1A 1JG6A 2WZCA 1SKQA 2FK7A 3GARA 4KXMA 3JYPA 3GMDA 2GERA 2VT2A 5IG2A 1X9GA 5ALSA 4HEQA 3C3MA 4UAGA 1RKVA 4IWNA 1VQ1A 4BX2A 4HKTA 1M5UA 4IEEA 3NHBA 4TXLA 1ZVVA 1UPUA 4LQ4A 1E2FA 3LQ1A 3O31A 4Z3KA 4MH0R 2Q99A 4W5QA 2ZTHA 3AGPA 3K6JA 3D6FA 5FRDA 2WWVD 1KDOA 2PBFA 4NCKA 4EBBA 3W5JA 3VC1A 2P2CA 1E98A 1JDUA 4L4ZA 1BWPA 1J5PA 2B83A 1DUIA 3UAXA 4B3SB 2P9CA 2H4HA 2YVKA 1MO2A 2K2WA 3KVRA 3SICE 2XB9A 3GJ8A 3HQ4O 4ZDKA 4H6XA 3VU9B 3GDFA 2ODWA 4UD6A 4UXIA 5C1BA 5EZYB 3DDUA 1U0OC 1KZ1A 2C5EA 3HWWA 3QVVA 5LMUB 5CXUA 4O4JA 1Y9JA 5B36A 5J4YA 1NW8A 2CNLA 1C8VB 3LUCA 4KQMA 4V38A 3TTWA 2AW3A 2YWEA 2ZB2A 4UUOA 5EWLA 5EJEA 1TUGA 1UDBA 3H2ZA 4GOKA 4DCNA 4ESEA 1SH7A 4G63A 1PEYA 3PUXA 4L5JA 4TV8F 3W1WA 1KJWA 5AKGA 1WUYA 4HPJB 2F8MA 4M9QA 4KXFB 1YDHA 1SC9A 3KE9A 4WXHA 2J7KA 1Z6PA 4WJZA 5FBZA 1X1SA 3K70C 4G1CA 3UAZA 4PRZA 3H9BA 4XRGA 1Q7EA 4XDGA 1UAGA 2YCLA 1PQPA 5E0KB 3J81A 5MN4A 5DNDA 4FFWA 1NY5A 1T1RA 2ZB3A 1DQNA 5M34A 1Z4QA 3KPWA 2FP3A 4JYCA 3UV7A 5LP6B 3HXLA 4YAFA 3TW8B 3OEWA 3WFJA 2G9VA 2JI8A 2O4UX 4J03A 5EP3A 1QYRA 2AE2A 3MM4A 1T6YA 4NBKA 5FL7D 4DMHA 4JYBA 5HCNA 4XARA 2QAJA 3NEYA 2WDZA 2V97A 3O91A 3RD5A 5BUQA 1R9MA 1H0RA 5LLDA 1VRCA 1XZDA 2G77B 1SGWA 2AH5A 4EGFA 1W76A 1PJCA 2IHKA 1ZGGA 2MCFA 3EEOA 2A9VA 1BX1A 2CYAA 4OYRA 4YGXB 3X43A 3EEBA 3VZDA 4ACBA 4RPCA 4ZVLA 1ECLA 3THSA 3IJ5A 3P5BA 2QW1A 3Q3VA 5KHLB 3D6AA 1XWFA 2E4UA 4I81A 1GQQA 3OAAD 4L0DA 1GSAA 4RVNA 3STYA 4MRSA 5HOEA 1LI4A 1KOFA 2Y05A 1P3DA 4X54A 3TI9A 3U7QB 4A8HA 1L4UA 2O0MA 5EZSA 3T35A 5L4SA 1OH8A 3C7TA 3W8DA 1AM4D 1SUAA 1QAQA 2ZXUA 2GBCA 2X2OA 2X19A 3FROA 5EIOA 2J31A 5JSZA 1PW7A 1DRVA 4I4TF 3KT0A 1L4MA 4O5OA 1MXFA 1XZBA 4DNOA 5FUMA 3C1TA 1PJTA 3AEKA 3VR5A 1C7JA 1SOVA 4JFAA 2AFVA 4JUDX 4W63A 1SPXA 4WFIA 5A4FS 1TMOA 4KXLA 3SFTA 3JCZA 4NCBA 4HYTA 4NZ9A 1C3JA 1WA5A 4M7WA 1ZMBA 1XCOA 16PKA 2Y1CA 2YMLA 3E03A 5ALEA 1VLVA 3BXXA 4URHA 1T4GA 1IZ7A 2IYZA 2V45A 4RE6A 2AXNA 2GTHA 4NMLA 4B1FA 5C8XA 1NV9A 2CHFA 3E23A 1NRJB 3H9GA 1RWOA 1IN1A 3KUUA 3GGSA 1XTKA 1HURA 1UKCA 2HJRA 4AG3A 1USWA 3PQ7A 4MVJE 1CUYA 5CJPA 1GLNA 2D2XA 4PZUA 3T5TA 4Y6GB 5J43A 4A27A 4ZT4A 2ISQA 4Z8XA 2CXTA 1FSFA 5ESDA 3C41J 1KZHA 1OLXA 4KEAA 5A3QA 1AQUA 5KQMA 4X66B 2UYCA 3UMRA 2P6RA 3R3UA 5A7GA 2WKRA 3VVCA 1G63A 3FPSA 1ZY2A 1S5PA 3FCXA 2NUAA 2DM6A 4F96A 5JJ5A 4LRUA 3RGWS 3L1HA 1DPFA 2O0LA 1CR4A 2NZWA 1Z36A 4O4LB 2DBVO 5E9QA 2HBYA 3RVPA 5IW8A 4ZCRA 1KFCB 5CD9A 1CUWA 3H6GA 2I34A 2O2GA 4CHTA 2VLBA 3OCVA 3PFKA 3QFSA 5ED4A 4G85A 1QVAA 2VHVA 3SFVA 3V7WA 1SAYA 3ADBA 4HS9A 2XQKA 1IZ8A 1SQGA 3E3NA 5F51A 3VAAA 1GCIA 2EJBA 4MA5A 5L3RA 3OOWA 3TB6A 3B48A 3JQRA 4MUHA 3DDCA 5G53C 2FFQA 4YRQA 3V00A 1ZNYA 4MPDA 4YJFB 4JENA 4UUQA 5FTNA 3RKRA 3MD9A 4I5FA 1QAOA 3HY4A 2VT6A 1ZXLA 2RGCA 2NNLD 2ZRNA 3MN1A 1Q1AA 2W00A 4UVGA 4Y2HA 3WLOA 4EELA 5L4NA 3IQEA 4OUDB 2BTEA 3WISA 2X76A 4NDZA 1JLLA 1QXSA 1FFDA 1BKYA 1YA4A 2AG0A 5I6DA 3A3YA 1KYIA 1TZMA 3P0FA 1H2AS 3ET4A 2VEDA 2X58A 3KKEA 3KYDA 2XVMA 4JIGA 4P1ZA 2VF4X 4OHZA 1RAHA 4P82A 3RYCB 1JKFA 3IMEA 5EERA 1V5EA 4WRRA 4C4PA 1Y1SA 1SKUA 2IYEA 5L6LB 1B23P 4BQRA 1GYQA 3OZSA 4MUJA 1OZGA 4EG0A 2R86A 3BN3A 1P5HA 5K01A 3NW9A 5IKEA 3DOCA 4OGLA 2PRSA 1AURA 1I5RA 2AYXA 1QK5A 3DQQA 2KJQA 2AK3A 3B36A 1JAZA 2WWIA 2ZQ5A 3MMXA 3GGCA 2K5UA 4IF4A 4RANA 5JXGA 2P6OA 4TM8A 3SMVA 1Y3AA 1RXYA 2PKCA 1W88A 3WJ1A 1QIFA 2OO5C 3WMGA 1IXSB 1C7EA 3AHDA 2QTGA 4CTJA 3AVWA 4ZZ3A 1MJ5A 2O5VA 1ISIA 3JRXA 2B4TO 1FYVA 1O2DA 4KKXB 3PGA1 1O0CA 2VK4A 3PQ3A 1ZI6A 2IXTA 1PKXA 3PXEA 2WJWA 4FONA 3TQFA 3WGJA 3ZWBA 4P0PB 4KTTE 5COBA 2YW2A 1FSZA 4D9KA 5BN4A 1YZYA 2VUHB 1BKDR 3ZDYB 3EUWA 1WXXA 1L7QA 1KY4A 3UMGA 5AQ1A 5ARDA 1J2UA 1KU0A 5HF8A 2PWBA 1DQPA 2GYYA 4ZAGA 5KDLA 5ALGA 3H1BA 4B32A 1K63A 2WSIA 2C4TA 4R9SA 3TN7A 2QRGA 2WTXA 1PG2A 5HRUA 1PJSA 5EC8A 2H48A 4DCGA