1NVKA

T4 phage bgt in complex with udp and a mn2+ ion at 1.8 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
351
structure length
351
Chain Sequence
MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the T4 phage beta-glucosyltransferase and the D100A mutant in complex with UDP-glucose: glucose binding and identification of the catalytic base for a direct displacement mechanism
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase
molecule keywords DNA beta-glucosyltransferase
total genus 128
structure length 351
sequence length 351
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1nvkA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1nvkA02
1JEJA 2X0FA 1FTWA 1JIVA 4MHSA 1GPYA 5JTTA 4RELA 5JTUA 1WW3A 3OKAA 2ACVA 1B4DA 3EBPA 5TMBA 2QN8A 3CUUA 3TSAA 3VDNB 2GM9A 1NLMA 3T7DA 1JG7A 3WC4A 3BCSA 1SXPA 2QRPA 2QNBA 3DD1A 3S28A 8GPBA 1AHPA 1NOJA 1NZFA 5HXAA 2QN2A 4MRAA 1NOIA 2QN1A 1QKJA 3L7DA 4BQFA 1J39A 2PYIA 4RENA 2PQ6A 1P4HA 1AXRA 2JLBA 1Y6FA 2IUYA 4MI9A 3ZCUA 3D1JA 1NOKA 2F3QA 5DLDA 1XC7A 2BGTA 3MS7A 1FS4A 2XA9A 3RHZA 2PRIA 4X6LA 3NB0A 2X0EA 4YUAA 4N9WA 3SYRA 2VCEA 5TMDA 3G2LA 4PQGA 1RZUA 2XGOA 1FU4A 3T3IA 4X7RA 1Y6GA 3G2KA 3HBNA 2R66A 3BEOA 3OTIA 4N39A 2QLLA 1QM5A 3CX4A 6GPBA 3T3HA 3OKCA 2BGUA 1P2DA 4CTOA 1M5RA 3CUYA 3C4QA 3GPBA 4RIEA 2R60A 4AMBA 1L6IA 3OY2A 3COPA 3MTAA 1V4VA 3O3CA 4N3AA 3ZCVA 3Q3IA 2GJ4A 2IEIA 3L79A 2AW3A 3MRXA 2IEGA 1K08A 3MS2A 2FF5A 1P29A 1WUTA 3D0QA 1ABBA 3MRTA 4XI9A 2ZB2A 4FKZA 1GGNA 3CEJA 2AZDA 2IYFA 3CEMA 3T3EA 2XCUA 1WUYA 4AMGA 1JG6A 5TMEA 3IA7A 1LWNA 3BCRA 2KS6A 5GPBA 4GPBA 3L7BA 4G2TA 4KQ2A 1K06A 4KQ1A 4N3CA 1F0KA 1L7XA 3T3DA 1UQUA 2QRMA 3BD7A 2PRJA 1KTIA 1JIXA 3MT7A 1C8KA 4MI3A 4EL0A 3NC4A 4QLBA 2AMVA 3BDAA 1XL1A 2VSYA 3VUFA 1Z62A 1Y8ZA 3TOVA 2XGMA 1XKXA 1H5UA 2VCHA 1SXQA 2VSNA 4GZ6A 3HBMA 3AMVA 4CTNA 3MRVA 2HY7A 2QLNA 5DU2A 3UYLA 3NP7A 9GPBA 3S29A 2VG8A 3S27A 2GPAA 4N3BA 1PYGA 4GYWA 2GPBA 3MTDA 2GEKA 2BISA 2X6QA 3L7AA 2R4TA 4RIFA 2X0DA 1P2BA 5D00A 3VDMA 1IIRA 3CV3A 4BQIA 4KQMA 2QN7A 1BX3A 4Z5XA 4NESA 2SKDA 3G2HA 2IV7A 1F6DA 1GZ5A 3H4IA 2WTXA 1JIUA 3T3GA 1XL0A 3NP9A 4RIGA 5TVGA 1LWOA 2C1XA 3G2IA 2FFRA 3H4TA 3HBFA 2ACWA 3E3LA 1WV1A 2X6RA 2JJMA 1L5SA 2G9VA 1YGPA 2QRQA 3DDWA 3QKWA 4RIIA 4RIHA 4XIFA 4AY6A 2IW1A 1C8LA 1RRVA 1FA9A 4W6QA 4EKYA 4X7PA 4M7PA 1EM6A 2XMPA 3MBOA 2F3UA 3E3NA 3MT9A 4AY5A 4YI3A 3S2UA 3NPAA 4HWGA 4WACA 3ZCTA 2QN3A 2ATIA 2H1FA 2XCIA 4EL5A 3BD6A 4CDRA 3HBJA 2GPNA 3OT5A 5ENZA 1HLFA 1L5QA 4CTMA 3G2JA 5IKPA 4BFCA 4GYYA 3GUHA 4EKEA 1C3JA 5IKOA 5C1DA 3NCHA 1IXYA 1WW2A 2F9FA 4M83A 4YI5A 4MICA 4F97A 1O6CA 1Z6QA 1PN3A 3OY7A 3G2NA 1XV5A 1P4GA 1L5RA 3DDSA 1P4JA 2H1HA 2C9ZA 3DZCA 5LQDA 3BCUA 4LEIA 3D0RA 2SKCA 2G9RA 4M60A 1E1YA 1GG8A 3IAAA 3L01A 4X7MA 3VUEA 2OFFA 3PE4A 4F9FA 3MQFA 4REMA 2Q6VA 3ZCRA 1WV0A 2QN9A 2AV6A 2P6PA 3MSCA 1PSWA 2O6LA 3SYMA 3CUVA 3QHPA 1UZUA 5BNWA 2XA2A 3E3OA 3EBOA 2F3SA 3OTGA 4L22A 3MT8A 3PE3A 2FETA 2QRHA 4MI6A 4MHOA 2GEJA 1XOIA 3ZCQA 3BD8A 5D01A 2C4MA 2IV3A 3ZCSA 4EJ2A 1FU8A 2IYAA 1Z6PA 1NVKA 3RT1A 3WAGA 1L5WA 2F3PA 4RBNA 1FTYA 4WADA 1L5VA 3Q3EA 2BFWA 3MS4A 1GPAA 1RZVA 2G9UA 4F96A 1EXVA 1Z8DA 1E4OA 1FTQA 1GPBA 2R4UA 2G9QA 3T5TA 3MTBA 3OTHA 1VGVA 3UYKA 2ASVA 2C1ZA 4NEQA 2SKEA 5I45A 1P2GA 3FROA 1YA6A 3Q3HA 7GPBA 1FU7A 4WHMA 1UQTA 3WADA 3CEHA 4GZ5A 4AN4A 2PYDA 2R68A 2ECPA 2GT1A 4FZRA 1A8IA 2XGSA 4HLNA 3ZCPA 3RSZA 1NZDA 3NAZA 3CUWA 1GFZA 4NC9A 2XA1A 2QZSA 2JZCA 2QRGA 1C50A 1PNVA 4BQEA 4GZ3A 5DXFA 3CUTA 4LDPA 3TAXA 2YJNA 2QLMA 3C48A 3L7CA 3OKPA 1FC0A 3C4VA 3RSCA 3S0JA
chains in the Genus database with same CATH superfamily
1ENPA 5JVDB 4CM7A 1P3DA 1MC5A 2OBYA 3UKJA 3WIBA 1XNRB 4B2LA 2JAQA 5TQ0B 5BVGB 1B76A 1YTUA 1J21A 3OI7A 3HU1A 3T15A 4B6QA 3VDQA 4P4SA 3OMXA 1Y1TA 2WJ3A 4TGLA 2RIPA 2WKSA 4U02A 3C3KA 4OHZA 4CM8A 1M2JA 4NU8X 1P17A 5AD1A 1U98A 2CHFA 2PZFA 2W2TA 1D04A 4J6FA 1N2IA 2PTHA 4AJ9A 4CMBA 1KK3A 2EKDA 3MCTA 3IAXA 5LOVB 4M1SA 3AERB 3DTNA 4U7WA 1YR6A 2PO7A 2G76A 4NONA 1HBJA 4I5DA 4UHFA 1ZP6A 3TLJA 3FDZB 3WNZA 1O97D 2FGJA 4MIYA 3E5NA 3UMVA 2QRPA 3FUUA 1P0IA 3KIPA 4LXYA 1ZWLA 3FA2A 4K6GA 4RETA 5DWQA 3AVTA 2JAWA 4K3UA 5IASA 2ORED 2V65A 4HVAA 1BHQ1 4UNIA 1BVHA 2O1SA 3IUNA 1H23A 4HF7A 1OVGA 2YYSA 2E4ZA 1RWPA 5K8LA 1PI3A 1NAHA 2QUIA 3V2UA 1FFHA 4YT4A 3IURA 3U26A 3WZLA 1KZYC 5FOUA 3EIFA 4M9CA 3KEGA 3E7WA 1VE1A 1NT2A 1TYEB 1G6HA 3Q6IA 3ECAA 4IWNA 2ZRKA 4KAJA 5IVIA 4BX9A 3LHIA 5F3WB 2UXCB 5L51A 3O1JC 1IDN1 4X97A 3KQSA 5I3CA 2H2AA 3KVVA 4DB4A 5KNDA 4GS5A 4ZIRA 3KKLA 1RYBA 4R8SA 4H3HB 3BE4A 3IBFA 2PKXA 3CLHA 4RMIA 4HS9A 4JA2A 2XWPA 4WBXC 1NWHA 4OUDB 4E15A 2OHHA 2IWRA 1GQFA 1NBAA 5CBPA 3R7NA 1XEFA 4FIDA 1E61A 3L41A 4GPAA 2HIGA 4J1TC 4MJXA 1YZLA 1GUDA 2OAEA 3JATB 3KQWA 1JJIA 1ZNXA 4FW8A 4QYIB 3TRHA 4K05A 5C7IO 1XCPA 4ERXA 1EINA 4IEEA 2R2GA 4EM6A 4DLWA 4R9VA 2GXAA 2M6LA 2PVPA 1RWMA 2Q1XA 2ZTMA 4OXYA 1P7VA 2ZR0A 3HE3A 1G8AA 1XYGA 5HM8A 1Z29A 3L40A 1Y6GA 2WABA 5BYAA 3X1WA 5IJ9A 4B17A 4LNHA 1DRVA 3RR2A 4YDSA 3KOUA 4TQGA 3F1KA 2C8KA 3NM4A 4QDZA 2EW1A 2GK6A 5KYKA 1CBUA 5EIWA 4P22A 4QGBA 2AFIB 3M9WA 3RROA 4BRWA 2QRVB 4CV0A 1DX9A 1GKUB 2F3TA 1NM5A 2FPPB 4XGRA 3OKCA 3U3JA 2J7PD 1YIDA 2QJWA 1WP4A 1MP0A 4FINA 1GQRA 4FNAA 4WZ6A 4JZKA 3W1VA 4CM5A 5FKJA 1OZ0A 2QT1A 3EIWA 4Z0TA 3T7CA 3EIQA 2NWQA 3OQHA 4KPYA 2Z5GA 1DPGA 2CV2A 2QVGA 1KIFA 5HR5A 1E5XA 4LJSA 3RSFA 1J0BA 3AO0B 1VKNA 4CRWB 2F9LA 2ZQZA 1C2TA 2AX4A 1RVV1 4B3JA 5FJIA 2EP8A 1RJ9A 1V4VA 1IWBB 3KPVA 3O3CA 3PRHA 4FXPA 3A32A 3AI7A 4PHCA 4ZQEA 1QWSA 3TNJA 1E0SA 1OLXB 4UZEA 1Q0ZA 3KNZA 1BCRA 3LC0A 4QWWA 2BKUA 4KLAA 3SQOA 4L51A 2OC4A 5HMMA 3W04A 4CKXA 2ZW9A 4PINA 4GR4A 3PC6A 3SK0A 1MDFA 1NMQA 4UM5A 2IEGA 4XGIA 3JQGA 5JHHB 4LVCA 2O2IA 1GGVA 1DP4A 4ZI5A 1BMFD 3EVCA 1RKVA 4DMMA 1N9GA 2ISQA 2O7VA 4PYOA 4NY1A 3T3EA 3IO5A 1IJKA 1PUXA 4RZQA 4OEHA 2FEOA 3IAS6 4EEXA 5CFOA 5C2JB 4GZMA 3KLMX 3FZQA 1YFKA 2JK0A 4KXNA 4O2LA 1UQRA 5TMEA 3SFVA 4Q7LA 4X3PA 7ADHA 1PJ8A 1FF9A 4XR4A 3USZA 3WGGA 1G3MA 2F1HA 4TQAA 5DGCA 1EFVB 2PU7A 1SIUA 4UHHA 4YP6A 3VBCA 4RF2A 1P9LA 4P80A 3ZGLA 1DKNA 2AOUA 2XVYA 4BJ3A 5BOSB 1GNPA 1EX7A 2Q45A 1G5FA 4JB2A 4Q1DA 2AFIE 2ZT8A 4YRLA 1KYYA 1LJLA 1Y6JA 3D8TA 1V43A 1U1EA 2QVZX 2GILA 3VYVA 1C30A 3BULA 4EZBA 2OO7A 4AJKA 2IS1A 3G23A 1VBNA 3VR1A 3AR5A 4IDDA 4HXYA 2IHTA 3AIKA 3K2EA 2AG6A 2D5CA 2Q99A 5C7OO 2DVMA 1IMJA 4Q7QA 3UK2A 3W06A 5JD5A 3DMDA 3L9WA 1X7GA 3GDGA 4DM4A 1MAUA 1LBHA 1ULZA 4K03A 2PXHA 5H5JA 1YMVA 1P19A 4FDVA 3T94A 4RULA 4TM8A 3CG0A 3QHAA 3IOEA 2JLAA 4XA8A 1N36B 4LOHA 1ORWA 1VPTA 4NJEA 3VA7A 1U5AA 3U3RA 5DRYA 1R5BA 4RTPA 1SBZA 1X77A 3TLBA 4M1KA 3KZKA 1UOQA 2Z57A 4KZKA 2QQ0A 4FT4A 4B8WA 5KSZA 1E6UA 2FJ0A 4IUYA 5J2TA 3PXDA 2HCJB 3RHFA 1IMOA 3E18A 5A5FA 3KYDB 4FCWA 2WHPB 5AKXA 2CJXA 3I8XA 4JNCA 4OYHA 3WBFA 4TRMA 2HIHA 5JSYA 5AI5A 5GJBA 1W4CA 1L4KA 3KYDA 4W7SA 5AVUA 2P2CA 5FYDA 1DAFA 1UBJS 2GJ8A 1JG4A 4F7WA 2NXWA 1X15A 2J7KA 2BMDA 1M9NA 1Q0RA 1V6AA 5LB2A 1XTRA 4C7JA 4LCJA 1ZXXA 1PZXA 5EIAA 2OAP1 2Y93A 1NMXA 1WQ3A 4EQZA 3F6BX 2P9HA 3EWNA 3D8UA 1HQYE 1OCEA 1WZNA 1ZD2P 4PZZA 3TVYA 5D00A 4IOMA 1Y7PA 5REQB 3IAFA 1QYDA 1E5QA 1KPIA 4HDOB 4UXHA 3E1KA 4EHJA 1BX3A 1SZCA 2FMXA 2OR3A 4NH0A 4EW1A 2JA1A 1P9WA 4R1TA 1K8ZB 1PJCA 2PQMA 1U0GA 2WWXA 2UUCB 3QFCA 2N1MA 2D7CA 1SUWA 1F0PA 3HFSA 4OREX 4WQMA 4PC6A 5FWDA 5JYBA 3HSKA 4XJXA 3T54A 3T06B 3UWPA 2X6TA 3M7IA 2M98A 4O0MA 2FFRA 2GF2A 3FCAA 5IPFA 5I47A 1Y4AE 4PR0A 4I4CA 1AUVA 4RVNA 3UWOA 1QCYA 3RC1A 4JYBA 2G70A 1I0LA 3VZBA 4IIJA 3O8OB 2GHIA 3GGPA 1Q7CA 4COOA 2E89A 3GD5A 3K35A 4PYMA 5ULLA 1GHTA 4B83A 3S8EA 1U6JA 3R5TA 2OKCA 3ENQA 2V3WA 2IIQA 3MCUA 5D8DA 2BGKA 2DHRA 3KTFA 4ZO6A 3RFVA 2XDYA 1Z47A 4R1LA 2RJ3A 1CJKC 4EKYA 2ZSUA 3ZGVA 4BBPA 4I3HA 3S6JA 1LFDB 5DLYA 2WTAA 2QMUA 2ZRJA 2QTFA 3H4VA 3FZEA 5BYBA 1II8A 4RZXA 3IDSA 2G4VA 2IVZA 2ROQA 1RHQA 4EPTA 4YI3A 1Z2EA 3ZXUB 1ORRA 4K9QA 3TF5A 2W2LD 3KE8A 3Q15C 3DKPA 3OETA 1L4UA 4R69A 2FQ1A 4YJDA 5AI6A 3OX3A 3EXAA 3OC0A 1EX6A 3HDVA 1LPAB 4IDOA 1YZHA 1D2NA 2C54A 2OECA 2PS3A 1ULHA 5TR9A 4NNPA 2PU5A 1C7JA 2R97A 4QOHA 4EG5A 2H1OA 5EIOA 1KBQA 1OLXA 3EZFA 1T0HB 4IMRA 1SVLA 4KXMA 1MXFA 2ZRAA 4I08A 1HFKA 1O97C 1P9NA 2Y05A 3WYNA 2RK6A 3VX4A 3WLKX 3TPZA 4HYEA 1NDQA 4MYSA 3STYA 4WJLA 4YJ2A 4H16A 1IAQA 5DFAA 2XT6A 4TTPA 1GRRA 2ZOSA 3I2JA 3F4LA 1AB6A 1UZMA 3BE5A 3QOFA 4MV5A 4OHVA 4I1OA 4D82A 2QWXA 1CETA 4ENPA 3ZLVA 4HGOA 3NYRA 2Z8XA 4I9GA 3B1KA 2W6QA 3HEAA 1SKUA 4P2BA 4GP9A 2VXCA 2UUBB 1UC4B 1VLJA 2IU0A 3GNSA 2E55A 4HGZA 3AXTA 4M1QA 5TPWA 4ESHA 4GPIB 2BEVB 2ZVDA 2HPAA 4FX2A 4BX0A 5AHOA 4G4JA 3PBKA 2BKVA 4R0VA 4MDEA 1GTG1 4PC2A 1HMYA 3UA4A 2JJ2D 4AJJA 4TXLA 4PAGA 1RHJA 1BO6A 2PUJA 5CA1A 1XV5A 4LE2A 1L5RA 5E6UB 3IVMA 3SEAA 5IDWA 1DV1A 3EG9A 4G1VA 4MXDA 1RM4A 1KJ8A 1U5BB 2QQFA 4NQZA 1DG3A 2XB8A 1USVA 4F5WA 4NMXB 5DN6D 1I36A 1WWKA 4IIJF 2PBRA 2KBEA 4ZQIA 1R9JA 4NOLA 4YV1A 4EJFA 2PAFA 4TKVA 3I42A 4H3KB 4KKVA 3UNXA 1V5WA 2Q9CA 3ITDA 3NHZA 1HL3A 2LGJA 3A05A 3WQHA 3TEJA 2FUG1 4LV8B 4LOAA 4L0DA 1Q0PA 4UTPA 4BV9A 3H99A 3IVCA 3OIGA 4QC2A 5KQGA 4C7KA 3LT2A 1Y9DA 4Q3NA 2EFDB 2PKEA 1MN6A 3CRNA 4ZTBA 3ZZ0A 1ZLXA 4ZOQI 3SR4A 4ZOLA 2A9FA 3C0KA 4X54A 3AZQA 5HF8A 2AV6A 3L6OO 3MSCA 3DYIA 2Z2YA 4KIJA 1W85A 4HK4A 3K70D 2Q0XA 3FB4A 4PM4A 1EQ2A 9ABPA 2I67A 4TTVA 1R4NA 2AFHA 1YMUA 1FPMA 2EZ8A 2SCUB 3PGJA 3VNVA 2AUNA 1FNMA 2RI0A 3TSOA 5L3QB 1GN9A 3PR2B 3EBOA 1XPOA 2ZAGA 4KWIA 3OM0A 4RYLA 2FRDA 4Z4FA 4W9RA 4GX1A 3WFZA 3NDIA 4UDYX 2PWAA 3ZIDA 2R5FA 2A67A 2FFQA 1E60A 4CCYB 3ZVKA 4UU1A 1EVIA 1P7CA 4AL4A 1ZSYA 4KLRA 4WI1A 4RZHA 3O7MA 1A0OA 3RT1A 3VR3A 1GDHA 1XYYA 1KZGB 3PCTA 4L5AA 3DC2A 3PNVA 3W79A 3UMYA 2Q3LA 3I58A 5IZCC 2D8AA 4Z49A 1U3UA 1VHDA 5LBTA 1VL5A 3OE5A 4M86A 1TFRA 3REOA 2FK7A 2VATA 3GRVA 3IUYA 3AFMA 4YBZA 1CRPA 1JQ5A 2TMDA 3K0CC 2EXXA 3GAAA 2VPZA 1KEZA 1KEPA 1RI3A 2M1ZA 3E0QA 4R84A 1OXSC 4BEBA 1JDNA 1Z13A 3EY4A 3ANYB 4EH1A 2V96A 5I7RA 2BOVA 1TQ6A 1P7ZA 5K6TA 2P30A 3B51X 1P1KA 4B45A 3L8FA 1GXSB 3H83A 3UCXA 4OMDA 3CVUA 1TF7A 3GJYA 1S2NA 3FHLA 4HZUA 4IIGA 4Q47A 3RC9A 3WLRA 2R00C 1JEAA 4U2GA 4BO3A 1MO2A 2COUA 2HK8A 3S4YA 1T2CA 2GPJA 2P62A 3PLNA 2OZPA 1Q50A 5ALNA 2WBLC 3TB4A 4F85A 5BV8A 5C5IA 2JLVA 1IY8A 2GNAA 4RK6A 1D2GA 1U9YA 2H1IA 1IH8A 4PZYA 2B25A 1ZOPA 4FFBA 3PK0A 4F21A 3GDFA 3FROA 3W6NA 1T0BA 1VJTA 2PGDA 1L7EA 3JASB 4HAUA 4ZVOA 2UZ1B 1R88A 4LTDA 2W6ID 2WINI 1LSJA 3Q3HA 5BN3A 1Q5PA 4YRFA 1CZHA 2P11A 1KO5A 2VYVA 2X0KA 1V8PA 4NG4A 5AW8A 2FRVA 3I5UA 1ZM4A 2BFPA 1OF1A 2I4IA 3BA6A 1LPOA 3IO3A 3N0VA 4WK4B 5DX0A 2MJLA 3ZY2A 3AVUA 1TRKA 2F59A 3AZOA 1X92A 2AYYA 2ZR8A 1YB4A 2HJWA 4MP8A 5DM1A 4D99A 2PUEA 5LB4A 4AJPA 1SCDA 1CEYA 2B36A 2RGGA 4HLNA 4W5QA 2VVTA 3MTJA 5JNVA 5EIXA 3ZCPA 1GY8A 5AVSA 3AOEA 2VF7A 5IVDA 4D4GA 3U48A 4E6EA 4ZJPA 4FNMA 4POOA 1HQCA 2IOFK 1NJGA 2ZQYA 3CWQA 1QOZA 1R6BX 2QYTA 4IWYA 4ZDWA 2BD0A 3UAOA 4GI2A 4Y9TA 4AMUA 1CUFA 4K2AA 4EUSA 3ODGA 4IY1A 3VPCA 4R5HA 3U3KA 4C21A 5ALSA 1IM5A 5CB4F 5EMJA 4EAAA 4JKIA 3AM3A 4N47A 3ZWKA 3CF0A 4X60A 2CMHA 2OPBA 3CUEF 4H4CA 2G1UA 3LI2A 2JEZA 2G0TA 3LUAA 4PHGA 4QXOA 4ABTA 3W5DA 1F2TB 1FK8A 1U7DA 3ITKA 4OPMA 1J0EA 1YVEI 2PT7A 3E27A 2GZRA 2X1MA 3ETNA 3GW8A 4KJXA 4QRDA 3GVXA 2PGNA 1Q44A 1T9KA 3U9SA 3NWBA 2QSJA 1E20A 2QJFA 4PG4A 5T67A 4M22A 4C87A 4CL2A 3T1TA 4XUEA 3ZKWB 3AESA 1AUQA 3RSCA 1Z0UA 1RXIA 2NPIA 2X1VA 3VR5H 2C3YA 2X41A 3KJNA 2I55A 1ZHOA 2CHUA 3AUJB 2H4ZA 5DHQA 1FTWA 3JV7A 1U80A 1PDWA 2QTVA 1SCQA 2R8BA 2XYRA 2J9GA 5COQA 1NRJB 3I05A 1MABB 4AJIA 2AI2A 3ZU6A 4B79A 2GEDA 4EATA 3BL8A 3WRYA 3VH3A 1E3JA 3PJFA 5BURA 3K0HA 3IE0A 1UPAA 4L5CA 1Z18A 4UFOA 3CLSC 4MUJA 4Z9AA 3RIYA 3ET5A 3KB8A 4EF5A 2GXSA 1GGEA 1M6YA 3DLHA 1MVOA 3G85A 2SHKA 4LHZA 1W5FA 4AYXA 2HI0A 3FCEA 3BE6A 3W34A 1YXMA 2QI9F 4MZDA 1KP9A 1QQ6A 3O9ZA 1SUBA 1XF9A 3E9CA 3H86A 2ZVPX 3QU7A 4CBVA 3C70A 1PGOA 4JB0A 4EHBA 3RFXA 1MG5A 3DMFA 3K9CA 3ZHUA 2AHRA 3EXFB 4NP6A 1N4AA 3AHFA 2TS1A 5C7YA 3SS9X 4MYDA 5IT5A 3KHSA 3I5AA 2CLDX 1NOIA 4Y6QA 5SZJA 1WE2A 3HO6A 4DCCA 2A0FA 5DSZA 3K1AB 1OFVA 2HJ9A 1R50A 3O4FA 4GIBA 5I7EA 3G8CA 4D0LB 5CA0B 1VB5A 2XODA 4Q37A 1AZSC 3WLJA 4CUZA 3RSSA 1EJ2A 4MGIR 4I99A 2H0AA 4UBNA 5KCMA 2H5EA 1OI2A 3KXIA 4DWOA 3DE5X 5AFSA 1ZM3A 4FJ0A 3PFWO 4YT5A 4Q1AA 2DR0A 2CLMB 4AJNA 2YN2A 1QIJA 1Y63A 4JNKA 4JC8A 5EHGA 1B43A 3TW6A 2VUHB 1S89A 3W77A 4BAGA 4EGCB 4TWZA 1Z4IA 2JNWA 2FZ5A 2PKYX 2XSZD 1B6RA 4HD8A 3FFTA 4LVOA 4RXMA 5TARA 3TDNA 1QH1B 2YVAA 4K6HA 2X4DA 4R71A 3SIWA 2ZI7A 4HB2A 3TTXA 2KPOA 3O4HA 5THXA 1V1MB 1ZONA 2BHTA 2I99A 2O8DA 4NOJA 2R9VA 3E22B 1O89A 1VE9A 1L7MA 3HUUA 1UPBA 1YCHA 2WZCA 3G2LA 3OZRA 1D9ZA 5H1YA 2PZLA 1SOWA 2A88A 3FLEA 5TMPA 1QVRA 2RFLA 2XGOA 1HGXA 2ZCVA 2RHBA 3BXHA 4OXXA 2A86A 1ODSA 3N75A 2VK8A 4YUZA 4W5TA 3EF0A 3WDMA 3LECA 3NUGA 1B42A 3LU1A 2OD9A 1U2GC 3DCNA 1WSAA 4IBOA 4DCPA 4QU5A 5EQFA 3IHKA 4B44A 3QIVA 1OX4A 5TQJA 4P3XA 5IVKA 2C5EA 1CU1A 2V55B 2AE1A 2IKSA 3SS8A 3V8VA 1WMDA 4KDFA 1KI3A 3C45A 4KWEA 3O6VA 3REQB 2JKYA 5ITZA 5LQJA 1L5LA 2HMVA 2QNRA 4BASA 5FPSA 3SOZA 3RJTA 4CU5A 3BMQA 3L7JA 1T5DX 2BP7A 4PLWA 5E1MA 3HVHA 1JLMA 3C4QA 3H5LA 4FS8A 4LK3A 5CIWA 4AVYA 3AIMA 2PZ8A 1GUAA 2GNOA 3ZH2A 2O8BA 4MQ4A 3ZE6A 2A57A 4FYJA 3D4NA 3MTAA 1GN8A 1GPLA 3DE2X 5L8VA 3B85A 4HDRA 4YRPA 3ILVA 2UYOA 2I6UA 3KM0A 4YCAA 2O6HA 3CPHA 1D1SA 1WS6A 3WLEA 2XNSA 1PFGA 1M2GA 1ZI8A 1EFRD 1CX9B 1ZUNB 2QZ4A 3HB7A 1U1IA 2PT9A 4LDRA 1RBYA 4U9UA 5FUYA 4ECEA 5EXTA 3QH4A 5BR4A 1WLSA 1SCAA 5F64A 3HCAA 3HCPA 4D9KA 4HVCA 2EG9A 2G63A 1R1DA 3CS3A 5K3EA 4R8MA 3ANLA 2NNWB 4Y9SA 5L95A 1T13A 5DDIP 4HVTA 1GPDG 1NUSA 5L45A 3OIVA 4UDNA 4PO3X 3KR2A 2AA3A 3MGGA 5K0NA 3LBNA 5E3IA 1TM2A 3ZHXA 4RQTA 4AF8A 1CJMA 3UXYA 1JG6A 3WHPA 1QGZA 5IXSA 3T5CA 2R1TB 3RKRA 1QIMA 3BCRA 4MW0A 1HRDA 3FDJA 4Y2XA 4E5PA 2QAGB 5KKCA 2JFWA 2E6UX 4N0PA 1C9DB 1V5EA 3DZKA 3RTAA 1XRLA 4PTYA 4Q3OA 3H0CA 3EGCA 4A16A 4B3GA 3IV6A 4R0NA 2FUNB 1OBHA 1KIMA 4EY6A 1JFFB 3OUUA 3RG2A 4G4SO 3RIGA 1G3RA 2ZYUX 4LWPA 5IG2A 3DL2A 3FPSA 4UTVA 4A1FA 3N53A 3NWJA 2VQSA 4B3MB 5A02A 2HTEA 3I2GA 4NPAA 1G21A 4B74A 5K0FA 2RGRA 2CMFA 1SA0B 2ZSDA 4B43A 4MPDA 1OI4A 3NORA 1J25A 1C3EA 4UD6A 1KU6A 5F76A 4G0OA 2YYZA 4ESOA 1NI5A 3VOSA 1JIXA 1XRMA 1C8KA 2EBFX 4LIPD 4X95A 4AAYA 2R5NA 5KCZA 1J2YA 2O9JA 2WMNB 3A3YA 1M2EA 2VPIA 3WGKA 5JMWA 1IB0A 3R44A 3ELYA 1J8YF 1LXCA 3T7AA 1F4PA 4QLBA 3UMJA 1JECA 2HGZA 1ZA2A 4H7HA 2UYQA 2V8BA 1P60A 3DBLA 5AI4A 3TCNA 4XYGA 1HOTA 2EKQA 2OK7A 3CH4B 4LHWA 2I71A 4RK0A 3RAJA 4LY9A 3DVAA 1K4MA 3F74A 4LA4A 4MMXB 3TOVA 2W5UA 2WTEA 2X40A 3H1PA 3LPMA 4YH1A 1XZMA 5H68A 4REOA 5EHQA 4HNVA 1LK5A 1L8QA 1TO1E 1ODIA 2AFVA 2H08A 2QX9A 1E2BA 4DABA 5T6BA 3EJ6A 4Y2TA 1G64A 1QFMA 4GE0A 2XRZA 2ID4A 4QPZA 5IU6A 5FWXB 3IMFA 2NTEA 3B20A 1HDZA 1SBYA 1Y5LA 4L3OA 1XKLA 2NADA 4C03A 4EW3A 4ZI2A 3NKFA 5DU2A 5HNKA 2D1RA 2LCFA 3H1AA 3TL2A 4BP3A 3LW8A 1J0CA 1VE3A 1CF9A 3OU6A 3SHVA 3IQHX 4BOYA 3ICOA 1A50B 2YRFA 4QGSA 1CUHA 1B8UA 2AYXA 1T6BY 4GYWA 2R65A 4R9SA 5I4BA 1WBDA 4I8DA 5GONA 1GUZA 4V0RA 3K6RA 2R4TA 3GY0A 1U9CA 3L7AA 3ZOZA 4DTCA 1G60A 4WA7A 3TNDA 2G67A 3ROKA 3KT8A 1YCDA 3GZNB 3RWMB 2YWXA 2GX6A 5CXQA 4CM9A 2FW7A 1G291 4V3CA 1S8AA 1QNLA 2GZHA 4XGQA 5E0OA 4EG8A 3WK7A 3ZDEA 2PZBA 1XL0A 4CG0A 1NQ5A 3CT6A 1E2EA 3DT6A 4B32A 1YA8A 3PEEA 2GASA 4P35A 1KI4A 3EHDA 4M88A 3WISA 1CUDA 1LWOA 3K9WA 4KXXA 5G1OA 5KWEA 2ZXFA 1ESCA 1WRBA 3KUKA 2IYZA 1QCZA 2NYRA 4QSHA 2AXEA 3O8DA 2KWIA 2X6RA 1QGYA 3QE3A 4PXYA 3OSZA 4BZPA 1L5SA 1R8XA 1U8XX 1UT8A 4JX9A 2G9VA 3JQAA 3RI3A 1WZIA 1HDXA 5ES4B 2RE8A 2JLWA 3QKWA 3RHTA 4DIFA 3HRIA 3D4PA 1NUTA 3ZI7A 4QJBA 3GCZA 4BATA 3T5MA 4QOFA 2VP9A 4HH3C 4B1FA 3P2MA 1HDCA 2CVFA 4LMBA 5DW0A 2AQIA 3DKVA 5CDYA 1GTRA 3PDCA 1G9SA 1RQGA 2G1AA 2AN1A 3ZIAA 1P6QA 4F3NA 5CD1A 2PM8A 2XYGA 4JMPA 3PX2A 5CITA 2IYLD 3QMVA 1FP6A 1KJ9A 1OZGA 1KZ6A 4WXHA 2I1LA 1E7MA 4UFPA 2JFBA 4WECA 3ZCTA 1GAJA 3OJ0A 1FXSA 1X7HA 2IEZA 3IQXA 4GOKA 1R5OA 4S0XA 3IUBA 4LZOA 1YB1A 4JJAA 1XWIA 2HCTA 2ZBRA 3HI6A 1LC3A 1NP7A 2GZ3A 3I9V6 4X00A 3IAM6 3W8DA 4CGYA 1W5TA 1DC4A 4JEIA 3TOZA 5KPDA 5DNYB 5TJ9A 2JFFA 2PLRA 3EIOA 1QG4A 4O2AA 3L7LA 4IRXA 4F3KA 1MJNA 1XMSA 4L07A 3INYA 2AVNA 2V59A 3KV3O 1VG8A 1YT5A 2EU8A 1BXRA 3COYA 4JH0A 3JQDA 3GT4A 4LJ4A 2VDPB 4HFJA 4AKSA 1FSSA 4IDAA 4C4TA 3NHYA 1B8VA 4H31A 2DKNA 2VZEA 3S1AB 4YY3B 3ZDRA 3TSZA 4AWXA 2W37A 1OILA 2ZVQX 4TQ9A 4UAJA 4HWTA 2XNDD 3T4EA 5BW4A 3DP9A 1YL7A 3I28A 3HRHA 1TUIA 1C1HA 3GLIA 1GQYA 2TMYA 3P32A 1YNOA 4DSTA 1Z7YA 5TEVA 3TDMA 4LJ7A 3A3OA 1TZJA 5HKBA 1OWNA 1VL0A 1ORTA 2D7JA 3G2NA 4X8OA 2ZIWB 2JIOA 2VDVE 1P4JA 3P5SA 4ZHQB 1XB2A 4G1CA 4RGQA 4YIKA 3DAYA 3SOPA 1BWSA 4CE6A 2ZWOA 4M98A 3SEFA 3WQQA 1KWGA 1MXHA 1XJQA 3H97A 1CRLA 5CH3A 3U37A 3VDRA 1N92A 3GVIA 4V1CB 1Q1AA 1I3CA 1N3BA 4D3ZA 2HPHA 1YKSA 3D0RA 4Q3AA 2W83A 4W8GA 2V7QA 1VLZA 3G9XA 5EIHA 3UEOA 5EHXA 3C74A 2YOHA 4CMHA 1HKHA 1WKBA 1CW2B 4WDRA 3VH4A 5HIKA 4MROA 2IZ0A 1W0JA 3VR0A 5JJ5A 2BBSA 3O75A 1FFDA 1SQFA 2JH8A 5K6AA 4UEKA 2D8MA 4DLKA 1FE8A 3THWA 4FEYA 1GG2A 2CSXA 3QUCA 3USES 4AY4A 2HRCA 1E1QA 4MVJP 3K31A 2M6RA 3L7NA 2OFPA 4FBMA 4TT8A 2VYND 2ZRBA 2ZTVA 2QN9A 3EXEA 5EE9A 3UV6A 4A2CA 4ZYXA 1N2JA 4IH1A 5LU9A 1P1RA 2Q28A 3V2HA 5HK9A 4NBRA 3NIBA 3VSEA 3TOCA 5SY9A 2HLPA 1K5PA 4QM7A 4D45A 2INGX 1YI8A 2YWJA 3N70A 1H2RS 4M7OA 2I1VB 3E5MA 1Z6YA 2XECA 1KI6A 3S7TA 2LCIA 1JEOA 3OM8A 2VC2B 2G5CA 4G09A 4HC4A 5CU7A 3ZDAA 2HHCA 4MHOA 4Q4AB 3GRPA 1AMOA 3ABQB 3KQYA 2WFMA 4JYCA 3CZQA 4LF8B 3E2PA 4G86A 4RVFA 3K70B 3PEUA 1I2ZA 3PQDA 5EL0A 1TQ4A 1N1DA 4EJ2A 3ZXYA 2OM6A 1NVKA 5AVOA 2ZM5A 1CEEA 1L5WA 4D02A 4BLQA 2O0HA 4M0DA 5JD6A 3SM3A 1NW9B 5ETJA 4K81B 3T3OA 1YDWA 4NCJA 5L6MB 2PUDA 2H2DA 2YJZA 4YXWA 3SHTA 5BR7A 1Z28A 5ES3A 2C1EA 2ZUTA 1VJCA 3BS4A 3H11B 3V9PA 1NUPA 1I2BA 1XEAA 5EJ2A 4ZAXA 1Z4LA 1EKXA 1KVTA 1OY1A 3DQPA 4C06A 3CX6A 1W0CA 4YAFA 3IP5A 4FE7A 1GL6A 3MK31 5AOBA 1MCZA 5LPNA 2AWOA 1O54A 2OV8A 4FDLA 4UASA 2HV8A 3SJ7A 1VKJA 4KR6A 3VKUA 2VTBB 2VBFA 1Y3DE 3Q7SA 4HTFA 2ZYDA 4MS4B 1QE5A 3TQHA 4F4JA 4KBFA 1FXWA 2WQZA 3OO1A 1Z5OA 2FP4B 4XYEA 3KD3A 2A5LA 2B4QA 4Q9LA 1V3TA 4DRXB 1QANA 2HA6A 3FN4A 4KN8A 4NBKA 4E5VA 4F5YA 4ZJZA 5I45A 5JZVA 1SBTA 5C53B 1TW3A 3ABZA 4RY9A 3ZYZA 1BTOA 5KJFA 2CE7A 2XY4A 2V4ZA 1PFQA 3SQLA 4OHWA 3Q72A 1B6TA 1YZYA 3PENA 3KAQA 2WSLA 1BA3A 3LXXA 4C0AC 1H6BA 1NMYA 1UQTA 3WADA 1M6HA 3RYFA 3VPAA 3CRVA 5C8YB 1EAYA 4EGFA 3JZDA 1DV2A 1RQ7A 1I0ZA 3WWZA 2NPOA 1Y9JA 3WTBA 3DVAB 5T4EA 2Y71A 3Q8XB 4QAJA 3IP6A 5FI1B 3CW2A 3HB1A 4WASA 3TWOA 3H9BA 4ADSG 2DCUA 1PS9A 1NLFA 3PICA 1NQUA 5CDFA 1Z7EA 4OLAA 4R5MA 3FCSB 1I3NA 2YV5A 2EFHB 4LGMA 3FH0A 3ZCUA 2VUSA 2ZUFA 4CEIA 4YJ3B 1ZY2A 1LDMA 3MW8A 4HN2A 4LYHA 1J8QA 4F06A 4WD3A 5GWXA 5FQOA 3RYFB 4MWEA 3DMTA 4G5GA 3WWEA 3K0FB 5G2OA 3BJZA 4N18A 4A8JB 1N2SA 5IWCA 4EQ6B 5HM6A 2LV8A 2FWJA 4B76A 2XUFA 1REQA 3GRKA 2ODBA 2ON6A 3OO0A 2NVBA 4JQCA 3EMKA 4JLJA 4PANA 1UUFA 4HB4A 3TAXA 4ZOLF 1XU4A 3DMTC 3RANA 1CP2A 2FQYA 2F8SA 2WM9B 1QQ7A 2TYSB 3A4IA 2NZWA 1M0TA 3SIPA 5LN1A 4N03A 4REQA 5CCXA 2AG1A 1AKRA 2D2EA 2XUGA 4GEKA 5ESWA 1Y7TA 2R1TA 3BIXA 2I4OA 5KINB 2ZWVA 1VSVA 2X8LA 3ET4A 5LZ9A 3N7AA 2VTBA 1XP5A 2I2BA 4DY6A 1XPUA 3VPSA 2BFAA 5DISB 1G8JA 4P08A 4DBLE 4ZV9A 3FMOB 4M1OA 3DUFA 1JKJA 3QBVA 1UADA 2WICA 2ACVA 3GRUA 1P2SA 4YC7A 2YV4A 3BIOA 1WUKS 2CJPA 2J48A 2X0NA 1KO7A 5IAJA 1UT5A 3O1LA 3QKTA 4C3ZA 5HIAA 4MJ3A 1UMDB 1WZCA 3AG6A 1PJQA 3GB9A 4HH1A 5KTSA 1FFYA 2WU4A 4YNBA 4GDMA 2BBOA 1JEQA 2TMGA 4DCNA 1DQPA 2GM9A 3DE1X 3UGQA 1UZNA 4ZP1A 1VIMA 4I66A 4HGRA 4Z1OA 4LYGA 1ZUNA 3PC3A 1U8EA 5I6DA 2VJAA 4H1HA 1MD9A 5K4GA 1O95D 1XFAA 4HDRB 1AHPA 5D2CA 4E6PA 3COVA 4QFMA 4P4GA 4MRAA 3O5AA 3G49A 5TB5A 2NZ8A 3W5SA 4PC3A 1DIGA 3ETHA 4Q05A 4ONEA 5HILA 3KYBA 3K9HA 3L7KA 5KSWB 2ZUWA 3Q9LA 3OAAD 3VVLA 1R0WA 2QP4A 3D0KA 2FMHA 1H4VB 2QTLA 3HSSA 4JI7B 1K7EB 5IDYA 2OZEA 1LA2A 2ZZKA 2IEAA 4HWRA 5MGNA 2PUGA 2OE2A 3LLCA 1P4HA 521PA 2O59A 5MN6A 1Q0SA 2BZ1A 2WKWA 3REQA 2BIFA 2F8MA 3MWKA 3RFCA 3SNHA 3C15C 3UK0A 2QTHA 2Q8PA 2WIBA 4TM7A 4AUMA 3D5TA 3ZS9A 4CQLA 4JLOA 4ODIA 4PE5B 1OX4B 1IFXA 1IB6A 2NW6A 3K4PA 1D3AA 1EK6A 2QV7A 4C30A 2K7ZA 2EFGA 5J58A 3UUGA 2PMDA 3KUDA 3KD2A 4IZHA 4W9NA 3ROZA 1DBPA 4KMSA 4RM3A 3JSXA 3HY3A 2VEOA 1JQKA 3KOYA 3IKTA 1M0SA 3FHOA 4LHXA 4KTVE 1YONA 4BP9A 1Z26A 3K9LA 3I6MA 2OL4A 3PPIA 4IFEA 1C4XA 4B0OA 5JXWA 1IEQA 2C4NA 3K71B 4RA9B 1HT1E 5AMXA 2JBHA 3OIWA 5A4IS 2O8DB 1FVOA 2QPLA 3D2AA 2CL7X 3LK6A 2OZLA 5DNVA 3N39C 3A1DA 2ZB7A 3BXFA 1AMNA 3EODA 2WFAA 1YU6A 3CA8A 3NAMA 3NM6B 4IV0A 4NYMR 4HVLA 5CDUA 2WYVA 5IAAA 4EI2A 1KWKA 2XZDA 4BRZA 4C4XA 1JH8A 3ZDZB 1PFVA 4P7BA 4Z4GA 2YHUA 4LBZA 2NXNA 1QM5A 2ZR7A 5LZ7A 5BWOA 1B15A 4QDJA 4AG5A 6GPBA 5IUJC 1ISGA 3P9XA 2VWQA 5T7BA 1CZRA 2Q1SA 3L1JA 4EFKA 1XTUA 2NQTA 4TZ6A 3EYAA 1T9CA 3FCYA 4Q48A 2VYFA 3W6ZA 3B3FA 3WOVA 4QVIA 5L7YA 2G08A 4K9PA 1DRUA 2P78A 1YFZA 1JNYA 4DHWA 1OR8A 1T9GS 2B78A 3GR6A 3PFFA 5JALA 1ZKMA 2QTMA 4KK3A 2GH1A 4EFMA 3PZBA 3J7AC 4E22A 2O3TA 3L7MA 4FXOA 2O4UX 3LPLA 4M1WA 5GY7A 1EIWA 3ZWDA 5LMZA 1N2EA 3ZWVA 1ECJA 3OCWA 3DE4X 1NSFA 2L42A 4C0HA 4DQKA 5DYNA 3GBVA 3A6FA 5H83A 2B7CA 3EZ2A 1DHTA 3ZIAD 4AWBA 4D3SA 5K8CA 4K40A 5E2IA 4EPWA 4F92B 4Q12A 2VHZA 1CIJA 3MRXA 2J3EA 4ETNA 4PYLA 1FYDA 2V97A 4E46A 1K88A 1NG1A 4B3SB 2H2IA 2JANA 3L4JA 1C3LA 3CNBA 3F2IA 4D4MA 3HA3A 1GYRA 3CEJA 4IIFA 5K3CA 3ZVNA 3SFTA 1G42A 4H1TA 1PR2A 3DZ8A 5G0TA 1JU3A 3PUYA 3Q2OA 2E37A 5DGDA 4IRUB 3UPDA 3LG2A 3VR2D 1N0VC 2ZATA 4S1TA 1WQ4A 3WRYC 1JUDA 1RM3A 1T2VA 1XEXB 1EFHA 3F5FA 3CNHA 3LZDA 1OX6A 4E4TA 3C8DA 5KQMA 4OFZA 4M1MA 5FPTA 2HW8A 5ALGA 1GV1A 1E8DA 2JGDA 1IJBA 1ZNYA 2EZ9A 3LT0A 5JS6A 1V2HE 2FPIB 3LF1A 3I53A 3JQAB 1PK8A 4EY3A 4F1KA 3LYUA 4AG3A 1X7ZB 2I8AA 1F2TA 3PE6A 1ECPA 2J6CA 4BRUA 3A1NA 4EHDA 1IN1A 1PAUA 2CW5A 4HZGA 1T1SA 2AG8A 4XW2A 5IX8A 2H0QA 1QBGA 2GD0A 4LQ4A 4KQ9A 3OM9A 4PLPA 2BSQA 2A1TS 4XCVA 2IYWA 221PA 1DC5A 2ZJ8A 4MS3B 3R7BA 1K63A 4D6YA 4F0JA 1Z17A 3LJKA 4QKQA 4WW0A 1WJGA 1NVXQ 3DV0A 1NMZA 1IATA 4IZIA 5D1NA 5E3JA 3TI7A 4AP6A 3NC4A 2AMVA 1QMGA 4C6HA 4ZEXA 4HT3B 1F5NA 1L8LA 2GAJA 4FYVA 4U2DA 3CONA 3ENNA 3KTAB 4C6SA 5BMVB 2OQIA 4FJ2A 2GCNA 1O4VA 3NDPA 4RA6B 1MT3A 1R0RE 1S96A 2GJ9A 2ZYSA 3AY7A 3FHCB 4WXMA 2REOA 5KNDH 4MPPA 5KSYA 1CY1A 1V5FA 2HNKA 3QIAA 4INPA 4OU4A 1FMCA 4RHEA 4WJZA 3TTVA 4FNOA 1LI4A 4FFBB 4U7DA 1CVLA 4ID9A 5BV7A 2CDNA 2ZT6A 4PYRA 2BCEA 2BGNA 4U6NA 1JR6A 3DHVA 5JSFA 2B2XA 3RC8A 4YYEA 1AKWA 1ICEA 1N0UA 1SCIA 2PJZA 5I01A 4BN0A 4AM8A 5LSAA 3OUZA 2A0KA 4KE9A 4EA7A 3GH3A 1A8PA 3AEYA 3NTXA 2DFLA 4L8LA 2HQRA 2POCA 4EJSA 3V34A 1C1XB 2RGUA 1IAVA 1PW5A 2OSVA 5HKLA 2EHDA 1G8YA 1IHUA 3G0GA 5ECGC 1JWAB 1IQRA 2PJDA 1VG1A 1ZGBA 1HYGA 1OXXK 1UKBA 3KEMA 2H16A 3OCZA 4QO8A 3CLUD 1C1DB 4LBYA 3KS9A 1Z39A 4A2WA 1U4OA 1CCWA 3E9EA 3E3MA 3QV1A 3PGLA 1RWVA 2A7QA 4UVDA 1NXWA 2YX1A 1I0IA 3I32A 3KSDO 3G2MA 4PPYA 5CTJA 4ZPXA 1Y33E 4LDZA 1H0HA 3WGMA 4LHSA 1KEEA 3KQLA 2ETVA 3JW8A 2DUMA 4PW0A 2AR7A 2JJMA 2OM2A 4TTQA 3HVIA 4C22A 1JFFA 4Z9FA 3QVTA 1L5FA 4CIVA 4AZVA 2IDZA 4B4VA 4DILA 4RTLA 1WUJS 2XADA 3K6SB 1WR8A 2FWNA 4ALKA 4D44A 2EP5A 4BJ6A 3L84A 1DCTA 2ZTHA 2CZGA 2HEGA 3VSCA 4DQLA 1FA9A 1R4NB 2AFHB 2SCUA 2B1QA 4I46A 4JX8A 1DU4A 1G5QA 3FXAA 4ZAGA 1RXVA 1XI2A 2WAMA 5F5XA 2IV2X 4B0PA 3FTCA 3K2IA 1VPVA 4HYYA 4XGKA 4TZ0A 5KTYA 1PT6A 3QNUA 4QXQA 1O95A 1M73E 1P77A 7MHTA 1VZ2A 3VHRA 1OKKD 1Q84A 2HLHA 4PZLA 4U9HS 3EQ2A 3HH8A 3TZLA 1YCGA 3LWDA 3WLIA 4EJSC 3U81A 2BEUA 4WLVA 2GUGA 2IBTA 1DLIA 3H2HA 3PHBE 4YRSA 2BGRA 2HDHA 3CGGA 3WO0A 1JDPA 3KXPA 3GRFA 3ASUA 1P0CA 1PIWA 2NYUA 3NBQA 1N5RA 1Q1ZA 4IILA 1XMQB 2KYRA 2ONJA 3O93A 2C0PA 2P4SA 4N01A 4OQ4A 1QHSA 4UEOA 1D09A 3B82A 4OK3A 1YAJA 5BNZA 3RODA 2J87A 3DAHA 2P2NA 1TDJA 1EB8A 1BWRA 4UDXX 5IKPA 2VDLB 5FNVA 1OREA 3D5QA 2DG2A 4BPRA 2NMVA 2VHEA 1Y4SA 5EMMA 3ZI0A 1NNEA 1TC1A 2A84A 5SYNA 5F52A 2JK1A 3PV0A 5IKXA 3Q3GE 4IOKA 1ZCFA 4BO5A 3DYBA 1BEEA 1TM4E 4YCMA 3U19A 2JIPA 4HAYA 3GLGA 5I9NA 2IFTA 2F9FA 4FMBB 3DWGA 5KDLA 3QI2A 1ZICA 1IZ8A 5G41A 3G0CA 1A3CA 1A1VA 1TGVA 3IDFA 4X64B 1T6YA 3J81A 3OOHA 5IARA 3GLRA 3U40A 1TQHA 1KZ4A 1XNJA 4ASUD 4HQ6A 4ZC1A 1SB8A 1MJGM 4GR9A 1NVVQ 2L19A 4RJ2A 4YJ2B 4RTRA 1FX0A 3U2QA 2DSTA 2DT8A 3RAPR 4AP5A 2PCLA 3OQ1A 1F51E 3GARA 4MUNA 4X8LA 2FLVA 5EIBD 5LZ8A 1K98A 3KQMA 1YKFA 2A33A 3N7UA 4S24A 2HQSA 1NW4A 2BEKA 4UBLA 2DLDA 1O58A 3UT6A 4Q9HA 3E8MA 1I30A 1E8MA 3K5IA 4KFRA 1OH8A 3E05A 1HEIA 1IQUA 2H2WA 2IYOA 1GILA 3B6KA 3E23A 3TD9A 4E31A 1EGAA 1CUBA 5HS6A 2KMLA 3WSWA 2VF2A 3F6SA 1UDAA 4KTTE 1GKIA 1H42A 3DO5A 3TCKA 4AJ4A 4DXHA 3CJRA 3MQFA 2J3DA 3QKSB 5DGXA 9LDTA 4RTOA 2FEKA 4KXYA 3EC2A 2R7AA 4NH4A 4A73A 3HKEB 1EUCB 1JA9A 1OGYA 2IXEA 5G53C 3A1WA 4XX0A 2Z5LA 4Q1EA 1KYIA 1HDYA 3W5IA 2H1WA 3D6TB 3OWXA 3EZXA 4IXTA 4S05A 3GRZA 3KAPA 4FR2A 4RKEA 4MGEA 2ODQA 3K1AA 1RBZA 4LYJA 4A6EA 2XA2A 4OYLA 3U49A 3HHPA 3OIFA 4RLHA 1IRXA 1K4YA 1PQYA 3HNRA 2C57A 2ZK7A 3O4JA 2W6ZA 1Z0ZA 4TLAA 4ZAWA 5FUWA 5ICMA 4IIJB 1V35A 2QZZA 2G8NA 1ECFA 2DQSA 3QWAA 2YMLA 3N8KA 1QFSA 1IY1A 3OHSX 1Z3IX 3Q3VA 4OLFA 5D01A 4M0KA 3TQOA 1E58A 4CM1A 1X87A 2KLHA 2PJUA 2ZE7A 1NUAA 2FSPA 3LD9A 3RREA 1BU8A 1BQEA 1HPLA 5DRTA 1Z5GA 2H31A 2VN8A 4X93A 4D9CA 1TJNA 4H9GA 3QW2A 5DCWA 1NQVA 4X65B 2SNIE 3LQ1A 2FW9A 3WGTA 1QQ5A 1Z7WA 1GPH1 4GMGA 4MR8B 2I4NA 4OL9A 1JFVA 5DBGA 3VM6A 2AGVA 4NYIR 5JS8A 1XTPA 4BKUA 1RYZA 2QTVB 3GCDA 5FJJA 1Z8DA 3WB0A 5JNSA 1IOZA 3ODPA 5HYVA 1Q19A 2R62A 3QZUA 4HAOA 4HQOA 4TL6A 1WLYA 2VHTA 2O8FA 1MOPA 4S1OA 1PYOA 3DTVB 2IS6A 1VG0B 1AKNA 1ZK3A 1U81A 4ZOAA 2AN4A 3UAGA 4UU7A 3LQ4A 4MCHA 2VDWA 5ARBA 1NAIA 1GNSA 2CHVA 2BVNA 3WRWA 1P2GA 3RQSA 3GDHA 4MVJH 1ZZGA 1U3DA 3LZ6A 2QTBA 3W9BA 1O8BA 4IAOA 1DMSA 3UWKA 5HUQA 3IUEA 2R25B 1I5OA 3H6GA 5J1TB 5EQDA 4ENUA 2VDJA 2ZETA 3GCXA 4X1IB 2PO5A 1J22A 2VHVA 1ODFA 2XCOA 4AN4A 2VDUE 1C8VB 1E66A 2DKOA 2EL7A 2ZTLA 3LSTA 4UVGA 1D4AA 1SPBS 1YVUA 2BR3A 4ES6A 4PYQA 4WIAA 1JHXA 1OGJA 4Q1FA 1CUAA 1XEWY 3TIIA 4HDAA 3DCYA 3NANA 3ND5A 9LDBA 2GTHA 3EZ7A 3JWPA 1XX6A 3S2GA 4MR7B 2WK1A 4BLTA 2V7PA 5KJ1A 1V11B 2PUWA 5L9AA 4IHJF 4FFOA 3GFRA 4I1IA 2VT3A 5EWLB 4H2DA 2OGTA 1EFPB 4GPTA 3C3XA 4BMPB 4V1CI 1K5HA 5BR1A 1ZMRA 1YUMA 4GECA 1N0HA 3ZLTA 3FWZA 1EJ0A 2XX3A 5JDIA 4FMCF 4E08A 2Z8ZA 5KTRA 3B6ZA 2Y0PA 1PSZA 4KJZA 2EWMA 3AR6A 1U3WA 2WM3A 1LLDA 5ED0A 1FUUA 1Q0TA 1P72A 1KFEB 1OXMA 3CUTA 3KB6A 4R4JA 3T5PA 2QYHA 3CM0A 1V47A 2FVYA 1ULUA 2PLAA 3QNWA 3KLNA 2J31A 3ZV4A 1FYVA 3QA3E 2MMGA 1U8ZA 4YK7A 5LFAA 4HZUB 5K3FA 1OXKB 1F14A 2PMWB 3HN7A 3DHEA 2GZDA 4PC7A 2CWDA 4FYXA 2VNHA 4LMPA 3ZZNA 1O94D 4MPTA 4BXOB 4LYAA 4IJ6A 5AJUA 1KY4A 2GN4A 1NVUQ 2EKZA 3WICA 4TS4A 1RRMA 2IXFA 3BN3A 1EFAA 1NKVA 3HO1A 2BHNA 3X1KA 2H9YA 3ESZA 4GXTA 1SNYA 3WQSB 4YUXA 1YUNA 5BV1A 3DLCA 1R0ZA 1U0HC 3EBPA 5TX7A 4KKXB 2G1PA 1BMQA 3GLTA 1Q6YA 4TWAA 1LI5A 3AOGA 1Z56C 3PP8A 1WSBA 2P4UA 3KLOA 1SEPA 5EYPB 2IYRA 4C05A 1USIA 3R3ZA 5IF3A 2P5TB 1L4GA 4U2KA 4E2WA 4EAQA 1P1BA 5K8IA 1K6JA 2AF3C 2C3MA 2Q0SA 3RF6A 5HUHA 16PKA 1VDMA 4NYJR 2HNAA 4N5HX 4DLTA 5B7QA 4CUJA 3C7DB 2IP1A 3RCBA 2D2IA 4RWZA 5JDCA 1JH9A 5CB8A 4U8GA 1Y7IA 1N7IA 5LZ2A 3KWLA 4HATA 2C4WA 5GAJA 5HGXA 5AO9A 4BIIA 5JDIC 3GU3A 4PHTA 2QN1A 4KR3A 4BQFA 2CVZA 3N2KA 3PQ6A 3BHMA 3FMFA 4L4ZA 3WKEA 1XMVA 5AKEA 1J39A 5KNCD 4HQLA 1YKGA 3VDXA 1RQPA 1VM6A 3A10A 1XAGA 3INTA 4ZKEA 2Q6KA 4B4OA 3GUCA 2I7XA 1E1NA 4DSOA 2XXJA 1ZEJA 2GF9A 5DHAA 5B1YA 3CW9A 1XT6A 1V8FA 3V80A 5DLDA 1MX3A 4NBUA 2P2ZA 3NO4A 3TG8A 1BRTA 1P1CA 4KPUA 4NZ9A 2CKMA 1UKEA 5HCNA 3T4PA 2BGTA 1YVRA 1I4TD 1KMCA 3JYNA 3QYAA 3VJMA 4LOIA 1EBFA 4UTXA 2B8EA 1H4TA 2X23A 3STHA 2HAEA 3H9CA 4H3VA 3SC4A 1JWLA 3MLBA 1FLAA 2QTGA 2WP8J 3X1ZA 1R12A 4ZQCB 2O4CA 1RWXA 4DA0A 1RYDA 3D3QA 1EWQA 2JCBA 1B1AA 4IHQA 2H29A 2WG0A 1ZPDA 2QGZA 2X86A 4MKFA 1PHRA 5DKFA 5ALKA 3TKAA 3NYWA 1KNQA 1TMGE 2AOXA 2HHAA 2O8EA 3L04A 2GOYA 4XCXA 1LW6E 2QUZA 1RZUA 2WJIA 3JATA 3P45A 4EKGA 5A5VA 2QB5A 1VHLA 2HOQA 4QJIA 3B1FA 3N8GA 3SHOA 1U0TA 3A3PA 2DPXA 3OECA 3WLAA 4MULA 2H18A 3STXA 2X5OA 1I5EA 3LP8A 1L5MA 1KDZA 4QEDA 1KOLA 4QUEA 3TCXB 5AQ1A 3DP7A 7YASA 3KC2A 2C9BA 4MRMA 4N39A 2APJA 4TS1A 5BP7A 5HK8A 1J20A 4B8YA 3H16A 1TCCA 3L6UA 4K8OA 2C5BA 4RJLA 1RWBA 1WMAA 3T3HA 2BGUA 1PT8A 1FLVA 1QH8A 1WU7A 1RD4A 2C29D 1JR4A 4HL6A 5FUBA 4A3SA 1GEEA 4GVXA 4WY2A 5IBQA 3NFYA 5GZ1A 5CT6A 1RMTA 3K94A 3N2KB 1DG9A 4UARA 1OA0A 3AZPA 4ZZ1A 3RNOA 4MW6A 4WUVA 4OQQA 4ND4A 4A0SA 4YAOA 4AMBA 1N2CE 1S2MA 1E96A 2CYBA 3KKQA 1FYFA 3SFZA 4F6CA 3IH5A 4XYMA 5EPUA 3EGIA 3K6JA 3CO5A 3X2EA 4NS1A 1PQPA 1UXIA 1A77A 1TADA 3MHPA 3TPFA 4YALA 5IANA 1OOEA 3E61A 1H3NA 2XXBA 1RKQA 4V39A 4DQDA 2NU7B 3PNQA 3FWNA 4EW2A 3OP1A 3FDZA 3INRA 3BWDD 2G07A 3BWEA 4NI5A 1KDPA 4J3JA 5FPYA 4OVKA 4V2IA 3K0SA 3VOAA 1XYVA 1WUTA 3IRVA 2CLFB 2C2BA 1EWRA 3NJ8A 5DEOA 4ARUA 5AXAA 4BNYA 2NZ2A 4C3OB 1DZ3A 4XSGA 4ZRDA 1QVZA 1RJDA 5EXXA 4F45A 2HUPA 1SOMA 3I34X 3GFQA 4M53A 4M87A 3RUCA 3WB1A 3FLMA 1JEYB 2ZBQA 1II8B 3EN0A 4TT3A 3IA2A 3IUMA 5TQ0A 4BZWA 3AFIA 3FOWA 3M34A 4JJKA 4PAOA 1OTYA 4X6YA 3VKWA 1TM7E 2BUCA 3A9WA 4A10A 1F2UB 4AS1A 3B9BA 3FWPA 1CR0A 2ZBEA 3OZDA 3PVZA 1ECLA 5JO0A 4GOND 5K0CA 1NI3A 2FWBA 3C7AA 4RL4A 3VO2A 1PKXA 2QQEA 4XQ9A 4RGBA 3TGWA 3TLEA 3UOAB 1FS5A 3WYCA 1COWA 2ZULA 3VZSA 1HNWB 1XMJA 1CDEA 1PR5A 4J1QA 3F9IA 1ZD4A 2HDWA 3TAUA 1QGUB 5JCJD 2AX3A 4IKPA 3ZUPA 2DXIA 5FL7A 1OXBB 4KPGA 1UL1X 1VJGA 4IV8A 2VBCA 3OPYB 1IY9A 4YAEA 3R3WA 3TSCA 1QF9A 4AX4A 3EGWA 5JC8A 3SLKA 1V9CA 1VIYA 4I4LA 1CDZA 3P2IA 2GGSA 3QITA 3RB8A 1VOTA 2EQ5A 1B6SA 3SZRA 3E2IA 5EJ8A 3IJPA 1C9YA 3EOBI 3OQBA 2F1JA 4CLOB 1ND5A 5DSTA 2MINA 2PRJA 2W2XA 4K8RB 2X0IA 2BJVA 4CHGA 3UHFA 4XM1A 4ZU3A 3F7MA 4M6WB 3DA8A 3W7AA 3W5VA 2P9CA 1WF6A 4GP7A 3LSYA 4R9RA 4WZAB 4YPFA 1NDHA 2WFZA 4JBYA 3PU6A 4J29A 5A5GA 4J2OA 5REQA 3V7NA 2W6IA 5K05A 1UC5B 3IGFA 2ZI6A 3OZUA 5FBRB 1H5UA 3RLFA 1F17A 2QUHA 4PFKA 3W4JA 4JU8A 1GJRA 3RS2A 1HSOA 4MYCA 4DCUA 4M89A 5AM0A 3VHXA 4ZVRA 1TJ4A 2BZ0A 2BDUA 3I2YX 4TKZA 5AW9A 4R2HA 4CYMA 2B94A 4RFLA 3T7KA 2RGBA 4BNZA 1CDDA 2WHPA 2FKNA 5F2EA 1Z37A 2HSDA 2JGKA 4FFWA 2BR4A 1A4IA 1N75A 4I1PA 4JUCA 4OHCA 2QYOA 2VG8A 4HRYA 3S29A 3UH1A 1KBOA 4D0NA 5J2TB 3FB1A 1AMUA 2AC4A 2FN9A 3BB3A 5E6SB 2VPYA 4NBVA 4U1RA 4TMVA 1MX1A 3DBRB 4U0JA 8AT1A 2CV0A 4I55B 3L9XA 4B4UA 3ZHYA 1TXGA 4ENWA 2NYAA 2GZ1A 4NJEB 2QX4A 2RC6A 3DL7A 4RIFA 4UBOA 2P3SA 3Q7EA 4HEQA 4OHBA 3HCRA 1Y34E 3E6AA 4C1BA 4DUGD 1UCFA 2ORYA 2WF6A 4TSKA 4KQMA 4U6QA 1QPBA 2QN7A 4HN4B 4R01A 2QIOA 1BE0A 1WO8A 4BEJA 4OQXA 5GM2A 2ECKA 3KR1A 4KAFA 4QRHA 2ZBDA 4JSRA 4MKZA 4YMLA 3T3GA 3KQKA 1SZJG 2VT6A 3Q3CA 3PKJA 4RIGA 4CI0B 2UDPA 2PUTA 5BUCA 1ORVA 1P5FA 3IIMA 3QY0A 1JPUA 1ZD3A 1N2GA 2CSUA 2BE9A 1YOBA 3HDHA 2Q5JA 1PLKA 1JT9A 1IHPA 1W2WB 2V8OA 1FUYB 3KRTA 4Q3DA 1EB9A 3SVZA 2HUNA 3EQZA 3QWIA 2BFFB 3GT0A 3IT3A 2VTVA 3ZHSA 1U0FA 5EJAA 2QMHA 2QDKA 3GLFA 3TW8B 2C9YA 1ND6A 1K9VF 2DULA 4LXQA 3HFJA 1P7YA 2JLCA 3BTSA 2OBXA 1CR6A 1GCOA 3PTAA 2Q1UA 4FDAA 1DUVG 3T5BA 1JLRA 3ZJTA 1Q11A 2BZGA 3EHEA 4ASUA 3KPJA 3LBHA 1DQYA 2P6NA 3FLAA 1ZG3A 2UYHA 2YIDA 4JLMA 1AA9A 3GPLA 4Y2SA 1P7PA 3MBOA 4YMIA 3LXMA 5EMHA 1L4MA 1J09A 2GKSA 2B30A 1FQOA 3AUFA 3HKEA 3M6FA 4HB0A 4RLQA 1U0NA 5B1IA 4AY3A 5BPFA 5A1JA 3E2MA 1SOAA 1N9GB 1V7ZA 3DDUA 4P58A 2HMUA 2C2YA 3II6X 1KSFX 1LS1A 3AR7A 5KX5A 3G2QA 4JJFA 1ZN7A 1RWNA 1FJ2A 2OCBA 5BSUA 5IHXA 2HCFA 1U8UA 4IMIB 1UMKA 2O14A 2ATIA 2H1FA 2HWUA 3L0OA 3QFTA 4J49A 4EO9A 1CS0A 1E2QA 3ESBA 5K4AA 3NNNA 1XJCA 1BXGB 2C9OA 5CVEA 1NV8A 5DJ5A 4J7AA 5EN4A 4CDRA 2P4EA 4URFA 1E7SA 2IIBA 4G5SA 4BP8A 5LA6F 2IPAB 5AXBA 4TVSA 1H8HA 2FFJA 4M0UA 1I7DA 2O8CB 2B4TO 2DWPA 3W2EA 4BNLA 4BBZA 2GK4A 3JVDA 3UV3A 1BSVA 1POXA 4C6TA 2CJYA 4GKKB 2ZPUA 3L0SA 3NWPA 5DB4A 4CMGA 1BGVA 1SC9A 5CFLA 3BJRA 1KY3A 2B3DA 3I9JA 1X1RA 1TMOA 5AK3A 3IQEA 2QVBA 1AO3A 3NWEA 1UAAA 4MUKA 4C9BA 2VZ0A 3W9YA 1FJXA 2W2PA 1MRZA 2IYYA 2Y1OA 3VYUB 4AZSA 1Z0SA 1GLNA 1VE5A 3QVKA 3W4KA 3VOTA 5AESA 2HWXA 4M6WA 1S01A 3OLVA 1MR3F 4FYWA 1ZFNA 2D54A 1KYWA 4MICA 4LXXA 4RVCA 3S68A 3SX4A 5IT0A 1YA6A 2QDXA 2R11A 4F46A 1U6IA 3U17A 2ZRHA 2B8JA 1BH6A 1RCFA 1M33A 3CKLA 3DJYA 3IR6A 3PWTA 4JHXA 1KAMA 2I2FA 4FFNA 5H0IA 5T4HA 2UXBB 5HMLA 4BO8A 3AHJA 4BQRA 2PG3A 4JJ4A 2J85A 3RYIB 1DBIA 1LDBA 2HDNB 1FS6A 3EXIA 5BN5A 4LBWA 1COZA 3SE7A 3D6NB 3ADPA 1QHFA 2QRNA 3FGOA 2PJRA 4ZEWA 1AK1A 5B7NA 2JS7A 1CE8A 5KVVA 1YA4A 4QXMA 5PGMA 1N5DA 2LE0A 1UJCA 2WVGA 3A31A 4CEJA 3EIHA 2BEUB 4C5AA 3PE4A 5AW5A 2FQXA 4EVRA 4P86A 1CLUA 1F6WA 2BMWA 4H0CA 3EAGA 3JVVA 1O0BA 2O3RA 1VIVA 1NNUA 2WHRA 5KREA 1FRFS 5CVDA 3V9AA 1OWLA 1QP8A 5ESXA 3V8QA 5JSQA 2VAXA 2VJOA 1R74A 3MWGA 2X2EA 3NOXA 4FDTA 1JEYA 4P9NA 1W1IA 3LTNC 4KQGA 3LO5A 2ZS9A 3PD1A 3HMQA 2D0PB 2P5SA 4JBWA 3T5DA 3BFXA 3WGVA 2AE2A 3PL1A 1PJTA 3DC7A 2PKCA 4JLDA 4JL8A 1M2VA 5AJXA 2VHCA 5CR9A 1NI4B 2ECQA 3AIIA 2W4IA 2FETA 4EHNA 4ISCA 5F33A 3WKAA 4RS3A 1WDTA 2R6FA 3VZDA 1LF0A 1E1CA 4H7EA 3NPMA 1XFDA 3WV4A 1NBME 3ZE7A 2C4MA 2JLUA 3C6YA 3ZCSA 3HJCA 4RFVA 3TLKA 1L3CA 3BGWA 5K51A 5LUAA 1V0JA 1QHXA 1X7WA 3A4MA 4WLNA 2IYSA 3MJ4A 4INZA 3LUKA 2GPSA 1EWVA 1OFUA 2F3PA 3G59A 3BEDA 4BE7B 1DWQA 2IBSA 4M99A 1M8FA 1M8GA 1E0AA 2XT9A 3V8RA 4WRRA 3RUPA 5K20A 2V6MA 4I55F 5LOVA 1RLOA 4OI0A 1Y4DE 2IYPA 2P4HX 4GGOA 3JWGA 5MDHA 4FYIA 1BJKA 1LCIA 2BFEB 3JD4A 3WGOA 4E7OA 4EENA 7AT1A 2Q0QA 5JYEA 1EVZA 2Q2OA 3Q7RA 3NALA 2NUTB 1DZIA 3K5WA 1PZFA 1T9AA 1XRSB 3EWSA 3LMKA 3NUQA 4FEEA 4M7RA 4G5OA 1YUBA 3QPCA 4N0DA 1C1XA 1M54A 3NXKA 4GPD1 3L18A 1OJLA 4RVDA 4LY0A 3KTDA 5TJHA 1GOTA 4MRMB 3HYSA 3S2IA 1FTNA 4E14A 4IDCA 3LUHA 5DWVA 3MMXA 4B3XA 4BNMA 3H1TA 1E2MA 1NXOA 1RPAA 2ACKA 4MV4A 3S40A 3TD6A 4H17A 2XDQB 2Y8EA 3MUEA 3MWFA 3G88A 5FPHA 3BH6A 1QIKA 3EDYA 2J9YB 2RAFA 3CNLA 1SPXA 1IZ7A 2ZJOA 1EWKA 4KYTA 4JIGA 1S9DA 2O8EB 2DRIA 1HMPA 2PKWA 3HUDA 1N2HA 3EVGA 3OFNA 5HCUA 4GOJA 4JOSA 2CFCA 2WWGA 3OQNA 3UY4A 3ZWAA 3X1YA 4G0VA 1BE6A 3FWYA 3GRRA 4QGFA 5C35A 2DUWA 2FDXA 3IMGA 5IDVA 4TV9B 4A0GA 3FLBA 4ZT4A 4NENB 5BW6B 4HX2A 5JI3E 3AP1A 1O94A 1Y9EA 2Z08A 2GN0A 1TTTA 1A7JA 1QO0D 4QUJA 1X9IA 4WSOA 3W6PA 1NZDA 4KGDA 3VC7A 4UBIA 1W46A 4I8IA 3WGYA 3Q41A 3FKQA 3U62A 4Z3DA 3B1WA 2BHRA 3AX6A 3IUPA 4WJKB 2XOEA 4DRYA 1RDFA 1E6LA 1TKBA 3IPLA 4PRYA 2O54A 3FAKA 3LWNA 1QHEA 1KXJA 1GGHA 2BSAA 1XCBA 1VJ1A 3IQFA 1IEWA 4H6VA 3LOPA 2CNNA 4K9SA 5A0VA 3H5AA 3T0GA 4OJQA 1HQKA 1KI8A 1ZIDA 2EF0A 3MJRA 1GTMA 1KS9A 2NO5A 4C76A 3V42A 2FKAA 1X2BA 3P9QA 1KI2A 3PDHA 5A6VA 4M8SA 2C3UA 4QHTA 4MRRA 2AMLA 2W8BB 2YFYA 4QFDA 5AVQA 5A0TA 3H8SA 3UB4A 4C78A 3VOBA 1G4AE 4DDKA 2WTMA 1N5KA 1XEXA 3K4QA 3QLTA 4EJSB 3R4CA 5JR3A 2NNLD 3WQBA 2ZITA 3I4CA 4Y1RB 5CG1A 4RVSA 2ETXA 4OI1A 1FSGA 5TMBA 2WD8A 3FFAA 3RIMA 4F2WA 1QAMA 3EE6A 2NAFA 4KI7A 3NYIA 3TSAA 3K7EA 3SDBA 3M5WA 2ZSEA 4FVTA 1EFKA 3KDSE 1A9OA 4RVUA 3WAKA 1KHHA 2O8NA 2V6BA 3R3JA 4WDQA 3USCS 3WC4A 5GTDA 3Q8MA 1RXSA 1TK9A 4WT7A 3N0WA 2IELA 2ID7A 3OJFA 4YAKA 3B89A 4FU0A 4R1QA 4NMHA 3GZ4A 4EFDA 4S04A 1W0KA 3M2PA 2NO0A 3E82A 5DBHX 3QVUA 3UBTA 5H8WA 1M1YB 2QXYA 3EVNA 2RDMA 5EHIA 1MC8A 2GK7A 4AO7A 2R7MA 2HLDA 2W2OA 5B53A 2VUUA 4M38A 2HBYA 5HRAA 2GTIA 1DBWA 1NYRA 2DAPA 2XUOA 4FHZA 1T6NA 4I0WB 3S7ZA 4B47A 1WOYA 2CUKA 2PYIA 2NG1A 3ZK9A 2IPXA 4F4DA 5FPKA 2JCXA 1ZD9A 5EWLA 1YHZA 3DKIA 2B1RA 3CF6R 3QQ5A 4RK5A 2ADOA 3V7YA 2IH2A 2WLTA 3ZK8A 1UM9A 3PC2A 1ZKDA 3ZGYA 1TUBB 2NQ2C 2WA2A 5H9VA 1T3ZA 3A25A 3PUZA 4ZT5A 3VC2A 3WIUA 5CLIA 2BF7A 1R0SA 4V0KA 4YHHB 5DNDA 1KRWA 2GI4A 2ZUEA 1UP6A 2FCRA 2OG1A 4JB8A 2Q5FA 3GEHA 4GE3A 2ZPAA 1JJAA 1GA1A 1A4UA 3K1TA 4ZYUA 4GLLA 2ZI3A 3TM5A 4X1IA 3RS5A 3FSGA 4NXMB 4QXAA 5EZ5A 3VNBA 2PAAA 4FR0A 3QJ5A 3WKCA 1Y42X 4IO0A 4CDGA 4KWTA 3GVPA 5KMGA 3OEHD 1N9ZA 4RPKA 1YR1A 3BL5A 4IIYA 5I8PA 1PCXA 1DEAA 1QG0A 4A6DA 3AEXA 1LQTA 1J9EA 1UBSB 2VDWB 1O6FA 4E1VA 5JJBA 2BFCB 4KBYA 1OW3B 3RS8A 4DARA 3M4JA 4GOMD 2P3OA 5KNDD 1II9A 3AM4A 1RP7A 3HBNA 3PDIB 1JBKA 1WETA 1H66A 5KQLA 2XMZA 3NZEA 2CWWA 3N2GB 3DR5A 1J2RA 3OFND 5C31A 2FEXA 3OHPA 3C2QA 2BBTA 2FMKA 2WTUA 4JI0B 3QELA 4LDNA 3WO1A 2GAAA 2HPZA 4Q7MB 1E6KA 1YDGA 2QLFA 1G6Q1 3H5IA 3CZRA 3JYHA 4MR8A 2VTKA 1U02A 2C7VA 4NCBA 1R8SA 2HXYA 2RHJA 2ZUSA 4FLEA 2GNPA 2I6QA 4XEUA 4XWYA 4CKBA 4CIBA 5AJHA 2EX4A 1MV5A 1W88A 4J7CA 4L0QA 4RHUA 3EDOA 3ONEA 1TYBE 2ZCJA 1HDOA 2OCIA 5BT8A 1R4MA 4DVJA 1X0XA 4QM6A 1LDYA 3LPNA 1H0SA 1Z2PX 2MTBA 3COPA 4X85A 5TEWA 2H54A 4B2PA 2Q1WA 5EXEA 4P7GA 2QUJA 1P62B 2VJLA 2B3TA 1VI2A 2QD2A 3OZFA 2N75A 3IBSA 3UJCA 3S8YA 1W36C 1G38A 3LC1O 3VZQA 4PCUA 1KI7A 4FC6A 2R0QC 1SXJC 1QJ4A 2RGNC 4FZ5A 3UWMA 3RRBA 4GKBA 2H4JA 4H1VA 4ISBA 1AZTA 1YZUA 2QE7D 2FV8A 2HRBA 3EZLA 5FPPA 3IEVA 1NX6A 1WMFA 4FKZA 1C7FA 1RTKA 1W6UA 2RHHA 3N76A 2IYFA 3PXXA 3R6TA 3TIXB 3U3DA 1MVLA 1TMYA 1E94E 3GNTA 4B7ZA 3I52A 1R6XA 3QP9A 3H7AA 4FYKA 3B2QA 3TUIC 4AMGA 2KHZA 2FEMA 2RGWA 4QQNA 1K68A 2IC5A 1RS0A 5K0BA 1IG0A 1UDBA 2AZMA 3QKSA 4G9GA 1XTIA 1UP4A 2YZGA 4LX0A 5CK4A 1T5LA 1S6YA 2ZRNA 2WJYA 1CPYA 2OCLA 4Q21A 3ZKAA 4P4TA 4ER3A 2Z9DA 4UJ5A 4QHYA 2ISSD 3GNQA 4X0EA 2A58A 3R7DA 1DNPA 1K1EA 2C31A 2O3SA 3D6FA 4QUKA 3JQCA 5AWFC 1PLJA 4ARSA 4IQGA 5TE9A 5K9ZA 3U1VA 3IAS1 4WXYB 4GLOA 5EEHA 3QNMA 2QG4A 1RMQA 3K0FA 3N9IA 2YY6A 1UKZA 1IEXA 1UQUA 3IOYA 5E38A 2AZ4A 1G8FA 2BLNA 3O8LA 3QEOA 1HE1C 2A1TR 1H2WA 4WKCA 1FX0B 2FFBA 1Y6QA 2GQ0A 3D64A 3KQTA 3LRXA 1N5LA 1FRVA 2A5YB 2XF8A 4FLMA 2FOIA 5H02A 3GLKA 3N2IA 3VNQA 4ITUA 1C9NA 2OUKA 3NU1A 1W48A 4XD7A 4B6JA 1CXZA 5DN6A 4Z4CA 5B1DA 3NM5A 2RB5A 3VR6H 3GUVA 1T9ZA 2Z5FA 4DE5A 1BGWA 1Z82A 2VSYA 1KFBB 4R8LA 4NBWA 4UDOA 5JC1A 2H48A 3DEHA 2WZQA 1UEJA 1NNI1 4FN5A 1U0RA 1VHQA 2HWYA 1XCLA 4M9XA 1AQ6A 2VTDA 3R7LA 4C3UA 5C8YA 2G6TA 1M66A 3FVWA 4DYDA 6ADHA 3N6XA 1GM5A 3FJOA 2G82A 4LHYA 4MS1B 3K9FC 3ZGZA 1G18A 3OTWA 4QOIA 4EMBA 2A1UA 2R8OA 4CTNA 2WF8A 4Q16A 4UU0A 4DDVA 1ZCAA 3BGVA 3WMEA 3UYLA 5A5EA 2OAQ1 3E0XA 4O4HA 5BXYA 4BE9A 1X7YA 2JCGA 5FI0B 1Q0LA 4MV7A 2Q4DA 3HJFA 1J49A 1XD2B 2GRUA 3KJZA 5CXUA 4L4RA 4R0MA 4GM4A 5EJ7A 4WK2B 3TW0A 2CFRA 5LQKA 1YDMA 2G9ZA 5JANA 1FMFA 2RKBA 2GZSA 4Y9RA 3P52A 3OEWA 5FXMA 4YQEA 2X0DA 3ZNNA 2WKPA 3IVRA 4HCJA 3ZWWA 4C1NA 2P5UA 4OXIA 3S3TA 2Z6UA 3ZWMA 3LKZA 4FMDF 4WNAA 2HSWA 2Q1TA 5KAMA 3NXSA 5FT9A 2X8JB 3IQIX 3KKZA 4LV5B 4XM0A 5FFNA 1BEZA 1MEOA 4JI1B 4DTIA 3AU8A 4KUHA 3VYWA 2YHIB 1B0AA 2YMPA 3VZCA 2MOKA 3CTPA 1X1TA 3ZQKA 1XVUA 4AG6A 2WUWE 3PNPA 1LFAA 4UC0A 3EIEA 4AUEA 1QOQB 1TAHA 3R5KA 3R2JA 5KTNA 3Q11A 2FMTA 1TAGA 3G8YA 4YUVA 4HX9A 3SJZA 1G7TA 3BXXA 4Q4AA 4K86A 1ESEA 5JSZB 1MZPA 2UU9B 1KEEB 4RJJA 4U4AA 2JRCA 4EHFA 1NU8A 3KFLA 1PVVA 1T3LA 1RHKA 1KI6B 4H4EA 5ER6A 5D7BA 4I4TA 4V03A 4NV0A 2I7CA 3W05A 2GARA 2HU7A 2MYPA 1T43A 3PKZA 3ZD8A 3M70A 4GKAA 2MYUA 1A7AA 4CCSA 2EJBA 3UJAA 2YZKA 2AR0A 4KI0A 1EM6A 2XCTB 1J9GA 1W73A 1C1DA 2F62A 2X77A 4PYNA 4H1UA 1BKYA 2VSOA 1YR8A 3E3NA 2QYSA 1X7DA 5A4KA 1JIKA 1G2QA 2FHSA 3F5QA 4WCFB 4RHYA 3A1FA 3HUEA 1A71A 3H05A 4QQKA 3H2ZA 3OPYI 4LNAA 1GA4A 2ZRMA 1UK8A 2RARA 3S2ZA 4Y9DA 4CLEA 4MAAA 3Q9UA 5C1OA 1ZVQA 1KVSA 1U3FA 3F6EX 5H3LA 1PNRA 1P39A 4EL5A 4KQXA 4MJ7A 3DWFA 4DANA 5LP6C 3KQNA 3G0BA 2R86A 2IXDA 4L74A 2FRXA 4HSEA 3IQWA 1XDZA 4Y18A 2GFIA 1TEZA 3O0TA 3G6WA 3BXPA 4GG1A 1OXUA 4MCAA 4N82A 1NF2A 4Q3BA 3RU3A 5B55A 1A88A 3OA2A 2JI6A 4CTMA 4G0WA 1ADCA 2OBBA 4K9MA 2JL1A 3RIXA 5JIBA 2E87A 2ZJBA 3GX1A 1FP4A 3T6KA 2O2HA 1BE8A 2ZXUA 1IUNA 3KQQA 1LPPA 1MKYA 4CKCB 2XHEA 1S3FA 4PX2A 5J59A 4NU0A 3KTAA 2OFOA 3CVJA 3EVAA 3EIXA 1NFQA 4AXXA 3JALB 3V4ZA 1PDOA 4FR5A 1MOSA 3LV8A 4JJZA 3U6KA 2PRYA 3PPYA 5LWQA 1XZFA 4L7QA 2XYVA 4M83A 4R1UA 2RG7A 5AW2A 3S1AA 3BGDA 1YSCA 1ZRNA 3DV0B 3L07A 4L85A 1ZH8A 4PAWA 2C4TA 4UUAA 3OFVA 2NU8B 2FUCA 4CF6A 1KPGA 1P4GA 2XNKA 3GRCA 1ZLYA 4Q6BA 2UUPA 4O2AB 5C80A 2YHSA 3PUJA 3R7WB 4H7IA 8ATCA 2KQUA 2OCPA 5E7MA 4PPGA 3ZG6A 2C4KA 4OKIA 1QO0A 4PZ9A 2Y3IA 4YO8A 2FE1A 2XWJI 3O84A 5D5PA 3S5JA 1DADA 1JR3D 2GJSA 5KYUB 3TNLA 3UT5A 5IKEA 3U1BA 3LKVA 2PZGA 4LJYA 4CKYA 1NN5A 4O4IA 4GM1A 2B7LA 3RQIA 2RH8A 3KZMA 4OA8A 2FPIA 4E33A 3TO5A 4RV9A 5LNK6 2CEAA 4KODA 3AFGA 4Y7CA 5EIFA 3U3OA 3V4FA 2B61A 4X3CA 1SN7A 4DCOA 4HQRA 4X7MA 1NIPA 1EP1B 2X7XA 1ID1A 1EXDA 3SQDA 3FJ1A 3L0YA 2O7NA 1TM3E 3I5XA 3JX9A 4LI0A 4MW2A 3LXUX 4YJ3F 1ORDA 5EKSA 1Z2AA 2GEUA 3T95A 4A03A 3DT9A 5KNBD 2YCLA 1NMSA 4IIXA 4ZRNA 3M1YA 3QWBA 3ZUGA 1TVKB 4AZ3B 3K9BA 2Z2IA 2JKZA 4RDIA 3FM9A 5JNWA 4N1AA 5F3RA 4X63A 3RU7A 2RGDA 5LYJB 4BO2A 2G7MC 1ZMTA 2IE0A 3IHTA 4JYPA 3R5JA 2Q21A 1RZ3A 1V8ZA 1Y3IA 1RQLA 1WY7A 3C3DA 2BTQB 1CTQA 2NLOA 3EA4A 4JJGA 5TPZD 2AK2A 3L8GA 1WVMA 1QUEA 1Z73A 2E7ZA 3L1UA 5HOQA 2R00A 1NFFA 2JGIA 3TTYA 3UT5B 5IT9A 1RHMA 1UDWA 1R8YA 4J0IA 4XRGA 2OT3B 3A11A 1ONBA 2PFKA 4D56A 3B13B 4YJKA 1XCMA 4OJNA 1FVXA 2Q50A 4IPTA 5DO9A 3VPHA 1KVUA 4ER0A 3B7GA 2W2NA 1M6WA 5JMTA 3A6ZA 1UXGA 2WZDA 1AIPA 1Q3HA 1RXUA 2TRSB 2HSZA 3TK1A 4JOBA 4FGLA 3BMCB 3IT1A 4WOJA 1Q2UA 1VPDA 2CNLA 1QYCA 3EISA 1LD3A 3DV9A 1HLPA 3JZAA 4Q9JA 4YR7A 1DKPA 2BM9A 1FSFA 3HN2A 2P68A 1FFAA 3WYBA 2YWBA 2YVQA 4AIIA 3DWEX 3GV0A 4OMFG 5GONB 1A8QA 2PX5A 4HWOA 3L6CA 1NVMB 1HV8A 5GZ6A 5ALOA 1E6CA 1XCGB 2IZOA 3QPWA 5FI5A 1CQPA 1N8SA 1CQIA 1I51A 1JLHA 2GK3A 2OHJA 5E1OA 1G8PA 3TQFA 3TX2A 1WMBA 5J4KA 2ZU6A 1ZIOA 3TOXA 3WHKA 3KUCA 3NOVA 3DGFC 2XRFA 3U4CA 1ZL2A 3VPBA