1NVKA

T4 phage bgt in complex with udp and a mn2+ ion at 1.8 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
351
structure length
351
Chain Sequence
MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA beta-glucosyltransferase
publication title Crystal structures of the T4 phage beta-glucosyltransferase and the D100A mutant in complex with UDP-glucose: glucose binding and identification of the catalytic base for a direct displacement mechanism
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase
total genus 128
structure length 351
sequence length 351
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1nvkA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1nvkA02
1LWOA 2QN7A 4MI6A 2GPAA 1XC7A 1KTIA 1FS4A 3WADA 1FTWA 3NC4A 5DXFA 3OT5A 1NOJA 3HBFA 3ZCVA 5LQDA 4W6QA 3QKWA 2JZCA 5D00A 1L7XA 1XL0A 4MICA 2X6RA 1YA6A 3PE4A 1XOIA 5ENZA 3O3CA 5TMBA 3BD6A 1PSWA 1FU4A 1L5RA 3HBJA 2X0FA 3MQFA 4AY6A 1F6DA 2QRGA 5TVGA 3CUWA 2R68A 3G2KA 1JEJA 1XKXA 3OTIA 4AMGA 1NVKA 1PN3A 2GEJA 2IW1A 3BCRA 3MT8A 4F9FA 1FA9A 3VDNB 3GUHA 4X7MA 1VGVA 5GPBA 2O6LA 1NZDA 2F3UA 1WUYA 3BEOA 2GJ4A 1C3JA 3L79A 2XGSA 1JIUA 2VG8A 3OTHA 1RZVA 1RRVA 2G9UA 3S0JA 1XL1A 1GFZA 1L5QA 1H5UA 1NLMA 3VUFA 2QN3A 1Z62A 4HLNA 2GM9A 4Z5XA 1Z8DA 3MTBA 1UZUA 5IKOA 2XMPA 2PRJA 3NP7A 2IYFA 3DZCA 1FC0A 4CDRA 1FTQA 1AXRA 1P2BA 3L7AA 5C1DA 4G2TA 4GZ3A 4FZRA 2QLLA 2QN2A 3CEJA 4RIIA 5D01A 4M7PA 1F0KA 3SYRA 1NOIA 2ATIA 2G9QA 2BISA 3G2JA 1QKJA 2XA1A 2PYIA 2FF5A 4GZ6A 4M60A 3H4TA 1K06A 3L01A 4RIFA 3D0RA 2C1XA 2X0DA 4YUAA 8GPBA 5IKPA 3VUEA 2AZDA 3CUVA 4FKZA 2QRQA 4NEQA 3TOVA 4F97A 1SXPA 4WACA 3MRVA 3G2LA 1Z6PA 3D0QA 2C9ZA 2X6QA 2QRHA 1A8IA 4N9WA 5HXAA 3BCSA 4WHMA 2P6PA 2GT1A 2VSNA 3OY2A 3CEMA 3Q3IA 3ZCTA 2XA2A 3T3HA 1XV5A 2ECPA 4NESA 1QM5A 6GPBA 1GPBA 3VDMA 2QLMA 1L5WA 1GPYA 1JG7A 3C4VA 3T5TA 4X7RA 3ZCQA 3D1JA 3TSAA 1GZ5A 2FFRA 4YI5A 3ZCRA 2VSYA 2HY7A 1JIVA 1WUTA 3C48A 4LEIA 4MHOA 4XIFA 1UQTA 3E3OA 2QN1A 5JTUA 3MRTA 3T3GA 3L7CA 4N39A 2F3QA 3MT9A 3S28A 4CTNA 1C8LA 2IV3A 5DLDA 1IIRA 2WTXA 1L5VA 3S29A 4XI9A 4GYYA 2GPNA 1E4OA 3BDAA 3CX4A 1PYGA 2AW3A 1M5RA 4RIHA 1WW3A 1IXYA 2QNBA 4AN4A 3ZCUA 3CUTA 2F3SA 4MI3A 2Q6VA 2OFFA 2BGTA 4PQGA 2SKDA 5TMEA 1BX3A 3G2HA 3G2IA 2F3PA 1P4GA 2C4MA 2IUYA 3Q3EA 4BQIA 4L22A 2F9FA 2XCIA 3OKAA 3NP9A 1FU8A 3EBOA 3HBNA 1P2GA 1WV0A 4RELA 2FETA 3CEHA 3S2UA 2IEIA 1K08A 4REMA 2G9VA 4MRAA 3MTDA 3CUYA 3S27A 1AHPA 3OTGA 2PYDA 2JJMA 2R4UA 3Q3HA 3WAGA 2QN8A 1UQUA 2IV7A 1RZUA 3RT1A 3GPBA 3TAXA 4WADA 3RHZA 2C1ZA 1ABBA 4EL0A 3AMVA 3BD7A 2AV6A 2KS6A 2VCEA 3FROA 3DD1A 3T3EA 3NCHA 4KQ2A 2XGOA 2BFWA 2XGMA 1WW2A 3MRXA 1L5SA 3HBMA 3MS7A 4NC9A 7GPBA 1Y6GA 3RSCA 4RBNA 4BFCA 4GPBA 3MS4A 1GGNA 3OKPA 4EJ2A 2XCUA 1P4JA 4EKYA 1Y8ZA 4KQ1A 1HLFA 4M83A 1YGPA 1FU7A 1EM6A 2ACVA 5TMDA 4KQMA 3OY7A 3T3DA 3ZCPA 3G2NA 4QLBA 1JG6A 2BGUA 3DDSA 3OKCA 4X7PA 3T7DA 3EBPA 3IAAA 4EKEA 1WV1A 3IA7A 1P2DA 4N3CA 3UYLA 4GZ5A 1P29A 3CUUA 1O6CA 1SXQA 2R4TA 3BD8A 4MI9A 4AY5A 1PNVA 4GYWA 3NPAA 2IEGA 1LWNA 5I45A 1C50A 4CTMA 2QRMA 1FTYA 4N3BA 3MTAA 1NOKA 4LDPA 1Z6QA 2ASVA 4MHSA 1L6IA 1EXVA 4RENA 2IYAA 3E3LA 1B4DA 3DDWA 3L7BA 5JTTA 2H1HA 2SKEA 9GPBA 2ACWA 3SYMA 4EL5A 3C4QA 2XA9A 5BNWA 3NAZA 4N3AA 1Y6FA 4YI3A 2ZB2A 4BQFA 2JLBA 3T3IA 3NB0A 1J39A 2R60A 2YJNA 4HWGA 2QZSA 2PRIA 2H1FA 1GG8A 2VCHA 3E3NA 4X6LA 2GEKA 2QLNA 1V4VA 3MBOA 3UYKA 4AMBA 3L7DA 3H4IA 1E1YA 3BCUA 3CV3A 1JIXA 2AMVA 2QRPA 3QHPA 3WC4A 2X0EA 2GPBA 1C8KA 3ZCSA 3RSZA 3MS2A 4RIGA 1GPAA 4F96A 4BQEA 2SKCA 2R66A 3COPA 5DU2A 4RIEA 3MT7A 3MSCA 2G9RA 2QN9A 4CTOA 3PE3A 1NZFA 2PQ6A 1P4HA
chains in the Genus database with same CATH superfamily
1BFUA 2H63A 5JNRA 2E4AA 4HY3A 4M36A 1DC3A 3VU1A 3VSEA 2JBAA 3PIIA 1GL6A 2AG1A 5H1YA 5BW4A 3MN1A 4GEGA 1GIAA 4FDAA 4IINA 1L5HA 5CVJA 1IHDA 3TQQA 4RAQA 2HMUA 3VO8A 1EVEA 3OEHD 4LOIA 1TKBA 3P71T 3PRYA 1YL5A 4GZMA 1I94B 2ZIGA 4OQYA 5GZ3A 2PXCA 5DNYB 2VDJA 3HBFA 4FS3A 3SIPA 4K6CA 4YAUA 2VJCA 1MEOA 2IEBA 1E2MA 4FMBB 1C1YA 5EMKA 4CMAA 2BBTA 1DTEA 1QO0D 3U4GA 2ZJFA 3KOMA 2VYND 4BNFA 4LTNA 5D3ZA 1EQAA 2V7QA 3MAJA 2HADA 4YMTA 4WESA 3PPVA 2AQIA 4JGIA 3EE6A 5K51A 3TGWA 1Z25A 4Q7EA 3FPFA 3K4HA 1AKMA 3OU6A 2FWJA 4B40A 3JPYA 1V1RB 3DFUA 1M8KA 2XOEA 2XF2A 3TEJA 4EECA 5C18A 3N5KA 4JQOA 3PU6A 5H4HA 5BXYA 2CZQA 2HA3A 1IY9A 4WN9A 2N46A 3SOZA 1R6VA 1GQFA 1X6VA 3F73A 2BSQA 4R7GA 1Z4NA 1GV0A 2X5OA 5L95A 1IOZA 3WYBA 2EFDB 3EODA 1XKQA 2JK1A 2MSWA 2Q6KA 3AT1A 2EZTA 3LQFA 3TPZA 1CE8B 5SYNA 4LDQA 3PTLA 4AY6A 1F6DA 4B74A 1PD1A 3OA0A 1MGOA 3SEAA 3AETA 2I76A 4G8CA 4CPDA 4Y9RA 2VA8A 3A6LA 3IXMA 2E6KA 1PN3A 5K3BA 5JAHA 1ZW1A 1AV7A 4WZBA 1D1QA 1KEPA 1JHVA 1JT9A 2OZVA 3NYIA 4FONA 3E4DA 4P35A 4PGMA 4Q37A 3ZU4A 1NLUA 2O2HA 2ZWVA 3GUHA 4GPZA 4MUJA 4NCKA 5IC6A 3TXXA 4CG2A 2QZ4A 5I7WA 5CNIA 4W8OA 2DUMA 3WL6A 5H9WA 4CTKA 4BDSA 3D6FA 1HDIA 3D59A 2WJ4A 3ABIA 4L2IB 4TWAA 1NUQA 3QJGA 1NBEA 2QTMA 1OGIA 3FFWA 4LNHA 3A06A 2Z3ZA 4OAOA 1UXKA 2PR7A 3LK7A 1PJ8A 3IDFA 3N6XA 4R2XA 5IEBA 3WMWA 2LCQA 1IK6A 1JYEA 2C9YA 4XIYA 1PR6A 1WZIA 1YFKA 2C92A 3WB2A 1L5QA 3SX2A 1L7NA 2DFDA 4FCWA 4M76B 1ZJZA 3NBYC 1FXUA 3HLKA 2QN3A 2VXYA 2YQZA 3GJRA 2RGBA 1VSTA 3HABA 5DHSA 2J0SA 2W22A 5KREA 5FB3A 2GM9A 1SCDA 2JKYA 2QT1A 2ZK7A 3T9DA 3RYHA 5B1EA 4L95C 3WDSA 2PBLA 1KPHA 1OU4A 3O8QB 3PZRA 2QVYX 5HFJA 3FF4A 4V2IA 4GE3A 5LXTA 4UM9B 3K16A 5SV2A 2AS0A 3O93A 4WY5A 3O8NA 2WD7B 4MAAA 4Q18A 3HDYA 2FRXA 2C04A 2ZSFA 5IX8A 2E5FA 1RYEA 1MZVA 1OASA 5BW5A 2HXSA 3TGLA 1EFHA 3TIVA 4R05A 1R0RE 2VWQA 1E9BA 3HQ4O 3E9YA 5L3QA 2YS7A 2GMWA 2Z1MA 4IJMA 1M2VA 2VDKB 5AUPB 2QTNA 1PQ4A 5U4XA 3SC3A 5IBQA 4MPRA 3T5CA 3JR7A 2IPAB 5IJXA 1RAFA 5GZ6A 4C7BA 2X5KO 1N6LA 2QD5A 1LXCA 3MG9A 5H3HA 1YVRA 3DFIA 3OZCA 4A8HA 4BFTA 5BNZA 1S2NA 1D04A 1P1JA 5AR1A 4ZVQA 2XRZA 5EE0A 5AVXA 4N49A 4B3BA 4JEMA 1YZKA 3V7NA 3HADA 4RJJA 1L4NA 1PL6A 1VCHA 1O6BA 4TL8A 4OLBA 1I30A 2FOIA 3L01A 4MP6A 1OXVA 4Q7MB 5T7BA 1PFUA 5DEOA 4LJKA 3QEJA 4QOGA 821PA 3MM4A 3GLVA 4XQ9A 3VHRA 2CLEB 2GN2A 3O91A 4YCNA 1FNCA 4NX2A 5FT9A 3E8SA 1SA0A 2PL9A 2A0FA 1A7UA 1P39A 3AB8A 3VZQA 3ASYA 5EWLB 2Q8QA 4YFVA 2CY0A 1GSIA 4H7FA 1EJ0A 1X1CA 1HL7A 2FMHA 2LE0A 2XUHA 4OX9B 5K3EA 4BQOA 1R4ZA 3D7RA 5LBIA 3DZ8A 4GBMA 3C3KA 2PUAA 1EK5A 5A4MS 3PXCX 5IYZF 4M1QA 4DJDC 2HGZA 1LB1B 2CUNA 2VPZA 2FSIA 4HXYA 3W8RA 3HXOA 3IESA 4GOKA 4WHMA 1NPDA 5CFPA 2GQ0A 4NU6A 5DM4A 3N05A 3FG9A 1U0SY 4I9NA 3TQHA 3FNGA 1ZQ9A 3L7OA 4CL0A 2IX9A 3B1ZA 1PE0A 4JLBA 4WIAA 3TBFA 4EB0A 2NYVA 3HV2A 1YVUA 5JD4A 3TNFA 2RGAA 1Q11A 1ZNZA 3RRBA 4OQLA 4J91A 4P32A 3OLXA 4X24A 1RHQA 3BFPA 5DVZA 5HILA 4KREA 2O8EB 1BE6A 1W0JD 2VQSA 2FHPA 2JFPA 2VDPB 1QIJA 1VKZA 3ISTA 2O57A 3HDHA 1WDKA 4ZI5A 5ED4A 2JLXA 1TA9A 1CLEA 5HKBA 2CV0A 5THKA 5AW3A 1UXGA 5F98A 3STYA 3L5KA 2FFRA 1H2RS 3AESA 4HN4B 4OQQA 3IGFA 3W78A 3W8DA 4CKYA 3II6X 4G1BA 3AF3A 3J7AC 1QQTA 1RAGA 3CONA 1GITA 1TTHA 3L77A 3DV0B 4QO7A 4WK4B 2H8KA 1XZAA 1U81A 2YWDA 3BSYA 3DZHA 4C03A 2QN1A 3BQ9A 3GHYA 3OEYA 1F51E 4RA6B 4OJNA 3WYEA 4BNYA 1V8DA 1WXFA 4BXOB 3RC8A 1KXZA 3KXIA 3MT9A 1ORIA 4ZT5A 1KERA 3DZFA 3S28A 1ZOPA 1UJ2A 4BX2A 4YRPA 5AM1A 2BE7A 4S05A 5CEEA 3U7IA 4KPYA 1XDBA 1MB4A 1TFRA 3CZ4A 1O8CA 1DCFA 3KKQA 2Z5LA 5D7NA 4QRDA 3D7LA 4C76A 5HKKA 4CZ2A 3HSSA 1ZR2A 4JBHA 4MS3A 4UUMA 1VL1A 4UUQA 1HY3A 1S3SA 2FZKA 3I53A 3K05A 4UE2A 4F9GA 4EO9A 4G5XA 3S4YA 4EUFA 2QNBA 4FPXA 4I1UA 1GGHA 4JELA 1W4LA 1XD2B 3ONDA 4OJYA 4CMBA 4KYUA 2XNDA 5EMNA 3WLJA 3NJ4A 4N0EA 2HIMA 3SNHA 5G3ZA 5B7QA 3DLHA 2ZSKA 3CE6A 1QOZA 4HJRA 4MW5A 2EJUA 1NYRA 4KDCA 2NU6B 2PUCA 4PM4A 4UM5A 5IWAB 2IDMA 2ZRDA 1ECCA 4LA4A 4BWVA 3B7GA 3E9MA 3EXHC 4B4VA 1M6NA 4B3FX 3A1FA 4L22A 2WIKA 4I08A 1IN8A 2XCIA 4MKHA 2P69A 4WKBA 4E2FA 1WXEA 1E1QA 5C4GB 1FU8A 4QTYA 4ZVTA 1FL9A 3R44A 2H3EA 1R5BA 4G5HA 1YKGA 4OYYA 2UZ3A 4X3PA 4UU7A 4QGGA 3V4ZA 1T3HA 3UHAA 3D6NB 4TUYB 1PI3A 4EA8A 4CUKA 2EARA 4YALA 4A2CA 2P1ZA 3DZGA 2G6TA 4YLGA 1UINA 4I8XA 1CRZA 4ZANA 4ZVUA 3W2EA 1MB9A 4B4UA 3BD9A 4FEAA 4UAGA 4TV9B 4M21A 1W8DA 3AKEA 2QLBA 4OHXA 3ADBA 1EFDN 4K9DA 1Z82A 1JLMA 1SPBS 5DN9A 1F1JA 2VDRB 3PGLA 3WAGA 2NSJA 4EHDA 4HDRB 3QEBZ 3K0BA 3TRJA 1C1XB 2NO7A 1TX4B 2IOFK 2BT4A 3GFTA 4OXYA 4RV9A 5CLLA 1UBOS 4U6QA 1H6CA 4DLNA 3M6WA 4JXZA 4A8JB 2C5HA 2P9QA 3SPXA 2LNDA 4ZYVA 3ROMA 3FPGA 2B78A 2AVDA 1P0MA 5BR7A 4ISCA 4QGBA 1TA4A 1SUSA 2R7MA 3S68A 3S81A 1LDYA 1EAMA 4BNKA 4RPJA 4KJXA 2AV6A 4ZEVA 2PRSA 2BAGA 3JQAB 2XXAA 1VJ1A 2QVXX 5KYXA 4PZCA 1PZEA 4HTFA 1L9XA 2BFWA 4KAFA 3ZHVA 1BX0A 3G0BA 5A06A 4HEA6 5J5CA 3U3OA 2I4TA 2ODPA 4XQCA 1TIBA 3GPDG 3HCFA 2AEMA 5I7AA 1O77A 3T1QA 5BN1A 4LF7B 1AN9A 4YP7A 4DB4A 1A96A 4MWBA 4H1TA 1X92A 1ZMRA 2BUCA 3RLIA 4EUNA 5CBKA 4KAJA 3CKMA 3PGKA 3NZEA 3NVDA 2ADFA 4OSPA 3NC0C 5FV7A 5L51A 4OO3A 3WO1A 3GQBB 4TQAA 1ISPA 4X94A 1XYVA 4OFBA 3HS3A 4ZJYA 2MOKA 4LZJA 1ESCA 2O3SA 1VKNA 3VJLA 3IAEA 1WM1A 5CNJA 5DI3A 1QIEA 1DAHA 3IR7A 5DFAA 4W8HA 4DBLE 1G8MA 4HQ6A 2I7XA 2IUSA 2M1XA 3HE3A 4P7BA 4EJSA 1AS2A 1N5MA 1C4KA 1NR1A 2NXWA 3FZNA 3H9JA 3N0RA 2QBYB 1N6NA 2ZYDA 5DMXA 3C16C 2VK2A 1YDEA 5PNTA 4BMPB 1OY1A 2MMGA 2YFQA 3ROGA 1NXXA 4BUCA 3ISVA 2OQRA 4PBTA 1N3YA 2FKAA 2Z9CA 2PX2A 5C1PA 1X14A 1S4MA 2HRZA 4B5KA 3ZBPA 4BQRA 4DLPA 1JG6A 2E37A 4G0VA 4D98A 2FPGB 2QWXA 1XK7A 3DWIA 5DULA 2J41A 2XMBA 1JLLA 3AONB 3KU4A 4ZA2A 4KWCA 3ZWCA 3A9SA 1Y7IA 5K3OA 4BOYA 3B20A 3AVWA 4QFCA 1AGRA 2VIIA 1BXGA 3WA7A 3ESXA 2ZUSA 4A5SA 5IABA 3B1VA 4RULA 3ZLUA 2XZLA 2V4ZA 1KI9A 2B1QA 3TLMA 2J3JA 3BZBA 3EVCA 1DTWB 2Y1EA 3INYA 4KZKA 4V0LA 3RUPA 3SXUA 1IQ0A 5E6RB 2MINB 2YICA 1B74A 3GC6A 1SQSA 4AMVA 5FWNA 4HRVA 1R0ZA 1KORA 1V95A 4LJAA 4O2BF 4PEVA 4V2UA 2BEVA 1N5LA 1JKIA 2IEGA 2YVUA 1KJIA 3HP4A 5LDGA 4CTMA 2JFQA 3PWZA 1UWCA 2RAPA 1OBFO 3BH6A 1YBHA 3ZBQA 2CXPA 3NHBA 4YX9A 1T2DA 1IVYA 2ZUFA 2A67A 3UCXA 3BB3A 2QOEA 3OOWA 3M9WA 2QZJA 1XTJA 3WL8A 2C07A 2HXGA 1OZGA 3UAWA 1XVAA 1G2QA 3ECAA 4D3DA 1U7HA 1UFOA 2QQEA 2XJ4A 5KAMA 4LVUA 4IUBS 1BMFD 4ZPJA 1ZJ6A 2D06A 2NADA 3DHWC 4KX3A 4EPRA 5JCZA 1OAKA 4AS1A 1YI0A 3E6AA 2Y1KA 2QPAA 4P80A 1MB3A 1QHXA 3KWJA 1SCJA 2HRQA 3OE5A 4FQ7A 1MB2A 1QJ4A 5SY6A 3FTEA 3KT0A 1MABA 1U7ZA 3C4QA 3FYTA 2X2EA 2ES4A 4KOAA 5ALXA 1AS0A 5IEJA 2AN4A 3UMJA 3D3KA 3DVSX 4FGKA 3LIPA 1CZUA 4FGWA 3ZKAA 1BVHA 4YA6A 1CUBA 1U8CB 4LRWA 3PIRA 2K7ZA 2AQKA 1QH1B 2EZ8A 1R6AA 4PFKA 5FTKA 3OQIB 3QELB 4Y6GB 2AI2A 4N65A 4CM8A 3EMVA 3U40A 3EOAI 2ALJA 4TL6A 8LDHA 3UGJA 4PYKA 2WUFA 3CR7A 5TEVA 1B6GA 2GEKA 3HUFA 4HUQB 1A5SB 3LPMA 4UBNA 2FPPB 5F1PA 4IQ8A 3W2IA 2QLNA 4C4YA 5BMOA 2II6A 2Z98A 4HG2A 5F7ZA 3BF8A 2GNAA 1IDN1 1O5OA 5C31A 1HDCA 1XIVA 4C89A 1VECA 3IHTA 5LYJB 4NXMB 1SPXA 1F06A 4KXWA 2HLHA 3VNAA 4AF7A 4AULA 3WJ2A 2G72A 2Q0SA 3KX2A 3NM4A 3FUWA 4FZ3A 1T4DA 4BCBA 5HBGA 1AF7A 1DWQA 5JJIA 2RHTA 4FYVA 4X6YA 5FJJA 4CGZA 3PA6A 2WPDD 1P3JA 3C45A 3GT7A 3T4UA 1F8YA 5LIRA 2A9OA 4FE4A 4DV7B 1QUFA 4GM0A 1MXFA 4BQEA 1ZGHA 3WLLA 5JADA 5DU2A 4Y9UA 3MSCA 2GF9A 4M22A 2ZUTA 1HE8B 1CUGA 3LUCA 4LOAA 1ECBA 1U6JA 2AKEA 4NU8X 2GRJA 1Q44A 1KO4A 2X4LA 3IR5A 1FXWF 3EMDA 3QXHA 4ZU6X 4R16A 2C82A 4Y98A 1LPSA 4WXYB 1DAFA 1P4HA 5I7SA 4J49A 2GBFA 2FZGA 2C0QA 1CJKC 5IBRA 2FPRA 2HQBA 2OCXA 2I2WA 1TJ4A 4MRMA 3BL6A 4B4KA 4BO3A 6CHYA 3QBDA 1L5MA 4HX5A 4MI1A 4F4HA 2F67A 4TGLA 2R6JA 5DNDA 4OK6A 4Y18A 4HAOA 1Q83A 2Z9DA 2F1IA 1NUPA 3LC1O 3NFYA 1QC5B 2Y67A 2YOFA 4QOSA 3KT8A 4NDAA 1ORVA 2NZYA 1V1RA 3V4SA 5CITA 5KSWB 2FCAA 1GU1A 3K9NA 1GAJA 3W6PA 3QIAA 4DVJA 5I48A 1NAIA 2XUJA 4UPEA 2QYHA 4G3XA 3ENWA 1X86B 2QY9A 1WUIS 5L6LB 4KQEA 2X6RA 1XO1A 2C9BA 3H4VA 3SHOA 1R0XA 2FQQA 2QTLA 3VYRB 4O4JF 1E61A 3KC2A 2J3LA 4PGGA 2V7BA 2YMPA 3IR6A 5I9MA 3R7AA 3U7JA 2ID4A 1CE8A 4ZIRB 1YS4A 1ODLA 2EKLA 3OT4A 4E7PA 3DE6X 3WISA 1AK9A 1DQSA 1UOPA 4Z51A 1Z4PX 1JRLA 1QIIA 2FSGA 2J07A 3ZW8A 3B53X 1LK5A 1R10A 1DKRA 2VNJA 3COSA 4RHCA 2YHBA 1KAGA 3KEOA 3LNCA 2OL4A 3UMGA 1EE2A 1KYQA 2JLSA 4INPA 3KOYA 3L8DA 2D2FA 2CN1A 3FOCA 4HPWA 5TVGA 3TZQA 1QAMA 4ENUA 1G2OA 1NJFA 1GGEA 5KYYA 3G1WA 1J1UA 1U8XX 3BWMA 4MCAA 3NGLA 2AF4C 2P0YA 3FB4A 3IRUA 1U8ZA 1WXWA 2IW1A 3BIFA 3BCRA 3PD1A 3WL5A 1F8UA 4PXSA 4ZQCB 1KWGA 1E6KA 1CUUA 4AZ0A 2JH9A 1FP1D 1YB5A 1TRHA 5KTNA 1AQNA 1OI3A 2W6OA 3TO5A 3TZ6A 1PFVA 3IOYA 1WHSB 1EHYA 3GDGA 1TGVA 1A9XB 2N1MA 2WU0A 3K8QA 4TTAA 4TKZA 4C0KA 4Y9DA 5EMMA 1ZWLA 1J22A 4NCIA 1G19A 4ZTZB 4LXXA 5HBRA 3TEMA 1SC3A 1GCUA 5AVOA 3L6DA 4AJ2A 1QX3A 1UBRS 3IUPA 1CW2B 4KQCA 4LXTA 4P86A 3ZWPA 4C05A 3BXFA 3SU8A 4EJSC 2NSYA 3ER8A 2D1FA 2C3YA 5BWBA 5AI6A 1S6YA 3O1IC 5D3KA 4BLPA 3RAEC 1T4BA 1ISSA 5IT4A 3IP7A 2J3DA 2VDLB 4ARZB 1O58A 2CUZA 4G9EA 1FX0A 1DUSA 3KT6A 2OD9A 2VEDA 3U4IA 1M7GA 1YKFA 4LYJA 3M81A 4HR7A 3P9SA 4LPKA 3NIGB 1L4FA 1S9DA 5ADWA 1QYDA 3KFXA 3RARA 3CN7A 3MCUA 4CN9A 1HE2A 3SOPA 1ACJA 3AKZA 1RMQA 4IO0A 2ZOSA 3FDIA 2QMQA 3RGWS 3EG9B 4GEKA 3ZN2A 4G2TA 2GZSA 2C42A 3R6WA 1BA2A 2HEGA 3HJGA 2I2BA 3PFWO 3T41A 2NU8B 3LT2A 1IWPB 1C0LA 4DLBA 1AMUA 3PQ2A 1U3WA 3F3KA 3W34A 5B64A 3VSDA 2ORVA 5FA5A 4H1VA 3OSZA 1VKHA 3G5UA 3KZKA 4EK9A 1T6NA 3E7DA 3E7XA 3OEEA 4JHLA 4EFNA 4IYJA 1P9NA 3LBIA 4OXIA 5FF9A 2UXBB 1W0KD 5H9VA 3LXUX 1ANKA 1I3CA 1X3SA 2XA1A 2AC2A 3BXPA 3OCXA 3O84A 4YK7A 4MWEA 5FOTA 5FP0A 4CE6A 3A36A 1SMKA 1F17A 1Y1RA 4RVDA 3JSAA 2IXFA 1DBVO 3CFYA 1EUCB 3RJ9A 4O3MA 3WBBA 1UBEA 3DT9A 3EEBA 2I3ZA 3VDXA 5KVSA 5KTRA 1J2YA 1XU9A 3IP5A 3LQ4A 5BR4A 5EE3A 1GKYA 2GZDA 4TV8A 4NULA 5DNEA 1RVV1 3RVQA 5KCZA 2GKOA 4UZFA 3FHLA 4FMCB 2ECFA 4CBVA 1R12A 1WSDA 2YY7A 4RY0A 3KR2A 4FJ2A 2C4WA 1NY5A 1A98A 1PVVA 3R7BA 1SKMA 4FNAA 1OZAA 5KYUA 1N2EA 2JIZD 4NEQA 4UFOA 3HVHA 1PJRA 3EVEA 2Q9AA 1RXCA 4Y2TA 2ISSD 5HUQA 2QTZA 4U7HA 4PGFA 3GV0A 3M5PA 4HZUB 1P7CA 2BZSA 3MVEA 4XYGA 4NSNA 3ZD8A 3RYCA 1JR6A 4G67A 3T9CA 2Q49A 2QJTA 1SQGA 2W4QA 1G9TA 1ETUA 3LXMA 3O47A 1CY2A 1GGMA 2GDJA 4YAKA 3MPUA 4DSOA 4MITA 3ZWBA 3DT8A 1MC8A 2HNAA 2P1DA 4IHJA 1DJMA 3A6KA 2NZWA 2J0QA 2YXLA 3QEAZ 2D5IA 4AT1A 2UYGA 2A5JA 2Q62A 4B09A 2Y4OA 4AKEA 4WSOA 3L1UA 3MWLA 4GQIA 1A1VA 1Z47A 2ZSHA 5DGXA 1CUXA 4LJ5A 5KCMA 3CQ9A 3A3YA 4KXXA 5KAPA 2P90A 3V1TC 4R1TA 5FWDA 5KDLA 2RGYA 3DFZA 1KMCA 1EPUA 2VR1A 4JUFA 3ZWXA 4DMGA 4TKUB 2CT8A 3JAWA 4YJHA 3THXB 2RKWA 3DSRA 4GR5A 1RYZA 2J6CA 3NEJA 2ZW9A 3EB9A 2PWYA 4XIFA 2IL1A 3U4CA 4MW7A 4PLCA 2J6BA 1X38A 3ODPA 1K6JA 1S4QA 4BE4A 4D7AA 4DDKA 5CRIA 3V2IA 1GQSA 4HLCA 1SZJG 4ZVOA 4RAOA 3KSAC 4ZHQB 4W5QA 1TADA 1IY8A 1THZA 3DTVB 3HJBA 1Y5RA 3W7AA 4QTTB 5LJLA 2VRNA 2IYEA 1SKYB 3DFKA 3HR4A 3GJ6A 4LAFA 4URFA 5DSTA 2FMFA 5FCDA 3JYPA 1U3UA 4F72A 4XGIA 4BO9A 5K20A 1ZD9A 5CFZA 1OYOA 2H11A 3S29A 5C8YA 4GXQA 4EGFA 5AW9A 3LY7A 1J2EA 1W25A 2BP7B 1COWA 3W5IA 1XPRA 1B16A 2Y05A 13PKA 3U4QB 3DNFA 1ORWA 1VE3A 1E8DA 3C8MA 2C7RA 3OE7D 3SYKA 4HGZA 5DNAA 1TYBE 3C8HA 4RANA 1JDVA 3HCEA 4IEFB 4KVAA 3WB9A 4LBYA 4JI7B 1YQQA 3ZCUA 1XA0A 1E20A 3SSNA 3FCCA 1QGOA 3GUUA 1YZTA 3D3EA 3Q88A 3NBKA 3LO8A 1XQ9A 2GARA 3FBTA 3PVSA 1NXPA 3KAQA 4KJZA 4OBXA 3P0FA 3TNLA 1YNOA 5ALHA 2R79A 3W7VA 1E66A 3HR8A 1BX3A 1ZJJA 1W4BA 3ZI7A 4K88A 4H6VA 4WNAA 3AHGA 3PPXA 5AM3A 4CV1A 2QKYA 2JI7A 1TAHA 2ZYSA 4QXRA 1U9ZA 3AM3A 1UP7A 1RC1A 1Y8QA 4RJ2A 4B45A 1CCWA 1LSOA 5I4CA 5FNVF 2I4OA 5B1HA 4RHEA 4EVSA 4TV9A 2Q2VA 1QLJA 2ODQA 2CHQA 1K8ZB 2G5PA 2HB6A 1VP9A 4WECA 3VOAA 5GVSA 3Q9NA 2OZKA 1XI2A 2E1PA 3VPXA 2BH2A 3DXXA 3I2FA 5IPFA 4HDRA 1M2EA 5EG5A 3GNTA 5B7NA 1G6KA 4MVJI 1EIZA 3JV7A 3PHJA 2IU3A 4G1MB 1OAAA 3HVKA 4GAEA 4QVGA 4A8JA 1WO8A 4HNRA 4IX9A 4HTAA 2RHGB 2VQFB 4AMYA 1JBEA 1KH1A 1VSVA 3OOHA 4I9FA 4IW3B 1C9MA 4PRLA 2Q3DA 4BTVA 4KKXB 4YP6A 2JJ1D 4KZPA 5JMTA 1CNMA 4Q47A 3N76A 3WIOA 4RVUA 4D4IA 1PJ2A 2FW0A 3PQ5A 5BSMA 1QYWA 3R76A 2XSZA 1KEUA 1TQ8A 1X77A 5H70A 1P62B 4QU8A 4D79A 3BH7A 2DTEA 1ATIA 5CAEB 3FPSA 5EQFA 3GW8A 4GOOD 4JP1A 2FEWB 2CZGA 2X4IA 4M6WB 3FAZA 5LP1A 2WNSA 2DTXA 2DSTA 1I6WA 1KDPA 1M7BA 3AUXA 4NBTA 4TYWA 1B43A 3KJIA 3AF0A 3NGMA 4RZHA 2G4VA 2B92A 2YYSA 4X64B 4ARCA 4WXRA 2E4YA 4G5FA 1E5VA 3GQBA 4I4CA 4KR0A 3YASA 2D54A 1JI3A 2Y71A 3BGDA 5ER9A 1USIA 2A9RA 1WW2A 4DA4A 4N4AA 4Q01A 1YZGA 1Z2CA 3MRXA 4DJTA 2PQ2A 4E09A 4MLCA 1XXLA 4JZKA 4EMTA 2C4HA 3W5SA 1PJ4A 5EE5B 3PC8A 3RRMA 1FSFA 4NR0A 1K88A 2R8EA 1DKPA 1K5GA 4PVDA 3T38A 1ZLXA 5J63A 1A76A 2G88A 3GLIE 1ZD2P 2QBYA 3U09A 2QGZA 3THRA 3RBAA 3JD0A 4INZA 4JQSA 4BEWA 4PO3X 4AY5A 2BM9A 5GJVC 1QU2A 2ZT8A 2IOQA 5BW6B 1FYDA 2XAUA 3EZNA 2QTTA 3HKDB 5BUSA 3KQTA 2AN9A 4A73A 2CJYA 3QY9A 1T4GA 2GZHA 4IS3A 2X9LA 1KJZA 4QWWA 3RSLA 1EA5A 2V1XA 2OQVA 4RK6A 4CKBB 4OA5A 1KSFX 3JWPA 3WLAA 1P0FA 3DOFA 4IG4A 5IUJC 3E5MA 4XIIA 4W7HA 1FJHA 2I0FA 2ZSDA 1MEEA 2HK7A 3EC1A 4HS9A 5EYPB 2ZZNA 1MV5A 2B0JA 1VPEA 2I4MA 4HV4A 1T9GR 3KFLA 3DE0X 3OFVA 1AHHA 5TQJA 3TW4A 2QTWB 3VBCA 3M82A 1ENZA 1M1ZA 2XGGA 4GKVA 4QHYA 4BDTA 2PH7A 3K35A 3ROKA 4BO1A 2MINA 1AO0A 2A5GA 4FR2A 4PLYA 4WCDA 3PJFA 3UMVA 3RBXA 1KZ9A 4AC9A 3OQ1A 1E2BA 2AEEA 4IUCS 2X5XA 1SHJA 4O3FA 1SIUA 1TKCA 2YASA 3AWIA 4XOIA 5K8TA 4DG9A 3HYCA 1SUBA 5MN4A 3N0TA 3W4JA 1XLUA 4C0BA 2XVXA 3NNNA 3S55A 2B3DA 3P0JA 2FRDA 1JIIA 2BFBB 2JFBA 3KLOA 3BE5A 2Q1UA 1RXSA 2PV7A 2JGDB 4NEHB 4OOEA 3HJCA 5DGHA 5HK9A 3P26A 3K31A 4XSVA 1N2IA 1Y5NA 2R4TA 3AFMA 1N9GB 2QRNA 1Y37A 1VJRA 1F9AA 2YZKA 3MTJA 1J8YF 3LUJA 3RTBA 1ISJA 2QRMA 1SB8A 4DUPA 1FTYA 2CVHA 1NVMB 2PG3A 1NP3A 1YUNA 3T12A 4Y6PA 4CKCA 1Z6QA 4O4LB 4IFEA 2RCYA 2WW8A 3G0GA 3JYOA 5EJ6A 4NV3A 3ZNQA 1F20A 1H93A 1RAEA 2ZYAA 3OP4A 4ITVA 1SCIA 5C4MA 2ZUVA 5AVTA 2XZOA 4HSGA 3VC2A 5JROA 3I9JA 4FLEA 3GLFB 4C2TA 1K4YA 3T7KA 2ODAA 2AG8A 2RI6A 4IH9A 2EBHX 3EXG2 4IDEA 4QUDA 3RLFA 1UJCA 2INGX 4F91B 3DJYA 5EIHA 1YCFA 3HDTA 3OQIA 4HFJA 1A88A 2EC5A 4OJTA 3K1TA 3NR2A 3QFCA 4O1MA 2FWBA 1C8VB 4JL8A 3FHOA 4JT2A 1EVIA 1QRAA 1JDNA 2WDZA 3IDAA 3K1AB 4HUQA 1U7UA 4P92A 4RDCA 1ZPDA 3GDHA 2AI1A 1IWOA 1VZ3A 3KELA 4WH0A 4AJEA 4WBNF 1K8QA 3AW9A 4RGYA 4X20A 5F64A 3IIKA 1PGOA 1CRWG 4K6GA 5CT5A 3HRHA 1KQGA 5LYJA 4Y9SA 3A28A 4IFTA 3TOXA 1LQ2A 1V6CA 3NWOA 5BN3B 1NY6A 1EB9A 1NUUA 1UJBA 1P8JA 1VYTA 3FLBA 1NQTA 4JJEA 3ZD9A 4IJVA 3NNSA 4HEHA 2OECA 1RJGA 4JLUA 3DOUA 4RK5A 2WTUA 4MMXB 1TAUA 2IEZA 2NSHA 4WNCA 1XKTA 1ZKDA 2JHAA 1SM4A 1PV4A 1OE0A 2BCGY 4X85A 4QRIA 1KZ6A 4LXQA 4U8HA 5ECDA 1N6PA 1RYHA 2OWEA 1JIQA 5JAUA 3OUZA 3L1HA 4FOPA 1G18A 4LYYA 4R2WA 5KTTA 2I62A 3OZ7A 4JH0A 1ZJYA 2VTKA 1P77A 2GPJA 3A6HA 3EUAA 1YZVA 3FNBA 2FN8A 5P21A 4DQ0A 4GOJA 1GZVA 1JBQA 4ZV9A 2RHHA 1ODFA 2VATA 1OI2A 2R6R1 4TTPA 3TAHA 4DLTA 1N7GA 3VKWA 3L84A 4ID3A 3FHTA 2HBQA 2WHEA 5LOVF 4L8LA 4PV7A 2VP3A 3S44A 1DO2A 5B6IA 3UENA 2OHOA 4PFQA 5ECWA 3RJTA 2C96A 1E6LA 1QVZA 1K6IA 2AMYA 4QYMA 2B2XA 2HHLA 2I2DA 4ESEA 5ESXA 1QTRA 5EJEA 2A4KA 3X2SA 4EG8A 4HLQB 3GVXA 2HMVA 5H5JA 4KFSA 2OV2A 4UNPA 1MRZA 2V7VA 3A4LA 1GCOA 3CE9A 3ROPA 1R74A 2M6KA 3RS0A 3TJZA 1H1TA 1QC5A 5LKAA 3V1KA 1DO0A 3EQ2A 3RCBA 4MS1A 2IYRA 4CEJA 4I3GA 3WGJA 5IU6A 1D2NA 1CZRA 2O8NA 1A95A 3SWWA 4C07A 3PDCA 4CNQA 2Q50A 4GPEA 2V7TA 3RHTA 4BFSA 2HSGA 4MRRA 2AFIB 2DUJA 3IILA 1RFGE 1J33A 2B8NA 5J3JA 4X65B 3VO9A 2RCNA 3L7YA 2AJCA 4BO6A 3DE4X 4UNSA 3X2FA 5HYVA 3NUGA 1Q0PA 3IQWA 4PQRA 3ZHQA 3O8DA 4ZCLA 4V03A 5WRFA 3RFTA 2PXAA 2GOYA 1JR4A 1WVIA 3IT2A 3MIIA 2XRFA 4NK4A 4BMZA 1C7EA 2DVMA 3LDGA 1WX1A 4JZYA 3RFXA 1RBQA 3KZMA 1MQAA 3LLSA 4B6OA 5GJBA 3JYHA 4IGKA 4J75A 4Y2VA 2W6NA 5T57A 4GL2A 4GLFA 5EJMA 4I50F 1PSZA 3ONWA 3PE4A 5ERGB 2DPYA 2D0OB 1A9SA 2ZAYA 4BWGA 1C3XA 1XRPA 5JARA 4RZQA 2WSSD 1UJNA 4YCAA 1N77A 3DPUA 4D5EA 5CVEA 3ZZNA 1DEXA 1OA0A 1OWNA 2Q2NA 4PO8A 1TM3E 4YAFA 4HEJA 2QUKA 3B36A 4FCCA 2EG5A 4J1TA 2Q0HA 4U2CA 4YJKA 3W9BA 5JZBA 3M83A 4FHGA 4L4UA 3TRFA 3VVMA 1NJ1A 2G83A 1WKBA 2GD0A 2J4CA 2OV4A 5DLYA 4TXNA 2O1XA 3HGQA 1I3NA 4Q16A 4AS2A 1ZBDA 1NYLA 3Q1LA 3SZUA 2X8BA 2ATCA 4MA4A 4W5OA 3C43A 5AM0A 3RREA 2FLVA 2JVJA 3AH8A 4NH4A 1NVKA 1A9XA 1LVUA 2YRXA 3LQQA 2ODBA 3E81A 4LVCA 1J5PA 2AOXA 2CB0A 2FOLA 4Q24A 1RI2A 5JAMA 1RHJA 1MJGA 1KPGA 4OOFA 4R3NA 3KZOA 2DWPA 1I0IA 1GZ6A 2Q8NA 2QSJA 3PC8C 3STUA 4DMLA 4PN7A 3H97A 3U44A 4JVOA 2HU2A 3NAGA 1OF1A 4R2HA 1GOTA 3CF2A 1EUQA 2AG5A 4ARIA 2IHVA 1FQOA 2MYNA 2JLUA 4TVKA 4V0KA 3O0TA 1R88A 1A69A 3L79A 4IKPA 4WWHA 4G0OA 3R8CA 1U11A 2A35A 2VDNB 3BK2A 3KLNA 1B7GO 1CY6A 3L6UA 4GYJA 4RXTA 1FYEA 1P8AA 1L7OA 3SLRA 5M5BA 4ZEXA 4DCUA 1W4RA 1NVFA 1CETA 1JR3E 3BL5A 4IMPA 3VVLA 1ESMA 3PFBA 3FWZA 1Q17A 4CIYA 2AZXA 4D0SA 1DGQA 4XM0A 2YJGA 3L6EA 3VZSA 4Z54A 3A14A 4C4AA 1BCSB 2AEFA 1OH7A 3EG9A 5FV4A 1CUIA 1GEGA 3GBPA 4KIFA 4M98A 5AXAA 3HYLA 1U2QA 4ARVA 1AE1A 5L3RA 2WWGA 2JCXA 2PFGA 2D2VA 1UZUA 4RGQA 2NU8A 4F5WA 1NVUQ 4RD1A 5E6SB 2R84A 4NMHA 1U0RA 1HKHA 3STHA 4CFSA 5B3AA 4ECEA 1DOZA 5IJZA 1B6SA 1Q95A 1PJLA 3EFEA 3M4NA 1GLGA 4IGEA 5K7SA 4LZZA 3BIOA 3TTTA 3W3ZB 4LMRA 4PPYA 1KMHA 2P9ZA 4XR9A 2OHIA 2W2LD 2IXTA 1AN0A 2A1UA 3ZK7A 4ZZ3A 2PD6A 2FRDC 1RQ7A 1HFJA 4L5IA 1T3SA 1RM5A 2QD2A 3I9OA 1EUCA 2B8TA 2Q7OE 1AUPA 1FUUA 2VTBB 5KBYA 1DEAA 5K3FA 5FD8A 4ZP1A 3AUUA 3U3JA 3LHSA 3GMSA 1OZFA 2XB9A 4JLOA 1ZXXA 3B9BA 3LLCA 3WQRA 1W1WA 5CB6A 2XUQA 2QAGA 4IAOA 4X3CA 3FCUB 3EPHA 1JHXA 3TCKA 3WFJA 1GAEO 3WLQA 1QV7A 4TVBA 1M2NA 3PL5A 5F51A 2P41A 2IC5A 1K06A 4D99A 2VSOA 3CUKA 4ARBA 2GN4A 5CDHA 4RIFA 2Q7DA 3HNOA 4ZC8A 3IX7A 4MIYA 1E7QA 4A0SA 3FNQA 2G0NA 3FMPB 3DZJA 1KSJA 5I47A 1NA5A 2JI8A 3DGFC 4G07A 1IXZA 1O54A 2RK3A 5AVQA 3FRHA 5JHHB 1E96A 1OTYA 1YK1A 3C3YA 3PGVA 4FGUA 2J9YB 2GD2A 5ERYA 4RTRA 4ZD6A 2BR4A 2CDCA 1VIYA 1D8AA 3FWPA 3ISJA 3NVMB 2W90A 2I4IA 3DA8A 3A0UA 4RZIA 3AVVA 2GBGA 1HDGO 2H92A 2H18A 2I29A 2EFJA 5EIBC 3T1HB 1WS6A 4OHWA 3IAXA 3VR5H 3G2PA 5BMVF 1A4RA 4MQ5A 1STOA 3KEQA 4QDXA 3FR7A 3ZEAA 1Q1ZA 2DBRA 2ZI4A 1JUDA 2ERCA 4E5PA 4YIKA 5HXAA 2IIVA 3L7JA 1VJ5A 5D5PA 3U17A 2H17A 5JSKA 2EDAA 2RH5A 4M49A 3CEMA 3CC8A 4P0TA 1S5PA 2CXQA 3O2NA 1BW9B 3R3HA 5DTIA 4KR9A 4A8PA 2JLRA 4J0DA 1QHSA 4J0EA 1VHJA 4TKUA 3VAAA 4G5SA 3C4VA 3T0GA 3B5JA 1XNGA 1AX9A 3D54D 1U2TA 2R6AA 3BJMA 4YECA 3ZQ4A 4BZPA 4EBBA 5LQMA 5FNZA 3C6YA 3FPLA 1WU8A 3OPNA 2ADOA 4ZHQA 3GFGA 3DTVA 3AOGA 1NF2A 4MQMA 2AG0A 3GP5A 4A26A 3WGKA 5AVYA 1OFVA 3E9RA 1MV8A 1EM8B 2QZZA 2WA2A 4R2KA 5DTQA 2VQEB 4PS0A 4TRMA 2GUGA 1VHWA 4AKHA 1FP6A 3TLZA 1JH9A 3BWEA 4F3YA 1R1DA 1YR7A 5ALEA 5E9JA 3THWA 5JTUA 2BP7A 4R01A 3TNYA 1XU7A 2BJWA 2WKSA 4ENQA 2NUTB 2PX3A 4E5DA 3U4QA 4K6OA 3P0HA 5AFSA 5K4AA 2PUBA 4KH1A 2CVZA 1JYFA 3IT0A 1MJFA 3PDUA 1K92A 3RC9A 4JVNA 4AMZA 3S2FA 1GT91 4MLZA 1OU0A 1SK8A 4LC9A 3N0VA 4KVFA 3PBKA 4XWTA 4OHZA 4CL8A 1AUQA 3BIJA 3VU0A 1PJSA 4UASA 4KBYA 3R5SA 4PC6A 2ZTLA 4DPLA 1MJNA 2D5LA 2IY8A 4ZOQI 5TX7A 4AJIA 1ODSA 1R7RA 4FFNA 2HNKA 4EB6B 1YQTA 4LZAA 2F62A 4RETA 2ZRGA 2JBWA 3PIDA 1KAMA 1U3CA 2E89A 4YDSA 1T10A 1PDWA 3JW8A 5A9RA 2K2WA 4BX8A 4HRXA 5J23A 1FF9A 1A97A 1FTSA 3D4NA 1E6EA 2XMRA 3FPEA 3MUOA 1NYQA 1RLUA 4KO8A 3FZGA 1DFGA 3BEDA 4LHWA 1X70A 2BGTA 2QQ0A 2QXTA 3WK4A 1QRTA 3OOSA 1E1CB 3HMKA 4ADSG 1VJCA 2QN6A 1OLSB 2WD8A 2QM7A 4FR0A 5GQSA 2F3PA 1IBKB 1O6ZA 3UB4A 3EXIA 3UWDA 1U1IA 3K8ZA 3KYIB 2FQWA 3QE3A 1XNQB 4BO5A 4IDBA 1RZRD 4BFYA 2JHPA 4BLVA 4EPYA 3GG9A 1JFLA 4MNTA 5IDQA 4ZREA 1BSVA 1FDVA 2H7XA 5FQOA 1DHTA 5CB4F 2B5WA 3DL2A 3WJ1A 4D9HA 1ZIDA 3QSYA 4II2A 5KNCA 5K0EA 1XXHA 5JVDB 4EEXA 1LY1A 1D5CA 1LSUA 3B38A 4Q05A 4R2MA 3C0KA 1M2WA 3PR1A 3FIJA 3GCXA 4HFMA 5EJIA 1QLHA 2BFFB 3G6KA 3M8KA 4XH9B 4ENRA 4ZYZA 1H5QA 2QDXA 2NO9A 4LZLA 4XWYA 2G76A 3ZWAA 4BO4A 4EZEA 4I7EA 3BTSA 2YL2A 4XPIA 3RF7A 1MAVA 3B9RA 5JYCA 3LCCA 1F2TB 3ZDBA 4FVTA 4YQEA 4ZYXA 4KR7A 4FE3A 4M6WA 4EF6A 4GF5A 4JYAB 4NTZA 1PVOA 5CCBA 5IVKA 4L9SA 1POWA 3C70A 5BRAA 4JYZA 2ZJ1A 3NG1A 2O4UX 3AILA 2IPOA 1BGWA 2B8EA 4R31A 2BE9A 1YJ5A 1LDMA 2A57A 3A1SA 3FHJA 4K5QA 4MA0A 2PMBA 3QTLA 5FPYA 1T9BA 4IF4A 3OZFA 4J7AA 4MRPA 1YR6A 1SCQA 4DA8A 4J4TA 1E7WA 1RPJA 2PLAA 2IF2A 3QWIA 1E1KA 3CNBA 5E2IA 4OL0A 5F77A 3REOA 3OH8A 5CW2A 1RXUA 2Q6IA 3DZDA 1Q1EA 2H7VA 1A71A 2D5AA 4QNRA 1KP2A 4WOJA 4XTRA 5E1BA 2I7DA 1ND5A 4MR7B 2QVZX 3RJ5A 4X1YB 2G8LA 2O2JA 1P1KA 4PZPA 2OHJA 2RGWA 1QIHA 4B2IA 1W36D 2NZXA 4XEHA 1Q77A 1G21A 1GA1A 1MO6A 1UZAA 3A6DA 4WCFA 4KCGA 1NN0A 1R27A 1GZHB 2XITA 4Z1OA 4EG5A 1GU0A 3UCFA 1RJ9B 1DXQA 4LW8A 1YZQA 3DT6A 4J1SA 3VNUA 1Q0UA 4CKBA 4YAGA 1DINA 4XM1A 1J70A 1XFDA 5K0JA 4ZK6A 1FFBA 1SIOA 1XQYA 4LKRA 2CFRA 4MVJM 1FJGB 2ZWAA 3RVOA 2QPTA 3I9MA 3U9SA 2WNIA 4OHPA 4Q4AB 1SXHA 3QXGA 2JD2A 5EUBA 3SJAA 3TTSA 2HWKA 2Z43A 2GCNA 2R6ZA 4YNBA 3V2UA 1G38A 1G5RA 2O2DA 1XTUA 3AU8A 5HTKA 5LZ7A 4DQVA 4URHA 3H3FA 2L42A 1FVOA 1HG1A 2GFHA 3UV7A 2P6RA 4JAVC 5EJ9A 1VHLA 3BWDD 4EIWA 3WSVA 5EXEA 3ZDXB 3D8RA 1XGKA 4UE6A 5A4DA 2ZYRA 4KIUA 3I9FA 4TT3D 1QQ7A 1KKLA 1XROA 2QAGC 3WYAA 4NZMA 1ULTA 4MGEA 3ZJ5A 4UREA 2C9CA 1DMRA 5HM6A 5LUAA 1KQ3A 3SMVA 1QRUA 4A16A 4M8KA 4DCVA 2K5UA 5KNLA 2OXCA 1OLXA 4QOHA 1SVWA 3KXLA 3SHVA 3HXLA 3ZXIA 5CD9A 3ZIUA 3Q8MA 3AOEA 1YH3A 1UBCA 2C98A 3IA7A 2FG7C 2PH1A 3LUKA 5FIUA 5IC5A 2PX0A 3IUYA 3KQYA 4GICA 3B7WA 3F3SA 3G8DA 4O4LA 4ZQBA 3RFUA 3JVEA 3FF1A 1XE3A 2PS1A 1P29A 2B6NA 4I14A 4DCOA 5KYGA 1AMNA 3ORFA 3QKRA 1YBMA 5I4KA 1CIVA 3GFQA 4DY4A 3GLFA 4TTQA 5KNDH 5FQNA 5A1TA 5F52A 1XLTA 2RHBA 3TLBA 1JXMA 4Y0VA 5HEKA 2APJA 4LOHA 1BH6A 1NOKA 3HB9A 1AS3A 4N5MA 1BIFA 1JTVA 2EAUA 1B8UA 1O95A 4KE6A 4NQZA 5E8RA 2VP9A 3GB9A 3IIIA 3GEMA 4BKMA 1ITZA 1A4IA 3K8OE 1VRVA 1L7RA 4WVFA 4TT8A 3LYHA 1TCVA 3DDWA 2RC5A 1TVEA 4ALKA 3HVRA 3OLZA 2Y93A 2C5SA 1ULZA 4MYCA 4YQFA 1XRLA 3IVMA 4G09A 2UVQA 1M0EA 3IOMA 2Q1SA 1RE1A 1ZI8A 3F5MA 1NMXA 2BMJA 5LZ2A 4KDRA 5MGNA 1OB5A 1C1HA 4MUEA 5ALFA 2R8OA 4RM2A 5BN3A 2B1JA 1GKLA 1MC5A 1S1CA 2AKYA 2WEKA 1XTIA 1TVKB 1ZC4A 2P5SA 3PUKA 3QV2A 1ZK3A 3MCWA 1NULA 5FBWB 3SIRA 2GHTA 1Y1SA 4HAZA 4OKIA 4Y2SA 3M2TA 1J39A 1ZK4A 3P2MA 1PL7A 3FYUA 5A7HA 1MDFA 3SS9X 4EB3A 2X9QA 1FS5A 4O5AA 3LX8A 3HVJA 3H86A 1QDEA 1FP2A 2PKQP 4TMZA 3NBZC 1C7QA 4AECA 4LJSA 3COVA 1V9LA 2Y8EA 3DKRA 1GG8A 2QL5A 3ESQA 1M9NA 1UM8A 4B35A 5I8ZA 3OX3A 4YAOA 2OCIA 3GWZA 5IS2A 1L4MA 4M7WA 2I65A 3M3HA 3ZV5A 4RK4A 3SQWA 3Q2OA 4MV4A 3WMGA 1RWXA 3NTQA 3H4IA 2BGIA 1MJHA 2ZUCA 1SIWA 3DJFA 4OA8A 2QVBA 1VC2A 4QBFA 3WRVA 1M1YB 5B1DA 2VDMB 1ZM3A 4OMCA 4BVKA 4LQCA 3OETA 1BJKA 1TO6A 2XUOA 1VIDA 3A1CA 2H5JA 3OPYI 4Y8VA 3RSGA 1J1ZA 2H59A 2J4DA 4NABA 3EQ9A 4JLWA 2Y68A 3UT5B 1QCZA 3PITA 1Z9BA 4NMLA 1NKTA 1KK3A 1LUAA 2J67A 2H2HA 1K66A 3PD0A 1J24A 1Q3TA 1OR8A 5J1SB 1J00A 3RFFA 2WV7A 4JGGA 4Z9AA 3RVKA 1I32A 4UNIA 1DJPA 1ECGA 2Q27A 2Q29A 3N2IA 4L4SA 4Q1DA 4TN1A 2ATEA 1FYXA 4Q7LA 4UTZA 3VNSA 2IYXA 4A0QA 5KX5B 4S24A 1YJQA 2AFIA 5AKJA 4DDUA 2FEXA 1HWYA 3FKSA 4TS4A 4WZAE 1CSEE 1Q3HA 1W2WB 3ZIAA 4D92A 5D3MA 3TECE 3ROZA 2O5RA 2WM8A 1J9ZA 4XWOA 3QA9A 1QO9A 1HETA 2ZBQA 1DPGA 1CJVC 3LUHA 2ZIWB 4ZO8A 3WGLA 1WR8A 5L4SA 1TEHA 1NBMA 3LG2A 3HDVA 2BBOA 3DCIA 2GPAA 4ROSA 4A36A 2HJHA 2O0MA 1P0PA 2WIGA 1W36C 1JHAA 4J7UA 4Q1VA 1XHLA 4Q4CA 1Z06A 2OV1A 2XNKA 1KVSA 3BVPA 4UEWA 5DGDA 4UOZA 5IKEA 1DJOA 3RU7A 1ZGAA 2C2XA 1ZC3A 5AQEA 3WZMA 4BRWA 1E9RA 1TKRA 1ZRSA 5IFKA 2ZTHA 2DCMA 2CFOA 4H27A 4MKFA 5CM9C 4KSCA 4DUGA 5F7OA 2Q5LA 1E3JA 2F2TA 5E3JA 4UBLA 5D00A 3I76A 3DOCA 1TAGA 3TD6A 3VR5D 2TYSB 3F90A 1LI7A 2AWOA 4DY6A 3JQRA 3LP8A 3AC0A 4M1MA 4KDFA 4TXLA 3COYA 4KWTA 2DFLA 1Z15A 2XWPA 3RVJA 1HFEL 1YBVA 3PKIA 1XOIA 4F60A 3TK1A 3OEWA 3OSUA 4MGKR 1CUEA 4Q9KA 4LJLA 4UFPA 2NO5A 4LHEA 3N2EA 1G63A 4GYKA 1GTMA 4UMEA 3RK1A 1Z2DA 4G5GA 3EQ8A 4Q3AA 3CX3A 2YYAA 2CNKA 5KTPA 1OLUB 1YS1X 4RZ2A 3FSGD 3S2IA 1AKWA 1IM8A 2GR9A 2XTMA 3GEGA 4AFNA 1Z7BA 4CTJA 3MERA 3DC7A 5F35A 5T4EA 1WDMA 3A3PA 2WAAA 3O26A 3VTAA 2XMZA 3DEFA 4ZODA 4KGDA 3L8CA 3PSHA 4AKSA 4DBZA 1X7WB 1SEVA 3VDNB 1D6SA 2PKEA 3P9ZA 1PLLA 3A6EA 4WCFC 5CVUA 1R9NA 3Q0IA 3TZKA 5GINE 2QTFA 3EMBA 4AY3A 1Q7CA 4RKFA 5LNK6 2ZTMA 3BSWA 2C2ZA 3W8FA 3WP1B 1XX6A 1QB7A 1Y6ZA 4UTPA 5JSYA 4Q03A 4R8LA 4NYIR 4AWBA 4DV3B 2D3WA 3M89A 2P3OA 1SOWA 3R20A 1JXOA 1XN1A 1TTTA 5NLLA 3IT1A 4GZLA 2FY8A 5A02A 4ENSA 5E6SA 1QPZA 1W93A 1YFZA 1FYFA 3KRTA 1FQKA 3I6QA 3PLRA 3AL2A 4EHBA 1WABA 3TLGA 4BKQA 3DOEA 5TQ2B 4K8OA 5HZKA 1DDGA 2K4MA 1ENPA 4PPNA 3VUFA 2DU8A 3I61A 2C7GA 4YT5A 4IQ0A 2WD9A 3RR2A 3W5UA 4EW1A 3GT0A 4UZEA 4MGYR 2FFJA 4GX1A 3PGJA 3MSXA 4LRSB 1I6MA 3ZWQA 1FMLA 3E9ZA 1RLOA 3DUFB 4FSHA 4P82A 5HIJA 5EHXA 1I2MA 1WU7A 4U2BA 4AX4A 1UJ6A 3B8HA 1L7VC 4EGQA 2OLEA 3DE5X 4BJ6A 3ORHA 1J5XA 4AZ3A 2C5LA 2QJFA 1JLRA 1PG5A 3D0KA 4INOA 4MVJP 1IQUA 3E7FA 4NXNB 1KRHA 4OI4A 2ZI7A 4HNAA 4GZ3A 5LN1A 4DXAA 3MHTA 1WB5A 2WHPB 1RLMA 1HZZA 3TSWA 2I6FA 2BGRA 1G7TA 2WJJA 3Q8XB 4BNHA 4CKEB 3I32A 4YASA 4DSZA 2IPLA 3BTUA 1KC1A 3SGLA 2I7VA 3MRSA 5D5QA 5DIFA 4LY0A 1R0CA 4R5HA 5HUHA 2QW1A 4QDKA 3RVDA 4X54A 2XODA 1U6IA 3W5CA 1L4HA 3FWHA 2V5VA 2R5WA 2BISA 2V6BA 1TF7A 3IQHX 2VK4A 1MH9A 4JLJA 1GXSB 4C9BA 1Y8RB 3TLEA 3D3NA 1O95C 1GUZA 3EC7A 1CNEA 2V5UA 4JY7A 1N7IA 1S3GA 3Q7SA 2IT1A 2X3FA 4JEIA 1IATA 4ONEA 1NN3A 2IVFA 2CNWA 5KDOA 4RVCA 1E5XA 1FRVA 5F73A 5HCIA 2W6IA 3OZBA 1ECLA 1C7ZA 3CLSD 3HC7A 4FK8A 2AZDA 2ZRNA 4TV8F 4EG4A 5DP1A 3UA4A 3HKBB 2JFFA 4ZVRA 3MCTA 4GECA 5B3JA 3JD2A 3OM8A 2NO0A 3TOVA 2A0KA 1KH2A 4KR3A 1DG3A 4ETWA 1EE1A 3HU1A 5IUKC 1SXPA 4I3HA 4CR7A 1O4VA 3FYUC 3QF7A 1JVBA 3V97A 2QRVB 1BHJA 4NCXA 3P0IA 3CPJB 4PHCA 3V55A 4FOTA 1V5GA 2XYQA 1Y3HA 3ETDA 3W0LB 5CCXA 4JSYA 2DY0A 2DF8A 1JFSA 1ZRMA 3OY2A 4P4NA 3CXUA 4JI3B 3MCVA 2G70A 1UMBB 4V0OA 4IVNA 1QK4A 5TE9A 2VHQA 2CXSA 7ABPA 4HPJB 4G0NA 1Y4ZA 4BQNA 4IHJF 1IN1A 2FN9A 3OPMA 2Z2KA 1EM8A 4IHQA 5CYFA 3LVFO 3ZWKA 2PWPA 1DCKA 1PFGA 4I5EA 1Z22A 2YWJA 3CZQA 3E9EA 1LLFA 4KMRA 5KNDA 3G6WA 4B8WA 1S2GA 2KLBA 4DYHA 1A0OA 2VYFA 2C59A 4EHIA 3ZCQA 1Z7GA 2EEZA 2Z3VA 1TLTA 1V7ZA 1R8YA 1K7CA 2NUTA 4REQB 2FGJA 2BKLA 4IYRA 2ORYA 1CRQA 1CT9A 3KSZO 1RSZA 5CFRA 4QM7A 3MWDB 2VSYA 1FX1A 1W85A 1LV8A 2MR6A 4BJ3A 1JIVA 1WUTA 1N5RA 4MHOA 3HXQA 2OP1A 4ZARA 3VR4D 2B83A 4CRWB 2OZLB 3ORRA 1N1GA 2W2XA 5CH5A 4B7UA 4Z4FA 1RYNA 4E5YA 1II8B 3CZ5A 1U3VA 3RRXA 4EB6A 4GHWA 1IUNA 3E9QA 2I3BA 2WFMA 4HYTA 4BMYA 5BQXA 1DTSA 2XWJI 2Z58A 4YXWD 2W6JA 1CIPA 1PZFA 1ZK2A 3E1GA 4E07A 1KP3A 3ZJ4A 5IC4A 2O8FA 2WHQA 1L1QA 4HWPA 2ZRPA 2IGTA 4HWTA 4IDPA 5HA5A 2WFAA 2VRBA 3I42A 1Y48E 4LE2A 5IK2D 4YJ3F 4MRSA 2JGJA 3LCRA 3PFIA 4PG4A 3BZWA 1DRWA 3L1JA 4R1OA 1X7DA 1J2RA 3L6BA 4LVNA 5C8YF 3SR4A 1OLSA 1W29A 3Q8WA 5BV0A 2ZJYA 4GOLD 1KRWA 2JFZA 4H2DA 2IODA 1N4AA 1Y82A 3A25A 4MB2A 1IBMB 2P2GA 3C7KA 4AN4A 2CV1A 3E03A 2VJAA 1XD8A 2HDNB 2H2FA 1RCFA 1P5HA 5LBUA 4Y2GA 1IXKA 2WJVA 2PKXA 2FPLA 4OHOA 3TYXA 2QYSA 3L4EA 4N76A 5AXDA 2BGLA 2AA3A 4HPXB 1TJ3A 1OIWA 3D2LA 3QPWA 4PPGA 1ADBA 1HK7A 4PX9A 4Q3OA 1XJ5A 4B7CA 1C5KA 1UT8A 3T5AA 2P2LA 1CK4A 1DBRA 4UHFA 3PNLA 3HBNA 2GLXA 4HAVA 4AX8A 4I36A 4KO4S 2ZIAA 1PWZA 3EEQA 4ZJPA 1SN7A 4XYMA 1NVAA 2DH6A 2WIDA 5TQ0A 1U4NA 1XHEA 5DBFA 3SR0A 4J9UE 3OQJA 3WLRA 4IKOA 1D2HA 3EZFA 3RIYA 2JIQA 4RQUA 2ZWIA 2GZ2A 2X40A 3CVJA 3I5MA 4YBRA 1V7CA 5A9TA 9LDBA 3CNNA 4OX9Y 3MWJA 1OROA 1W5EA 1C14A 3TUIC 5JNWA 3TGPA 1ZAYA 3VAZA 1E1RD 3ZJTA 3JAKA 4LZPA 3FPAA 5M3BA 2JEZA 1GR1A 1Z28A 2PYDA 2K2QB 1U94A 3LMKA 2GEFA 4M0CA 4RMNA 5A3JA 3FCOA 4BQSA 5CEFA 4HDKA 1Z4IA 3C7TA 4P34A 4Z49A 3IE2A 2W8BA 2Z56A 4N9QA 4WEOA 1J8FA 5EKSA 3W5JA 4IL5A 2FNAA 1UIMA 3HRKA 4FEEA 3GPBA 3OCYA 1EDDA 1GZUA 5ICEA 1HNNA 1BHO1 1Q15A 2NSLA 1Q3KA 3CLRC 4OK5A 4R40A 3TD9A 3L02A 4CKWB 1Z13A 1L4UA 3T5BA 4PC1A 1PW5A 3U4AA 2J32A 2JCSA 1ORRA 3QX9A 4TSFD 3OHPA 3PRJA 5TNXA 5KWJA 2XXAB 4IH4A 1UBLS 1M6VB 2C5AA 2D59A 2JIOA 1O1YA 1G3QA 1OJLA 2WB2A 1X1QA 2UZ4A 2D74A 1D8TA 2G7ZA 2FSHA 3HFGA 5E1DA 5ER6A 3UWOA 4YMVA 2X7JA 3VOBA 3RAFC 4Z0TA 3ZV7A 1C4XA 4AQ7A 1M8GA 1YRLA 3LU1A 5DT2A 5GV7A 1Q0ZA 2NNWB 1ZHHA 1A9TA 2KLHA 5BYKA 3HO8A 4KXLA 1QOPB 3F6BX 2DPXA 5CW1A 1L3IA 3QVXA 2VP4A 5DYWA 5JPCA 4H4CA 2LVBA 2QRKA 1L3BA 1OQAA 2B36A 1ZRNA 3G0DA 3R3VA 3EPKA 1HQCA 4HEQA 1FNSA 3ZQ6A 1KGDA 3JVUA 1W6RA 2ZEJA 3QZUA 3TLCA 3K30A 2P7IA 3KUDA 4MINA 1I4WA 5JEEA 3FTNA 3FGNA 3WRYA 3PNSA 1MORA 1QDUA 5AI9A 4Q7KA 4ZOEA 3OFSA 4BNNA 1HZZC 1NXQA 2X8JA 3HCOA 1M2KA 2H7CA 1LQUA 4XTCS 5DF1A 1HE3A 4IH1A 2O2YA 1KDOA 1U6KA 1XTKA 1BWQA 2YJ6A 3AF5A 4NBRA 4QYSA 2Y1DA 1KEVA 4KUEA 5FHQA 5B5SA 5KOIA 1ZN9A 4N47A 4K6MA 1MH1A 2HZ7A 3ZCPA 1RRFA 4BTLA 3P19A 4HAWA 5AVWA 2XNJA 5JY1A 4J7CA 2R11A 2ZJ4A 1RCUA 5C5EA 1A8QA 1J20A 4GC5A 5G0WA 3ZGXA 4PZ0A 4YWHA 3EF1A 5EEHA 5I8WA 1RM0A 3GA5A 4YJ2B 2Y0CA 3LYLA 4WKOA 5EPOA 4BC1A 2Z6VA 3JASB 1SU7A 2FFQA 1B14A 3GRYA 4U5QA 1NV9A 1XSEA 3N0XA 3BA6A 3C6MA 5ICFA 2FZEA 2PRKA 2P5TB 4QYTA 2YVLA 3W5VA 1FFDA 5EIOA 2DR3A 5HCUA 2W6ZA 4MRNA 2ZM5A 1UIRA 5A1JA 5B3JC 1GUDA 1GZ4A 4NATA 4BN4A 3K9QO 2O8DB 1OBHA 3NPAA 2FR1A 2Q46A 1E92A 1Q1BA 1VI6A 4NZNA 1FRNA 1T13A 4GLOA 3HFSA 4OGGA 4IR7A 1G5IA 4N3BA 3SKVA 4WQMA 3SYNA 4FW8A 1Y33E 3EZYA 3NATA 3L9WA 1L8QA 3PHIA 3G7NA 4MZDA 2BCJQ 2RKBA 3WJ7A 1VHQA 5A3QA 1IRXA 1XRJA 4M2LA 1E3MA 3OJ0A 4MHSA 4W1PA 3S6JA 2JFHA 4HB3A 3KKLA 5CDGA 3FY4A 4LNUB 5AK3A 4TWRA 2VHJA 4JMLA 5DRYA 3EFOB 1RC0A 1RPZA 2F3TA 1T2FA 2VDQB 1ZFNA 3ANXA 3R74A 4KQJA 2Q9CA 1KBZA 3KKKA 3OJCA 4MW2A 1KJ9A 4Q9NA 4ZYLA 2YH2A 2BFNA 4TWBA 4DMFA 2VDUE 1BXKA 5DTEA 2WY2D 1A7JA 1K3UB 2VO1A 1GO2A 4KGZA 3VBEA 1VSUA 2AGVA 3FH0A 3GNLA 4XASA 4DQLA 4Z1MA 2YWCA 4CIWA 4KPEC 3I34X 4V0RA 2JCYA 1GSHA 1W48A 2PM8A 2QYTA 2IE0A 4XGQA 1KSGA 5ITSA 1E18A 4B4OA 4HNTA 4HWGA 1N8NA 1NBHA 1QZXA 2DE0X 2JFNA 2OQ2A 3CIOA 3IHKA 2R62A 4RFLA 5CLHA 1P4RA 4B2PA 1M1YA 2PRIA 4XWKA 1DMSA 4YDRA 4UM8B 2PUEA 3NBAA 1N0HA 4QLOA 4D1YA 4X6LA 1N5IA 2XUGA 1IXRC 3CU5A 4QSMA 1LQTA 1UPBA 1WVMA 4MV8A 1V8ZA 3E61A 3G9TA 3INGA 5EOVA 2CSUA 1HC7A 1KBOA 2YHAA 4FQ8A 4OBEA 3UT5A 2OBYA 1Z68A 3AG5A 4U2DA 3MPOA 3BRSA 1O97C 2ATVA 1FRFS 1A9YA 2QRPA 2YVAA 1R4NA 2E3JA 2F8TA 4PX3A 1TU4A 5I4BA 1XVVA 1COZA 1P6XA 2VWGA 3FWYA 2HC9A 2G77B 1VYVA 3ZCSA 1JGTA 4G4JA 1D2CA 3GRPA 4NG5A 2BDTA 4IGAA 4YB8A 5BT8A 4MZXA 1SU4A 1PR5A 4L85A 3HPRA 2VWHA 3H0CA 4GI3A 4KN6A 4IIJB 1F3LA 1XZHA 5GV8A 2ROQA 4E4YA 4F4UA 3ML1A 1K0UA 3G49A 5DSXA 1VL5A 1XP5A 3EEYA 4RIEA 3I9LA 3IPCA 3Q12A 1G0OA 1NGSA 3LVQE 2CKMA 5D87A 1DIAA 3FJ1A 2G8NA 4ALJA 3EXFA 1KAHA 1LRLA 2RBEA 4AUEA 1H6AA 2AOVA 1OBCA 3NTLA 3AVQA 5ITWA 4U7DA 2A3RA 1V3UA 1ZVMA 1GNLA 2A59A 4YEDA 4B7AA 3H13A 1VQ1A 5C34B 5B1YA 4P0QB 3ROFA 4C6HA 3FOAA 5FEMA 1E8NA 4ZKDA 1MW9X 2UYHA 2CL6X 4QOJA 1QP7A 4E4TA 5JR3A 3D43A 3QNWA 2B0CA 2IIBA 2XQKA 4P38A 1CEXA 1AQ6A 2IQIA 3UHFA 2POCA 3WADA 4BNGA 1PDVA 5BVHB 3LJKA 2ONYA 1S2IA 3WBJA 3NC4A 1SGWA 2DLDA 1MPXA 4IMIB 2A9QA 3HZRA 1J9EA 4RWZA 4EPWA 8ABPA 3EIHA 4ER7A 4B6EA 2O3TA 4E7OA 1KI2A 2GXQA 4YDHB 5A4AA 3DBLA 3T7SA 4Z4HA 2WKQA 5EE1A 4ENWA 4AYXA 3CTMA 2P9FA 4AI6A 3RROA 4D4LA 1AKQA 3OFNA 2C7QA 1A9ZA 5TLSA 2GO1A 2BFAA 3RE1A 2YMMA 3A4YA 3JS5A 4NI5A 4KE8A 4UKDA 1G7RA 1YI8A 5BV2P 1MUUA 1IJEA 1OLUA 3DBIA 3FJYA 4MWZA 2OXTA 3TB6A 2VA9A 2RBKA 4MDEA 1EINA 1OZ0A 1DX4A 2PDAA 4AYWA 4JVMA 1XQ1A 1J2JA 5JNVA 4LQLA 4NICA 3TBKA 4K9RA 5K99A 3CISA 3PQ6A 3ZYZA 4ERXA 3C87A 3UFXA 4B17A 1W1UA 4BPBA 2ATXA 2ZYIA 2M2IA 4AO8A 3QWFA 1GDDA 2I8AA 1ZMXA 3FOBA 1RFLA 2H1CA 2XBUA 3AEYA 4BIIA 3PUZA 4HNGA 3R5KA 4C4ZA 1JEJA 1DKQA 1KMNA 1SXJD 1Z18A 3FAKA 3K0FA 3N2YA 4OB6A 3TQIA 4C7JA 4DLZA 5IAOA 2I87A 4CEHB 2QJOA 3CN9A 1NVVQ 1WMSA 4Y7CA 2PSHA 4OPMA 4Z53A 5EKDA 4QREA 4F93B 3CG4A 2GZAA 2MSCB 3SK0A 1H1LB 4ND6A 4G24A 4TTJA 5E7IA 4H4DA 2P35A 2V54A 3LO5A 3VV3A 3TE6A 2JIPA 4NBVA 4BU1A 3HCDA 2WYUA 2D7DA 2YRWA 4Z4IA 5FTNA 4QEKA 4EUSA 4HLUA 3NIFB 4WTOA 1DV1A 5TQ2A 1QV6A 4QWMA 4DM4A 4CR6A 1CEQA 3EPPA 3F5DA 3SHTA 1FFSA 1T6XA 1B0PA 1WCYA 2WHRA 1YUBA 4FYMA 2XGSA 4DR2B 1V7QA 3DUFA 5AHOA 2BEKA 2WTEA 3NBUA 3WRYC 1Z7YA 4NBKA 2RBGA 1S2LA 5HHTA 4KACA 3CEPB 4UDNA 1SZCA 1K86A 2E85A 2DHDA 1T1EA 3WG9A 2G1KA 1SRQA 4L3WA 4QYXA 4WE3A 4OAQA 1HA3A 1IB6A 3R4VA 4MUYA 4YGXB 2OCAA 5CT9A 3FNEA 1G20A 1VP3A 1GQYA 3BN3A 3I9V1 3JQEA 3T54A 3GLHB 4R8VA 2WHPA 4ZYYA 4R54A 1XPJA 1NSTA 3A6JA 3KKZA 5CJJA 3BL8A 1JDSA 3U7QB 2F8MA 2VHEA 5DOZA 1E2KA 1W46A 3VXKA 2XHEA 4KLNA 2TMYA 1V7PC 1LX7A 1NM5A 1XEWX 2N3ZA 1C30B 2IF0A 1JKJA 4YJDA 3X1YA 4OP1A 4AY2A 4UXIA 5HNKA 2IZ1A 2YJ5A 3F9CA 3WRWA 5I9SA 4JP5A 4PZLA 3T7RA 4E33A 4EY4A 5EIAA 1CDEA 1KRXA 2EHDA 3VO2A 1Y8RA 1DAEA 3EULA 1E9CA 1CQPA 3E5NA 3FD8A 1G4AE 3RS4A 1N2ZA 3F2VA 3PLNA 3OLCX 4GSLA 3V7UA 3CM0A 2YN2A 3PPWA 4M87A 3AKDA 5AIBA 4DTIA 1AD2A 1ZK0A 2BFDB 2RGDA 1KU6A 4K9PA 5JQGA 2GXUA 4FWIB 5FLXA 3KQKA 2Q2OA 4RVGA 2D4AA 3UFBA 2HMYB 1YS6A 3L4BA 4B6JA 1Z35A 2XTAA 4QQFA 2PCLA 3AEZA 4ZO4A 3RG2A 3LL7A 5EP2A 3TW6A 3MGGA 3SXJA 3W2FA 4AJHA 5EUQB 2EFHB 2QRVA 2H4WA 1XCJA 2YINC 3BJIC 2BMAA 3KVVA 2R1UA 4N7RA 2H29A 2B4TO 4AO7A 1II9A 3B7PA 4N12A 1F7VA 5IG2A 2CNNA 4OY3A 5KPJA 1BMTA 1XTTA 4MR8B 3OMXA 1MO3A 1UUFA 4RF5A 1FIUA 2X8WA 3N2KB 2VN8A 3Q7EA 4QOFA 4WACA 1X80B 3IUMA 3OA2A 2C2YA 2ODWA 4U9HS 5FOUA 4CEIA 1XVTA 1L8XA 1EAYA 1CB7A 4KXMA 3FPBA 3G7SA 1IN5A 4KQIA 1DQYA 3GLUA 3LPNA 2VZ8A 4H16A 1VMIA 4L1KA 3AZPA 1VCMA 3NYQA 4XARA 3KK0A 3U6KA 5CFLA 3LWZA 2EGGA 1ABFA 3V46A 4KQGA 4Z7QB 1PJBA 5IAEA 4YC7A 3B1JA 3F67A 1F1BA 5KKAA 1FW6A 5FPHA 2YZMA 1FYWA 2WA1A 3PXUA 1N75A 5TC4A 4MVJA 1JDBC 1TJPB 3VDMA 3NW9A 3IP9A 1E2HA 3I2IA 3IXQA 3KBBA 3MWDA 4UBKA 5L3ZA 1QTNA 3LGAA 3R3JA 5CU7A 5JT1A 1U7XA 4HZIA 1MENA 4BV8A 1SZPA 4L02A 3V4OA 1PNQA 2Z4SA 5FUXA 2PA3A 2JDID 2RDMA 3O82A 2OZLA 3PTZA 1JXQA 2C54A 3T9AA 2MCFA 3PP8A 1B2LA 4PCUA 3BE4A 1GZ5A 1II8A 1X0VA 2D00A 2F1HA 1KKMA 2I4LA 2R1TB 3HEBA 1M74A 3GEBA 4I2NA 2AZTA 3ME5A 3QEOA 4Y0NA 4BMOB 4H6PA 1DEHA 3BXHA 3FTPA 4PSVA 3AGQA 5EHGA 4ZWNA 1KAOA 1TM4E 2CF5A 2ZXEA 4OQFA 3WA6A 3L6OO 4LF9B 1UQTA 2M32A 3D4BA 3KL2A 1U8AA 2OPBA 4BECA 4PZAA 2X8AA 1EP9A 3NBXX 3MRTA 3QUCA 4PHGA 4B9AA 1GY8A 5K03A 2GXAA 2W2KB 1BN7A 3LFHA 4U63A 2XZPA 1W2HA 2ZDHA 1TO1E 4QM6A 1Z0SA 4LX0A 2A88A 3D6TB 2GD6A 2IV3A 4QGSA 2G17A 1QDLB 4TLLB 3DOOA 5MFPA 2JZOA 3KXPA 1TC1A 4XYEA 1EX9A 2YC4C 1P4SA 3E8MA 1H2EA 2V55B 1PLJA 4XZ3A 2QU7A 3OM0A 1RPNA 1SXJC 2GASA 2ZYGA 3GJ3A 3ZU5A 3RNLA 1T91A 3Q0EA 1PYGA 2FEOA 2HWWA 3KOZA 1VI5A 2YVKA 2X86A 3OM1A 5I9NA 1GM5A 3L8MA 3L9XA 4IDOA 4Z8XA 1AO3A 3C3CA 3PUJA 1ELOA 1DWUA 1DIOB 5JLAA 1CR2A 2O48X 3LI2A 2F3SA 4RZUA 4MI3A 4US2R 2B1IA 4RA9B 4GMKA 1B3BA 4JC4A 4RJLA 4EI8A 4R41A 1U3FA 3T8YA 2DKFA 2JHCA 4OB7A 4JSRA 3BA1A 3TIGA 3OZGA 1KJYA 2AH5A 1CF9A 1VCIA 4JX9A 2H4HA 2YHUA 2ISCA 3AK4A 3E35A 4E3ZA 4QBTA 2NAFA 1EGQA 3IP8A 4I55B 3A1NA 3MYYA 4WZ6A 1QV9A 1CJTC 2F9FA 1AGPA 4ALLA 4C4OA 1JU3A 4UXJA 3UKJA 3E7WA 4G36A 4B8YA 1BYIA 2OZEA 2QVCA 3MWFA 3ZDFA 3AXSA 5CDFA 2OSBA 3QFSA 1B2RA 4ITUA 3WVNA 2ZYUX 1S01A 5C5DA 2G71A 1L7BA 2G08A 2XR1A 2I1LA 5HOQA 3AR9A 4OQPA 5KVCA 4L3OA 2A9FA 4DIUA 4OXQA 5HP4A 1FQWA 1D03A 1OXUA 3AU9A 4NG4A 2ZRKA 4HWSA 2ZBDA 1S8FA 3QVWA 1BGXT 2EW2A 3D3WB 2CJWA 4TRNA 3F6PA 4LWZA 2I4RA 1X39A 3GCWA 5AKEA 2NP6A 2X8LA 4DA0A 1XRRA 4GL4A 4HAUA 3OBBA 5TVKA 5ALLA 1O9BA 1UBUS 3FX2A 2GJ9A 2G36A 4GUDA 2OGZA 5G3YA 1TM7E 4C7KA 3ZDDA 2Z4RA 5DJ5A 1XNJA 3BMCA 3U1VA 2PFKA 2XWBF 4EMSA 1M6VA 3DLCA 3EIWA 3OJEA 2C31A 3L46A 4WVLA 4NCJA 1QYCA 5F23A 4LZOA 2HV9A 3ILSA 4HLUC 1BWPA 1T8PA 1Z2AA 2QAJA 4L72A 1YB1A 2GVNA 4WOBA 1RMTA 4RH3A 2HX1A 5BUZA 3DWEX 2JEYA 3TR5A 3IMGA 3HJUA 1I7QB 3ZQKA 3BSSA 5AJZA 1WEHA 2FWAA 2G1JA 3AY3A 1NHWA 3SCZA 4CG3A 1SKYE 1B0ZA 2RG1A 2Q4TA 3DR5A 3DV9A 1N2OA 2EFGA 3L92A 5FFMA 4QIHA 2QM0A 1GPKA 5H81A 3MAAC 3QFTA 3JQGA 1YR2A 4IDQA 4NC9A 3CPSA 4WL0A 1Y6JA 2ZU0C 3I9KA 2IKQA 3G82C 2GEDA 5DLQC 4D4KA 4RBNA 3CW9A 1OYYA 1X8JA 1S1MA 3T9EA 5EXDA 5LDHA 1LNZA 4DSNA 4FYXA 1V45E 2FN7A 4FNGA 4NECA 3QPAA 3AIKA 4WN3A 3UMFA 1NKVA 1NM5C 5JBNA 3B3JA 3WLFA 1KDYA 4JHXA 3RKUA 1O5TA 1H94A 2BRUA 3WGNA 2NNLD 5IAKA 2O19A 4L5JA 1G6Q1 4D3ZA 3ESRA 5HJ7A 1C9JA 1DELA 1HLFA 3LDHA 4M83A 4YAEA 1LTQA 4NBSA 1DQRA 3VJRA 1QPBA 4YAIA 1TCCA 3GLQA 3RUFA 5A4FS 3JASA 3ND6A 2R7LA 4FYJA 3ZQUA 3OY7A 3AHHA 3Q98A 4G56A 3C3JA 4K28A 1KQNA 1DIBA 4B76A 5JISA 3TXAA 3A1DA 3MIZA 5JBIA 5TPZD 3I37X 2BGUA 2WAYA 2PWAA 3D64A 4PTZA 5DX8A 3RC7A 1KYIA 4HATA 1XZCA 1NSYA 4LJRA 1J7KA 1Z5GA 5AKYA 1W19A 4RPKA 4YRJA 4JUCA 4Q1BA 3UICA 4N3CA 2CMFA 1T3LA 1GTSA 4EEZA 3OAAD 2FFBA 3OPYB 4J1QA 4OKSA 3IAS1 2Y6VA 1VPLA 5DASA 1YO6A 3DL7A 3KU1A 1OCEA 1X1TA 4Y6QA 4LNUA 3ZDAA 5GJWC 4FFBB 3UAYA 3H2JA 5T6MA 2QTGA 3AM1A 1TVMA 1U8FO 1A9QA 1JHDA 2WKRA 3NOOA 2ZSUA 3DBVO 1Y3FE 3OOJA 3QOFA 4QNMA 4CV0A 2O8CB 1N0WA 1X87A 2W4MA 3OC6A 4D4JA 2I1VB 1CPYA 1LW7A 3OURA 1PZNA 4KDEA 2NAPA 4E32A 4CM9A 2YZNA 5KC8A 2H08A 1EXVA 3BKWA 3L0YA 4GQAA 1VOTA 4OSOA 4DLAA 4DR4B 2DT8A 2FSUA 2GN0A 5L3VA 3ANMA 1UEIA 4ZAZA 2I33A 1V0JA 4NU5A 1P7VA 1EFRD 2HSZA 2CDRA 2YV3A 4MUFA 4KSBA 4R3UC 1N5DA 3QKTA 4X1IB 3WYGA 2CYBA 2Q99A 4DSUA 3IUSA 2QLTA 3M6AA 3D6AA 5F7JA 5KI6A 3V1LA 2UUBB 1TMKA 3NALA 2JAPA 2O2SA 4N0MA 3R3YA 1Y6FA 4HRAA 1N2GA 1HRKA 2XCQA 3EAQA 3INTA 3QSGA 2YJ3A 3RV3A 3F5QA 1XAJA 3FFAA 1SOAA 1JL3A 1RP7A 3AZOA 3U60B 2NYAA 3R6TA 1M10A 3P1JA 7REQB 2FWIA 3FOFC 3AHEA 2GWRA 1QMPA 2HSJA 1ISHA 3A27A 4JFAA 4B79A 5BO5A 4ZCRA 1X9GA 4PLWA 3KD3A 4QARA 4G0QA 4B3DA 5JJCA 1M1NB 2MT9A 3OOEA 3DHVA 3IA2A 3N75A 2YOHA 4QDTA 2IJGX 1HT2E 3VSCA 3D8BA 3I6BA 1DIRA 2OM2A 4Z2AA 2Z5VA 4G1FA 2YMLA 3UQYS 3IHWA 3PS9A 1EJ2A 4NS1A 4RMGA 4CU5A 5KWVA 2XDWA 4D56A 5KQMA 2ZIXB 3QHPA 2CLSA 2PTHA 3FMVA 3V1NA 4CFYA 1EWKA 3E48A 1P44A 1CRLA 3OWOA 3P9RA 4LSMA 2VT7A 3GLGB 1VBNA 1LBQA 4U2EA 2L18A 3FPKA 1EG2A 2CJPA 4NZPA 4LK3A 5CA1A 3RUCA 1DRVA 2R2AA 2A3NA 2WFLB 4RH0A 4DDMA 2QMHA 4KU4A 4W63A 3ZTYA 4NNPA