1NVKA

T4 phage bgt in complex with udp and a mn2+ ion at 1.8 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
351
structure length
351
Chain Sequence
b'MKIAIINMGNNVINFKTVPSSETIYLFKVISEMGLNVDIISLKNGVYTKSFDEVDVNDYDRLIVVNSSINFFGGKPNLAILSAQKFMAKYKSKIYYLFTDIRLPFSQSWPNVKNRPWAYLYTEEELLIKSPIKVISQGINLDIAKAAHKKVDNVIEFEYFPIEQYKIHMNDFQLSKPTKKTLDVIYGGSFRSGQRESKMVEFLFDTGLNIEFFGNAREKQFKNPKYPWTKAPVFTGKIPMNMVSEKNSQAIAALIIGDKNYNDNFITLRVWETMASDAVMLIDEEFDTKHRIINDARFYVNNRAELIDRVNELKHSDVLRKEMLSIQHDILNKTRAKKAEWQDAFKKAIDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA beta-glucosyltransferase
publication title Crystal structures of the T4 phage beta-glucosyltransferase and the D100A mutant in complex with UDP-glucose: glucose binding and identification of the catalytic base for a direct displacement mechanism
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transferase
total genus 128
structure length 351
sequence length 351
ec nomenclature ec 2.4.1.27: DNA beta-glucosyltransferase.
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09198 T4-Gluco-transf Bacteriophage T4 beta-glucosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1nvkA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 1nvkA02
2QRQA 3CX4A 1EM6A 2C1XA 4AY6A 5GPBA 3D0QA 4F9FA 2FF5A 5D01A 1C8KA 2GPAA 1L7XA 2GJ4A 3ZCTA 2ASVA 4MI3A 3OKAA 4BQEA 9GPBA 4MI6A 2F3PA 4GZ3A 3WC4A 2X0DA 1BX3A 4GZ5A 2XGOA 3HBNA 4M7PA 3S29A 4GYYA 3TAXA 2QN1A 4BQFA 2FFRA 3CUYA 2BGTA 1FU8A 6GPBA 5ENZA 1UQTA 2KS6A 1JIXA 3MQFA 3MRXA 1UZUA 1FTQA 2JJMA 2XCUA 3O3CA 3WADA 3CEMA 3G2NA 3OTHA 2BGUA 2H1FA 4MHSA 3H4TA 1P2BA 2G9QA 4CTMA 4RIHA 4GZ6A 1FA9A 3T3IA 3BEOA 3MTAA 1FU4A 2ATIA 5DXFA 2AZDA 2JLBA 2PRIA 1KTIA 1GG8A 3QKWA 1WW3A 4YI5A 1C50A 3S2UA 4FZRA 3QHPA 5TMDA 2AV6A 3L7DA 3UYLA 4N39A 2QLLA 4X7MA 3BDAA 2SKEA 1FS4A 3RSCA 1GPYA 1E1YA 3E3NA 4MHOA 1PN3A 3IA7A 1GPBA 3C4VA 3VUEA 2IEGA 3HBFA 1Z62A 3HBJA 4WHMA 4CDRA 1E4OA 3OTIA 3CUTA 1L5VA 2QN7A 2F3UA 2C1ZA 2QN3A 1V4VA 2Q6VA 3MRTA 3ZCUA 3IAAA 1NZDA 2XCIA 3NCHA 3BCUA 3OY2A 4MICA 4WACA 4EKYA 3DZCA 3H4IA 2IUYA 4BFCA 2ZB2A 1P4HA 3RT1A 1XOIA 4W6QA 1YGPA 2GEJA 3OY7A 3TSAA 1WUYA 1NVKA 1F0KA 1AXRA 3C4QA 3T3GA 1LWOA 3MS2A 4AY5A 4N9WA 3ZCPA 3DD1A 1Z6QA 1GFZA 2XA2A 3MBOA 2QN8A 3MT8A 1Y6FA 2C4MA 3BD7A 3G2IA 5D00A 4MI9A 2QRPA 1NZFA 3NC4A 3CUUA 2QRGA 2R4UA 1FTYA 4N3CA 4Z5XA 1SXPA 1L6IA 4YUAA 2WTXA 2X6QA 2C9ZA 3C48A 2O6LA 3OTGA 2XMPA 2QLNA 3WAGA 1O6CA 1HLFA 4KQ1A 3T5TA 7GPBA 1B4DA 3L7BA 3OT5A 4PQGA 4MRAA 3RSZA 1EXVA 2QN9A 1FTWA 3CV3A 3CEHA 3T3HA 3S27A 5BNWA 4XI9A 3OKCA 5C1DA 1RRVA 2QNBA 3T3DA 1Z6PA 2BFWA 1QM5A 1A8IA 1GZ5A 3GPBA 1C3JA 3SYMA 3RHZA 2VG8A 3S28A 3NPAA 1M5RA 5IKOA 1F6DA 2VCHA 3BCRA 2ACVA 3NP9A 4EL0A 1YA6A 2XA9A 1PSWA 4KQMA 1JIUA 5I45A 1RZUA 2QRMA 3G2LA 3SYRA 2XA1A 3NAZA 1XL0A 1NLMA 1K08A 2IYFA 2X0EA 4X7RA 3HBMA 3Q3IA 1XC7A 4X6LA 2R60A 1L5RA 4AN4A 3GUHA 4FKZA 1P4JA 1XL1A 3ZCSA 2IW1A 1VGVA 3MS4A 2R66A 3CEJA 4EJ2A 3UYKA 4F97A 4GPBA 4EKEA 1Z8DA 3L7CA 4N3AA 1Y8ZA 2AMVA 1L5SA 3E3OA 1JIVA 1FC0A 1P29A 5TMBA 3VDNB 3G2HA 4BQIA 3ZCVA 8GPBA 4QLBA 1NOKA 2XGMA 2GT1A 4L22A 1P2DA 1FU7A 2R68A 3L7AA 3CUVA 2F3SA 4YI3A 2QN2A 3FROA 1ABBA 3DDWA 5DLDA 3TOVA 2JZCA 3T3EA 3OKPA 3VUFA 4WADA 1WV1A 2PYDA 1P4GA 1PYGA 3E3LA 3NP7A 3EBPA 3L01A 1XV5A 5JTUA 2GM9A 4CTNA 2F3QA 4G2TA 2G9RA 2VCEA 2VSYA 3MT9A 2QRHA 2GEKA 3G2KA 3S0JA 4HLNA 4RIIA 4M83A 1L5WA 2G9VA 3NB0A 2GPBA 3MTBA 2BISA 3D0RA 2IV3A 2QZSA 1IXYA 4RIGA 4CTOA 5TMEA 3PE3A 4RIEA 2G9UA 3L79A 2AW3A 2QLMA 1NOJA 2IYAA 1K06A 5IKPA 4AMGA 1SXQA 3DDSA 2FETA 3Q3EA 4LEIA 2PYIA 2PQ6A 2YJNA 3CUWA 4NC9A 1WUTA 4AMBA 1GGNA 4XIFA 3PE4A 2PRJA 1P2GA 3AMVA 1GPAA 4EL5A 1Y6GA 1WW2A 3MS7A 3Q3HA 2SKDA 1RZVA 2OFFA 1AHPA 2IEIA 1JG6A 4RENA 1IIRA 2HY7A 2GPNA 1L5QA 2ECPA 1JG7A 3ZCRA 3BD8A 4RELA 4M60A 1C8LA 3T7DA 3MRVA 1QKJA 3EBOA 3COPA 2R4TA 4LDPA 3ZCQA 1NOIA 2SKCA 1JEJA 2X0FA 1H5UA 4RIFA 5JTTA 5DU2A 5HXAA 4HWGA 3MSCA 3D1JA 4NESA 2VSNA 1UQUA 1PNVA 5LQDA 2ACWA 4RBNA 1J39A 3MTDA 3BCSA 3G2JA 3MT7A 4REMA 3VDMA 4F96A 1LWNA 3BD6A 4NEQA 1XKXA 4N3BA 2H1HA 4GYWA 2P6PA 5TVGA 2XGSA 1WV0A 2IV7A 4KQ2A 2F9FA 2X6RA 4X7PA
chains in the Genus database with same CATH superfamily
3ZHQA 2QVZX 3E82A 3C6YA 1WP9A 3KALA 3NEAA 1S3IA 4LJLA 2IS4A 3LT5A 4MLPA 1A9SA 4B6RA 5KSYA 5E95A 4PYRA 1NXTA 2HCJB 3B3GA 3L6RA 4OXQA 1SVWA 2V96A 3L8MA 4AO7A 2FUG6 3IAHA 4JOSA 4GT1A 4R1UA 3VDXA 3H65A 3IDQA 2Q4RA 4J91A 3BTUA 4RCZA 5HHTA 2LPMA 1JZSA 1SB9A 3VC1A 1V1MA 2XUDA 3UAGA 2ZYHA 2OLEA 1FB5A 4K8RB 2QTAA 2ZBQA 1WB6A 1G2PA 1II8A 3X43A 4QZVA 4D57A 4E5YA 1UDWA 1RYMA 1TJYA 1WDTA 2Y66A 3G0OA 1L5KA 2SCUB 3HCWA 3IUEA 1J8DA 2P79A 4JJIA 1DO0A 1N4AA 3VSBA 2X2EA 2D8MA 4OHCA 1K7YA 2NU8B 5KTOA 3OIDA 1EZZA 2PU5A 1RXWA 2C5BA 4M7RA 5LFAA 1T8TA 2E18A 2HHJA 4BFXA 2E4AA 3RKRA 3P32A 3WX0A 4M1QA 4EHKA 3I2GA 4D99A 2WSSA 2AJBA 3TTWA 1LNQA 3T1YB 1L7OA 1X9IA 1DU4A 1YUNA 2YZ2A 4GYYA 5EFOA 4BEVA 4P33A 3EPJA 5I01A 1H4VB 5DBGA 4EYOA 4XQ9A 2N46A 2V7QA 1J0BA 2QDKA 3DMPA 1UBTS 4IZOA 3A9TA 1ZK3A 1KO4A 2PGJA 3TVYA 1WA5A 4AG5A 1KJ9A 3Q0EA 3N2KB 3N70A 5L3QB 5JSZB 4CF7A 2BBSA 2ZCJA 1P1HA 1WB4A 2GSDA 2PO5A 4MA5A 5DN6D 4DR7B 3KRTA 1EA5A 4F84A 1WQ3A 5AW6A 3RSQA 1QH1B 5B1EA 3HI6A 3CEMA 1TFUA 1P77A 2H1FA 4GHWA 3WDSA 2GI4A 5IM5A 1H94A 3DF9A 4XUDA 1EFRA 5JFGA 4H1WA 1ZOOA 4WX2B 5CITA 3KCNA 2P2LA 4TM7A 5DI9A 3HRKA 2AHOA 4NV1A 3P2EA 3DNPA 1NN0A 2E37A 3D5QA 4HQNA 5BW5A 5KWEA 3EPHA 2NP7A 3FNGA 4C6SA 5DHFA 5EE9A 2FEAA 4B7AA 1FA9A 5PNTA 4CMHA 2GWHA 2XT9A 1AJEA 5L95A 2H0QA 1Y3AA 1UC4B 2CWWA 2W11A 2ZJYA 3BEOA 3MTAA 3WWZA 1DEHA 1RLUA 3CZPA 3R75A 4DDTA 4KPEC 4UQLA 2QD4A 5FFMA 4EHNA 3TQOA 1F2VA 6CHYA 3W5DA 2IYSA 2BEUB 3CLVA 4ZOQI 3NONA 2OQVA 2NACA 1SXHA 3GFPA 3U6KA 4QOEA 1D9ZA 2Y68A 1B41A 3CXRA 3N7AA 3V1TC 4Z1MD 4N0EA 4RHTA 3OPQA 3TB6A 2JCVA 4YECA 4W5QA 4NECA 1LPOA 2B4AA 2E48A 3KVRA 1D4OA 2RHJA 2WYHA 3GWGA 3HFJA 3WNCA 4D8TA 3G8YA 1E9EA 4BNUA 3B7PA 4YQZA 4WN9B 1JWAB 1ECPA 2HBRA 3KZOA 3JQBA 3NBFA 2GOYA 3F1KA 2SKEA 2XYHA 4I66A 4D74A 4M1OA 3ZPXA 4LF6B 2VHVA 1TJ4A 4B3XA 4G8CA 1OH7A 4RW0A 4X85A 1KI8A 2HSDA 2CLKB 2W71A 4ARAA 2MSLA 3ETDA 1QP8A 1PGNA 2GHIA 4BQSA 3EOBI 4JENA 3JQ9A 1KKLA 2JGKA 3GLHE 3RVJA 1ZM3A 2NU9B 4BV3A 4NP6A 1C1XB 4GNRA 3UJHA 4KREA 2QN7A 1DKMA 4ARUA 3AIIA 4RA9B 2EJTA 3DFIA 1DC5A 4TUYA 4JBNA 2H2GA 3BN3A 3O47A 4XZ3A 4YCSA 3UAZA 2QKYA 2QTWB 2ZWIA 2HJVA 2FPGB 2RKOA 3FMGA 3HC7A 2NAFA 3MFYA 5EE3A 2WYWA 3KJXA 5ALNA 4F85A 2D2FA 1SR8A 2QT0A 1T8PA 3GZNA 1RE1A 5J1TB 4IUCS 1Q1BA 4L74A 4N9QA 3MOIA 4TOIA 2JJ2D 3BH0A 4Y1GA 2P9GA 3ZHUA 1N8NA 1PT6A 1YIDA 5DIFA 5DM0A 4F46A 5I4CA 1Y4DE 4RKQA 1XEWX 2BH2A 3DVQX 4B3CA 4P3YA 2EFGA 4RV4A 3QHQA 3QVVA 2Q6LA 1SCQA 3DFFA 1XOIA 1A5ZA 2X0IA 2R1UA 3PNQA 3SQNA 2UYCA 1IFXA 2HNKA 4NVRA 2B99A 4E08A 1K6IA 1Z2AA 2WD7B 1XHLA 3O6VA 1KQGA 5GJBA 2GKOA 1LDYA 4INJA 1BXRA 3RJ9A 5ARCA 3KV3O 5JJIA 3DVSX 3ELUA 4MKHA 3OTOB 4OUKX 1WLYA 1WOYA 2CHFA 4OBWA 3TI9A 4XFJA 1SCAA 1OLOA 1YKGA 3FZYA 1Z08A 3MT8A 4JVNA 4U2GA 5A1JA 3LI2A 4XVCA 3RC2A 1GZVA 2WUWE 4CQNA 4YPFA 1BN7A 2NGRA 2XGGA 4HBGA 1PQUA 1AO0A 1D6JA 1MNAA 4JDPA 4ZOLA 3GLHA 4MA4A 4PRKA 1FP4B 2ZI9A 5AHKA 3VZRA 4BNDA 3GRCA 1R9NA 1T1EA 5E38A 1Y1RA 4N3CA 1FUIA 1ZEMA 2Q5OA 3C6QA 3K32A 4EVSA 5H3HA 1G3IA 4FTWA 3MWEB 1QG0A 1Y8AA 1ZC4A 3ROKA 1SXPA 2HDNB 2AI1A 4CCAA 3TRKA 3OIFA 3PWTA 2AZ4A 3IEIA 1TA9A 3IXLA 2X6QA 2ZFUA 3FKSD 3CLSC 1WB9A 5LP6C 3KWFA 4LXIA 4RVOA 4YLEA 2FN4A 5IC5A 3M9XA 1Q0RA 4KACA 5K8LA 5M34A 4MS1A 1D9XA 1Y34E 1G9TA 1U28A 5E3JA 5HE8A 1E3EA 1ECLA 1T2NA 4C21A 1ZZEA 1DWUA 1EBBA 4PG5A 1G1MA 3ICWA 3LA6A 1J99A 1HOXA 1A5BB 3WOHA 1JX6A 3KQYA 4FYWA 1P80A 5B6PA 1KAMA 2C4TA 2P41A 4JBHA 5DHTA 5FUWA 1EX1A 3EPLA 3OD5A 2BMAA 3WKBA 2W6OA 3UY4A 4PHHA 2WAAA 2XCOA 3CEHA 3ZD7A 3WLHA 2RK4A 2FPMA 4X1YA 1L7BA 2R97A 5C80A 5LUBA 4Y2GA 1JLMA 2M2IA 2YV1A 2RHCA 4RM2A 4PPNA 2D3WA 3ZOKA 4UPEA 3G8CA 1IHUA 1KVUA 3CUKA 4HB3A 3K71B 4WFKA 3LCUA 4AZ3A 4C0XA 4FM9A 3NGLA 5F3WB 2Q27A 2GHRA 2ZAOA 2FUCA 3U39A 3VSEA 1H4QA 4I1OA 3SSNA 3UMJA 4BQNA 3JVEA 1HMPA 4MDFA 2X42A 2R8PA 3W8FA 3HYLA 4BOYA 4ARVA 2HF7A 3ABOB 4CYMA 2ZJ3A 3PJDA 1P19A 4P7FA 2P1ZA 2HF2A 2OXEA 1XZIA 4FLFA 5CXXA 2G9NA 2PMEA 2REQA 3T0IA 2PUEA 2XUJA 1SWVA 2HNAA 3BTOA 4HEJA 4D97A 2IF2A 2IYFA 3PQ4A 4HNAA 4OHBA 5JXWA 4LY0A 2X0EA 4FSDA 3N8GA 1LPPA 2Y0CA 1SOVA 3BS4A 3EMKA 4H35A 3GP8A 1UMCA 1FMJA 5GJCA 3NFRA 4B34A 2CHQA 2HDWA 3PHBE 1G98A 1YOVB 3C6ZA 3OOWA 3PCXA 4MUKA 3WLAA 4QOFA 4MPRA 4QWWA 5AESA 3AR5A 3LWBA 1QAQA 3K16A 1D04A 3A4TA 3NNSA 5FAXA 1Y9AA 3CBQA 4KXMA 3WLIA 4KU4A 5FPYA 3JPYA 4GMGA 4MW6A 3KPWA 4KR9A 4EJFA 5HX7A 5GIOE 4TZ6A 2WA1A 3FSGA 2NUTB 2GZHA 3C3JA 2Y1LA 3AFNA 3ILHA 5JU6A 5CNMA 2J3IA 3LQYA 5GONA 4D8WA 4FDMA 1HK7A 1CD5A 3ZIAD 2FZCA 2ZTVA 5CDYA 5K99A 5CCBA 1H93A 4F97A 4O4IB 3K1AB 1TVCA 4PR0A 3GMSA 3GT7A 4PVDA 2SHKA 3D4OA 4C5CA 2NVUA 1ZM2A 3O8DA 4D9FA 4EKNB 3VMMA 4I81A 4AROA 1FUUA 2FI1A 2IDMA 3Q6MA 1HRKA 4XYEA 4WOPA 3UGQA 3RJTA 4V1CA 4G0WA 3CRZA 3ZWDA 3ZNQA 3Q3JB 1JGTA 2QJWA 3S5UA 5IABA 1VRWA 3VDNB 3KJIA 3KHUA 4PLFA 4Z0NA 2H11A 2RHTA 4GMKA 3COZA 1UMKA 2LBPA 2VF4X 1SD5A 5CG1A 3ZBQA 4K6MA 5BSTA 4D3SA 2EG9A 2O14A 4EUSA 8AT1A 3E84A 4NONA 1NRXA 3NEPX 3OZUA 5CR9A 4AKSA 1CUWA 4CL0A 1SCUA 1ILEA 4XDGA 2Q6IA 2W00A 2D62A 4M46A 4TT3A 2PG3A 3B3JA 5DB4A 5K0EA 2MSDB 1VYTA 1XQ9A 1F20A 1DJQA 4L28A 4IQFA 3U7QA 2AOUA 5IJZA 2H2AA 3OCYA 1X7GA 3NBXX 4MEBA 4LDZA 3U3OA 3OTWA 3BGWA 3ZWMA 5DBEX 2ABWA 4AZ0B 2IH4A 3L8DA 4OQNA 1ZXLA 3EVCA 4PW0A 1R6VA 2PK3A 4WKCA 4EGAA 4BTVA 3EBPA 1BS9A 3R23A 3PNBA 4KV9A 3RBAA 3WQBA 1H0KA 3PYMA 1YR6A 1R8QA 5JMOA 3IEUA 4QAQA 2HWUA 1OX4B 2OT3B 3BYZA 4PAWA 5E6UB 4HAUA 3F4KA 3L8EA 2VHEA 3CN9A 3SZLA 1Q7RA 2V4ZA 4WL0A 2OPBA 2UZ1A 3BZWA 4QEZA 5L53A 2QW1A 3ESBA 1F2UB 3ZE9A 1UINA 1QCZA 1YZLA 3KTAB 5JSYA 4MVJP 3LPLA 4ZIRB 4DV5B 4S0XA 2D8AA 3KVOA 4Q6BA 2ZBGA 3AHDA 4RFVA 3T99A 2I65A 4NNPA 1D5CA 2NLOA 1NWHA 4AYWA 4KITB 3AM5A 2VQFB 2QMOA 3NB0A 3C8UA 4UOQA 4ASUD 1GA4A 3W79A 3JXEA 1FFEA 3I76A 1SZJG 1WVMA 2QZSA 3D5EA 3DFKA 2X2PA 3G68A 1GITA 4PSVA 4DV6B 2XZDA 5T4FA 3LDFA 2PX6A 2FE4A 2X8BA 5JAIA 5K09A 2BE7A 5FTNA 3VNQA 1Z2OX 3ABIA 1DKNA 2J4CA 3Q40A 4MWZA 3V2HA 1AKWA 1UKBA 3FYTA 4HDSA 3M7IA 1UC9A 1U9ZA 2H16A 3O4IA 4KO4S 1SELA 2GCPA 5EP3A 5LQKA 4EBBA 2A7QA 1Z0KA 2RJNA 3S5JA 4DV7B 2C4KA 2IUUA 5BW8A 4AMGA 2DUUA 2VHWA 2DUMA 2JVKA 5HF5A 1DKLA 2GHTA 3PFKA 1PUXA 5JWHA 5J43A 1EJBA 5I3ZA 1R4MB 2QPAA 4IMJB 4ONEA 1AURA 3WWDA 3OZEA 3T3OA 1L6RA 2YJNA 4MI1A 5AIBA 5DBIA 1E9FA 2NZUG 1Y8RB 5IFLA 1PQ4A 1YMQA 5AVRA 3LNTA 3TWOA 3SYNA 3VR4D 5BWOA 1PHPA 5FL7A 4B2IA 2DFKB 1UOOA 4LMBA 4NZZA 1DDGA 4ZVLA 3IILA 4DRXA 1UH5A 4YV7A 1RBZA 1ODTC 1U2GC 4NCKA 1T5LA 4P86A 4F4HA 4L8GA 1V1MB 4PO1A 2BCGY 1IVYA 3AW9A 4QUBA 2CNLA 3R7NA 2J46A 3VPHA 5HIJA 5KOHA 1NKSA 1V4NA 4LFBB 4Y7CA 4I2NA 3W34A 2PT5A 3ELYA 1SC4A 2IU4A 4KMOA 2RMKA 2B8NA 1GWNA 1COZA 4FYYA 1XMPA 4QGGA 1H0SA 3U62A 5JECA 2H1OA 3B7GA 4QASA 3VNSA 4YPVA 3M1LA 1TQ4A 5KCZA 1YQEA 4F3RA 4WZ6A 3Q9NA 4HBZA 5GJVC 3P45A 5K3AA 1Z73A 3P5BA 1N2JA 2GPNA 1ZX1A 5KPJA 1GQFA 2RBKA 3NVKI 3E3AA 4HXYA 4BZPA 2X2FA 2BJWA 5DT2A 3T7DA 2P68A 3WGIA 1YB4A 3ONFA 2IRWA 1FDIA 2BFFA 5AT1A 5KZMB 3AHHA 3NJ8A 4X71A 1OAKA 4D0SA 4DTIA 1Z2NX 4LZLA 1O03A 3UFXB 4NK5A 1B3BA 1CV2A 2B69A 4NH4A 3SLKA 4CM8A 1KI1A 3FYDA 4DA6A 1NW7A 4INOA 3PDUA 1GRVA 4KXUA 1JEJA 1FYDA 3V4OA 4DT1A 1JXOA 5IANA 1FMFA 3D3WA 2CL0X 1H5UA 5IUNC 4ND4A 3OOJA 2O8DA 1VL6A 5BSHA 1OWOA 3WL3A 1NWCA 2DLNA 2ZDGA 3CRMA 4JJ8A 5DFAA 4NAUA 1OCEA 3K20A 3D1JA 3EIEA 2HMYB 2HYIC 2VTVA 4G67A 2NQ2C 1H66A 1JSLA 5P21A 3G8AA 2R8EA 5CGQB 4N76A 1ZNXA 4J76A 2Q1TA 4HNVA 3V34A 3N2NA 2AZMA 2YCLA 4TXJA 4WVFA 1E9AA 4G1EB 2VWQA 4R8KA 3JZMA 3RVQA 4BBJA 1V7PC 3DLHA 1E89A 3KUDA 5DEIA 3MUOA 3BQMB 2CW5A 2XLCA 3E53A 3BD6A 3UWMA 1VGRA 2GVZC 5JALA 2NUBA 3VJLA 5ITZA 3CO0S 5G02A 3DE5X 4RX1A 3C7TA 4PZ0A 5MF6A 2HADA 1JXMA 1BE0A 4OQLA 4I5DA 2R62A 3IPAA 3LP6A 3FCAA 2ZRIA 4FFNA 4PFKA 2PJDA 2VZ0A 2O1XA 4PS1A 1MT3A 4R1NA 2BH9A 3UVEA 2PUJA 3OJEA 1F5SA 4IIDA 5B3AA 1NW3A 1VBMA 3DNFA 5HKKA 1G19A 1V11B 2EKZA 2H4WA 2RB5A 4X7PA 4I50B 2QRQA 1T4MA 2MOKA 1ZITA 9LDTA 1H9AA 4EHAA 1X9GA 2WW8A 5CBPA 3BK1A 4U2EA 3STTA 4C6RA 4CN9A 5JJBA 5DBHX 2HW8A 1C3OA 3MG9A 4AAYA 3GDOA 2QY6A 3QVJA 4X8OA 2YVAA 1CUZA 1NONA 1XTQA 1D1SA 2XUIA 2VNAA 3Q3CA 2Q4EA 4JDUA 5TS3A 3VZBA 1W0JD 4FUTA 2CNOA 4BO1A 5AI0A 4L8WB 2QIPA 3EISA 1XA0A 4MYTA 2V6FA 5CX1B 4YMUA 3URMA 4YR9A 2P1RA 3D2LA 3BXGA 4FYHA 3SBEA 2NXEA 1FPQA 2DHCA 2J7PA 2VDJA 4CIDA 2F3PA 3TUZC 4S04A 4LPKA 2JEYA 1KY3A 1N6IA 1PJBA 4FOPA 1N0HA 3LIIA 4GKBA 1GPNA 2HOQA 1UZLA 2P67A 3A4MA 3HJHA 1VHQA 3K5WA 3NHAA 4UQOA 4CMAA 3GCXA 2RAUA 4K9RA 1V6CA 4GZ5A 1SCIA 4MUXA 3RQSA 1V8BA 4FDUA 3D2BA 3TLGA 2BY4A 4YMSA 1T3HA 3CEPB 3QPUA 4URUR 3C97A 4C2UA 3DYVA 4W5HA 1W5BA 2DBQA 3DONA 2IS2A 1X7XB 4Q16A 4IIUA 2P7IA 5KNCD 1HV8A 2GNAA 1OY1A 5CB0A 3THXA 2I2CA 5DHUA 4M0DA 2C3PA 1DQYA 3VR6A 4ALNA 1PR4A 5SY4A 2O05A 5C7LO 4HSGA 2CSUA 4EG7A 5ICSA 3ZE8A 1HWYA 2CSXA 2JFNA 4JR2A 4XLZA 2IUSA 3IP7A 3OQBA 1Q0HA 1OBFO 3ECSA 4LRYA 5CLGA 4KZPA 4OFXA 1N6PA 3I3OA 2JLCA 4OHMA 4DMMA 1Y81A 5FRDA 2R1VB 2YIMA 1OFHA 1MIOB 2BI7A 3MCVA 2JJMA 3NIBA 1X1SA 2IYEA 5J1SB 4W5TA 1BFKA 1Z63A 4D3YA 1SUCA 4FNAA 2FRVA 3C5HA 3QWIA 4YUZA 4F06A 1XTKA 3FNRA 3ONNA 1AIPA 4MMZB 1UOEA 3GLHB 4GWKA 1FFAA 3O9ZA 4QTZA 3D6NB 3F3SA 5LB2A 2D0PB 2BGKA 1D2MA 3I6ZA 1G3QA 5IM4F 4A92A 2GLXA 4MV4A 1A8PA 1CWUA 1DZ3A 1M6WA 1KORA 4N4AA 2COUA 4KNYA 4YAJA 4AB1A 3V48A 1PVDA 2HJRA 1THTA 1D8TA 3LG2A 1BWRA 4BGUA 2IYQA 1BHSA 4O4IF 2AZDA 2JLBA 1I2AA 1I30A 3I34X 3LLMA 4GR9A 3FD8A 3DLBA 2PXCA 2EC5A 4F3YA 4UHEA 3MIZA 1BXKA 3AHCA 3MTIA 1GG8A 2ZB3A 1KFCB 2H85A 4PPQA 2DBZA 3HWWA 4E4RA 2DPXA 3F5SA 3EDCA 2EIHA 1R8JA 2QSUA 5CVDA 3UUGA 1WW3A 1C50A 2JIRA 2RKBA 1YSCA 1IMJA 1Z6ZA 4ZVOA 4N5IX 3ZE6A 5L51A 2CL6X 3QHPA 1VLVA 2K87A 1TI7A 5AHWA 2BR3A 1DCTA 3QPVA 4C89A 2IYYA 3RRNA 4NBUA 5HS6A 1V16B 1QIJA 1GPYA 2W83A 5EERA 3F7OA 4OJKA 3F67A 2CMKA 4MKXA 2Y2VA 3FPLA 4ZJUA 5BUCA 4C0AC 4XPIA 3E22A 1Q14A 4I9NA 4YN3A 4G0UA 3AK4A 1UMBA 2Q1XA 2W2KB 4O4LA 4JI1B 1RQGA 3KQVA 3NTXA 1EAMA 5TGTA 2P9TA 2C1ZA 4LYFA 4L0MA 3NH6A 4I8XA 2XRFA 2P5TB 1U8XX 3OPYA 1GKYA 1CRLA 2AFVA 2I2FA 4LV6A 521PA 3QU2A 4ZQGA 4FONA 4Y9SA 1DCKA 4HFMA 2H29A 2OG2A 4NY1A 2NZYA 4U6NA 2QXTA 3D8BA 3O8QA 4LHEA 2P5SA 4QWMA 4TLLB 4Y9UA 1MENA 5AOBA 1B3RA 5A62A 3CURA 2FZWA 1SA0B 4BIIA 4II2A 1C3XA 2EJUA 5BNFA 4M1EA 3WRXC 4JC0A 3CW8X 4R5MA 2C7OA 1T91A 3CKKA 2ZAIA 2WHPA 4J94A 4E6PA 2IUYA 4DCVA 5THKA 3JAWB 1IY9A 5BV2P 5EP1A 4H18A 3MHTA 3UO8B 621PA 3NTVA 4EHIA 1KVTA 3WK6A 3WKDA 1M1NB 4KRFA 2GAAA 5TGDA 2WIDA 4EKDA 1G9SA 4K9OA 3EXIA 2AGVA 4KQFA 2LXNA 3UWKA 4GL2A 1OR8A 2YJ6A 1DC7A 4BE7B 3MS2A 1LDMA 4JYAB 1H1LB 1R2QA 2JK1A 2YIJA 4OBXA 1ECBA 5IJ0A 3NDBB 3H5LA 1UBFA 5EHXA 2NVUB 3OJXA 3EY9A 2LGJA 3PT9A 3SWWA 3TF5A 3FPHA 1QIMA 2GZ3A 4KYIB 3WLSA 5KYWB 1F4LA 3CUUA 3T9AA 3H9JA 3PYLA 4XOIA 1FTYA 1N7GA 5DT9A 3SJAA 1OFUX 4X1KB 2O8FA 2NU6B 4DV3B 4A10A 4EPWA 5K2OA 4HUTA 3MUNA 3C74A 5JC1A 4PIMA 4MQMA 4YUAA 4NHEA 2W2MA 1MJHA 1ZAKA 1XTRA 3BK7A 4BB0A 3LF1A 4M36A 4LWOA 3HMKA 2XMPA 3QA9A 2ARKA 5KQGA 1Z6TA 4ENTA 2PJRA 5K7SA 1ULTA 1K7SN 3LXXA 4M6WA 4ND2A 1V7ZA 4XM2A 4HK4A 4F92B 1Q7GA 2G1KA 3BBLA 4JUBA 3GD7A 3UAOA 1C0EA 4HD8A 1VSVA 1WX1A 1DCMA 3GFFA 4IDAA 4K6HA 5TLSA 1E7SA 3D4NA 3MWYW 2FSIA 1NU6A 3U7QB 4ND8B 2OWEA 4UVGA 1I7PA 4PC1A 3EY4A 4BNMA 2OBFA 4C1BA 5KO2A 1NF9A 4LZWA 3BE5A 1XSEA 3FJOA 3VU9A 1SBHA 2WJYA 1Z6PA 5HF9A 1Y4AE 3LUJA 1QPBA 2JFHA 3ET4A 3JY6A 5K8VA 3GPBA 3EULA 3L2OB 3DKRA 3NRBA 5L40A 3NAMA 3SYMA 4Y1RB 1EP3B 3EA0A 2PQ2A 3NRCA 1M5RA 2XKJE 2GVDC 5IVHA 2QVXX 4EW6A 2BAGA 2QRVA 3NQ41 2JBAA 4MVJE 4MVXA 3UBMA 5K3CA 3RSGA 3UUWA 4BO8A 3DBLB 4WZBE 2A0XA 5I7EA 1DG3A 1GJRA 3U37A 3I2JA 2PMDA 3WP0A 1QTQA 4NOKA 2Q7DA 3QKRA 5BN4A 2P0AA 4XD7D 1HFJA 2AN9A 1YE5A 4OFWA 4YY3B 2A35A 3NAZA 3TBFA 1K5GA 3FFXA 3KSDO 4EYQA 3D7KA 2H51A 3D4LA 1NR5A 3C1AA 3JASB 2LNDA 3OLWA 3WRVA 4NPHA 4GMFA 1R64A 4UCQA 3D5TA 3EK2A 3G8BA 3KWMA 1SQ5A 5AKYA 1WXXA 3OICA 5C4IA 1IIBA 4CFZA 1QO0A 4FJ2A 3AY3A 3N0VA 2JIMA 3B38A 2J3KA 2O2SA 3GJ7A 3GUHA 4G84A 2W90A 4NKRA 1I32A 3WNVA 3PZBA 1YS6A 4M89A 1M75A 4E5UA 3PP8A 4ZCLA 3JALB 4AURA 3EGXB 1C1HA 1YJXA 2C8LA 5TF0A 1NVBA 2H52A 1JT2A 3BF7A 2C5GA 2ODEA 4EJ2A 2X15A 2WT9A 4QE3A 1YJQA 3EWNA 5ALGA 1SCNE 4FR2A 3H8VA 3DT9A 3TINA 1E3IA 3O7WA 1DKUA 2I9KA 2Q5HA 3ZXUB 3A4YA 3SZRA 1L5SA 1C7RA 5EZ6B 3TM4A 3S1SA 4DRXB 4H3SA 5FUVA 3OC0A 3PHLA 4S35A 4WLEA 1NW6A 2DVMA 4YRRA 4IFIA 4M8KA 3RKUA 3ZCVA 3F5MA 3KWLA 1YQQA 3QNMA 4ZZIA 5KOHB 4MVJA 3I92A 2PMBA 1DUSA 2H5LA 2J5XA 4I50F 4WZBA 2GF0A 2NZWA 1UPUA 4CQLA 3N2LA 1I24A 5IT5A 4RJIA 1L7VC 1OXVA 2ZZNA 3GQBB 1JQAA 1IUOA 4DANA 1ID1A 4G6ZA 4DBLC 3FY4A 1YQXA 2JA1A 4B3TB 3MJDA 5FA8A 1M2OA 1T6YA 5D6NA 1RMYA 2C8KA 4IINA 3QSYA 1MNQA 3FIUA 3U60B 2V9CA 4L85A 1TQ2A 1BMFA 2HLDA 3DXZA 5IFKA 4ETMA 1Z68A 4BLTA 2VC2B 3ZQUA 4FP9A 3CX3A 1T8UA 4R2IA 3IL2A 2PYDA 3O21A 4PCLA 1S2LA 3HK2A 3F71A 4TV9A 1XZHA 1XI2A 3NP7A 4A6DA 1DUVG 3NEYA 1T43A 3DR5A 1U5BA 2HBZA 4XH9B 4J0JA 4AULA 4UTNA 5JTUA 4PBSA 1JHZA 2IODA 2OZKA 4JLBA 3D6FA 4US0R 4DT1B 1QJ4A 2IZ6A 1QGDA 3SX2A 3D3WB 1L4HA 2JVJA 1NF3A 2X0KA 3I1FA 4RMGA 3WL6A 5JO9A 4BNZA 1XO1A 3FI9A 5EUQB 3V97A 4E1BA 4QDTA 3O0TA 4Q7JB 4TTVA 2NV0A 3WWYA 3EGDB 4DW8A 1J6UA 2J0VA 1B42A 1YS4A 5E9JA 3ANSA 2HCBA 4OJYA 1LA2A 2FRDA 4UATA 3VO2A 1CEEA 2ODQA 3CU5A 4E46A 1ISIA 4Y2HA 1XNRB 4LI0A 4R54A 1KIAA 1U2DA 1B00A 3TSZA 3ZKAA 4EY8A 2CXQA 4B5LA 3AFGA 2WE7A 3CXUA 3HR8A 4FOOA 5C37A 5A2QA 3K70C 1AQ6A 1KERA 2YS7A 5TMEA 5HKBA 1O6FA 2FK8A 3SVZA 3GLSA 1X1DA 3BRSA 5CPBA 4Z4CA 3ETNA 3KBOA 4L5IA 3GVHA 1X94A 4P7KA 4YYZA 2FFAA 2WV7A 3ICCA 1NOJA 2BRUC 1MB0A 2X8LA 3M3HA 4HSEA 5FL3A 3SOPA 4BNWA 2C0CA 3FCYA 1HMYA 3TQHA 3DQZA 2RIPA 2OFOA 4EMBA 3AYZB 4GX5A 3M4XA 2H5IA 2PYIA 3P2OA 2M6KA 1OWNA 2PQ6A 1UKVY 2CVOA 2JH8A 2Q5FA 1P6QA 1NSYA 1O58A 4ETNA 1HQCA 1M1YE 4HFNA 1XVVA 4XA8A 4G89A 5CBPB 3DV0B 4EGFA 1NY6A 3GHHA 1CQXA 2BDUA 1LKZA 1THZA 2CFOA 3HRHA 3CBGA 3ISVA 4AJPA 4DCPA 4D0RA 1OIXA 1XJ5A 3RKSA 5L6MB 2BFEA 4EX7A 3CQ9A 2EV9A 3U0BA 4P0PB 1M2EA 3IKLA 3VNRA 4LZNA 5C5EA 4DADA 2DUNA 1Y6GA 2WFMA 2D6FA 4YASA 4BC1A 2AMYA 4GVLA 1QHGA 5HM8A 1LS1A 5HJ2A 1R9JA 4ZVKA 1X14A 3RAEC 2PZLA 3LPNA 3GI1A 4GI7A 1CFJA 2XB9A 3KWJA 2VDKB 5FBHA 1N6RA 4ZC8A 2QYOA 4RSHA 3M5PA 3OEWA 4ZAYA 4ZV9A 4ZYXA 1OFGA 1U3FA 1RAEA 2X8AA 1M6YA 4N0MA 5GZ1A 1GV1A 1XTTA 4DIKA 3SQXA 2BHSA 2AFRA 4YJHA 2BGWA 3NJ4A 5HCUA 1Q5PA 1QMGA 3FZGA 3QLUC 4PLPA 1N6OA 2GJSA 1SVUA 1RM5A 3QWBA 4P08A 4I46A 1VA5A 2IOQA 3RUEA 1FX0B 4YJ2A 2X3YA 2Z6VA 3ENNA 5CLLA 2ODWA 4PGAA 1F06A 5T7BA 1Y5LA 4DLWA 5BMVB 2HGSA 3H8WA 5PGMA 4UHCA 1WBBA 1QGED 4N7BA 1QFJA 5DW0A 1F8XA 3A0UA 1GGHA 1ZSVA 4TXLA 5FYQA 4I1RA 4KR0A 2GM5A 4RKFA 2COEA 1CDEA 1P18A 2YHIB 4FW9A 3ZVNA 1PI3A 3AHJA 1P1FA 1YHYA 3H6HA 3PCRB 4GUAA 3TD2A 3V7NA 1W19A 9MHTA 1LPBB 2ZDQA 1ESNA 4WNAA 2UKDA 4IS3A 1U4OA 1T29A 3JPWA 3TR5A 5EZQA 3SSMA 4OMCA 4F4IA 2EJWA 2OENG 3H2JA 3K4QA 1CJUC 1ZJ6A 3H1GA 2VPPA 3GRRA 2B1RA 3HDGA 2XNDD 3QBEA 3QE0A 3ZZMA 4YCAA 3O2SB 5ALUA 3AH8A 3BOSA 2EW1A 2CJPA 2OC9A 4GX0A 2GZAA 4N3NA 3J7AC 2Q2NA 1DAOA 3ANXA 2KX7A 1P2TA 2QHXA 2VJMB 1U0LA 2F1HA 3MM4A 4EY5A 2YWXA 2RHHA 3OX1A 3VKGA 5SYAA 5ES4B 5AVQA 3PQEA 1L3IA 3P2MA 4YMGA 5EFZA 5HDQA 4EFNA 2B82A 3LY8A 4EM6A 1WSDA 3OEEA 4E11A 4HDNB 3BZUA 4E2FA 3IOEA 2OXTA 3H75A 1E3LA 1T8YA 1AXEA 3ZDQA 3ZWOA 2BKXA 1QGOA 1KRXA 3MGCA 4E88A 1E1RA 3SIRA 1ST2A 4YRCA 3LLUA 2XUGA 4CU5A 2RAVA 4E3ZA 4LJRA 2ZKLA 2VP4A 2Q5JA 1ND6A 2I1LA 4G9EA 5EWJB 5CD1A 3MMNA 1OLUA 4LECA 3SFTA 4C2AA 1AM4D 3AYXB 3O84A 4IO1A 5K0CA 3C5WP 2H2WA 2HIGA 2JFOA 4DE5A 2A0UA 2MYPA 3EGOA 3LUFA 1XLVA 4NV3A 2ONKA 2H7CA 2WZCA 2IA5A 4LOLA 2EKDA 4HH4A 4B80A 4LOKA 1WMSA 3EASA 3NXKA 4MR7A 2OHXA 3CPHA 5A3JA 1WB5A 3WJAA 5FTLA 2EF0A 2Q3FA 2HPZA 5IKXA 4GR5A 1RRKA 2F62A 1KMHB 2CJWB 4AKEA 3IQXA 4RY9A 4CR7A 4A6EA 1UWKA 2VLIA 3ONWA 2GETA 1GAXA 2NPFA 2C57A 3FAKA 4TMZA 4HAXA 4G3XA 4KIFA 4YJKA 3LGXA 4HXFB 1TGYA 2GRAA 4LBWA 1OIWA 4PAOA 5C7YA 1JHUA 3OPYI 4KG7A 4UU7A 4G1VA 1N2BA 4FFWA 1KI6B 1PNOA 2VDVE 4JGBA 4II3A 1JQ5A 1RWKA 2YXNA 3C45A 1JHOA 1MA3A 2YNMA 4FCCA 1YTUA 1Z47A 3GN1A 4MW2A 5JBNA 1PHRA 3HEBA 4FGUA 4DQLA 2ECQA 3JQAA 2V3CC 2HU8A 3GNLA 3NBMA 4ENRA 3A1UA 1PWEA 2ZREA 4V0MA 3RJ5A 2BR5A 1AU9A 1ZU4A 5JDIA 2AZTA 5L6LB 1UIMA 3NG1A 1V9CA 2R5WA 5BPHA 2W42A 4D96A 1HDYA 3E61A 4EA9A 1CUXA 4RPHA 3MD0A 1JQKA 1ZQ1A 3FB4A 1RKUA 5AKEA 3CZRA 2UYQA 4ZYUA 1VJRA 3KLPX 3GA5A 1XN1A 4O2RA 3ZNNA 3KJNA 4G4SO 5F7JA 2QX6A 2ZYGA 3DE2X 1KRHA 1SIBE 4NK4A 3V33A 1T4BA 1JFFA 1RCTE 1M2JA 2BGUA 4J43A 4PX5A 3OUTA 5CM2Z 5ULLA 4HQKA 3T34A 4I08A 1YJCA 4B7UA 5CFPA 5JHHB 3RTCA 3E03A 3DBOB 1V26A 1VLMA 3U4CA 3VKVA 1BOOA 4BO6A 5I47A 4K9PA 2G9QA 1A77A 2I87A 2RGXA 3TMKA 2OV2A 1QGUA 4IJQA 4TS9A 4MAAA 1R18A 5E2IA 1H42A 2DQYA 2NU7B 1UK8A 4ZEXA 1II0A 4PZEA 1A50B 1AY0A 4R8LA 1EUDB 1GU0A 2J6HA 2XZLA 1RJDA 2I3ZA 4Y30A 4FYJA 3RQIA 3OCWA 5IS2A 4IDCA 1PBTA 2WLSA 4S1PA 1P7VA 2HHAA 4RVNA 2XBUA 5EQTA 1EQAA 3UHAA 3TIFA 4REQA 2BTQA 2WOJA 4OMUA 2FPIB 3AG6A 2VZ8A 4OIFA 1JU3A 2RG7A 1XTUA 3MVEA 4BVBA 2CLMB 4HS9A 4L2IB 1FFCA 1T2EA 3P8ZA 3SVLA 4XYGA 4C43A 1ISMA 1B8NA 1CS4C 1P74A 5IDVA 3RYTC 2I76A 3C3YA 1KO8A 2HYDA 2QJTA 2R6GA 4GGOA 4HRXA 3EW9A 2O8NA 1FRQA 1X7YA 1QBGA 2QTHA 3HBAA 2XD9A 3KC2A 4XSHA 5IAJA 2AVDA 2ZETA 5KUTA 4B71A 3BDAA 4PEVA 1T2AA 1VLJA 3E2MA 1YRHA 2ILVA 1B73A 4JJEA 5EZYB 5G0UA 3WGVA 5JSQA 4D9GA 2D5AA 3SBXA 3A10A 4OYYA 3TLMA 3T4XA 1B1CA 1HUQA 5IBCA 4WHMA 1YVPA 4R2HA 1MEEA 1AD2A 1M76A 3LKVA 3PPIA 4I4NA 1KGDA 2R8YA 4RESA 1EFPB 2JGLA 4JEMA 4ICIA 3FLMA 4B44A 3TW4A 3OSUA 1QU2A 1QTNA 4OV6B 1MHPA 3A6FA 1FVHA 3UIEA 3K6JA 4ZOBA 1QFMA 1YGYA 1OE0A 1HE5A 1U0SY 1FUYB 5A7HA 5DCLA 3ROQA 3WK4A 1FNSA 4Y2YA 4G4GA 2WDPA 3OEHA 3V1LA 4H7IA 1U6JA 1G3UA 1Q22A 4J90A 4A2QA 2AIRA 3DUWA 3F2VA 3MMXA 4F2GA 4ID9A 3HCNA 3Q7RA 4QYIB 2QRNA 4IH4A 1FBTA 3H5TA 4RPLA 3AG5A 1XP8A 2PD6A 1B74A 3PIDA 2UVDA 5BO5A 1ONOA 1TQ6A 1AKUA 1KZ6A 2R8BA 1Q3TA 3PDWA 1Z4PX 4RZUA 5CA0A 5ALQA 3ZLVA 4AYXA 4ZHQA 2BTEA 2JASA 1AGPA 2GEJA 3FSEA 1S9DA 1U65A 3AR4A 1E59A 4RWEA 5AXDA 1GSOA 2QORA 5I9SA 3V46A 1W29A 4AF8A 1MC1A 1FLAA 4B33A 3I2KA 3QYJA 3NKFA 4JEHA 2ALJA 3E9EA 4MEJA 4B83A 4CCYB 4QATA 2PD4A 2QL7A 2R8RA 3CINA 4RD1A 3RTGA 1D0VA 1VCMA 1LBHA 2GBFA 2JD1A 2GXSA 4TWIA 5IZCC 2NP6A 4PHGA 1QQ5A 4X6YA 4ZAZA 4BU0A 3HP1A 1ENOA 1NJSA 1TZ2A 1XTSA 1F38A 1HT2E 2VHUA 2VH5R 2VXCA 3BJZA 4LYAA 3X2SA 2V7PA 3IVCA 4DZZA 1NVEA 3OIUA 5KNBH 2X40A 2Q07A 5F52A 5HRCA 3A58B 2GAFA 5B7NA 5HTOA 1QH8A 2I0FA 3NVDA 4QU5A 3REQB 3ZHZA 2F17A 2J4FA 2C2BA 4C3UA 5KYYA 3T3PB 1ZCBA 5LZ8A 4Z4HA 5CEEA 1M8JA 1WDKA 3K0FA 5ALLA 1FVFA 2A4KA 2GN8A 3INRA 5CDTA 1KEUA 1E66A 2CXXA 1E77A 4ZV7A 3B48A 4DR6B 5CK5A 1R7RA 4NPAA 1LDBA 1XU4A 1WZEA 1P5ZB 2DBRA 3LHIA 3OTGA 3OPMA 4MVJI 4Z8YA 3OQ6A 5EMLA 1U2PA 2F6RA 4ZO6A 5FF9A 4ALKA 4DG5A 1ZS9A 2H54A 3IKTA 1NQWA 3H1TA 3OHMA 4X3CA 1BGXT 4P34A 4OD0A 1G55A 1GNVA 2PKWA 4XE5A 2IXAA 2XHZA 4A16A 4CNQA 1O97D 3BVPA 1VKNA 3OZTA 2FX5A 3R0ZA 2OCBA 1IQRA 4N0DA 4YCBA 2C97A 4RY8A 1T36B 2HHHB 5AI6A 2O8CB 2QZZA 5FBKA 3PNLA 1E3DA 1B8OA 2FFQA 4Z9AA 5FWAA 4PBRA 1KZ4A 2O3RA 3S27A 1M67A 2FRXA 4R7GA 3R6DA 2NQ8A 3PK0A 1TZCA 4DA4A 1BW9A 7AT1A 3U7EB 1YU6A 1VPDA 2PWZA 3FG9A 3VVCA 1KOGA 1TIKA 2GBLC 1X8XA 4B8WA 1GNRA 3IBYA 4L15A 4XCXA 5GQSA 1EB8A 3UXEA 1PAUA 5F4BA 1Z7EA 2YJ5A 4R1LA 1NUTA 3ZW7A 2AC4A 3LJKA 1E9RA 2GEBA 4YQEA 4H0NA 4I1VA 2BKVA 3GOQA 5E6RB 3HV2A 3EEQA 4WCDA 2IQ5A 3KXDA 1UEJA 4GRDA 4IJUA 4L6AA 4R3WA 5FTJA 3RHTA 3O4GA 2VSOA 3QELB 3VSCA 5BMVF 4YB8A 4U2FA 2ZBUA 3PC3A 3N28A 3H2SA 5FUQA 1Z0FA 1YRLA 3DTNA 4YIKA 3H5WA 4EB6B 3GLGE 4J7UA 2EJBA 1IQUA 3U4GA 1LQTA 1ODFA 4MYUA 1TM5E 1L5ZA 2INGX 4Q7LA 1OTHA 4QPZA 1VHWA 4ZPXA 3LTNC 1SBCA 3NHLA 4G56A 2EAUA 3HVKA 3QNUA 3T9FA 2QR2A 4IWXA 1O4WA 2OBMA 4EPYA 3RODA 1VDMA 3GLQA 4OXNA 2OHHA 3TZBA 2G83A 5DP2A 4DY6A 2DEUA 3R3XA 5JMWA 1B76A 4EHDA 1BVRA 2ANCA 1EK2A 4L3OA 3FUTA 2R66A 1XHEA 4FLMA 4LCBA 5LBIA 2C5AA 1C4OA 4UNSA 2CVZA 5EJIA 4UARA 4C0KA 3T35A 1K7XB 2XWPA 5EXXA 3NHBA 4TYNA 2VJLA 2ZG6A 1KZGB 1N7IA 2A2ZA 4MRSA 5BW4A 4GQAA 2W2PA 4JT9A 2QPTA 3E35A 1LSJA 3DWEX 4HLDA 1PJAA 2Q3HA 2FK7A 1KC1A 1HF3A 1ZIYA 2BFEB 2CXUA 3ACCA 1OU4A 3GUCA 2XE7A 4Q3LA 3AEKB 3P20A 1DJPA 1YZUA 3T4PA 1F2TA 3TTTA 3L6DA 5HZGA 4QLBA 4BCDA 4WLVA 1NOKA 3JQFA 3JQEA 5DW3A 1P0FA 3N59A 2CYAA 4TTIA 4UQPA 1MCZA 1ZHHA 4M1MA 4J0DA 3T5CA 5ICCA 2BUAA 4RY2A 4PZYA 2QAGA 4WGGA 1OXUA 1FDWA 1KMQA 1GFWA 3L8YA 4DR5B 4HNUA 3CRRA 1YZHA 1R8XA 1SHUX 4IMPA 5KYVA 4DPLA 4GEGA 2O1SA 4QHYA 3GLGA 4I99A 3QIAA 3RS3A 4HDCA 3A27A 5G0TA 1AZTA 3RVNA 4YJHB 2XUQA 1RRCA 2HQBA 4AJIA 5J47A 4WA8A 3ELDA 4WMLA 3ZUGA 1BH6A 1U9CA 5AQ1A 4CGYA 4F2HA 2ZJ1A 2C7QA 2P9CA 3LVFO 2PGOA 2D4AA 3UQYS 4Z3KA 3L01A 1RMQA 4DCCA 2DPYA 4KFTA 2GM9A 1VM6A 3FGPA 1ACMA 2OBXA 2R48A 3I9NA 1LK0A 2BKEA 1EE9A 3IAEA 3E4DA 2ZITA 4RL4A 1XT6A 1L5OA 3STYA 1M1YB 4C2TA 1GLNA 2WWIA 3L46A 4H0FA 3ZHTA 3QLVA 4CLDA 2RE8A 5FNVA 1KAHA 4CE6A 5EHIA 2E3JA 1YQUA 1Q7CA 2KHZA 3PUJA 1F12A 3G1UA 4DMLA 4A6XA 2I7DA 3FWZA 2I1QA 1KEEA 3M9WA 3SSOA 3D81A 4JJ7A 3UT6A 1A8SA 1VSUA 4Q3DA 1RWPA 3BIWA 3PNPA 3OOSA 3ABZA 2BGJA 2G4LA 3BSWA 2EFDB 4AY2A 4A1OA 4YRZA 2HT1A 2FP4B 4I55A 3HKEA 1N3BA 2RK3A 4IH1A 1KNQA 4WRRA 3GFVA 4RIEA 2EBUA 5K6AA 4QBIA 5C31A 1IAVA 3SKXA 3WGOA 2QYHA 1AGXA 3EH1A 4QTXA 3NEJA 4C6TA 2OV6A 3WVNA 3TRJA 2E4WA 4WY5A 1GPMA 1SGWA 2H0RA 4GC5A 4P7GA 1EJ6A 2PUDA 5FLKA 3EAGA 2DPMA 3QVMA 4C5BA 4CU2A 3QBTA 3S2FA 5CU7A 4LEIA 4NJEB 4AXXA 2B98A 2L69A 4PAQA 4QPPA 2WICA 2M6LA 5IK2A 5JRZA 4FS3A 2C7GA 2D7JA 1VYUA 1WTAA 2P2NA 3EDOA 4R1MA 3EGIA 3OE7D 3X0DA 1JA9A 4CETA 1CF2O 4HCJA 2PIDA 3SR3A 4MUGA 1ZGAA 2W43A 5IJWA 1XKQA 1UPFA 1OLUB 1N0IA 2RSLA 1P2GA 3V1KA 5JYEA 2REXB 1OFUA 5F76A 5AD1A 3L1IA 4R1PA 1XZDA 1TYBE 3DLIA 4X63A 3WV4A 1I6WA 5IDXA 3DMRA 2Q0SA 4EVQA 4IUBS 1PX2A 4F45A 4EWLA 5TC4A 3GDFA 1US8B 4ZRDA 4R83A 5HM6A 2EBFX 2OAEA 4MJXA 3BXHA 4R05A 3PHJA 4MR7B 5ECGC 1B23P 1WKVA 1KL7A 4BLQA 1L4EA 1IPEA 5FBLB 2BTOA 3JQGA 3SHOA 4DG8A 4ZQHA 2KB0A 4HL6A 5FFFA 5C1PA 1Y89A 2BD0A 5DRTA 1T9HA 3Q72A 1P17A 3INGA 1XVAA 3NYQA 3O94A 1PFWA 3BKXA 4UAVA 4YP6A 4A8HA 5CDFE 4QC2A 5C8YA 4DYHA 1VP3A 2GD6A 1IIRA 2AWNA 3PQDA 3F90A 5TEWA 3H3XA 4EMTA 3TFOA 5K5EA 3RC8A 4IZHA 5EZYF 4LY3A 3BTVA 3W3AA 4RV9A 4TZKA 4MUAA 4EA6A 4M60A 2A1TR 3R7AA 2AN1A 3MJRA 1Q74A 2ZUWA 3V8RA 3VBCA 3G9UA 1F2DA 3WNZA 3FVVA 1U0RA 2CKMA 2EZ8A 2X9QA 2VXOA 1XZCA 2J87A 3JWEA 3K7EA 3LRTA 3C3PA 4A8JB 4B43A 5EYPB 2AG5A 4GE0A 2PL1A 5CVCA 3WIUA 1BQ4A 2Z2ZA 4N5NA 2P30A 2VH2A 1DI0A 2WWHA 3D6UA 2OKCA 4UVIA 4E5PA 2VFAA 2J48A 4EYSA 5CH5A 4BCBA 4UU8A 3K96A 1MAAA 2MR5A 4GPZA 4ETIA 4HOYA 3PU6A 4KIWA 2PLWA 1TTTA 2XB8A 4MO2A 1QNLA 2G09A 4MQ6A 4PYKA 4Q3NA 4CKCA 3QW2A 5BVGB 1VB5A 1NT2A 2KBEA 4HN2A 2ASEA 1E20A 3EPPA 2DR0A 3MT7A 4DOMA 4DR4B 1REQB 1VFPA 2WTAA 4J7AA 4UJ5A 5IVPA 1WMDA 2H00A 2JRCA 2ADOA 5CLIA 1YO6A 3VC7A 1QGUB 4ETWA 2HO4A 2W98A 1XZ8A 2COKA 4PYQA 4RLQA 3PC8A 3D59A 3RAJA 2F8SA 3PFNA 2LWIA 4RSMA 3M33A 5JCJA 3UMGA 4L4XA 1DMSA 5MN5A 3KE9A 1P73A 2FPUA 3HXMA 1W1IA 1SU6A 2JJ1D 3IAS1 4WK0B 4TYYA 2ODTX 4BS9A 4ECAA 3MZ0A 2HPAA 2WJVA 4N3BA 1MJNA 2P9YA 3R8XA 2O0KA 1VYVA 1FEZA 2BTQB 4REQB 2Q3EA 1X1RA 3NHWA 4MIYA 5GZ3A 4G63A 1E94E 2FP3A 3BT7A 1DBIA 1C9DB 2AYYA 2C1XA 3DKIA 2QLJA 3E15A 1NFQA 4OSPA 3UK1A 5AOCA 4YAGA 3N0RA 3B1FA 2IBMA 3LW8A 3GAFA 1QS0A 4YEDA 5FKJA 5HZHA 3KZVA 3PHHA 3IOCA 4FD3A 4IAOA 5AICA 3U61B 2CNDA 5CAEA 4CI9A 1VKZA 5F7ZA 3EJWA 2AFHE 2BHRA 4MR9B 4A5SA 5JD4A 5JRJA 5KHOC 2WTBA 9GPBA 1WNFA 2GMWA 1CLEA 2W5UA 1A5AB 3OLQA 4IOMA 1FYWA 5CM8B 3FOZA 4MI6A 1JLSA 4CQMA 2VRNA 3WYCA 4NTZA 4QUGA 3ISJA 5JNVA 2W4QA 1K5HA 2HWKA 3OURA 1ILWA 1HE2A 2WTNA 4M76B 2IS6A 2QW8A 3SU8A 4IUYA 4M37A 1DHTA 3C1UA 4PONA 3LAWA 3A1EA 5I51A 2C77A 1O94C 2W37A 3CUEF 3HBNA 2OBBA 3THYB 3AKDA 3TYXA 1BWPA 4LRTB 4IJKA 2B0JA 1JJFA 2VYQA 4UUOA 2H1RA 3N0WA 2W8ZA 2OO5A 2YVKA 3LUPA 4MLZA 2I6FA 4PE5B 1IDN1 4UAJA 5IEJA 4LJ8A 1N92A 3GC6A 2M6SA 2YASA 4JAVC 4ZHSA 5T6MA 1XWIA 2ZZMA 2ZYIA 3PLRA 4TL8A 4X7BA 3BORA 3WL5A 1WULS 2DETA 2CY0A 3BCHA 5CA0B 1JR3D 3E8MA 4KDFA 3GCGA 3G0BA 1IHYA 5ALYA 4E14A 1TVMA 3D9QX 5KQRA 3A1DA 1GDHA 1FYEA 1KO5A 1ORVA 1TTQB 2QTVB 3EYAA 4R2WA 4S1NA 3MRXA 5JD3A 1YD7A 1ZIDA 1UZUA 1RYZA 2WA2A 4FINA 1RLTA 4LGVA 3EOZA 5KYKA 2XCUA 5LN1A 3VSAA 2JAXA 4R2JA 3LWNA 3KSAC 2DFDA 2R9VA 3HU2A 5JVDA 3GEMA 4OLJA 1A9YA 4J03A 2AFHA 3FIJA 4IP0A 2G76A 1L8LA 3EIFA 3NYWA 1GTL1 3AETB 4WSOA 2LUOA 1UXOA 2XYPA 4Q0MA 5DYNA 5JQWA 1YFZA 4G07A 4ZVSA 3DOIA 1Y4ZA 1X87A 2RHBA 5FX2A 3VTAA 4UJ3A 1YFKA 2UYHA 3MGKA 3N8HA 4TWAA 3QJGA 1DKOA 4TROA 1JEYA 3GLFE 4JKYA 1WMAA 1T2UA 2I9PA 1J56A 5KTMA 2ZYDA 2J5BA 4TWZA 2HHCA 1EWRA 1Z4KA 5I8PA 2HC9A 2A9JA 3PL1A 3NTUA 5AW7A 1L7AA 3QVSA 3N2EA 3IKJA 4M0MA 4QPNA 5G4KA 1KTIA 3FPSA 1B7GO 1JG3A 3P9YA 2OD7A 2XWQA 4WXEA 2NSHA 1W1UA 3M34A 4RQUA 4ES6A 2P4QA 2BLNA 2OCDA 1QV6A 1RDFA 2TMGA 4FQ8A 4WWHA 5AKJA 3UWPA 4DMRA 3UBTA 3Q8XB 1JPJA 3SM3A 1ZN9A 3TPZA 4RLHA 2R47A 2O57A 5ALPA 4DXDA 5EKDA 4EJ0A 3AVXA 4MW7A 1GT91 3D6AA 4F9EA 2AJ8A 2VRCA 4E1VA 3H4VA 2G77B 2WF5A 4ANFA 2XCQA 4P0QB 3PQ2A 3QKSA 3ZBPA 1RLJA 2RHGB 4Z4QA 3RT9A 2ZUDA 3GB9A 3IEMA 1KH2A 3H2HA 2QLTA 1DB3A 3R3UA 3HYTA 2ZS8A 1N78A 4DSTA 5F9MA 1A8QA 3U4MA 1OLXB 3DZ8A 3V1UA 2QQFA 3Q1KA 4HH0A 1RM4A 1T0HB 3GQVA 2HQOA 4JOCA 2I71A 1EWTA 2Q6VA 1FVOA 2FPPA 1PLKA 2HRCA 4HB4A 4ND3A 4ZQIA 1XU7A 4XSGA 2V58A 1PJSA 3WGTA 4DDKA 3DHVA 3LYUA 3Q2OA 2NUAB 1GADO 1R0BA 2FX2A 1MZPA 3KOOA 1R4ZA 3NOXA 1L8OA 3O2NA 3CG0A 4I36A 1G8JA 3HHPA 3QYFA 3L9XA 4JLKA 1YC5A 3LKZA 4OSEA 2Y1FA 5BOSB 4LX8A 2A1UA 3SXUB 3DDCA 3FBTA 1AO3A 5AK5A 3RRMA 4ZP1A 2EG5A 4BFCA 4BMNA 1C9NA 2O20A 2ZB2A 4WT7A 5F5NA 3B6JA 4AK9A 5JS7A 4FFSA 3CG4A 4N01A 3T7EA 5GV8A 3AF6A 3DL7A 2A84A 4CI0B 5C34B 1JDJA 2IHBA 4MS4B 3OQNA 4U5XA 3OQ1A 4W7IA 2C31A 4E51A 4WLNA 2YMQA 4S0ZA 3P97A 1KDYA 1GFZA 1Q12A 3MERA 3OFKA 4Z7QB 1H6AA 1I1OA 5DNYB 2ID9A 3ZE7A 1OC2A 2O06A 1YQGA 1BOFA 1RP1A 3B60A 3OZGA 1E69A 2QQEA 4V0RA 3IUNA 4CLOB 2ESRA 4CKEB 4M3NA 1MQAA 3DUFB 1YB7A 3EDMA 2JEZA 2H9AA 5FHRA 3NIDB 4Z4GA 4QAJA 2Q2WA 2RC5A 1QV9A 3QEMA 4PINA 1IK6A 1L6IA 1NN5A 1SEPA 3U4HA 4NJMB 4HPWA 1KIFA 1XTIA 2YVLA 3HMQA 2C9ZA 3BMNB 3C48A 3MWJA 4UEWA 4LZOA 3PIIA 4I6GA 3FWKA 3ORQA 1XPRA 2CNNA 2D4HA 4H27A 4C76A 4G23A 3OC6A 4EH1A 3ZGNA 3AT1A 1NBMD 1MGOA 1ZA2A 1PFYA 2AYZA 2N0SA 3Q5EA 5DHSA 5A4AA 3ITDA 3SYTA 1JP7A 4B82A 5L45A 4ABYA 1DRKA 3BWCA 1B2RA 2DY0A 2J32A 3TTYA 3W5BA 3WE7A 4QA9A 3RG2A 4L50A 1DXQA 1D2GA 4OEHA 3W8RA 5BSGA 5JAPA 2W6IA 5KYTA 2PZGA 4QXMA 4ZYYA 3CR8A 1AT1A 3E2IA 1TVKB 2V1XA 3FOCA 3ANYB 1W87A 4N3GA 4GSLA 1U7TA 4JOQA 4BVAA 4NBSA 3OKCA 3NWEA 2Y6UA 2IHNA 1E7RA 4RHXA 5HA5A 5AJZA 4D8XA 3IBGA 3PQFA 1XNGA 4Z0TA 3SCZA 2YRWA 1ESDA 4Y2VA 4QXRA 2O8BA 1NPYA 4I9FA 4YJFA 4L7QA 2XZTA 1SUIA 3WLNA 5IKOA 1GQRA 5LQRA 3AFIA 5H8WA 1UFQA 3X1YA 5JS1A 1LK7A 1V6AA 2A78A 2I1WA 4KQMA 1QYIA 4ML3A 3UJPA 4CUZA 4F3CA 5FNVB 3VYTB 5FOQA 4EW1A 4CBVA 5AP9A 4DSAA 1IY0A 3Q3GE 2IL1A 4G36A 1SN7A 3AVTA 4G0OA 1USKA 5LJIA 3W2FA 3D8UA 4J1TA 2GK7A 2I29A 3ASUA 2O3QA 1Z0ZA 3FLEA 1LK5A 3I39X 4XJVA 2G17A 5EPUA 1R6DA 5LPNA 1M5TA 1Q57A 2GJKA 2VT7A 4CKWA 1AKQA 1XC7A 2R3SA 2W2QA 1TUIA 3CF2A 4KL8S 3PUWA 1IJBA 2NZJA 4QGAA 4YJDA 4K0KB 5K0NA 1U7WA 1RKQA 1ZJ5A 3H0EA 3AUAA 3AUUA 2DHDA 3MJEA 5LD2C 1WJGA 1U04A 3KS9A 3DPSA 4R9NA 1WXQA 1K7CA 1GZUA 4CM6A 1OBOA 3CEAA 4PPGA 5IX8A 1U11A 3H3JA 2NG1A 5C5IA 3C14C 2C2OA 4F6LA 5J5AA 3BILA 3FYUC 5MN6A 3I83A 4MEAA 3L9WA 4JHXA 4DCSA 2HX1A 1M2HA 4IYJA 3RS5A 4E09A 1KY5A 3BM5A 1U63A 4N3AA 3L7CA 3Q5DA 4YXWA 3TXXA 2WTMA 4JWTA 2J1LA 3OZ7A 2BMWA 3KVYA 2JLVA 2F1IA 3GEBA 1DEXA 2GF9A 3AI3A 4XVUA 2VF2A 4AW9A 3QMMA 4NENB 1RYYA 1RCFA 4YJ3B 5FBWB 5CCDA 3THWA 1M6VA 1NBOA 5IDYA 2DSTA 1LV8A 4GBGA 3VHXB 4C3OB 2JFVA 1P2DA 3EEOA 4KWCA 4LYJA 2CKDA 4UHBA 4YGYA 1BS1A 3JAKB 2V45A 3EXHC 2R68A 2ZP1A 4TLCA 4ZJYA 2A57A 4JH0A 1Q11A 2QTTA 2I2BA 3KVVA 5F4ZA 5BWBA 2G04A 1GNQA 2B4QA 5J5VA 2F3SA 1XTBA 5M3BA 1ZL2A 1IM5A 1Y1TA 5KIAA 1DX4A 3E1SA 4JL5A 3EN0A 2H4ZA 2OV4A 1JJBA 3VPXA 1K66A 4BWYA 2D13A 1ACLA 4X6XA 3SMQA 2QM8A 3OKPA 1L5NA 1FNBA 1WU7A 3L41A 3HVRA 1JALA 3LXRA 4JEIA 5CT5A 1CP2A 2Z58A 3TK1A 1SHJA 1O9BA 3TTXA 4EI9A 1JEQA 3AP1A 5CB4A 3CX7A 4FHDA 5G1OA 1W5FA 4CR8A 1AUXA 5BWCA 5KNBD 1EXDA 1GCIA 5A03A 3QE3A 3TKYA 4U2KA 1OV4A 1WBJB 1YJ5A 4LHSA 2XOEA 2HF9A 1P81A 3SC4A 3PF9A 5IN4A 1NV9A 1UC8A 5KDLA 4DIMA 2YWDA 3HSSA 4LKRA 3WYEA 5KQLA 3KQUA 2PUFA 3V4ZA 1VTKA 4ILEA 5FH9A 3IAS6 3V42A 1ODLA 1OROA 1NAHA 3DOHA 3VNAA 1O3YA 5DYWA 3TEMA 2IPXA 1CEQA 4B6GA 5HSGA 1NNSA 3EVGA 3T06B 4KFUA 1ZG3A 3GRZA 4DDWA 4ZAVA 4Q4HA 1EP9A 2IP2A 1T10A 4XUEA 4JCCA 4KSYA 3D0RA 2IV3A 3SXJA 3B3AA 4ZHQF 5CA0F 5LR6A 4IIJA 4C30A 3FOFC 2D7CA 5HVNA 1PVVA 4H31A 3QEJA 3GYGA 3HH8A 5EEGA 4AU1A 4HZGA 4RYLA 1E63A 2F67A 1MXHA 1AZWA 4M99A 4V03A 3NHMA 3BKWA 3HVIA 3RD5A 1G6KA 1IEVA 4K05A 1OIVA 4HB0A 1KAGA 1JRLA 2GAIA 1Y33E 3KU1A 4M38A 4PIVA 1YZYA 4AM8A 3QFFA 4EZBA 2HSGA 3K9FC 1TF7A 4DNPA 4R98A 4BHTA 4IQ8A 1HDGO 1OBCA 1VL1A 2OR3A 3F78A 4HN9A 4DR3B 1S02A 4LHZA 2VLBA 3SF8A 4BVLA 1SB8A 2ZT6A 5AVXA 4PX3A 4BRSA 2P9JA 1U1FA 3SKYA 5EGSA 1QS0B 3IOBA 1G5FA 4CLHA 1U2EA 1LF0A 4KEAA 3A1NA 1DAEA 1O08A 2JAPA 3GPIA 4R0NA 1I7NA 1NUAA 3KEQA 5CAEB 1N6NA 3HDJA 4RE5A 1O8CA 1VOTA 4KN5A 3I64A 4OI0A 4TTTS 1QOZA 4U7WA 4FMPA 1PR3A 4TSKA 2PGXA 3PXEA 4U9UA 3L93A 3EQ9A 3MS7A 4LXQA 5HMLA 4CQMB 4P35A 3LWZA 3IAM1 1CUUA 2I22A 1PL7A 2OFFA 1XJ0A 2CDBA 3RWOA 1HX7A 1R15A 4ZOEA 2IEIA 3KOZA 1EFVA 3TRHA 3VOBA 3L4JA 5I9NA 3K0CA 2CL7X 3OP4A 5CNJA 3TLKA 3P27A 3AVUA 4YDHB 3OEYA 5FUMA 5MFPA 4WINA 4BNVA 4LJ7A 5KEIA 1CY0A 2FEOA 4GR4A 1FLVA 2NAPA 4PX2A 1BDMA 4ZT2A 5IJXA 2AFIE 3DDZX 2F1OA 4F4JA 1VIDA 3T7TA 5JAOA 3OQMA 5EQDA 3DDOA 1PDWA 2FMFA 4TQ9A 4CUKA 4E5NA 4EQ6B 3E7PA 2VQEB 4F72A 2WSSD 2X1HA 2J5QA 4ZT5A 3WGMA 2ZVPX 4TMVA 1L4GA 2UUAB 3TVTA 1Q84A 2J3DA 3TIXB 3D2CA 1U5AA 2BI4A 2ZJ8A 5DISB 1GKUB 2ZVJA 1HT3A 3QX8A 4YP9A 2V7QD 1OPRA 5ICMA 5GINE 2X0FA 5KX5A 3H2ZA 3DE7X 1R0RE 1GTZA 2PLNA 4DSNA 5JTTA 1EWVA 1UJ4A 2PSFA 2BC9A 5JZSA 2Q21A 4O8CA 3L7YA 4LWZA 2WPDA 2RGAA 4NESA 1Q92A 2UXCB 2Q3MA 3MUEA 3A6JA 4KVGA 5ELXA 4IXWA 3QVGB 4GF5A 2D5LA 3JYPA 4WIAA 1P2FA 3SE7A 2K5UA 1J39A 3FH0A 2RJ3A 4LRQA 1WCIA 2HWXA 1AXGA 1XCOA 3OT1A 1EFRD 1LJLA 1PJ8A 5CURA 3MSXA 1C7QA 1YQTA 1C14A 3IEXA 3V8BA 3WRYC 1X0VA 3EIXA 2V97A 1WKCA 3K1JA 4I7EA 4JX9A 5HKLA 3WP1B 4AICA 2XNKA 4BTLA 3F6EX 1UBHS 2BFDA 4PRLA 1I1QB 3W6ZA 4NEQA 2IPLA 1Z5GA 3HO1A 2POCA 1XKXA 2XRZA 1K97A 5CEJA 3CKMA 5K20A 4TLAA 2J3EA 3EQ2A 4TKLA 5G4KB 3KOUA 1E1DA 2AFIA 4EJSC 1HKUA 5CDHA 1OUMA 4MV3A 5T57A 2AJCA 3KXIA 3MOGA 4E33A 1XZGA 3DO6A 2O5VA 3O8RA 3UXMA 3GUUA 4U6QA 2Z30A 4D4GA 1TNDA 3BH6A 3BJRA 2IXEA 2FOLA 5GPBA 1IN7A 1TCBA 3DT6A 4D92A 2VTEA 2ID8A 3VXKA 4BFYA 1E1CB 1NR1A 2PFKA 2YWCA 3PNOA 4UMDA 5EJMA 3UMRA 1APBA 4KBGA 3MPOA 1PW7A 2FPRA 2ZT5A 3L7MA 4U63A 2I4MA 3K8ZA 1DS6A 1E3WA 3MGBA 3ZLTA 4HDMA 4UPDA 3W1WA 1QH9A 1CQJA 1GXSA 2VYNA 3V5NA 4AKTA 4B7ZA 4EB0A 3KQLA 4FEAA 1XD2A 2NNLD 3GL9A 3A2LA 4HR7A 4XSVA 4QOGA 2DKFA 5IEBA 2BGIA 1RI1A 1LU9A 4NE7A 4AJEA 2ZI6A 3WNDA 4BY9E 2P6OA 4HAYA 2UYGA 3Q41A 1RPNA 5CRIA 5IUJC 4C6HA 2VWPA 3L6UA 1U7DA 4RZHA 4TM8A 5EL0A 3ISTA 3DW3X 4Q18A 3V7UA 3MD9A 2QE6A 3RU2A 1USUA 5JNUA 2FZ5A 2ZIGA 5ITWA 3NBQA 1U1CA 3PTLA 1NW4A 2XB2A 1IE3A 1BD3A 3GLFB 4IQGA 4JLMA 1JHXA 3OTQA 3O1IC 3MMPA 4Y6OA 5DM2A 4QRHA 1C4KA 1O97C 3SJUA 4F5YA 2YJGA 3UV3A 4MVJH 2BLLA 1P1KA 4YTEA 2C54A 1PL8A 4D9CA 2EEPA 5KSOA 4BMDA 5FNVF 3DMNA 4I0WB 1Q2XA 5BSRA 1PTJC 2H92A 2FW0A 1POWA 5DI3A 3AUYA 4KK4A 1K2VN 4FB4A 1CP3A 2WR8A 4O1IA 1JHYA 4KWTA 2PKRA 2Z9BA 3AVYA 4BAZA 4DJFC 1T5BA 1HE1C 3C8DA 4PPYA 1XPOA 3I73A 1IB6A 3E6AA 4LW8A 3SNHA 1Q7TA 3QWFA 4KAXA 2F4NA 3MTEA 3BUSA 4RDXA 4NU5A 1ZPDA 3GFSA 4KQ6A 2GEDA 4PG6A 2LW7A 1GA6A 5CT9A 1BDJA 4DIDA 3TAUA 1WZ2A 3BFXA 2NO5A 1PJCA 1ZD3A 5B3JC 4Z6KA 2XMQA 5COQA 5CXUA 2PL3A 3R3SA 4UC0A 5HIKA 1NP6A 2UZAA 2B4KA 3QUAA 3BGSA 1FDUA 4LTDA 1L4BA 4MVWA 5TR9A 1U90A 5J40A 2R85A 1E4YA 2Z8YA 2VOEA 4B74A 1H2ZA 4A2WA 3FYCA 1GN8A 5FTMA 5B3KA 3U81A 2DHRA 2V0GA 3H1AA 4LY9A 1ZWLA 3C2QA 3SAJA 2D74A 2RH8A 3N2ZB 4XR4A 1T0BA 4D82A 3OSZA 2B7LA 3FCSB 4XEHA 3FPAA 4LMAA 3JTEA 4UEOA 2HXYA 5K1ZA 1RIFA 4MYDA 5KQPA 4YJ3F 3K6SA 1TL7C 2XXBA 3FMVA 2B25A 1D4ZA 3Q98A 2VBCA 4D25A 1A4IA 1OD6A 2QP4A 3RRBA 4I4TB 2A1IA 4X7MA 3Q10A 1XEXB 2XRMA 2YH2A 5EUBA 1SXJC 3HN2A 1ZNWA 2ZSAA 4E94A 1N2XA 1KZ9A 2B8EA 3ENVA 4L0DA 1DO2A 4FFOA 1A82A 3OQPA 4LOHA 2Q0QA 2P9EA 3EHEA 1RZRD 3LLCA 3AL2A 2V0CA 3K9BA 1D6SA 2WYOA 4LJ5A 2IXFA 2Q5QA 4F0JA 5LP6A 2WE8A 3KL4A 1MJFA 2F3UA 3R5XA 1ABFA 2WMYA 2QN3A 2WKQA 2X3FA 3CW2A 4RANA 3W04A 4CHGA 3KYDA 2HK7A 2BHTA 5A0VA 3TI7A 1D6NA 1BSVA 3ETLA 1PD1A 2QJFA 3LW7A 4Q12A 1WZNA 4WK2B 4YCLA 5E7MA 3D6TB 1P7WA 3DLPX 4A2CA 4ZANA 1AMNA 4HGQA 3LQRA 1WMFA 4CHTA 3STVA 1CERA 2V0NA 1HTBA 1KE1A 2JGEA 4QYTA 1GGMA 1R50A 1G1AA 3I04A 3GWZA 3LFTA 3SC3A 3JS5A 4LG1A 1BFDA 1GOTA 1E6WA 2WFAA 4HQLA 4HY3A 2IYWA 1XZLA 1E2IA 2G9ZA 2NVOA 3I01M 5CVVA 4P54A 3U48A 1F9EA 1B8VA 2YWHA 5AM2A 1J20A 5JYDA 1FFYA 3C5CA 3HFSA 3KFVA 3HN7A 4GRAA 3H1EA 3SC2B 2IJGX 4QYMA 4J4TA 1MC4A 1G6HA 1JKJB 1NJFA 4KW7A 3VA7A 5AKGA 2DXIA 3DZFA 2C3MA 3IJEB 4BZQA 2ZSDA 2BKUA 3CPSA 3NH9A 4O4HB 1BFUA 3L1JA 4KJXA 1QZTA 4GM4A 2BUBA 4HN4B 1ZXBA 2IS1A 2PGAA 3QK7A 1A4UA 3V55A 1QF7A 1MFPA 1Y3DE 5ENVA 4D8UA 1JPNA 3IR7A 5E4FA 3WK7A 2WG2A 1S9HA 1KDOA 2P8JA 3N8KA 3N6RA 3U40A 5IDWA 5AFSA 1HYQA 4ZGBA 2XNJA 3F3MA 5JG7A 1XMIA 1M6VB 4JUIA 4ND5A 1JVNA 2WKWA 3PICA 1PJZA 5BRJA 4JGGA 2ZRKA 1K3TA 3DEKA 3KR9A 5TQ2A 1VJDA 2VDNB 4WV3A 3P9PA 3IQGX 3DGEC 2IPOA 2VH1A 5CVUA 1ZGHA 4D9EA 4DGSA 1PS8A 5CA1B 2IYZA 1HT1E 3HPRA 1ICEA 1K6JA 1KBZA 3INTA 6Q21A 2Y67A 5C9ZA 5KWIA 1EVJA 3VVBA 1E7QA 2DECA 4DILA 1E2NA 3M3PA 5ECYA 1T5TA 3O8BA 1HYBA 2MSEB 2CFIA 1PJ2A 2PUTA 5KSPA 2PMKA 5TX7A 3RVPA 3HJNA 3O92A 3HE3A 3QXSA 3SE0A 2D2VA 5CH3A 3DJFA 4KQIA 2K2QB 3PXDA 1XN4A 4FCTA 1SQFA 2O19A 1W48A 3BJEA 4M7WA 5C1OA 5I7SA 1NJ5A 3N58A 1BJKA 4OJMX 3RARA 1E4VA 2ZAYA 3K0AB 4R01A 4KTTE 4RMNA 3Q7QA 3HJTA 4U7JA 1NLYA 1YCGA 2BM8A 1KZYC 3FKJA 4UHKA 2EDCA 2YYAA 4IZIA 1EH5A 3ZDEA 2ILTA 2OCLA 2H06A 2JHAA 3QFSA 4IZ6A 1OXKB 1LBQA 1HNNA 2J67A 2BEVA 3O93A 4EL0A 4MV0A 5HQ3B 1T6NA 2WIBA 1GGVA 1TQDA 5DCWA 3BL8A 2AWOA 2WSBA 3NO4A 3UJBA 3VV2A 1XBTA 4BP9A 1W5TA 2GD0A 3PX2A 5EXDA 5COAA 2Y9MB 3SYRA 3HACA 3PR1A 4WZAB 1FW6A 5B6IA 1RI4A 1RWBA 4MP8A 4YC7A 1T9DA 1V1RA 4WLUA 3TIGA 2HD4A 2C84A 4HVLA 3TZQA 4PICA 2R60A 4N7MA 1IOLA 1I4TD 1EGQA 1R1DA 2H2FA 4FUQA 4OI4A 4AN4A 3S99A 3JATB 4KQKA 4BN0A 4J3JA 1QIFA 3TNLA 4EW3A 4FYVA 2X19A 1G21A 5THQA 1IQPA 2PMCA 4LUCA 4ZU1X 2OOKA 2VUHB 2M32A 4X90A 3RUPA 1ZD4A 4FT4A 2IW1A 5JZ9A 3QPWA 4MYRA 1OWLA 1KHTA 4IOLA 1Q83A 5IKMA 2K2WA 4HDAA 2Q29A 3KTFA 3M70A 4U2CA 3PXXA 2HM7A 3IAM6 4MP6A 5EUCA 3VPDA 4AKIA 2P0EA 1JIKA 4FU0A 2R1ZA 4RVGA 1HQYE 1QANA 2AUMA 2FWMX 3MLBA 3QJ5A 4HJRA 1QYWA 3LT2A 4FFBB 1FDOA 3EIQA 3BRCA 1GUBA 3EIWA 3BMQB 5EAIA 2FGJA 3G2HA 3UWOA 1UKCA 3R5JA 4UBOA 4QQNA 3AONB 3ND5A 2VO1A 1F5NA 4KUHA 1V8PA 1I36A 5ETJA 3OAAD 1U3VA 1I4EB 3AESA 4CUJA 1FTGA 4PN7A 1EDOA 1QGZA 1A2OA 5D87A 1C4WA 4PZCA 2WVGA 4R2XA 4U8GA 1EG7A 3ZHXA 1AKEA 4RD0A 1BGVA 2IOFA 4AJ1A 4CMBA 2O2CA 1M72A 5BYAA 1ZGJA 4E5SA 2ZSJA 4TMWA 2GVNA 2QX9A 5HIMA 1UADA 3QRWA 2K7ZA 2IUTA 3BIFA 1SQSA 1U2GA 3BXXA 4PLYA 4EITA 4F93B 2AMJA 2ZUSA 5D3MA 3NLLA 4MW9A 3QPDA 4R2MA 6NULA 3TDNA 2ZU6A 3EZLA 5SV2A 2QYSA 3H9EO 1K89A 5JAQA 2OCGA 3B1JA 3DR3A 4IS2A 1EQUA 1K75A 2EBHX 2OILA 5B1SA 2RGRA 3QUBA 4KDEA 1VA4A 3FWNA 1ZH0A 3DXYA 1DRWA 2E2WA 4FDVA 3CH7A 3CVVA 4V0NA 3EFEA 2YYZA 2J3QA 3ZKWA 2XXAB 2QI9F 4FHGA 4MYCA 2WWGA 3DEHA 2HA4A 3CGWA 3O3NB 5DN9A 2R6DA 1HDXA 4QX6A 1MRNA 1C3EA 2OQIA 3A9UA 2BFMA 2SBTA 3O3OB 4ENWA 5A7GA 3VYVA 1KEZA 1R0CA 5FBVB 2VS1A 1EK1A 1PFKA 3W5CA 2QTBA 1J07A 1RJEA 2BJVA 4C87A 1WCIB 2GCIA 2IZZA 5I9BA 5WRFA 1E6UA 4LFCB 2J6BA 5BUQA 3KZXA 4JUAA 1NVXQ 5CCEA 1X8KA 1U80A 3OT1B 2G07A 3TFWA 3OJWA 1EXWA 3DSRA 3ZWNA 2VEDA 1XWFA 4YJGA 5FP0A 3T15A 5KC9A 4MZDA 1N57A 1HDRA 1VCNA 3TH5A 3SP1A 2HUPA 2EKPA 4KNVA 1M7GA 1Z6XA 2BZ1A 3KYCA 3QJYA 4JVSB 4OQMA 4UUMA 5KWVA 1JBEA 1TQHA 4JKOA 2D1QA 2LCFA 4MLCA 1K4YA 1NVWQ 2QX7A 4XDHA 4EABA 1ONNA 1BDHA 1WMEA 2RKWA 3KO8A 3RC3A 1GEGA 3IAUA 3DKVA 3DDSA 3PUZA 4MPJA 2FETA 2VHCA 2NWQA 3FFWA 1JA1A 1N7JA 1VMKA 3GJ5A 5ITVA 2BKLA 3EJ6A 3GRPA 4RTJA 2HBQA 3AP3A 3R6LA 4FKBA 4H6VA 4XYBA 5IUKC 1NW9B 2EF1A 5UKDA 5HKKD 5K8JB 1FS6A 4LNAA 1XDUA 1YCFA 1IATA 3A1TA 3C3BA 3Q1LA 1NYTA 2PGNA 2FEKA 2WJ6A 3QFTA 4UE6A 2QVGA 5BR7A 4I9UA 2GRJA 4GVXA 2IHVA 4QFDA 3UWDA 3E9RA 3WG9A 1DCFA 4KE8A 5GP1A 3WYDA 4EX6A 3FPKA 4M0UA 5EIAA 1KMNA 4FGKA 3SSAA 4GECA 1MC8A 4RH3A 4PG8A 3FLAA 4ZGGA 2J59A 4EG5A 2GEFA 3DAYA 1VL8A 1QG4A 3SJCA 1R16A 3GJ8A 4Q9HA 1XD2B 1JAHA 4KH0A 4MWGA 4D5EA 1HL7A 1NQXA 2EWWA 4IXTA 4UM9D 1Y9JA 1W30A 4GM0A 1KSGA 5AK0A 5KNDA 4YXFA 3F97A 3DVRX 3MJHA 4P82A 3BHMA 4I4TF 1PIWA 1OXMA 3ICQB 4AJ9A 1FSZA 4JQYA 1JG7A 1K9VF 2AMFA 2MIIA 4JBXA 3VDRA 2G25A 3AVQA 3EEBA 4GOKA 4B8ZA 2JDIA 4OHOA 2WT8A 3ROGA 3EBOA 5JV5A 3N0XA 3SXPA 4ED9A 3X2EA 1P5HA 3CRVA 3N9IA 1BXGB 4PFJA 4ZKEA 4XAQA 3HTXA 4LDPA 3R24A 4DLVA 4IIVA 3ZE1B 5TPZA 1K8QA 4ZO9A 4WXHA 3C4JA 1IRIA 3KB8A 3VNUA 3DLCA 1VMAA 3HA3A 4LJ6A 1WD5A 1Y1SA 4HC4A 4WCVA 1G8PA 1NXOA 1H8HD 1UJCA 2PD3A 3ENKA 1BE1A 1TMKA 1V37A 1DLIA 4JBLA 5FOVA 3WMWA 4BO5A 5CDSA 1E0AA 3DA8A 4HWGA 1RC8A 4LVNA 2PKEA 1ZOPA 4MTCA 1USWA 1P33A 4ZREA 4FGZA 1QQBA 5K3SA 1H3EA 4IV0A 3RFXA 4JQSA 5AIAA 1J33A 3UJ9A 3UKJA 1BX0A 1RQLA 2CZCA 5EUMA 4EARA 4JV5B 1YHNA 1DMRA 4IIFA 1I2DA 2O07A 5E8JA 4REMA 2CLFB 1KK1A 3F3YA 2DJIA 3T9CA 1K68A 4N6GA 3IQFA 3V8PA 1XCBA 1DIGA 2QW0X