1NVMA

Crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
340
structure length
340
Chain Sequence
b'TFNPSKKLYISDVTLRDGSHAIRHQYTLDDVRAIARALDKAKVDSIEVAHGDGLQGSSFNYGFGRHTDLEYIEAVAGEISHAQIATLLLPGIGSVHDLKNAYQAGARVVRVATHCTEADVSKQHIEYARNLGMDTVGFLMMSHMIPAEKLAEQGKLMESYGATCIYMADSGGAMSMNDIRDRMRAFKAVLKPETQVGMHAHHNLSLGVANSIVAVEEGCDRVDASLAGMGAGAGNAPLEVFIAVAERLGWNHGTDLYTLMDAADDIVRPLQDRPVRVDRETLGLGYAGVYSSFLRHAEIAAAKYNLKTLDILVELGHRRMVGGQEDMIVDVALDLLAAHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 4-hydroxy-2-oxovalerate aldolase
publication title Crystal structure of a bifunctional aldolase-dehydrogenase: Sequestering a reactive and volatile intermediate
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Lyase/oxidoreductase
total genus 130
structure length 340
sequence length 340
chains with identical sequence C, E, G
ec nomenclature ec 4.1.3.39: 4-hydroxy-2-oxovalerate aldolase.
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
A PF07836 DmpG_comm DmpG-like communication domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nvmA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1nvmA01
2ZZ3A 3NL6A 1RV8A 1JUEA 4DO6A 1W3TA 1GQNA 2Y6ZA 2PC4A 5FF4A 3B06A 3H4MA 4R33A 2I1OA 3SGZA 1EEPA 2E6YA 5EQTA 1VHCA 5G2IA 5D2XA 1T96A 1VS1A 1G3IA 4K36A 3O07A 5C6MA 3M16A 4K8EA 3TV8A 3O63A 1QPQA 1KTBA 4ZMGA 1JR1A 4WW0A 3NAVA 1QCWA 1ME8A 2QF7A 5CPLA 1QNVA 4WXYA 1IN7A 3HPSA 1WX0A 1R2SA 2NX3A 4FWGA 3HPXA 5F4WA 4LY6A 4K7VA 1I2PA 3HG5A 2A21A 3W74A 2DU2A 5C1BA 1OX6A 2CW6A 2B7QA 5IBXA 3NZRA 1JULA 1JR3D 1G4TA 2VEPA 1X6UA 2DHRA 2FDSA 2QCLA 4GUJA 3B0UX 3WK2A 4BR1A 1W5MA 5DELA 4HNTA 2HTMA 3EX6A 5IBXC 4QHSA 3LM7A 1ZENA 2QDGA 1ZFJA 3NL2A 2C9CA 5DBTA 1ALDA 1F05A 2ZRYA 2W79A 2OT0A 1IN6A 3EX1A 4PCFA 1M5WA 1SW7A 2C18A 2F7FA 3VLFB 3QF0A 5HJLA 3RU6A 5AYYA 1W0MA 3R89A 4U4MA 1J5TA 2CFFA 5EXXA 5CZSA 4KO8A 1THFD 3MHFA 4NNCA 4YLWA 1NSJA 3OA3A 1GYNA 3TXZA 4MFEA 4WY0A 3LI0A 2X1TA 4LJ8A 3KVLA 2QCHA 3CLMA 4N2YA 5AHMA 5FEXA 3EIEA 3TQKA 3W1QA 2CZDA 6ALDA 2GOUA 5IM51 1ZY9A 1OFBA 4AXKA 3IIXA 3TCEA 2VFHA 2HSAA 3L9CA 4XZ9A 1U83A 1KFBA 1JCMP 2E68A 3IGSA 3W70A 4UTIA 2ZDRA 3G0XA 3R5EA 2QZ4A 3TJLA 1JUKA 2NX1A 3VFDA 2R62A 3ATZA 3N2MA 3NQAA 3P5YA 1N8FA 1VLWA 3FOKA 1KLYA 1F2JA 1TYGA 3L67A 4WQ6A 1KBJA 4PC8A 4H4IA 2JGYA 1QOQA 2QENA 4M19A 2QPAA 4WJEA 2B7NA 1JUBA 2ALDA 3LCFA 4JR5A 4AH7A 2DZOB 3M5YA 2X1SA 1O4UA 5AYXA 2GQ9A 2X1RA 2X1UA 3SECA 2Z6JA 1WYIA 2QBYB 3GIYA 4JTJA 5LNSA 4BFAA 4JX4A 3O15A 3U6WA 1KV5A 5E0KA 5F4SA 1W5SA 2RKXA 2Y62A 2CHQA 3I65A 3EWBX 4LS2A 1T99A 5DYGA 3QEZA 1YADA 2YZRA 3NZ1A 1LLZA 3S1UA 2Q8LA 2NZLA 5K4ZA 1HQCA 4LJ7A 1HFBA 1VQTA 4K39A 3LDVA 3GNDA 3W7DA 3FYOA 1GYLA 3HF3A 4MY8A 3NL3A 2C96A 1KTCA 1H60A 1RVGA 1B9BA 3TC7A 2ZZ4A 1R30A 1XDMA 4ZPXA 4LJ4A 1KW1A 3TK7A 1C29A 2F84A 2DORA 1LROA 4OV4A 4O4VA 1C8VA 1ONRA 5F1VA 4DEFA 4TU1A 2VEIA 1FBAA 3FLUA 2CZEA 2YCEA 2R8WA 3G8RA 4UR8A 3W7OA 3C2OA 3W73A 1EWDA 2C98A 2CLIA 1BEUA 5K2ZA 3CWNA 5EXPA 3TSDA 5EBUA 2FFCA 3TMLA 3GR8A 1FUYA 1XL9A 1TIMA 1M7OA 1UJPA 1NAL1 5HUPA 4I7UA 3PB0A 3WFAA 1L2UA 3QRHA 4ICNA 4FNQA 3GLIA 5FTKA 4OHQA 3GXTA 1HO4A 1TRDA 3UQNA 3JRKA 6TIMA 4RR4A 1SXJB 5HWNA 1YDVA 3DGRA 4QAIA 2BX7A 3QSRA 2CZ5A 4FCVA 3A9IA 3DKLA 5HWJA 4LS0A 2NUXA 4X22A 3WJWA 2Y85A 2V1UA 5AHFA 2RDWA 1GOXA 4O15A 4LT9A 4C1LA 3TMQA 1W5TA 3B4UA 4MIMA 4UMAA 1YXCA 2TSYA 5HR7A 1O5XA 3W1MA 1BWKA 3DI1A 5D03A 4IMCA 4EWND 1LORA 2ZTKA 5C2XA 1Z41A 1WV2A 1TV8A 2FQIA 3HGOA 5G5IA 1J7KA 3LCGA 1LZOA 1VCFA 3NQVA 4JYDA 2RHGA 4O1DA 2E6FA 4WXZA 3O6DA 4XKYA 4JYFA 2BSLA 2OCZA 4N02A 5KZMA 2ATSA 3W7HA 3BLEA 2TPSA 1AW5A 3T4CA 1KSFX 5DXYA 1ZHAA 4D80A 5BMWA 3U61B 1WBJA 1O60A 3TSMA 3E96A 1XKYA 5F1UA 1F6PA 1IQPA 3E49A 1TPH1 3EB2A 3M7WA 2QDHA 3TR2A 2Y61A 2VC6A 1ICQA 3HG2A 3EWUA 3BO9A 4O1AA 4XTDA 5D2VA 5L6UA 1L6WA 3QSTA 2QJGA 3B8DA 1ZAHA 4ZQCA 1DQWA 8TIMA 1RQEA 3NM1A 3W3OA 1K7XA 3PSWA 1P0KA 3SY5A 1R46A 4ADTA 3LCWA 3EWYA 3R12A 3WK0A 1KM0A 1T8XA 3U8GA 1JCJA 2ISSA 4ONVA 3S5NA 4KWWA 3VE7A 2XN0A 4CQ8A 3UXDA 1X1ZA 3KRUA 3LHUA 3TAOA 4PL1A 4NXSA 1HTIA 2OZ0A 3NOEA 2ZRZA 2RFGA 2C0AA 4N9DA 4UTUA 3L5AA 4UTTA 4UMCA 4LU0A 1M6JA 4IX2A 2WKJA 3M1ZA 4YCPA 1FDYA 5CKSA 1OFIA 2C14A 3THQA 4IUOA 1QPNA 4CNNA 1D3HA 2W6RA 4YCOA 1FWNA 3MBDA 4TX9A 2Z6IA 2WO5A 2PCQA 1KYIA 4JN6A 3LI1A 4MYAA 4NJHA 3H55A 4YWIA 5HULA 4DF0A 5F2LA 4M6QA 3ABOA 3GLCA 2YFNA 2V82A 3KVKA 2CWNA 4DF1A 1FDJA 3OHIA 2XN2A 1OYAA 3G3MA 1EP2A 4MPQA 5HQEA 1XBXA 1NVMA 1W37A 4ZQNA 3TQ0A 2ATMA 4NXKA 1YTKA 5EPDA 4N9CA 2ZZ1A 2TMDA 2DZSA 4LJ9A 4O1BA 1FX6A 4O16A 3MI2A 3UD6A 2A2IA 2ZA2A 1HG3A 3H54A 2EGZA 3CM4A 1FCVA 4AHQA 5LHFA 1JQVA 1KFLA 3BVJA 1AW1A 1DL3A 1TV5A 2R91A 3TUUA 1TTQA 3MJYA 4IXHA 1SZNA 3N19B 4N6EA 1XXHB 1OF8A 2A7NA 1A53A 4ORMA 1EIXA 1DV7A 1F74A 3HU3A 1VYPX 2VFIA 3D0CA 3NPXA 4HNNA 3HO8A 1WA3A 1N7KA 3N34A 3W07A 3SFKA 2NWSA 2HS8A 2WV8A 3KOFA 5FEPA 1IN4A 1RQBA 2VOMA 4UCGA 5EXTA 2OMAA 4Q4KA 4ZZ9A 1IXRC 1YYAA 3CTLA 5JI3E 3GXPA 3MI3A 5DCDA 2DP3A 4FIRA 4N6FA 4OV9A 1QPOA 1GJPA 3UNDA 2QCMA 2Z0IA 3UY7A 3M5VA 1OJLA 2ZBTA 5CPNA 5L9FA 5G4WA 4GXMA 3MYPA 3MHGA 4IOTA 2NLIA 1ICPA 4WOQA 3GDTA 5AN7A 4LCBA 4BF9A 3QZEA 3L65A 3LLFA 3B0VC 1ME7A 5TBOA 3W83A 5HMSA 1L8QA 5CPMA 5EP1A 4ZVJA 5FTJA 3TIMA 3HB9A 3PM6A 1S3SA 2H3BA 2DVWB 1PHQA 1W54A 2ZA1A 1LP6A 4LVGA 1L6YA 1G7VA 1EUAA 2H6RA 3S0CA 4UTWC 3GLGA 5A8GA 1VRDA 3G1YA 4UC5A 1TQXA 2GVLA 3C2VA 4MZYA 2JGQA 3PSVA 3G1FA 3STFA 3M5ZA 5FF0A 4LC8A 2NUWA 2C99A 1E94E 4HSNA 4L15A 4UNLA 1GVOA 1G67A 1QWGA 1C1KA 2WSRA 5D37A 1TPC1 1TTIA 3TFCA 1TO3A 4FNTA 4Y9AA 2V30A 2BXVA 5MHBA 2FPYA 3DFPA 2NXGA 2WSYA 3B03A 3T78A 2H3DA 4XWUA 2ZAMA 3NM3A 2A0NA 1QVRA 2CZFA 3L66A 3MI6A 4WUIA 1JJKA 3UWQA 1Q6OA 4WY0F 1PHWA 4KLNA 4ALDA 3UY8A 1SR9A 3S1VA 5BMXA 1QFEA 5CZ0A 1LOQA 1YXDA 1JRCA 3DFNA 4LGMA 1AW2A 5LKYA 3G0SA 3TSBA 2CHGA 5K9XA 3G18A 3O6YX 3G1HA 2TYSA 4DF2A 3PXGA 2JKEA 1GVFA 3U5ZB 2E6DA 3MP4A 2GVGA 4PL2A 3RF9A 4FF7A 3NQ2A 4OT7A 4DQWA 4QNRA 1W1ZA 2WNNA 2VFFA 3DHFA 3AJIB 3ZS4A 1ZAIA 1R47A 3GZ3A 3GDKA 3MUXA 3O1NA 1WDWA 5FF2A 3QPYA 4K7YA 3W1XA 4Z1AA 1BWLA 3MW7A 4H3DA 1D9EA 5EMUA 3VKJA 4POCA 3W7MA 4FWDA 1QMLA 4BI6A 5LNVA 4NNBA 2CLLA 5KMYA 3ZH9B 3NXFA 3PF3A 3PR2A 4S1FA 5E93A 4NUWA 5KITA 5EP2A 4Z1CA 3EWZA 2QCGA 5BW6A 1GWJA 1RPXA 2V5BA 1NSFA 3NQ8A 1VCGA 5K3VA 3TXVA 1JVNA 3TROA 4WX2A 2DZUA 4PODA 3AJXA 1GTHA 5DN1A 2FB2A 2PE4A 3UWZA 1FXQA 1I2OA 5DCEA 4RCXA 4YL2A 4UTMA 2V5LA 2RDTA 2R14A 1SZFA 4YXGA 1G7UA 3W1AA 2C9OA 4QHTA 3BG3A 4NX5A 2ZRXA 3KAOA 3L2IA 4HHPA 4W9TA 4FX7A 3Q2DA 3VNDA 1WAUA 4RXFA 3P8IA 1OABA 3GDRA 2E5DA 3BPWA 3LHTA 1W5QA 1DO2A 5LHEA 1P5BA 5D02A 1LCOA 5EYWA 3ZR4A 1UCWA 5SWUA 1FWSA 3M0ZA 4O17A 1SUXA 1GVQA 3FYPA 3SIZA 3W1LA 4LTSA 4OE7A 1RR2A 1PS9A 4PFMA 4N9EA 1LM1A 4PH6A 2KRKA 4B5NA 2ZZ2A 4X9SA 2J88A 5G1YA 2DZPA 3F4NA 2A6NA 2PRLA 3HIJA 1FCQA 1H1ZA 4NU7A 2V9DA 4NQ1A 3PB2A 4HPJA 3LRLA 4LJAA 3F4WA 3EKLA 1OF6A 4AMAA 2H8XA 3GDMA 3BOSA 3V1PA 4E2DA 3HU2A 3V75A 2VFGA 3LTPA 3HQ1A 5KZEA 3GYEA 1NY5A 1X37A 1UUMA 3TKFA 4RJEA 2GJLA 4IQLA 4Y6GA 3TC6A 1FQ0A 3W7JA 3LCXA 5F2IA 4AAJA 1X1OA 5U7SA 4FD2A 2X16A 3DFSA 3IIVA 3E9AA 1O95A 1SFJA 3GAKA 1EP1A 3SGUA 5FEZA 2Y88A 1SO3A 2EAWA 3MO7A 3PVFA 1IXQA 4LVAA 1NF7A 2YYUA 2ZRWA 1WOAA 1XFBA 3PULA 3G24A 5K7JA 5KZDA 3UYCA 5E1QA 1XBVA 1S3HA 3QC3A 4LW7A 4O52A 3MYOA 3W72A 3QQ0A 4FHAA 3LOTA 1IY0A 4FNSA 3STGA 1WOBA 1LRNA 2XFWA 4JXCA 2VIIA 3KDSE 3RMJA 1RQHA 4YMZA 3IIZA 4IXXA 2QBYA 4NNAA 3CF2A 1RZMA 5DY2A 3PAJA 2VXNA 5BNKA 1I45A 4TO8A 2ZRVA 4NJKA 3TQVA 3W1RA 4D2JA 2E6AA 1IXOA 1SXJE 3CIWA 1OFAA 1O5KA 3DU0A 1NEYA 1SZGA 2E5BA 5AB3A 1B3OA 2QAPA 5AHEA 1E32A 2WOQA 3K30A 3N3MA 3KFTA 4JTKA 2CEAA 4JIPA 1CW2A 1DORA 4NVTA 3CWOX 3M47A 5CZTA 3TW6A 3IEBA 1N55A 3DKJA 2P0OA 1JQJC 4FXRA 2QR6A 3NPVA 1FWTA 3FS2A 4GRSA 4RZ5A 3TU9A 1TSIA 4WOZA 3BW3A 1OYBA 4I7WA 5J5RA 2ZZ7A 3NVTA 4LC6A 4JTUA 3EIHA 4XTIA 3L0GA 1G41A 2BLEA 4GWEA 2LLEA 4ZQOA 4UNKA 3DAQA 1EB3A 4BWLA 1TPB1 4RXGA 2J9YA 1YDNA 1IF2A 3WJXA 3KW6A 4UR7A 1KV8A 2XN1A 5DBUA 3UWYA 4DBEA 4DBDA 4O19A 1QO2A 3DZ1A 1QOPA 3LRMA 4BWLC 1KM6A 4Z0JA 1SSGA 2Q8ZA 2Z2UA 1SXJA 2QCNA 4AVFA 1ADOA 3IGUA 5FESA 4JY8A 1GZGA 1K02A 1FCUA 2YFOA 2BZNA 4Z08A 3TW7A 1SW0A 3M41A 4FX6M 4JDBA 1L6SA 3WHLA 3HG4A 3LTSA 5HNRA 3O05A 2EHHA 1XBZA 3A23A 3P7YA 1KM4A 4CCEA 4UIOA 3P8JA 3GLIB 3JS3A 1EP3A 2FPTA 3FFSA 3Q37A 1SSDA 1ME9A 3C6CA 3R13A 3FIGA 3L0NA 1VHNA 4LRTA 3HGSA 2DWZB 1KTNA 1TREA 3M9YA 1R6BX 3FKRA 2Y7FA 2DZXA 3MBFA 4UFHA 1IIHA 4I9AA 5DY3A 1D2NA 3KRSA 2YR1A 5EL1A 4IMGA 2QJIA 1TPWA 1TPUA 3GVGA 3DXIA 2QKFA 4MZ1A 3EX3A 3OG3A 1UASA 5FEWA 1PCWA 2NV1A 1HO1A 3SYKA 1H7OA 3C56A 1XDLA 1K3UA 1TPFA 5CGQA 3ATYA 4XKYB 4UXDA 1OX4A 3GKAA 3G1XA 3RK8A 3B9PA 3F1QA 3A5VA 3OVRA 5D04C 5AYZA 5D2WA 3S5YA 4CCCA 5K9CA 3HG3A 3WK1A 3C0JA 2J27A 4JX6A 5I3GA 1SW3A 2R94A 2Y7GA 4O54A 4H6KA 4JICA 2QCEA 3MHUA 3BW4A 2B4GA 2J9ZA 2WNQA 4FXSA 3G8EA 4IX0A 4KFPA 2VEMA 4MYXA 1VGAA 1SO4A 3THAA 2EPHA 3IIOA 4IMDA 1JCLA 5AHNA 2QCDA 3USBA 4O53A 5CSRA 1XI3A 3G22A 3NR0A 3ELFA 4LNYA 3CQ0A 2BJWA 2EF9A 4O50A 5DCBA 1VR6A 3IVSA 5K9DA 1IGSA 5AFDA 1GG0A 4UTTC 3W1NA 4E0CA 4A2RA 1KFEA 2H8ZA 2QJHA 3P82A 1QDSA 3L5LA 4QITA 1P4CA 3S6DA 2HCBA 1DQXA 2P10A 4XBSA 5D2TA 4JS3A 5C54A 1LYXA 1KM2A 1HL2A 1TV7A 3W7EA 3N9RA 1FDZA 4OQVA 1XXXA 1FNNA 2QUUA 1SFLA 3U2OA 2YX0A 4O0ZA 4JTHA 3M44A 3TDFA 1OG0A 5D2YA 4K38A 4EVZA 4RK8A 4RZ4A 3LHZA 4GITA 1LBMA 3I6RA 5AOUA 5I3FA 3ABQA 1G69A 3P5ZA 1DJQA 4ADSA 3QM3A 1ZNNA 4IJBA 5CSSA 3HGJA 3TA6A 1TTJA 1TJRA 5EA9A 2Z4SA 1A5BA 3W7PA 4FCWA 2YGYA 4RX0A 3DI0A 1YPIA 1SU5A 3I7SA 4JD4A 3NPUA 1MXSA 5D33A 3IRDA 2Z4RA 4P2VA 2E77A 1CI1A 1IY2A 4GNJA 1IXSB 4O14A 2BJVA 4O18A 3C4UA 2CU0A 3PFIA 1KFJA 2YW3A 1G4AE 4M7SA 4O1CA 3FKKA 1DJNA 1HT2E 3NQDA 4GUIA 3QMRA 4ZQRA 2NUYA 4FX8A 4D82A 4QM1A 3S5OA 3LTYA 2XSZA 3DFTA 5I3IA 1CX9A 1FWRA 3A22A 4L4MA 1H50A 3W1TA 4M5PA 1W5OA 4LWWA 4AWSA 1WQ5A 1QZMA 4MLRA 1H62A 2VELA 1Q6RA 1OHLA 3I7QA 2ISVA 3W86A 1G6CA 5AHLA 4WZHA 3UPWA 2Y63A 4XUGA 5FF3A 4E2BA 3DH7A 1K8XA 2C6QA 2HS6A 3W88A 3LBCA 2GQAA 4NT0A 2J9XA 2GUUA 1VH7A 3LHYA 1S5VA 4MUZA 2X2GA 2DJLA 1WBHA 3W1PA 3H53A 1H63A 3GXNA 3EXTA 1TPVA 4RLIA 2E1DA 3CC1A 4DELA 5F2MA 4BI7A 3PC0A 1LOLA 3W2LA 1LLWA 1HUVA 2Q3OA 3T40A 3M5XA 3GLFA 2DZNB 1K7FA 3GX9A 2YDAA 1GPWA 3IVTA 3GLHA 1H7RA 4GBUA 4FNRA 2O7QA 4LV9A 5CPOA 2VEKA 4LS1A 3DZDA 1EWEA 2ABBA 3T7VA 4EF8A 4KFOA 3F03K 4Z0SA 3N73A 2ISWA 2V2DA 1PVNA 3BV4A 4QQ3A 4O0KA 1OFHA 5LGXA 5LZLA 5AHIA 4QJ1A 1OYCA 1PV8A 1H1YA 3HJZA 3NDOA 1LDCA 3CEUA 5AC8A 3S42A 3HWSA 3UWVA 1UUOA 1MEIA 4AF0A 1JCXA 3PY2A 4KFNA 3HBLA 4CQ9A 4NJIA 3W9ZA 5C5YA 3CPRA 4MFDA 1KBIA 5BRBA 3NQCA 3KXQA 4QNWA 1I4NA 3FJ6A 1R2TA 1H7NA 3NL5A 4AB4A 2ZZ6A 4LRSA 4C1KA 4ZL1A 4UTJA 5F2GA 1F5ZA 3KVJA 3P84A 4ZQMA 1F7BA 3L68A 3NQ7A 4FEZA 4G1KA 3O6CA 3EX4A 3NQMA 1H7WA 4IWWA 4UTKA 1V7YA 4LOCA 2A85A 4IPIA 1GEQA 2AAMA 4IPJA 3R2GA 1BKSA 4S2CA 3DFOA 1Q6QA 4LV4A 4FCTA 1P1XA 1T0OA 2E09A 1W3IA 2OJPA 3GR7A 3NQGA 4JTSA 1H51A 3PUOA 5H2ZA 4CCDA 4GUHA 1VJIA 3FJLA 5EY5A 3TNOA 3FEMA 1DHPA 2FLIA 4CNPA 3U60B 5HWMA 4A3VB 2QUVA 4JTTA 1OK4A 3PS7A 3K1JA 2FNAA 1M7PA 1S5WA 3NA8A 2C13A 4JYEA 5D32A 5TQLA 3OVQA 1XCFA 3QW4B 4LVFA 1OFOA 4MOZA 3W76A 1P0NA 2NXIA 1AL7A 4O57A 2RH9A 1Z44A 4NZJA 1A5AA 4MKNA 2QCFA 5T26A 4MVAA 4JTEA 4JTIA 1EA0A 1AL8A 1ZJIA 2GJNA 3NQ6A 1K8YA 5CG7A 4O10A 4Z1BA 2Z1BA 1G4EA 1ICSA 3INPA 4M6VA 1G4SA 2ZA3A 3P80A 4R34A 1LRTA 1J2WA 3M6YA 3KHJA 1PE1A 2CLMA 2G95A 4Q33A 4O8RA 2C16A 5I3HA 3QYQA 1XM3A 4N9BA 5F4XA 1NFBA 2C3ZA 5BOOA 2G5WA 3CIXA 2B7PA 1TJPA 1JR3A 2HMCA 4FB7A 2ZQ0A 2I9EA 2BWGA 3SYLA 1R7RA 4HSOA 3BLIA 1JCNA 3LXAA 1X7FA 2VENA 1IXZA 2YPIA 3N14A 1GG1A 2W0UA 1K8ZA 3G1SA 4UUIA 5LNWA 1YXYA 2FB3A 2QAFA 2FJKA 1VPXA 3S1XA 3G1VA 3PUEA 1NJFA 4J9JA 3NG3A 3W2UA 2NX9A 1Q45A 4NJJA 4QIUA 1B57A 4Z8XA 5A5WA 1NY6A 5C55A 2ABAA 4IMEA 3MMTA 2V6ZM 2Y7EA 1LBLA 3W7LA 4HN4A 3LCLA 5G2WA 1B4EA 3W7GA 3BK0A 4JTLA 2ZFAA 3KVMA 2A7RA 1KA9F 4WD0A 1MEWA 4BK9A 3TFXA 3IGXA 4LVBA 4WY0B 3G1AA 2CE7A 3TX9A 3YPIA 4HPXA 5DYIA 4LY8A 3QFEA 5D38A 5AC6A 3A21A 5CZJA 1SO5A 3HU1A 5EP3A 1E51A 1YTEA 4PA8A 3D8BA 2A1YA 2BTMA 3C61A 2QUTA 1PIIA 2WJZA 3JR2A 3P81A 4AWTA 1MO0A 3GAYA 3BGJA 4A21A 4P61A 7TIMA 4LJ5A 1QR7A 4O12A 4HNUA 3P62A 3QH2A 3GNNA 1KFCA 3P74A 5LNUA 1FCBA 1TQJA 1HT1E 3P61A 3RLVA 4CQAA 1GT8A 2D73A 4AHPA 5DLCA 1MSSA 3Q58A 3S9YA 4Y96A 1A50A 3PG9A 4NX0A 1OVDA 4UFKA 2Y89A 1OFQA 1YTDA 4HT3A 3OVPA 2OX1A 4CNOA 4JY9A 3LCHA 5LGZA 4Q32A 1OK6A 1KM1A 3A24A 1I2QA 4X3ZA 4QNEA 4GUGA 3UZ5A 4MY1A 3LHVA 4LUIA 1OFDA 1IY1A 3G1DA 5GVJA 4QNMA 1QO5A 3S8HA 2G97A 3LX9A 2X8AA 2V8ZA 3E0IA 1Z48A 3KX6A 2OT1A 4GFSA 1DVJA 1O94A 2VKZG 3PBYA 2I14A 3CF0A 3VE9A 5EXSA 4PTNA 1EUNA 3LLDA 5J5DA 2NV2A 2QCCA 4ORIA 2A7PA 4JNMA 1KM3A 3E12A 4MJZA 1IXNA 2FIQA 3QW3A 3NNTA 1VC4A 1BTMA 3S5ZA 5D09A 1R2RA 3BG9A 3LBMA 1DO0A 3A5FA 4I4LA 2ZAOA 2A4AA 4FWHA 1H5YA 3NO5A 1VZWA 4MZ8A 4L4UA 2YXGA 3W2MA 3CEPA 3T55A 2DJXA 5KINA 4UFLA 5G4EA 5G1TA 4HKPA 3W1UA 1A5CA 4DO4A 4O13A 3EX2A 3RFAA 4OGZA 1TPDA 1W31A 4R53A 3MHVC 1MZHA 2ZZ5A 4M6PA 3W84A 3VFLA 4I81A 1IN5A 3ABRA 3O06A 1SXJC 1IN8A 3BARA 1SXJD 2X30A 3E02A 3W23A 5KSWA 4D81A 4K6AA 4A29A 4JEQA 2TRSA 5U4NA 3TE9A 4FW9A 3G0UA 2IQTA 1IXPA 4TMCA 3R8RA 1NJGA 3QQ1A 4JTFA 3SI9A 3W75A 1AK5A 5LNRA 4NZFA 2JKPA 3L5MA 3BGGA 1IIGA 2GQ8A 3SSJA 2H90A 5HUOA 2R65A 4A22A 3LV6A 4DPQA 2GPTA 3CB8A 5DXXA 1IM2A 1JCYA 3EXSA 4JIQA 3WJSA 3P67A 1AG1O 2DZWA 1SQ7A 3UWUA 2UV8G 3I68A 2ZANA 3MP3A 1ZCOA 4RZ6A 3WK3A 1Q6LA 4HIBA 3TH6A 3ZWSA 1FY6A 1SZEA 5KTLA 2WNZA 3W7NA 4JX5A 1JQXA 4M7TA 3PG8A 4AWUA 2WPBA 2FTPA 1VYSX 1DKWA 4LZZA 1GTEA 5H91A 1QPRA 1D3GA 1KM5A 3G3DA 1LOSA 1YDOA 2VFEA 1GVRA 5D30A 3STEA 1UBSA 1W8SA 3PBWA 3C2EA 1OX4B 3B05A 3HPZA 4UFIA 4Y90A 1XBYA 1H7XA 3C3NA 3DFQA 1TRIA 3C52A 4AHOA 3R8FA 3ZWTA 4I7VA 2RKOA 4R7JA 1GVSA 2A6LA 1KLZA 3LV5A 4GUFA 3C2RA 1UM8A 3W7RA 1K7EA 4QSHA 5K4XA 1ZALA 1I8JA 4MJMA 4UFJA 3EKZA 3UWWA 1TTPA 4LUJA 3W2NA 2A5HA 5I3JA 2C1HA 3GB6A 4K8HA 3PWAA 2VFDA 1HQYE 4L16A 1H61A 2GVJA 1FWWA 1V5XA 4N4QA 4RV8A 5FTMA 3LB0A 4OWGA 2QCDB 4BI5A 3O16A 2ZTJA 3N2XA 1MEHA 3NPWA 3CHVA 4TMBA 4UTHA 4X2RA 4KWVA 1XC4A 4FNPA 1W5PA 3RLUA 2Y70A 2CLEA 4Y8FA 1SPQA 2CLKA 3LXBA 3S1WA 3O8AA 1VLIA 3HOJA 1Z42A 4TIMA 3W7QA 3NEVA 1ML1A 4GJ1A 3AO0A 3EEGA 3WJYA 1RD5A 2J24A 3QPZA 1VYRA 2EKCA 4JDYA 4CLMA 3DBPA 3GK0A 3IV3A 3LHWA 4TR9A 3DHDA 1DOSA 1K03A 4JTGA 3GDLA 2ZRUA 4ML9A 2FPVA 3SW6A 3LERA 3L21A 3WJZA 1UB3A 2WQPA 1XXHA 2PURA 1A5SA 1TMHA 3W71A 3SR7A 4A2SA 4XBKA 2YW4A 3ANYA 5I3KA 1OFPA 2CLHA 3SZ8A 1S5TA 2V0TA 2DZTA 4FIQA 3UPBA 1TB3A 1PL9A 4ADUA 3HMJG 1OFEA 3HGRA 1NF0A 1EPXA 1XWIA 3L0KA 4O4WA 3NGJA 1XUUA 5G2HA 3ABSA 1OFRA 1G4PA 4FO4A 4PEKA 3C8FA 1KFKA 4E38A 1F76A 3W7CA 1H7PA 3UK6A 4HNVA 1ZAJA 2O7SA 3STCA 1WXJA 2JK2A 3W22A 1QAPA 4Z1DA 1L9WA 3W6YA 2CLFA 5JI2E 1YPFA 5FTLA 1I2RA 2XSZD 1SO6A 3OBKA 2B7OA 3CT7A 2PRMA 1VCVA 1LRQA 3PUDA 4UTLA 2CLOA 2CHVA 4KODA 4S2BA 4EF9A 1AMKA 1TCDA 4L4LA 4GC4A 1B4KA 4OBTA 3EWXA 4A3UA 3PBUA 5C18A 3LRKA 3QMTA 4KKXA 4MLJA 2ZYFA 2RDUA 3QJAA 1U5JA 1LBFA 1YLVA 3CU2A 1LTDA 4U28A 1W56A 1J4EA 4N4PA 3I7RA 3C2FA 4ZQPA 2C15A 1XUZA 4IGHA 4UTWA 4XQ6A 2C19A 4QISA 3NQEA 3TAKA 2JKAA 3P60A 3EWWA 2Q3RA 3B04A 5LSMA 3PBVA 4NJGA 2J6XA 4EOUA 3N9SA 3GLGB 3NYZA 2YSWA 3BW2A 3SC3A 4EIVA 3LXCA 5FI8A 1X8FA 3W85A 5TIMA 3LCIA 1F6KA 2DZVA 1DBTA 2JBMA 3W2JA 4UFMA 1OX5A 3GLFB 1JRBA 5HINA 3GLHB 4QOSA 1C9DA 5EP4A 4K37A 1Y0EA 3VI2A 5AC7A 3B0PA 3W2KA 3Q94A 3RNDA 1LV7A 2B0MA 2QEZA 3LGEA 3MP5A 2NXHA 3FA5A 3UZJA 1I2NA 3ZFHA 3BLFA 5ABTA 2NWRA 3UXAA 1FXPA 2AGKA 3WHKA 3IVUA 4GE8A 1W5NA 4AF0B 2PRHA 4OU1A 4O11A 4MY9A 4AEOA 3EXRA 2QP9X 3MWAA 3W87A 3QMSA 1OJXA 1F73A 1PCKA 3VCRA 3TJXA 4DPPA 2E5CA 3OEXA 5EKYA 3W7KA 4DXVA 3M0EA 3M6AA 2V2HA 3DENA 5FF7A 3W7IA 2V81A 5HR6A 1TPEA 3GKFA 2P1FA 5D05A 4FNUA 4EIWA 3BG5A 3IIPA 3KRZA 4IMFA 3NQFA 1Q3NA 4LJ6A 2KZHA 3M43A 3SJ3A 4O28A 1W3NA 1EX5A 4RKAA 2V2CA 2Y7DA 2AQWA 5FTNA 4LVDA 2G96A 4JGDA 2WSQA 3T44A 3PVSA 3OIXA 4UMBA 2ZCGA 4DO5A 2YYTA
chains in the Genus database with same CATH superfamily
3LYEA 1W3TA 1GQNA 4GO8A 3HA1A 2PC4A 3B06A 1IV8A 3ORWA 1TV4A 3L4XA 3KS5A 2VOTA 2J66A 1VHCA 3LNPA 5G2IA 3II1A 1CENA 1EFUB 1G3IA 2WLZA 3O07A 3O63A 1XLKA 3S46A 1QPQA 3PBGA 5C0QA 4ZMGA 2CV0A 4WW0A 3NAVA 1QCWA 1XRFA 2QF7A 3T07A 3AI0A 1IN7A 2BVWA 3QV7A 2E40A 4C6DA 3HY5A 5H8PA 1U5HA 3C58A 4FWGA 1E1CB 3HPXA 1C8YA 1I2PA 2PSNA 5BOFA 1V34A 4RF1A 3CZJA 4LEFA 3NZRA 1JR3D 1WZMA 4GHRA 4Y8EA 4HZ7A 4ZSTA 3CTWB 4IGNA 2FGLA 2JE8A 4BQ2A 4HNTA 4GJJA 4W7WA 2JUJA 3MMPA 3SHGB 1HJSA 1ZFJA 4MKVA 3V5FA 4QX4A 2Q09A 3VIFA 7CGTA 3PN8A 4ZA0A 3EX1A 4Q4QA 3OTRA 2C18A 3LA4A 5CAHA 4LF9M 3QF0A 4MWAA 3RU6A 1SJAA 1E0XA 1OCNA 4U4MA 3LSBA 1MXGA 8XIMA 2NSOA 1NSJA 2X7VA 1GYNA 1UOZA 3LPPA 1A5LC 3LI0A 4BZYA 2QCHA 2PDLA 1CXFA 3CLMA 2WZMA 2I17A 3CQIA 2CZDA 2VC9A 4W84A 5IM51 2ZWYA 4AXKA 4TX8A 2HSAA 3QOKA 3JUGA 2EUCA 2ZVRA 4DJDA 3UGRA 1MNSA 2E68A 1S3TC 3R58A 3H24A 2WVUA 1GOKA 2I7NA 2YLAA 3TJLA 1DWAM 2R62A 3N2MA 1R4GA 2XWEA 3FOKA 3FUXA 4WQ6A 3RM4A 4PULA 1V7AA 4QROA 2XFYA 2QENA 4W85A 3B8TA 1JUBA 2ALDA 1RLDA 3DYPA 3HHWA 2QV4A 5D9OA 2FHCA 4A35A 2DZOB 1Z8AA 4B4HA 3WEOA 5AYXA 3ZJ8A 4H00A 2AKMA 1D7KA 3U6EA 1FFRA 2O01F 4JX4A 1KV5A 2KNZA 5BU6A 2CHQA 5LIUX 3EZ4A 4IIDA 3ARSA 5A6TC 3L29A 3NZ1A 4E3VA 3S1UA 5DO8A 2Q8LA 2NZLA 5K4ZA 1HQCA 4LJ7A 1VQTA 3WBXA 3LDVA 4YTUA 4FOJA 1LG2A 2PEVA 3FYOA 2X8RA 2GSEA 2JIEA 3PZIA 3N6HA 3TC7A 1B9BA 3AOGA 2ZZ4A 3HHYA 2E7FA 4HYRA 3MSDA 3TK7A 2JQXA 4J3ZA 1FP8A 1LROA 1H11A 1Q85A 4BQ5A 1C8VA 5BCAA 4AEEA 3UPMA 1PUDA 3FTDA 2CZEA 2YCEA 4BY3A 5HNTA 2VMFA 3SQMA 3FY1A 1EWDA 2KNAA 3QGKC 3CWNA 2I7PA 1XL9A 1UJPA 5HUPA 1N33M 1OWQA 1RD6A 4I7UA 3PB0A 4M1BA 3CBWA 4ICNA 3QRHA 3MMDA 4K1WA 1X38A 1KRCC 3MUZ1 3UQNA 3GHRA 3ID7A 4FP1A 3ZQJA 5HWNA 4ZOEA 1Z32X 3U6DA 3MJMA 1BXBA 5M5DA 1SR0A 3A9IA 2POZA 1EE8A 1NDVA 4DLMA 2P3EA 2G0WA 5AHFA 3IJ9A 3P6LA 1GOXA 1OT1A 4TX6A 3B4UA 5H6HA 4ATLA 4MIMA 2M60A 1SJDA 1M9HA 3AS3A 4IQEA 4EWND 3TWLA 1WV2A 1TV8A 1UIOA 3HGOA 3LCGA 2ACQA 2V3EA 1R87A 3WQEA 3CWHA 3VO0A 4DO7A 3QGVA 4IF2A 2BSLA 5F7UA 2Z4GA 5KZMA 3ITOA 4PGLA 2PF8A 4XX6A 2TPSA 2Z7KA 4D80A 3ICJA 1CTNA 4C60A 3HHXA 3BOXA 4S3EA 3GPXA 1ENUA 4DJFC 2NQ8C 3ZLGA 1C7TA 3E96A 1XKYA 3T8LA 2WVSA 3B4YA 1J11A 1TZ9A 3SM0A 4Z17A 2QDHA 5FJOA 4O1AA 5D2VA 5XIAA 3QSTA 2EBNA 3CUGA 3KM8A 1RQEA 3NM1A 3PSWA 1JAEA 1R46A 4ONVA 1NHWC 1UPMB 1Z9AA 1QQWA 3KRUA 1DXFA 1V6TA 2XVKA 2OZ0A 3NDYA 2ZRZA 2AKZA 2C0AA 4LAKA 4UTUA 3L5AA 1QI0A 1PXGA 3VNMA 2OWWA 2NQZA 2PDUA 4CHTB 1MQQA 2IMRA 3T8QA 1M6JA 3WQGA 3PJXA 5KQ8A 1FDYA 5CKSA 1QPNA 4CNNA 6PTDA 1RBAA 4YCOA 3KBVA 3MBDA 2Z6IA 4NXNM 2BG5A 1KYIA 4GIYA 3LI1A 3TN6A 3SBFA 1E6SM 3H55A 3VM5A 3W24A 4MB4A 4DF0A 4R7OA 1VBRA 4U3CA 4M6QA 4PBFA 2ZX8A 4MB3A 1K4HA 1NV9A 1EF2A 2V82A 1BYBA 2CWNA 4RW5A 3WDPP 1V51A 3R11A 1XBXA 2HZGA 1TWSA 2VDBB 1W9PA 3LQRA 3TQ0A 2ATMA 4N9CA 2ZZ1A 4AW7A 1EHNA 2PWFA 3BAIA 1OIMA 2A2IA 1RCOB 1RA5A 2L7IA 1PWMA 2EGZA 4DR1M 2Z8YM 3R0DA 5LHFA 3AXKA 2R45A 2MR9A 3MJYA 4DNHA 1UJQA 2IS7A 4MNJA 1DGFA 1G1YA 1RALA 2JWSA 1OF8A 2XSBA 1BYDA 4W5UA 1F74A 3N34A 4CU6A 1CLXA 3C2YA 3KOFA 3AMKA 3SCRA 1NOFA 4UCGA 4GVGA 3V16A 1WDSA 2XGZA 3GLFE 5CC7A 3QWLA 1IXRC 3CTLA 5JI3E 2XIIA 3GLHE 3DBNA 1FHDA 4KQNA 1RUSA 4OV9A 1QPOA 5DFLA 2E4TA 2DZAA 2RUSA 3BJSA 3B7QA 3M5VA 2O9OA 2FYMA 4DV0M 5HPOA 1JGMA 4IFKB 1V33A 4WOQA 2BHYA 2IW0A 3QZEA 3LLFA 4TVUA 5TBOA 5HMSA 1L8QA 5EP1A 3T09A 4RE0A 1MVYA 1CGWA 1J0YA 2H3BA 2DVWB 4DXXA 3U6CA 2ZA1A 3ZIZA 2VGBA 1E6PA 4AY7A 3VIJA 1UKQA 2H6RA 3WUFA 4U2ZA 1UZHA 3FYYA 2GVLA 3C2VA 4MZYA 4LB4A 4DBUA 2XH4A 1Z7AA 3STFA 1AQFA 3M5ZA 1DGHB 2C99A 3EAUA 4HSNA 4MAZA 4G4OA 1GVOA 3PNVA 4GMEA 5IWAM 2ZXAA 5JH2A 2WCGA 2CBIA 4Y9AA 2FPYA 3ITLA 3LMZA 2NXGA 2DVUA 3T78A 3BAJA 2ZXQA 4XWUA 2ZAMA 1Q6CA 2YZ5A 1QVRA 3TZFA 5DMYA 2WC4A 4NZCA 4WUIA 1JJKA 2OYLA 3UWQA 2FZNA 3UY8A 3UETA 1Q2RA 3CZGA 4IM4A 2POTA 2XH0A 3MT1A 1EGVA 4DR6M 3HV8A 3QKEA 3G0SA 1BVNP 4PMVA 3WH7A 3O6YX 3RM9A 2XLJA 4H7VA 4Q8UA 5HJXA 3AU6A 2E6DA 2J78A 3MP4A 2GVGA 4CD8A 2HAKA 3GO2A 2PZ0A 3BBZA 1CT5A 2QHAA 1S2TA 1EC8A 3OU8A 3KZSA 4QNRA 2WNNA 3AJIB 1PKYA 1YHTA 3GZ3A 5GNZA 3DIPA 3O1NA 3M0MA 2X40A 2RGOA 1GQLA 1WDWA 5FF2A 1RVKA 3NZQA 4WLCA 1N34M 2OKTA 3FTFA 3H70A 4YHEA 5ITXE 4H3DA 1D9EA 1MZRA 3LM3A 4MJ4A 5EMUA 1EQPA 3HJ8A 1XYLA 4GI4A 1B0IA 5LNVA 2KW0A 3BLDA 3UCCA 2BWEA 1H49A 5KITA 4JFVA 3ME3A 1GWJA 3M0KA 2V5BA 4J40A 1NSFA 4QG9A 4G4RA 3TXVA 2QUMA 3E6EA 4DZHA 1E1CA 4ZB2A 3AJXA 3IV8A 2FB2A 2PE4A 3UWZA 5CGTA 3FUWA 3SN1A 1T7LA 3VDHA 2R14A 1H09A 4KT2A 1SZFA 4MDPA 3HU7A 1EPVA 2C9OA 4QHTA 3BG3A 3KAOA 1B31A 5JUVA 5I5RA 4FX7A 2D2HA 1XIHA 5M17A 1WAUA 3BGAA 4E6MA 1XRSA 4J7RA 3GDRA 2PU0A 5ITXA 1UCWA 5SWUA 4M24A 1F3WA 1SUXA 1NP0A 1RR2A 4PFMA 3MV01 5LA0A 4LAUA 2QSFX 3BICA 3AIUA 5JU6A 2PDHA 4JCMA 2DZPA 3F4NA 4K3ZA 1U1HA 3PB2A 2LVPC 1PM5A 2JP7A 3CV1A 1GQJA 3UNTA 3OO2A 4L9XA 3W6MA 4BQ4A 3EKLA 4AMAA 3GDMA 2DDXA 1HGYA 1TE6A 3V1PA 4E2DA 3O3RA 3QN3A 1X37A 1UUMA 2FHBA 4IQLA 4Y6GA 1OINA 3LCXA 2XZ7A 3IARA 4PBGA 4C7GA 3MY9A 2D0FA 1EKOA 2P8CA 3KFUG 1SFJA 3GAKA 1EP1A 2NSXA 2YB1A 3PVFA 2ZRWA 3RRXA 3G24A 5KZDA 4JBRA 4NAFA 3QY6A 5E1QA 1S3HA 4LW7A 2X0YA 2ZIDA 3RR4A 3LOTA 1IY0A 4FNSA 2ZTDA 3RX4A 1CXIA 2XFWA 4JXCA 3W25A 4TUFA 2IXVA 4IXXA 1PKNA 4C1NB 4LF8M 2NV9A 3KXEC 3Q45A 4C6FA 2WJEA 4C6MA 2FH6A 3WLIA 1I45A 1QI2A 3FSUA 5A2CA 3V0SA 4M0DA 1W9XA 1SVDA 1P7TB 2E5BA 3DU0A 3MKVA 1JCTA 1E70M 2EKFA 1K4GA 2P88A 4A05A 3KFTA 3UJFA 4W8BA 1XLEA 2PPGA 1CW2A 3S2NA 1XHBA 3CWOX 1ELSA 4A8LA 2OU4A 3IEBA 2DUZA 1QAOA 1JQJC 3TOPA 3NPVA 3KTCA 1JPMA 3B7NA 1D2KA 1BVZA 1YE4A 3ZT7A 1EJUC 1OYBA 4I7WA 3FJNA 3L0GA 2H9AB 2EPLX 3DERA 4GWEA 4L64A 4D1IA 1W1A1 3AMCA 1JNEA 3DAQA 2CBVA 3KBSA 4GOAA 1HKJA 2ESCA 4RXGA 1UKSA 1RA0A 4J3VA 1KV8A 5DBUA 4DBEA 4NRWA 3DZ1A 1QOPA 4BWLC 2E25A 2Q8ZA 2Z2UA 2DSVA 3IUIA 5A3HA 3IGUA 4JY8A 1JDFA 1K02A 4IT1A 1Q6GA 4N7QA 4Z08A 2OZTA 1BQCA 4QE4A 4M0WA 3LTSA 5HNRA 3ENLA 2F9RA 2K6BA 1JYWA 3B8IA 1UG6A 1EFZA 4WSKA 3FFSA 4CCZA 5IREB 4GABA 1SSDA 1NWRA 4MM3B 3THGA 1XMOM 1FH8A 3L0NA 1VHNA 2JF6A 1GJTA 3HGSA 1KTNA 1TREA 1R6BX 1F8IA 2Y7FA 5DY3A 1E4MM 2YR1A 2L7HA 1EL3A 2LH0A 3I3BA 4J3UA 4AQYM 1VDDA 3LS9A 1TPUA 3V35A 1UWRA 1XWYA 2QKFA 3DXIA 5FIPA 1J9YA 2DNAA 1PCWA 5A69A 4RNAA 2NV1A 1JB0F 3ZZ1A 3GBEA 1J5SA 2GSJA 4GH9A 3T2QA 2NLYA 4PCPA 4NASA 3ATYA 3GW0A 2JNHA 1HNWM 4YVVA 3K2LA 4YTQA 3WDJA 3TJIA 4W88A 4HEOA 4LCRA 2PDIA 2I56A 4CCCA 4L65A 2J27A 5FJIA 5I3GA 2R94A 2JZ1A 2W67A 1PX3A 4UQ9A 4GC9A 2J9ZA 9CGTA 3S2MA 3G8EA 4MYXA 3RUBL 1T5AA 3EWDA 2D20A 5EB8A 5AHNA 3ZQ9A 5CSRA 3G22A 4GVFA 4ZXLA 1QUMA 4GXPA 3CQ0A 2BJWA 2EF9A 1VR6A 1J6PA 3ZVHB 3CMFA 1NV8A 1N8WA 1GG0A 3LVVA 1HIZA 4A2RA 4E2VA 1KFEA 5CQ1A 4HMEA 4CVWA 4GACA 3L5LA 2F5OA 2VX6A 2PWVA 3APTA 3FAWA 1OC6A 4C5YA 2VDGA 2VC7A 4OVZB 1D8WA 5D2TA 3T1HM 1LYXA 4LF1A 3BAKA 1TV7A 2PDWA 1CUKA 4NF7A 1A4MA 3PP7A 3BSMA 4H01A 4RK8A 3CQKA 4GITA 3ABXA 4PMDA 4IIHA 5AOUA 3VDGA 4PE8A 3QM3A 3DC0A 1ZNNA 2XVNA 2X1IA 3PJWA 4HLQA 5CSSA 1O12A 3DA1A 2HE5A 1R7AA 1LL7A 4BBAA 2Z4SA 1TJ0A 4FCWA 2WB5A 3DI0A 2GUBA 1XS2A 3R0KA 2YKKA 1RK5A 3L4ZA 4ZOBA 3VCCA 2E77A 1QUSA 2ACSA 5FCZA 2VGFA 4O14A 3I4EA 2Q02A 5I00A 1GGOA 3NQDA 2ZXDA 1SJCA 3QMRA 4FLSA 1VENA 4FX8A 3S5OA 5I3IA 1JZ6A 1FWRA 3W1TA 1H50A 2CCRA 3NJ3A 3QY8A 1WQ5A 3WMBA 3I7QA 1OBAA 3W86A 1IT8A 3NZGA 2OEJA 4GCAA 3SAWA 4Q8VA 4CVUA 3UPWA 3EDJA 3GBDA 2WM1A 3WLPA 1J0ZA 3UR5A 1UMLA 2WZIA 1K8XA 1U33A 4WDTA 3CLWA 2GQAA 1MU5A 5DMLA 3LHYA 3N4FA 4KCUA 1ZUAX 4HNLA 3SEPA 3BLOA 4WJ8A 1X96A 2AL2B 4P8VA 3WNOA 2KA6B 3TR9A 1H63A 2O0TA 3GXNA 4DELA 4BI7A 4JTRA 3E0WA 2J7DA 3PC0A 2Q3OA 3T40A 1IHIA 3GX9A 4DBGB 2O7QA 3MA8A 3SJNA 3KCJA 3GFZA 4EF8A 4XSMA 4HCLA 4CD4A 4QG8A 3N73A 2ISWA 2V2DA 1ZPTA 3WBEA 1PVNA 3BV4A 4QQ3A 5A8QA 3C8NA 1NQKA 3CNYA 1H1YA 1W1B1 2BHUA 2BS9A 3CEUA 1R3RA 1UPPA 2QIIA 5A6SA 2WVTA 1HL9A 1I0DA 3N2TA 4XBOA 1UQZA 3GTIA 4MFDA 2ZOXA 2VF7A 1TWWA 3FJ6A 5M3WA 1R2TA 2H5XA 4B5TA 5CBBA 4C1KA 5ITQA 4UTJA 4ZL1A 3VMPA 2GQFA 1J10A 4Q8QA 4LJ3A 5CJ5A 3B8SA 4G1KA 4WP2A 4S3DA 3W27A 4NY2A 3S6TA 4UTKA 3GVWA 2VEFA 4ROQA 2EO2A 1G5AA 3DYOA 4FZIA 4LV4A 3TWAA 3UP8A 3JR4A 3GR7A 4IICA 3PUOA 1JR3E 5H2ZA 2BY3A 4NILA 4DNMA 5GNXA 2KXEA 3FJLA 3M0HA 3SCUA 3AFHA 2WAGA 4GI9A 5AC4A 1QI5A 1UD3A 5A6LA 4V33A 3U60B 5CGMA 1S46A 1V79A 2J75A 2QUVA 5E9AA 1Q5MA 3PS7A 4YTTA 2FJUB 3OVQA 1XCFA 4ILSA 2NQJA 4YVPA 3W76A 1AL7A 1ONXA 1QVBA 4MKNA 2V67A 3GXIA 4MVAA 3T15A 4JTIA 1EA0A 4XSLA 3OP2A 1A5UA 4S3CA 1W2VA 2DUAA 3EA1A 1K1DA 4YWSA 1G4EA 1XLHA 4AD2A 2WVVB 2VNCA 1XYZA 4K68A 2APLA 1OGGA 4W7UA 1J2WA 2IPJA 4IPNB 1R6WA 3M6YA 4GQBA 4DZAA 1ZLPA 3AUJA 3GS6A 3QLDA 4N9BA 4LAMA 5BOOA 1XG4A 3K4WA 1JR3A 2OPJA 2ZQ0A 2D1ZA 4KERA 3CMJA 4HOZA 2ZWZA 3SYLA 3WNPA 1F3TA 4HSOA 2DT2A 3BLIA 3P3BA 5IFPA 2PLMA 3LXAA 1IXZA 3RCMA 3N14A 1GG1A 2W0UA 4JAWA 1XIJA 2QAFA 1VPXA 3G1VA 1JZ4A 2ASHA 3KLLA 4J9JA 2WCSA 3THCA 1W1VA 1LUCA 1RJPA 1J09A 2NX9A 1Q45A 4QIUA 2GQ3A 6TAAA 4W93A 5C55A 2G3JA 4IMEA 1AUSL 2O9PA 4JPGA 3JW7A 1BYCA 1UH3A 1P48A 2WPGA 3LCLA 4HN4A 3U4FA 1QBBA 4BKNA 2E67A 1TVPA 4LSBA 2Z00A 3KS4A 3LQLA 1UBPC 1LWJA 1AODA 1XD0A 4DUVA 1MEWA 2PFHA 3T2PA 2BB0A 2PDKA 1GOOA 2ZX9A 5AKQA 4IL0A 4JI7M 4J28A 3TL4X 4ACZA 3QFEA 3A21A 2PDPA 4F0SA 1E55A 3P81A 1NJJA 3BGJA 1BD0A 4MNMA 4P61A 3TYDA 7TIMA 1QR7A 4O12A 4HNUA 4D6DA 3R10A 2BGSA 3W28A 3ARUA 3BZGA 2BVYA 1QJWA 4PN2A 4ITQA 5L8RF 1RJQA 3P74A 5LNUA 2FTYA 1TQJA 3RLVA 3ITTA 1GT8A 2XU2A 3D46A 4D6GA 4MADA 4XKMA 3KP0A 3OIHA 3T9PA 1AVAA 1X8CA 2J8FA 1C7SA 2Y89A 1OFQA 1P7TA 1PSCA 1P1MA 4JY9A 4Q32A 4KH2A 4M56A 3N1AA 4L1GA 1LTMA 1KM1A 2VCBA 2Q2EB 4X3ZA 3UZ5A 3IJIA 3PZVA 2V5KA 1P43A 2BHZA 4H6QA 4C6BA 4JTAA 5FSWA 1DQUA 4LUIA 1ZBVA 3G1DA 5CPQA 1QRQA 2RDXA 3LX9A 2V8ZA 3E0IA 4P5UA 3TWKA 1Z48A 3VPLA 2WMFA 3ALFA 3ECQA 1BVSA 2UU9M 4YVXA 4IBEA 4PTNA 1EUNA 3LLDA 3MZNA 4JNMA 6A3HA 2FIQA 5D4YA 3S2LA 1PX4A 4ACYA 3FW6A 1UZ4A 3BG9A 1FH9A 4I8DA 4GKKM 2ZAOA 1Y5WA 2A4AA 1H5YA 1VZWA 1VP5A 1Y7VA 3BCFA 3ZLFA 3PBMA 2PBOA 3VILA 3T55A 1ISYA 5KINA 4UFLA 2V1CA 4HKPA 5ABFA 4DO4A 3RFAA 4OGZA 1TPDA 2ZZ5A 3MUY1 3OG2A 3VFLA 4I81A 1IN5A 2DVXA 3ABRA 3S47A 3BARA 1IT0A 4PZVA 4PUWA 2VD9A 4XAPA 2TRSA 3G0UA 1UKTA 4JN8A 1U2YA 5ABGA 1O5QA 1AK5A 1HQTA 4ZO8A 5XINA 5LNRA 1VEOA 2JKPA 3L5MA 3HJQA 2QNEA 1TDHA 1XW8A 1JDEA 2H90A 2R65A 3UG8A 1W91A 1AH0A 3WF2A 2LVNC 3WJSA 3P67A 4KEVA 4X60A 1JPHA 1O66A 3WH8A 1TJ1A 3GXFA 1GK8A 4H8HA 3VNYA 3WK3A 4CD7A 2K47A 3TH6A 3PNYA 3RU8X 1FY6A 1SZEA 1TH3A 4M7TA 2WZTA 2GK1A 4L8RC 1WO2A 4XD3A 5C7VA 3BMWA 2FTPA 3WFZA 1VYSX 3VAVA 4LZZA 1JPKA 1GTEA 4GZJA 4IIBA 4DR4M 2YCLB 5FAJA 1B3XA 1GVRA 3STEA 2UY3A 1UBSA 3SY1A 5E6YA 3U6OA 3CUFA 3HTWA 5HQLA 4RW3A 3PZ9A 1GOIA 4HPGA 3GO8A 3HPZA 4UFIA 4Y90A 3H2MA 3DFQA 1UD8A 3VZXA 3C52A 3FNDA 3R8FA 3ZWTA 5BRPA 3OLGA 1K7EA 4QSHA 1HJVA 1ZALA 5BROA 1R9ZA 1TTPA 2UWFA 3K1DA 3SAUA 3B74A 4ZR8A 2VFDA 4L16A 4LAOA 2ONEA 4N4QA 4OWGA 2QCDB 2CIPA 4ZO6A 3O16A 2DKLA 1JF5A 5IT9S 4UTHA 3CF6E 1XHGA 3RLUA 4LG2A 3EOLA 3QKZA 1VBGA 2QMJA 2CLEA 4Y8FA 4OFCA 1SPQA 4DWSD 4GBDA 3O8AA 3HOJA 1Z42A 4H9UA 4HMCA 3W67A 5IXEA 3AO0A 3EEGA 3WJYA 4D9PA 2VL4A 3LQQA 2QULA 4JDYA 2JY6B 1JXJA 1J0KA 3IV3A 3LHWA 3DHDA 3AXMA 1DOSA 1XSIA 5I07A 3N2OA 2FPVA 2VUNA 3LERA 4AUBA 2K9DA 1A5TA 1A47A 3MJ5A 2G8LA 5IHSA 3ANYA 5I3KA 3HJSA 2DW7A 1OFPA 3W01A 3T6CA 4IJEA 3LCUA 5JH1A 3AQUA 3VKBA 1S5TA 1E72M 2VRKA 1IWBA 5ECUA 4ADUA 3HMJG 1OIPA 1B5TA 3HGRA 1VEKA 1WPCA 2JA2A 4I9TA 4FO4A 1OFRA 3C8FA 4F2TA 3TN5A 1KFKA 1M3UA 3PWGA 1ODUA 1H7PA 1BF6A 3SRFA 3UK6A 2O7SA 5KO3A 4NC6A 3W22A 4H9MA 4GCXA 4Z1DA 2O92A 1L9WA 1QDRA 2CLFA 1PZ0A 2OG9A 1YPFA 3RXZA 5FTLA 1I2RA 1Q7MA 2XSZD 3OBKA 3WYZA 1S2WA 1Z6KA 2B7OA 4F9DA 3PUDA 4UTLA 3GD6A 3FYCA 2CHVA 4KODA 4S2BA 4L4LA 4OBTA 1TWDA 4LUTB 4B3ZA 5AC5A 2MANA 3WD4A 3E21A 3OLEA 4KKXA 2INEA 2I9UA 3AU2A 2AL2A 1LBFA 2PCEA 2V5JA 3VKKA 4L1WA 1W1IE 2W63A 1WJ7A 7REQA 1QK2A 4QISA 5A2AA 5MKGA 3MKKA 3TAKA 1A3HA 4DAFA 4REZA 4S39A 3TTYA 2YIHA 4QDWA 4TUWA 2FDMA 2QV5A 4TV6A 4EIVA 2UZ9A 5I03A 4UQCA 4F2BA 3LCIA 3U7VA 1F6KA 1RP9A 2DZVA 1DBTA 4EANA 1U22A 1OX5A 1IFYA 3FDGA 1GLNA 4HJFA 3GU9A 4QOSA 1C9DA 4K37A 5CXPA 3R8HA 3Q94A 1LV7A 1VEGA 2CNCA 4P7LA 1NHGC 4AWEA 3BLFA 1R3SA 3AS0A 2HXUA 1OIZA 2KHHA 4PT5A 1PPIA 2QVHA 1V92A 2NWRA 1AFSA 1C3FA 4IJFA 3IVUA 3ARZA 3KP1E 4MM1A 4AF0B 4OU1A 4O11A 1ZJAA 4FR1A 4Q6XA 2G41A 4RNHA 1BAGA 2QP9X 1PTAA 2F61A 1ISVA 1OJXA 2J7NA 3EMZA 4DPPA 1V6XA 5LIXX 5GJMA 4QLLA 3W7KA 4DXVA 3W7IA 4PTXA 3WKZA 1XLCA 5D05A 4ZE4A 3SHFA 5BXTA 1JYXA 3KRZA 4ZOAA 1GL6A 4HHLA 3F4CA 4LJ6A 4AYGA 3SJ3A 1XLMA 2J7HA 4FXFA 4M29A 1W3NA 4R7WA 2V2CA 1ISWA 1TZ7A 1VFHA 1GVEA 2RAGA 2GLKA 3E1F1 4DV5M 3RIKA 3CYVA 5H1WA 1DGBA 4MNLA 5EJCA 1VRXA 2WSQA 2QJMA 2JXNA 1XQLA 2ZZ3A 3SCVA 1JUEA 1UP0A 2WVVA 4Q4MA 2YCKX 4B08A 3KP1A 1EEPA 3B3DA 4AEFA 2E6YA 2VRJA 3AV0A 3FCPA 4C6PA 2GVEA 5I7GA 5D2XA 3I4KA 1Q8AA 3M16A 5C6MA 1EZ2A 1JR1A 4BLCA 3K4AA 1JG9A 1QNVA 4WXYA 3HPSA 1DWJM 1WX0A 3TQPA 1IZCA 4PCZA 5AVNA 2A21A 4KRZA 2LVOC 3LLXA 2DU2A 5C1BA 2FVMA 1XG3A 2CW6A 1KXQA 3M0YA 4D6FA 2VEPA 1X6UA 3URBA 4AFYA 3B0UX 2KZUA 3P0XA 2RGHA 3GVQA 1XF0A 2Z29A 2XF3A 5IBXC 2WQDA 4G4NA 1VBJA 2QDGA 4OIFA 3AHVA 1M5WA 4PTWA 2HISA 2F7FA 2HL7A 1BG9A 3OZYA 3KL0A 3VD9A 2M5ZA 3APYA 1W0MA 9RUBA 3R89A 2CFFA 2PZNA 9XIMA 1WXYA 4Q4OA 4KO8A 3FYDA 2E8YA 3G2GA 3LK6A 3TTEA 3EB3A 4CN6A 4HOXA 2X1TA 3CAKA 4RZBA 2PP1A 2UXDM 4XG1A 4GC5A 1WXQA 3CO4A 4UN2B 3IAQA 2C5RA 1ZY9A 2YA1A 3A4JA 2PDQA 3AWOA 4PMXA 1NTHA 2HHHM 5DRCA 4XZ9A 2OKOA 1U83A 3IGSA 3W70A 4UTIA 2FE8A 5ITRA 2WMJA 1X6NA 2QZ4A 3GRVA 3NQAA 1N8FA 5BXRA 1TZZA 4LUYA 3J2PB 1F2JA 2A3HA 3L67A 3PJUA 5EMMA 4H4IA 2JGYA 4DV3M 4LYPA 2VWTA 4M19A 2QPAA 1DTUA 4GYPC 4WJEA 2B7NA 5CG0A 2GGEA 3LCFA 4NRRA 4JR5A 4OVXA 4ZENA 4NKCA 4IISA 2X1SA 4AZHA 2HDJA 1AUAA 1JZ8A 3PTKA 2GQ9A 2X1UA 2Z6JA 1WYIA 4JTJA 1ONWA 2DAEA 1E9YB 3OLDA 4O8AA 4Y9MA 1W5SA 2XIBA 2PUZA 3VUPA 3W0FA 4V2XA 4F3HA 1RY0A 3L4TA 3QEZA 2ZUNA 3EPNA 2YZRA 4AIBA 1LQ2A 4QBXA 2DUXA 2FGBA 3E46A 4CGYB 3SBJA 1HFBA 3LPFA 1YW1A 1C92A 4NI8A 2YDSA 5T91A 4BJHA 3WLHA 1REQA 4MY8A 3NL3A 1UR0A 1H60A 2OO0A 1XDMA 4LJ4A 1KW1A 4C90A 2J62A 3UA3A 1C29A 1PIFA 2BGQA 3A9BA 4CISA 1CECA 5F1VA 4DEFA 3ZXWA 1FKXA 3TTSA 2DI0A 2RGLA 4UR8A 3HX3A 3C2OA 3PTMA 3N04A 5A2BA 1K3WA 3UFYA 4ATWA 1WKDA 5CSUA 3NBXX 1Q2SA 1K8CA 5EXPA 3TSDA 4J2MA 5BZAA 1FUYA 3LY0A 1M7OA 1NAL1 1DWHM 1MDLA 5KPTA 4FNQA 3HPAA 2W66A 3GXTA 1XNQM 1TRDA 4IG2B 3DGRA 2GJXA 3GH5A 3DKLA 5HWJA 5A6AA 1Q8JA 4HGXA 2NUXA 3E0VA 3VKHA 2Y85A 2EG7A 4W87A 3PZTA 1QBAA 4DV1M 4L4OA 4FVMA 2RDWA 4HYVA 3SQSA 1XB2B 3G5EA 1UZ1A 4UMAA 5HR7A 5EMKA 3W1MA 1BWKA 2QGHA 5AVHA 5CH9A 2VJXA 3EYPA 1LORA 4DYEA 1E6XM 5C2XA 2FHFA 4JYDA 3BLKA 4WXZA 3AJ7A 1DGGA 2XVPA 4XAFA 4JYFA 2OCZA 4N02A 3T1GA 4B5XA 2J4GA 1DIDA 5CC5A 1I60A 1UA3A 3C0QA 2LXEA 2I5IA 5DXYA 1H0IA 4HK7A 3MCOA 2PLKA 1O60A 3TSMA 4C6QA 2FVKA 2VR4A 5F1UA 2RGMA 2R1MA 2V63A 5I02A 3M7WA 2Y61A 2O9TA 4ROPA 3NUKA 3WEZA 5L6UA 3B8DA 2VQTA 4NOOB 1K7XA 3WLOA 3T42A 3LCWA 4YJ5A 5EFFA 1T8XA 3OW1A 3U8GA 2ISSA 3S5NA 2KNVA 1IZKA 1KFVA 3UXDA 4M1RA 5LIYX 3LHUA 3WNKA 4PCSA 4PL1A 1HTIA 4QGCA 3NOEA 1JPDX 2RFGA 4N9DA 4HBKA 4JXJA 4LU0A 1D8CA 2WKJA 4IX2A 3M1ZA 4ASTA 4YCPA 2NQLA 5C70A 5A2QS 1NWUA 2XPKA 1DWGM 1XMQM 3S2CA 1RLCL 1FWNA 1PTGA 4KMQA 2R1KA 3EOEA 3VMOA 3N4EA 4H9TA 2WO5A 3U2EA 1OCJA 4AZ6A 4MYAA 3KOXA 2PWDA 4YWIA 4DWSB 4F0MA 5HULA 5LYRA 3VDUA 5HA7A 3KVKA 3QXBA 3MWCA 4QOZC 1OYAA 3G3MA 1EP2A 5HQEA 4ZCWA 1W37A 3S9ZA 1ECEA 5C9ZA 4NXKA 4GMQA 1EBHA 4FLQA 1F4HA 4W5ZA 4O1BA 5CLTA 2ZA2A 3H54A 3GNRA 4G56A 3CUJA 1SZRA 1JQVA 3BVJA 1DL3A 2BP1A 2C71A 1RCXB 2R91A 4OZOA 1XLJA 3ZSTA 1JI2A 1SZNA 3H23A 2A7NA 3UEQA 3FUVA 1DV7A 3HU3A 2VFIA 1EO5A 3NPXA 5I3DA 3HO8A 1WA3A 3L4WA 4IJCA 3SFKA 4D8AA 4M9ZA 1E5NA 4R88A 3V3WA 1IN4A 3CL6A 2VOMA 1TA3B 2OMAA 1HJQA 2HRWA 1YYAA 4JN7A 3VKAA 1BSLA 1POJA 4MGKE 2J74A 3PTQA 2QUNA 4FIRA 2ZDSA 2DZBA 2DV0A 1GJPA 1PEZA 3UR8A 2Z2BA 5DFAA 2J6VA 2L09A 2ZBTA 5L9FA 3U6PA 4GXMA 3H4WA 4IOTA 5EGRA 1JFHA 1ICPA 3KOZA 5TNVA 5AN7A 3L65A 3W83A 3F7JA 8CGTA 3AYRA 3UVAA 1Q13A 1KD0A 5FTJA 3TIMA 3SRKA 3FK4A 1W54A 3AIEA 2MJ5B 1LP6A 5C7HA 4UQDA 1EUAA 3S0CA 1EOMA 4PMQA 3G1YA 4BA0A 4UC5A 2PU1A 1GZJA 1V0NA 2JGQA 3KBJA 3ARYA 1R3VA 5FF0A 2NUWA 3LSCA 1E94E 1FWDC 4L15A 1NFPA 5CCZA 4UNLA 1G67A 1C1KA 1TPC1 3L4UA 4AVNA 1TTIA 3IANA 3KS8A 3SAZA 1CYGA 1PYFA 4PSPA 1FOBA 2B3TA 3DFPA 3NWRA 4J3WA 2H3DA 3F2CA 5F3WA 4XUYA 4C6KA 4HNCA 3A13A 1KWGA 4TOQA 3RILA 1TFVA 1Q6OA 1XGDA 2UUAM 1H5VA 4ALDA 3GHUA 4MPKA 1JRCA 3VNKA 3MS8A 4DVOA 3BDKA 4LGMA 2E5LM 3EWCA 3JZEA 3UERA 1BSIA 4AXNA 2DSKA 4KEZA 3FKEA 5FKYA 3TSBA 4CGTA 2KAUC 4O1EA 2TYSA 1IT7A 5CZKA 5HQMA 3PXGA 1GVFA 4G1NA 1KRMA 3RF9A 4FF7A 4UQBA 4EX4A 1J18A 1W1ZA 1B3ZA 5A6JA 1HJWA 3ZS4A 3E5BA 1R47A 1GZ1A 4KT0F 1V3MA 4KW2A 4FPSA 3MUIA 3MUXA 2INFA 4YS1A 3AIVA 3W1XA 3N13A 5JBEA 3BQ6A 1L1ZA 2XH9A 1J5EM 3MW7A 2BVDA 5CSYA 3FTCA 2EKKA 4DUWA 4FWDA 1EZWA 3LU2A 5KMYA 3PF3A 3NXFA 3DUGA 3PR2A 5E93A 4NUWA 2ZUTA 5EP2A 3UW6A 1M7XA 4Z2IA 2OSWA 2OZ8A 2XFRA 5BW6A 2CV1A 3M4HA 4CU8A 4FXJA 3NQ8A 1VCGA 5K3VA 3IJQA 4WX2A 1QNRA 4PUDA 4PODA 3IGHX 2Y0FA 4HYWA 3FD9A 2KZSA 3A4WA 2G5GX 1FXQA 2PDMA 3CHCA 2XDFA 2UXCM 3JR5A 4C6NA 3E38A 4YL2A 1FHVA 2RDTA 1XINA 4B7FA 3M0JA 3UA4A 3IWPA 1R3QA 1JI1A 3TEVA 4F2LA 1PJIA 4ZODA 2ZRXA 5D8ZA 2WSCF 3T0TA 3VNDA 2P76A 3LN3A 8CATA 4AZCA 1M53A 2C0HA 4ZTYA 4RXFA 4XZBA 1AQ0A 4BS0A 2E5DA 2OPFA 4IHCA 1W5QA 4C6IA 5LHEA 5D02A 4LNCA 3KRBA 2EJSA 3RGSA 3ZR4A 3CZKA 3SIZA 3W1LA 1ZP4A 4LTSA 3MSYA 3MSGA 4CU7A 2KRKA 3EMCA 2ZZ2A 3IS4A 4LANA 4UR9A 1IR2A 3O7UA 2Z7GA 1WZLA 3VNLA 2PRLA 3HIJA 1FCQA 1H1ZA 3IJDA 2V9DA 4NU7A 3UG3A 3W0KA 4HPJA 5FL0A 3VIPA 1OF6A 4QEEA 4MWAB 2HK1A 4DAIA 3HU2A 1EIJA 2VFGA 3LTPA 2Y5JA 3V75A 5KZEA 3GYEA 3TKFA 3CPGA 2VRQA 1JDAA 3H7UA 4J4KA 1UD4A 4DUXA 3NURA 2OO6A 3N11A 3B8VA 3GIQA 3GP1A 4WCJA 3IIVA 3L4VA 1LQ0A 5FEZA 2Y88A 3GVVA 1NF7A 1W9UA 6XIAA 1ESWA 1V93A 3QBUA 1EXBA 1HKVA 3CHDA 1XBVA 1V0LA 3H21A 4V1XA 5RUBA 4O52A 3MYOA 3SCNA 4FHAA 5HOSA 1EH9A 3WD1A 3STGA 3UG5A 1RQHA 4YMZA 1F8MA 4NNAA 3CF2A 4JFSA 4K1GA 5DY2A 3MZ2A 3WLNA 1U30A 2VXNA 4DR2M 1S1PA 3AICA 4TO8A 1NOUA 4IIFA 4D2JA 4I5UA 1QTWA 3H2CA 4BF5A 1IXOA 4CUCA 1PGYA 3M46A 1GOMA 1UKOA 2GYIA 7ODCA 1SZGA 1B3OA 2AL1A 5AHEA 1E32A 2WOQA 3K30A 4P17A 4D8ZA 3GNOA 2CEAA 1QZEA 1TCMA 3NSNA 1IYXA 4JIPA 4FOUA 3L25A 2V5CA 5HXMA 2WMIB 1DORA 3WQDA 1HNZM 4NVTA 3M47A 5E09A 1N55A 4J27A 4FXRA 4GA8A 1FWTA 4IBBA 4RZ5A 3TU9A 3KL5A 3LEPA 4H6EA 1XLBA 3LD5A 2ZZ7A 4JTUA 1X98A 2CITA 1HNYA 3ERPA 4ZQOA 3VDCA 3B89A 4IBFA 2YOCA 4FK9A 2OODA 3VGDA 1GJUA 1CEOA 2J9YA 4EWJA 3KW6A 2OELA 1GJWA 3UWYA 2L6OA 4O19A 1QO2A 2FVLA 3TYEA 1VEJA 1KM6A 1DXIA 1R3YA 1PX8A 4GKLA 1FCUA 3TW7A 4FX6M 3M41A 3GG1A 4JDBA 2Y1HA 2PDYA 4WF7A 3WHLA 3HG4A 1VFOA 1XBZA 3P7YA 1YLAA 1ZB5A 4CCEA 2V68A 3P8JA 4EPKA 3UG4A 3JS3A 4ZTXA 1EP3A 4F8XA 1BGAA 2FPTA 3Q37A 3FIGA 4GISA 3WELA 4PTDA 4B2DD 3WD0A 4DHGA 2DWZB 2GJPA 3M9YA 3VA8A 3MBFA 1A5MC 2DQWA 4I9AA 5EL1A 3EDKA 4IMGA 4NSRA 5C2CA 4MTVA 1AD4A 4GIAA 5FEWA 4M3PA 2UY5A 3BJTA 1OKSA 3SYKA 3J80S 2YL9A 3O9NA 3THUA 1XDLA 1K3UA 1TPFA 4AZBA 5KZ6A 3L4YA 4L6DA 2V5DA 2Z2AA 4UXDA 1OX4A 3GKAA 2VDIA 3B9PA 3F1QA 1IR1A 4JV5M 3OVRA 5AYZA 1Z5BA 5D2WA 3V1HA 5K9CA 3ARRA 4JX6A 1SW3A 2Y7GA 1R0MA 4P8UA 3RG6A 2B4GA 4IX0A 3H7RA 3WQPA 1H41A 3ABZA 3GHSA 2EPHA 4IMDA 3AWNA 3I01M 1KBLA 1Y8BA 1ZJBA 3NR0A 4JIHA 1QHOA 1WXZA 5DCBA 3VD7A 3IVSA 3SN4A 2DAGA 4ZO7A 4BCEA 1GHRA 3WF0A 1VEMA 5KPRA 4GXWA 1PTDA 3VOJA 1Q7ZA 4QITA 1P4CA 2EEXA 5BWFA 2HCBA 2WM0A 2BNJA 4DWSA 4CQCA 4JS3A 1QDTA 4AX6A 4U3AA 3QTGA 1US2A 4AY8A 5HAOA 2LVQD 1FDZA 4OQVA 5BR8M 1JNDA 3T08A 4A3RA 5A8MA 2YX0A 4JTHA 2EA0A 3M44A 3TDFA 2CZVA 2DIKA 4K38A 3VYLA 4S3KA 3BTNA 4RZ4A 1YE9A 5I3FA 3ABQA 4DN1A 1G69A 3GSMA 3IK4A 2F2KA 5IFTA 5H8MA 3PZNA 3MK6A 3TVAA 2WC7A 3KOYE 4XBJA 3MTWA 3EA3A 4H19A 3U5UA 5EA9A 1VKFA 3W7PA 2YGYA 4RX0A 3GM8A 4QDPA 3FGCA 1E9SA 3W26A 1I94M 4JD4A 3NPUA 4IH3A 3AZRA 2PGRA 4PCNA 1CB7B 2ALRA 4P2VA 3PTDA 4EPDC 4GNJA 2CYGA 2BJVA 4O18A 3C4UA 4XD5A 5BWAA 1N82A 3ZJ6A 2YW3A 2OR2A 4QJ4B 3TTQA 3FKKA 4AZ7A 5JVLA 4QJ5B 4QM1A 4D82A 3LTYA 2XSZA 3DFTA 1X97A 3A22A 1XH0A 4M5PA 3K13A 2YXXA 4LWWA 5CLWA 1ZU8A 3FDKA 4MLRA 4S38A 3GHTA 1Q6RA 4R27A 2ISVA 2D24A 3AKZA 2JZ0A 1AA1B 1G6CA 1NM9A 3HZJA 3LENA 2FH0A 4AZIA 1DWFM 1TX2A 3NVDA 3KOYA 1DTNA 3PPGA 3W38A 4E2BA 2C6QA 4HD5A 4DR7M 3AIQA 4NT0A 1IWPA 2J9XA 3EOUA 3VVGA 3QZ6A 4B90A 3PNUA 1DJIA 2X2GA 1GVYA 2DJLA 1WBHA 3W0LB 3VUSA 3CS2A 3H53A 1P6WA 3CC1A 5F2MA 1BFNA 5DMNA 4Z2KA 1LLWA 1HUVA 2AQOA 4QLKA 2DZNB 2RJHA 1GPWA 4GBUA 4FNRA 1XLIA 4L9YA 4JKMA 4KFOA 4GY1A 4XVEA 3CUZA 3MQTA 1MQRA 3MKCA 4O0KA 5LGXA 3VD5A 1PV8A 3U5YA 3NDOA 3K9PA 1XR2A 3I04M 3H6OA 3S42A 3GRIA 1QNQA 4AKHA 3HWSA 3UWVA 1UUOA 1HJPA 1HP4A 1MEIA 1XQKA 1TMQA 4GX8A 1JCXA 4ZSUA 3HBLA 1GNXA 4KBXA 5C5YA 2YDQA 1B54A 1KBKA 1U1UA 1UR3M 4AB4A 2ZZ6A 3F5LA 5F2GA 1F5ZA 2OQYA 1US0A 4PUUA 3KVJA 2FOIC 3P84A 4ZQMA 1H6UA 5D9PA 3OPSA 3O6CA 4MB7A 1IZJA 4LOCA 1K9FA 4IPJA 3R2GA 4W5WA 1FHUA 1YIXA 4S2CA 4RUBA 1P1XA 1TMLA 3GG7A 2OJPA 4JTSA 1KCLA 4AKIA 2DH2A 1UWQA 3TNOA 3FEMA 3E2RA 4CNPA 2WMHA 1BG4A 3UBPC 1M7PA 2C13A 3B9NA 5D32A 3T0AA 1E0UA 3QW4B 3ZO9A 2PTZA 2D3NA 2Z24A 1GW1A 2XVGA 1TELA 3K8MA 3AHXA 3GTHA 2XSAA 4M82A 3NQ6A 4JI8M 5CG7A 4QSFA 1XICA 1DIKA 5BXSA 1ICSA 4MWAE 2ZA3A 1LRTA 2BMBA 2G95A 2YLLA 1PJJA 2FZDA 5I3HA 1G01A 3QYQA 3JVAA 1XM3A 2C3ZA 2ISFA 4JL2A 1VFSA 4D1JA 4FB7A 4WKFA 2NVAA 1IBKM 1JCNA 3WBYA 4WGXA 2VENA 3MPGA 2YPIA 4MH0E 4UUIA 2DSZA 1GYMA 2PDJA 3S1XA 3PUEA 3N12A 4NJJA 1B57A 1AJZA 4KRUA 2F6UA 1NY6A 2NQ5A 2ABAA 3AS1A 5CAKA 1B3WA 2Q8XA 3MMTA 2V6ZM 4TTUA 1KCXA 2XFTA 2Z28A 1J96A 3LZ5A 3F5JA 2WBKA 3TOYA 3FHAA 3TWMA 2ZFAA 3KW3A 3MANA 2XIMA 3KVMA 3RCYA 3VOHA 2YL5A 1K70A 4IJRA 4DLFA 2LHGA 4UZSA 4GVHA 2CKSA 1XYAA 4RNJA 3S2JA 2BY2A 3TX9A 1E71M 5DYIA 1QOXA 2PWEA 5CZJA 2VX4A 3GFXA 1E51A 3ARWA 3WEMA 3NZPA 2A1YA 3C61A 1ZBWA 3A3WA 3FV9A 1MO0A 3GAYA 3E5PA 1Z89A 4LJ5A 2Z1WA 2Y5EA 3P62A 3QH2A 2YBUA 3RO8A 3GNNA 1V02A 1KFCA 1UR8A 3LBOA 1XLLA 3HFYA 3ZM8A 2LWXA 1TH2A 1MW3A 1FCBA 1HT1E 4I3GA 4LGYA 2D73A 4AHPA 5DLCA 2E9MA 1MSSA 4NAFB 4X9YA 3URNA 4Y96A 4NX0A 4UFKA 1J2BA 4HT3A 4OTKA 2PTWA 3LCHA 1A3XA 3EEZA 3FA3A 3RGTA 2DT3A 2WMIA 4MY1A 2BXZA 3V36A 1HF6A 4M9SA 1R2YA 4PMYA 2YBTA 5GVJA 3CV6A 2G97A 1VJZA 1EJWC 1CGVA 3SMPA 1AJ2A 3Q67A 1FWJC 2OT1A 3OA5A 4GFSA 2YNMD 2VKZG 2R6FA 3PBYA 8XIAA 1CB2A 3CZLA 3MCNA 2BNKA 2DH3A 2CWBA 2NV2A 2WSKA 1KM3A 4IFRA 1Q63A 3NNTA 1VC4A 3S4TA 4EACA 3S5ZA 1DO0A 4XK2A 3A5FA 2PF0A 1ZMVA 3DHUA 2YXGA 3GVRA 4PMUA 3MMUA 3CQJA 4C65A 2WZEA 1DJYA 3W00A 5G4EA 3WF4A 4RKUF 3FN9A 1YBQA 4XIAA 1W31A 3E2QA 3MHVC 3U57A 1MZHA 4M6PA 1OQFA 2ZKMX 4FR6A 4GRIA 4AC1X 2F4VM 2X30A 5KSWA 3COTA 4K6AA 3MSRA 5FLXS 2HWJA 4FW9A 3W53A 2KDLA 2Z7JA 1Z5AA 3VK7A 3K2GA 3R8RA 4JTFA 3QQ1A 3SI9A 2OQLA 3L12A 4MJ2A 4KCWA 3B7ZA 1IIGA 2GQ8A 3SSJA 4A22A 4IL2A 2GPTA 4W86A 1A49A 2CBUA 2DENA 1AQHA 3KEHA 4KIRA 3J7AS 2UV8G 1QASA 2ZANA 4F0KA 1E6ZA 2G3NA 1IWAA 1KWKA 1E15A 1QHZA 4HIBA 4GVIA 5KTLA 1ITCA 2PLJA 1S39A 2WNZA 4GNKB 1E4NA 2WPBA 4ERAA 4LUSB 3CXOA 1DKWA 4E8DA 4J5NA 1QPRA 5KETA 1D3GA 1KNWA 2CKRA 3MO4A 4GKJM 4GI8A 1DIOA 5D30A 1P0EA 3F4VA 1NY1A 4H9XA 3GG8A 3UXIA 1AD1A 2VP8A 3B05A 3C3NA 3AMGA 2VD8A 1GVSA 1KLZA 2Z26A 3W7RA 1EOKA 1UC5A 4UBPC 1CLVA 1I8JA 4MJMA 4ES4A 3AHTA 3EKZA 4LUJA 3L2AA 1XXHE 3W2NA 4Y28F 4GHAA 1TIWA 3FUTA 2C1HA 4HZ8A 3GB6A 4DWDA 2HQAA 2XINA 1FWWA 4RV8A 3NQBA 1M04A 1TX0A 4B3TM 4PBEA 4BI5A 3N2XA 3NPWA 3CHVA 4WSHA 4X2RA 4KWVA 3BANA 4FNPA 1W5PA 4I5SA 3EB4A 3O2LA 1E9IA 2VWSA 2EPNA 4DWSC 4URIA 3ONBA 4MMWA 4CNSA 1RD5A 3KCLA 1A0EA 2EKCA 1XV8A 3AHYA 4CLMA 3GK0A 3GPUA 5EFDA 1NOWA 1K03A 4I8YA 3BLLA 3MC5A 1TDZA 1MRQA 2ZRUA 4ML9A 4U10A 1UH2A 3ZLHA 1CXHA 4M6UA 2WQPA 1XXHA 3SR7A 2X2YA 1XIGA 5A8NA 1EDQA 2FZ9A 2CLHA 4CD6A 3STPA 3ARQA 1E56A 3UPBA 4PMJA 1TB3A 1X7IA 3IUHA 1PL9A 4LYQA 1JYNA 2XYLA 4DV2M 3DG6A 5I09A 3VGFA 4GC3A 4O4WA 1TV2A 3ABSA 1G4PA 1ZL1A 5LMUM 3T6PA 4TV5A 2ZX7A 3V0UA 2CV2A 5DX7A 4EAYA 3N15A 1M68A 1EGZA 3R94A 4HNOA 3SAVA 1CGXA 2W9MA 2DSUA 1ZAJA 3VIHA 1O68A 2JK2A 1GKIA 4NL4H 1UWUA 1ZZMA 4PMOA 1KGXA 4NYYA 3CQHA 2W92A 1SO6A 3CT7A 2PRMA 5GPRA 5IZ7D 2QQ6A 4FSAA 1AMKA 1G0CA 2R9RA 5C18A 2F5PA 3QMTA 4HA1A 3ARXA 4MLJA 2ZYFA 3H2AA 5AYBA 2IUZA 1FWIC 3QJAA 2E9BA 3AIWA 3IAPA 1WKEA 1JL8A 4BEQA 4U28A 3BURA 3C2FA 2C15A 4B91A 1XUZA 1UP2A 4IGHA 1HP5A 4UTWA 2QYGA 2C19A 1PKMA 3N18A 2JKAA 3P60A 4D72A 3B04A 4GQRA 3PBVA 4NJGA 2NQ9A 2J6XA 1ZV1A 3QOMA 2YFQA 4REQB 4EPEC 3GLGB 2YSWA 3BW2A 3SY8A 5D9MA 1X8FA 4QQUA 2CBJA 5FJRA 1QNPA 2Y8KA 2R1PA 1JZ3A 3QHMA 4B4FA 5IRPA 2ON3A 5EP4A 1A0DA 1DIEA 1Y0EA 3MDWA 3B0PA 3NTYA 3RFWA 3K92A 2B0MA 2NXHA 3FA5A 3UZJA 1YUBA 5I2UA 4DUYM 2DW6A 5A6MA 5ABTA 2AGKA 3LGGA 3U5ZA 1L2BA 4MY9A 4S3AA 2IXUA 1V77A 3ZR5A 1F73A 3TJXA 3M0EA 3M6AA 5FF7A 4D6HA 2VF8A 2A3LA 4EIWA 3IIPA 5CJMA 3NQFA 1HXJA 1FWBC 4G9PA 4CIZA 1EF3A 4O28A 3UT0A 4JI3M 2AQWA 1GVIA 3SARA 1EC7A 1UC4A 4Y2WA 2CXEA 1IEXA 3VXGA 2F38A 1HVQA 7ENLA 3OIXA 3GRYA 4J3SA 1PJ9A 2F5QA 2YYTA 3NL6A 1LWHA 4DO6A 3DN5A 4AIUA 1U1JA 5FF4A 1V3IA 3HGIA 3AZTA 2YDRA 4JFUA 3SGZA 3VIIA 3IRSA 4C6CA 1FTXA 4RE4A 1T96A 1VS1A 4K36A 1FWAC 3TV8A 4P8WA 3CHEA 1CNVA 2Q71A 1EGMA 4B7GA 4HMDA 1R2SA 5A6BD 2YL6A 5F4WA 4LY6A 2I5QA 4G7FA 4K7VA 4UB9A 3HG5A 1OD8A 3ARPA 4HA4A 4MUPA 3RLHA 2B7QA 4IQJA 3UU0A 2FDSA 1EJ7L 2QCLA 3DDMA 4CNTA 3ITCA 1Q4NX 1W5MA 1BHGA 5DELA 3EX6A 1DE5A 1ZQ9A 3OLIA 1YSYA 1FWEC 4QHSA 3LM7A 3VOIA 3ZT6A 3NL2A 1HW6A 5DBTA 1F05A 2ZRYA 2OT0A 1ISXA 3VLFB 4LB3A 1O1HA 5AYYA 3ITGA 1LUCB 1J5TA 4JI5M 1W3KA 1THFD 3MHFA 5T9CE 4EPBC 3SO7A