1NVMA

Crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
340
structure length
340
Chain Sequence
TFNPSKKLYISDVTLRDGSHAIRHQYTLDDVRAIARALDKAKVDSIEVAHGDGLQGSSFNYGFGRHTDLEYIEAVAGEISHAQIATLLLPGIGSVHDLKNAYQAGARVVRVATHCTEADVSKQHIEYARNLGMDTVGFLMMSHMIPAEKLAEQGKLMESYGATCIYMADSGGAMSMNDIRDRMRAFKAVLKPETQVGMHAHHNLSLGVANSIVAVEEGCDRVDASLAGMGAGAGNAPLEVFIAVAERLGWNHGTDLYTLMDAADDIVRPLQDRPVRVDRETLGLGYAGVYSSFLRHAEIAAAKYNLKTLDILVELGHRRMVGGQEDMIVDVALDLLAAHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a bifunctional aldolase-dehydrogenase: Sequestering a reactive and volatile intermediate
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Lyase/oxidoreductase
molecule keywords 4-hydroxy-2-oxovalerate aldolase
total genus 130
structure length 340
sequence length 340
chains with identical sequence C, E, G
ec nomenclature ec 4.1.3.39: 4-hydroxy-2-oxovalerate aldolase.
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00682 HMGL-like HMGL-like
A PF07836 DmpG_comm DmpG-like communication domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1nvmA02
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 1nvmA01
3EX4A 4PCFA 5A5WA 3PBYA 1IQPA 4I7VA 1TPFA 1TTJA 1XBYA 4FEZA 5AC7A 2V2HA 1F7BA 1XC4A 3LCXA 2VEMA 1P0NA 3S1UA 2H3DA 4O17A 2QUTA 1MZHA 3G24A 4ZQCA 1VYRA 3P67A 1LZOA 2ZTJA 1KFLA 2C13A 1JUKA 3MI6A 1GVFA 3QW4B 3LXCA 4AWSA 1ALDA 2WPBA 2WV8A 3LBMA 4DPPA 3FYOA 3E96A 3O15A 1NAL1 4MFDA 3A24A 1JR1A 4EIWA 3GNNA 1OG0A 3THQA 4UCGA 3HBLA 1IXRC 3WHKA 1GVRA 3QSRA 4UTHA 4NU7A 2G95A 4M5PA 3EWYA 5ABTA 3TQKA 4UFMA 2YFNA 4M6PA 5FTKA 3CWOX 4S1FA 1TTPA 2C0AA 4ZQMA 1RQEA 3G3MA 4BWLC 3N73A 2Y7EA 5DCEA 2V2DA 2J24A 1JCMP 3VFLA 4AEOA 4J9JA 4Z0SA 3SFKA 2DHRA 4JDBA 4A21A 1W5SA 1SSGA 4O16A 1I2RA 3V75A 1JRBA 3W7QA 4AHQA 4BI6A 5FEZA 1O5XA 1RD5A 5E1QA 4GJ1A 3EX1A 2C14A 1DO0A 4K8EA 1AG1O 4AF0B 4XKYA 4AWUA 5D03A 4KODA 1QPNA 1JCNA 3ZWSA 3DXIA 3T44A 3MHGA 2QCEA 1TQXA 2DZWA 3PY2A 3KVLA 3NM3A 1OFDA 1PVNA 4JTJA 1IGSA 4FCWA 3AO0A 1TRDA 4UR7A 4IX0A 1JCXA 4GBUA 1J4EA 2YYTA 3EWBX 1JRCA 3M43A 2PC4A 3M9YA 4MPQA 5FEWA 4DO6A 3P60A 4MIMA 3LCLA 1SZFA 1R2SA 4OE7A 2ZZ1A 3W73A 4RR4A 3F1QA 1MSSA 1ZCOA 1ZALA 5CG7A 1VHNA 3MBFA 3GDLA 3A21A 4YCOA 3GXPA 3QQ1A 1FCQA 2R94A 1HO4A 4MYXA 3TSMA 1I2OA 3LBCA 4R7JA 3PS7A 1TPUA 4AF0A 1UASA 3G0SA 2QJHA 3SI9A 2ZRZA 1GG0A 5HWMA 1OK4A 4O1DA 4CQ8A 2A2IA 2FIQA 4GNJA 2ISSA 4KWVA 2ZZ4A 4GRSA 2NUWA 2QCDA 3PSWA 4E0CA 1IXOA 3FKKA 3BOSA 1WBHA 3DH7A 1KW1A 4DEFA 3NVTA 3E12A 4Q33A 3ABOA 1K7FA 3MUXA 1M5WA 2WNZA 3PG9A 2NV1A 3QPZA 2O7SA 4WX2A 1OX5A 1SXJD 5E93A 3NR0A 5FF2A 4RKAA 3STEA 3EX6A 5EA9A 4LJ6A 4NJGA 1Q3NA 3L0GA 4IPJA 3W2MA 1H62A 3NPVA 2LLEA 4LJ8A 3PG8A 4HSNA 1DOSA 4M19A 4HNUA 5D32A 2BXVA 2QBYB 4O50A 4KO8A 5L9FA 3C61A 4NJJA 3H4MA 3P74A 3TAKA 1U83A 5AYYA 1UM8A 3B05A 4JYEA 1I45A 3HG3A 3HMJG 3E02A 1A53A 1RPXA 3W84A 1NSFA 3WHLA 1NF0A 3R12A 3LDVA 5EYWA 4UMBA 4XBKA 1E94E 2AQWA 4QHSA 3TC7A 1DQXA 3RFAA 3QJAA 3G1DA 3UPBA 4QQ3A 2DWZB 4GC4A 1M7PA 3TA6A 2CLFA 3BW2A 1JQVA 4ORMA 3C4UA 1EWDA 3TR2A 2BWGA 4D80A 3W85A 2CE7A 4D2JA 5I3JA 4QITA 3W9ZA 1YADA 5DXYA 3USBA 3F4NA 4JTUA 1EB3A 1KM1A 1SZEA 4FX7A 3W1NA 3SC3A 1HQCA 3S5NA 1NEYA 3B06A 2PE4A 4X9SA 1KM3A 1H50A 2WSRA 4UFJA 4BWLA 4LV9A 4XBSA 3EIHA 3LV6A 1J5TA 2JKEA 1SPQA 3HGOA 1H60A 3P8IA 3S5ZA 2NV2A 3LI0A 3HU2A 4GUIA 2CZFA 2NLIA 4RZ5A 4N4PA 4RV8A 3N19B 3RF9A 2VC6A 1XBZA 3MHFA 4NJKA 3CTLA 4JTEA 1WOAA 2ABBA 3VKJA 4XZ9A 3M5ZA 4RXGA 4TO8A 1YDOA 1SXJE 4K6AA 3NPWA 3TJLA 2V8ZA 1HTIA 1SQ7A 4NZFA 1EA0A 1Q6LA 1VLWA 1NF7A 3CF2A 1VQTA 4MOZA 4CNNA 1FXQA 5HMSA 4DBEA 3FEMA 2X2GA 1U5JA 3TMLA 1TJPA 4GWEA 3S6DA 4DF2A 1M7OA 3HG5A 1KLYA 5C18A 1KFJA 1WV2A 1MEIA 1SUXA 1FWWA 3G1HA 1O4UA 1VYSX 3MP3A 2WNNA 3W7PA 1VC4A 2QF7A 3TH6A 5D09A 1I2NA 4UTWC 4C1LA 4WD0A 3V1PA 3HB9A 1H7XA 4FXSA 2CZEA 4UTIA 4P61A 3M5XA 4WY0B 4LVAA 3R5EA 2FQIA 1H7RA 1H7OA 3KFTA 4RZ4A 1TO3A 1VPXA 5D38A 4FIQA 1IF2A 4O54A 2X8AA 1W56A 1W5PA 4ADSA 3QW3A 3NL2A 3W74A 4H4IA 1F73A 4ADTA 5LSMA 1EX5A 3M6AA 3GXTA 2B4GA 1NY6A 1MEHA 2YW4A 3TQVA 3OA3A 4QNMA 5G2IA 2V81A 4JR5A 3U5ZB 1LRTA 1SO6A 1WA3A 1XUUA 2HS6A 4Z8XA 1HT1E 3CQ0A 3TQ0A 4Q32A 1AW5A 3SGZA 2E5DA 3NZRA 4WW0A 2OT0A 4WQ6A 2FLIA 2DZSA 2E5CA 3L66A 4O0KA 4UUIA 3KW6A 4HN4A 3QPYA 3S8HA 4RXFA 2QCHA 1RVGA 3P61A 4KFPA 4FNQA 1DKWA 1WBJA 3S1WA 1GPWA 4MLRA 4XWUA 1DBTA 5F1UA 1DO2A 3GLFB 3UWYA 4O4VA 4HNNA 3OVQA 5BMXA 3N9RA 5D33A 4JEQA 3EKZA 1QO5A 4FHAA 3S5OA 4JTFA 3OHIA 5U7SA 5CGQA 5I3GA 3KX6A 3VCRA 4BF9A 1EUNA 3UK6A 5J5DA 1VLIA 3TU9A 4M7TA 1ME7A 2WKJA 5DLCA 4UNLA 1KM4A 3LCFA 3UY8A 4E2BA 5EXTA 1XDLA 1Q6RA 3VLFB 1NVMA 2C15A 5F4WA 4IMFA 5H2ZA 5L6UA 4LCBA 2YXGA 3GXNA 4PL2A 4UXDA 4K39A 5IBXA 3PUEA 1LOQA 1QOPA 1XKYA 3B0PA 4MUZA 4LY6A 3GAKA 1GVOA 1ZY9A 5LNRA 3TJXA 2WO5A 1FDYA 1Z48A 1EIXA 1UCWA 2YFOA 2DVWB 1R46A 2XSZA 3PBUA 1H5YA 3MI3A 2PCQA 3IIXA 2A1YA 2PRHA 4CLMA 3NZ1A 3MYOA 4YXGA 3RMJA 3C3NA 4N02A 4O52A 3NQAA 3LOTA 4DF0A 3HWSA 4ADUA 1OFEA 3GR7A 4PTNA 1S3SA 3PF3A 5HUPA 1VYPX 4O18A 5CSRA 4YMZA 4N9BA 1OFPA 3F03K 3TXZA 4NZJA 4LS0A 2X1TA 1ZAIA 4N9CA 3L67A 3IVTA 1LLWA 3JRKA 4LUJA 1KFKA 1OFHA 2D73A 4JN6A 1KLZA 1KA9F 5EP3A 4D82A 3G8EA 3PB0A 1TPWA 1PCWA 3LLFA 1GTHA 2QUVA 4ZL1A 2QUUA 3DZ1A 2Q8LA 1UJPA 4AB4A 5LNVA 3W87A 1XM3A 4IMGA 5EXSA 3O16A 3OVRA 1QO2A 2C99A 1RZMA 1G4PA 1H63A 3LRLA 4YL2A 3A5VA 1EWEA 4LT9A 1EEPA 3GLIA 3GDTA 3W7LA 3W2LA 2FFCA 3TFCA 1NJFA 3W70A 4FXRA 1FXPA 5AHLA 3ZFHA 4LC8A 4NT0A 4CCCA 4UTUA 4E38A 3ZR4A 1CX9A 3LTPA 3W1RA 5EP1A 1SZGA 5KZDA 4A29A 1OX4A 4ML9A 1PE1A 7TIMA 2B7PA 2Z4SA 5C55A 3HO8A 3TNOA 3M7WA 5G4WA 4Z1DA 3G0XA 1SXJC 1VS1A 5LHFA 1H1ZA 3TSDA 2ZA2A 3EEGA 5FTLA 3ZWTA 2CZ5A 4MY8A 3VE7A 3SJ3A 1A5CA 3DFQA 3FYPA 2ZCGA 3TDFA 4LVGA 3LI1A 4UFLA 1QPQA 1N8FA 5D02A 1Z42A 3IGUA 2WJZA 1JJKA 3MBDA 3C8FA 3T4CA 3W86A 5DBUA 1YDNA 3FKRA 2BLEA 2J88A 1CW2A 2ZZ2A 3NQ8A 5I3KA 3W23A 3NOEA 3HGSA 2H8XA 1HG3A 4O15A 5KMYA 2YDAA 2QCFA 4QSHA 4PC8A 4BI7A 2DZPA 2XN2A 6ALDA 3JS3A 4LWWA 1SFLA 5LNWA 1TPC1 2A5HA 5D2WA 4FX8A 5DYIA 1TCDA 1L2UA 1QPOA 4JY9A 4Z1AA 3M44A 3C2RA 2W79A 2V9DA 3W7OA 1J2WA 3FLUA 4HNTA 4FWGA 1YXCA 5T26A 1TIMA 4IQLA 1KFCA 3B04A 2C3ZA 1SW7A 4Y8FA 4WY0A 4O1CA 1G4AE 2G97A 4QNWA 2GQ8A 3NM1A 1W0MA 1PHQA 4M6VA 1OFRA 5EXPA 2ZZ3A 3HIJA 3AJIB 1WX0A 4Y6GA 1F76A 1KTNA 1A5BA 1VR6A 2NWRA 1LRQA 4JTGA 4LGMA 4LU0A 1S5TA 4UTKA 4HHPA 1PHWA 1EP1A 2A7PA 1W5MA 5HR6A 3TV8A 5AN7A 3P62A 3PULA 2HMCA 3EXSA 2DZNB 2TMDA 4RJEA 3H53A 2Y62A 1FWSA 1XFBA 3I6RA 3R89A 4UFHA 3DU0A 5CKSA 2ZRXA 3W71A 3GZ3A 2QAFA 4DELA 4I7WA 2QCNA 3ANYA 5C1BA 3W07A 1GVQA 3STCA 1UB3A 5K2ZA 1SZNA 2TRSA 3L2IA 1V7YA 1AMKA 5TBOA 3LXAA 3C2OA 4OGZA 3UD6A 1TTQA 4K7VA 2BJWA 4PODA 2H90A 3BO9A 4CCDA 1DL3A 2Q8ZA 2C18A 1HO1A 5CPOA 1TYGA 1F2JA 1ICSA 2EGZA 4S2CA 1ZENA 2R91A 1G6CA 3IIVA 1T8XA 2PURA 5G2HA 2OCZA 1X37A 1HFBA 3PC0A 1O60A 3STGA 3EWXA 1XDMA 4JX5A 1VJIA 1KM0A 4FIRA 4LJ9A 1H51A 4TIMA 1AL8A 4HNVA 4FNSA 1OABA 1FCVA 3UY7A 3DBPA 2VFDA 1GWJA 3GDMA 4IGHA 4M6QA 4GUJA 1S5VA 1ICQA 4JX4A 1BEUA 3PUDA 4FWDA 4QNEA 3B9PA 2Z1BA 2GJNA 4KFOA 3KRUA 5K9CA 2QZ4A 3B8DA 2O7QA 2I14A 2YSWA 3IEBA 1K8YA 1SW0A 1M6JA 2Y7FA 3N9SA 3GLHA 2IQTA 2ZRWA 3W1PA 4UTLA 3NYZA 2VIIA 4LVBA 3TIMA 3CM4A 1K7EA 3CB8A 4MZ1A 3T55A 4A2SA 1TPDA 4LS2A 2E6FA 3NPXA 1E32A 3R13A 5A8GA 3G22A 1NSJA 4EWND 3O05A 5EP2A 4RX0A 3W7EA 3ZH9B 3IV3A 4YCPA 1T96A 1D3HA 3U61B 4RCXA 3L9CA 2NXGA 3WJZA 1B3OA 3UYCA 5C2XA 5D2TA 2CHVA 1QVRA 3IVSA 4A2RA 5CSSA 3GLGA 1SW3A 2VFIA 4FF7A 3W7NA 5LNUA 2VENA 1OX4B 3NA8A 4CNPA 3TW6A 5KINA 5AC6A 4BK9A 4LZZA 3GB6A 3LCGA 1I8JA 2A7RA 4ZZ9A 1KM5A 3QYQA 4I4LA 1AW2A 3DFNA 1THFD 5FF7A 1W5TA 3FJ6A 4AHOA 3EXTA 5FEPA 3W7HA 1FWNA 4HPJA 2Z4RA 2J9ZA 3BGJA 4LNYA 4MKNA 5HJLA 5D37A 4NXKA 4B5NA 1A5AA 3UPWA 5CZSA 2DU2A 5CZTA 1IXPA 4K36A 1ICPA 2ISWA 2CLKA 2ZAOA 2ZBTA 2H8ZA 1LV7A 1B9BA 4R34A 2I1OA 1DJNA 4WXZA 2A6NA 2CHQA 3SR7A 3C56A 2VOMA 3QH2A 2PRMA 3O06A 5F4SA 4WUIA 3SSJA 3LLDA 3SYLA 1JULA 2ZANA 2AAMA 3WK3A 2FPVA 4O0ZA 3CEUA 4AVFA 3N34A 3E9AA 3GYEA 1F5ZA 3OBKA 1VH7A 2GOUA 4AHPA 1CI1A 1QOQA 1SSDA 2GVLA 1IY1A 3RK8A 1YTDA 1G7UA 3FA5A 2DJLA 3E0IA 2YCEA 3CIWA 3CPRA 3THAA 3UZ5A 2HS8A 4L15A 3FS2A 3UZJA 2P10A 5LZLA 3WJSA 1H7WA 1G41A 5AYZA 1B4EA 2BJVA 5SWUA 3M41A 2VEPA 4JYDA 3W83A 1WOBA 2R65A 2Y61A 1W8SA 3GVGA 1GYLA 4BI5A 4O19A 4JTIA 4JDYA 2Y7GA 3DENA 4UFKA 1YXDA 5CPLA 3KVJA 3CF0A 4MJZA 3LERA 4Z1BA 2ZAMA 1L6WA 4IMDA 4K37A 4A22A 3WK0A 3ATYA 1EPXA 3F4WA 5AHFA 1VGAA 3CWNA 1UUOA 3PVFA 5IBXC 4P2VA 2ZQ0A 4EOUA 4UMCA 1O5KA 4N4QA 1LBMA 4N9DA 1VZWA 3HU1A 1Q45A 5CPMA 5D05A 3IRDA 4IXXA 1DHPA 3LV5A 2PRLA 3BG5A 2FTPA 2V30A 3R8FA 5AYXA 1RR2A 2F7FA 3LX9A 3U8GA 1VHCA 1D2NA 1QNVA 2ATMA 2NWSA 1G7VA 2Z6IA 5DYGA 3ELFA 2EPHA 1OF8A 3AJXA 3EWZA 5K4ZA 4QAIA 4I9AA 1GEQA 5FF0A 3W1XA 4L4UA 3RLVA 3B4UA 1TPVA 1JQXA 1OYAA 3P8JA 3HU3A 2WSQA 3B0VC 4O28A 2P0OA 1AL7A 2J6XA 3NQ6A 3W75A 3KDSE 5AHMA 1X8FA 2EAWA 1Z41A 1ZNNA 3EXRA 4NVTA 5CPNA 3BVJA 3NGJA 1OFIA 2V2CA 4JICA 2YGYA 5K9XA 2QCCA 3PUOA 2ZRYA 1MO0A 3A22A 2FDSA 2ZZ7A 3NAVA 3NQGA 3NPUA 3QMSA 5AHIA 2FPTA 3O8AA 2EF9A 2YYUA 4Z0JA 2E68A 2JGYA 2QP9X 2G5WA 1ADOA 1KFBA 2GQ9A 5EL1A 1FCBA 1IXQA 2BX7A 3DFOA 3STFA 3W1QA 4OV4A 4S2BA 3W7GA 5K3VA 4MY9A 3TK7A 1IN4A 1YPIA 3IIOA 5FI8A 3U60B 2X1UA 2A21A 1K3UA 1W54A 3EWUA 4RZ6A 3W76A 1JR3D 2TSYA 3M0EA 3YPIA 1OFAA 2XFWA 3QM3A 2E6YA 2YZRA 5K9DA 1SXJA 3GKFA 3LTYA 3I7SA 5DCDA 2FNAA 3UWVA 3S1XA 3UWUA 1QDSA 2GQAA 4TMBA 1OFBA 5FEXA 4A3VB 1H7PA 3TSBA 3W1AA 1R2RA 4Y9AA 1FQ0A 1ZAJA 4ZQPA 4LOCA 5DCBA 4IPIA 4O1AA 1VRDA 5FTNA 3NQEA 4L4LA 4Y96A 4CQAA 5DY3A 1XCFA 4UTJA 4HKPA 4O1BA 3NQCA 1K02A 1TB3A 4FNTA 2OMAA 2DP3A 1UUMA 4WOQA 3LHYA 1I4NA 2GUUA 3M6YA 3H54A 1L9WA 4DO4A 3HG2A 3I68A 2V5BA 4O13A 1N7KA 1D9EA 3I65A 2RFGA 1IXSB 2NXIA 3U6WA 1SFJA 2H3BA 4N6FA 3HGRA 1S3HA 3QF0A 4ZMGA 1L8QA 4N6EA 2WNQA 2NX1A 3BV4A 4KWWA 1JUEA 4FCTA 1WYIA 5BNKA 1SO4A 4NXSA 4BR1A 1SO3A 2RDUA 3S0CA 3L5MA 2C16A 1TPB1 4PH6A 4IJBA 3T7VA 4E2DA 2ZZ5A 3G8RA 5D2YA 2OJPA 1R2TA 2RH9A 3G1XA 1DORA 3LHUA 3S42A 5D04C 3BG9A 4ORIA 1BWLA 2C1HA 1KBIA 4YLWA 1OFQA 5CZ0A 3BPWA 2VEIA 3Q37A 5F4XA 5DBTA 3GLFA 3PR2A 3W1LA 3NO5A 3MHVC 4QHTA 2V5LA 3HPXA 3PBWA 4ZQRA 1DV7A 3A9IA 4QNRA 2X30A 3W88A 3TKFA 2Y63A 4NX0A 3M47A 3BARA 1W5OA 2E77A 2QJIA 3EIEA 3W72A 2GJLA 1DJQA 4UTMA 3VE9A 5JI2E 1GJPA 3K1JA 5DY2A 3N14A 3TXVA 3MJYA 3LHZA 1PS9A 1G4SA 1S5WA 3C2EA 1BTMA 4LRTA 4ALDA 5HWNA 4JTLA 1R30A 5KITA 4O10A 3Q58A 3L68A 4MFEA 1TQJA 2ZFAA 2ZDRA 2E6DA 2WSYA 5F1VA 5HINA 3NQVA 1YXYA 4TMCA 5BOOA 1XXXA 2DZTA 3GDKA 2Y88A 1TSIA 3CT7A 3EKLA 1A5SA 2FPYA 5D30A 4GFSA 4LVFA 2F84A 3VI2A 4DQWA 2XSZD 3CIXA 5EKYA 2RKOA 4O8RA 1FWTA 2C19A 3CU2A 4LW7A 3EB2A 2CFFA 1L6SA 4WZHA 1G67A 1L6YA 3LHTA 3C2FA 4IMCA 3FJLA 3RU6A 6TIMA 1IXNA 1OK6A 3DKJA 5H91A 2OZ0A 4MLJA 1YTEA 2HCBA 1LBLA 2CW6A 3LHVA 4EVZA 2A6LA 1J7KA 5HWJA 5I3HA 2JK2A 3S5YA 4IXHA 2C9OA 3SIZA 3SGUA 1AK5A 5LGXA 5F2GA 1TRIA 1LP6A 1NJGA 1QPRA 2B0MA 3B03A 2C96A 1LORA 3SY5A 1IY0A 5AHNA 2C6QA 4JIPA 2Q3OA 4EF9A 1FDJA 4FB7A 3DGRA 3HG4A 1SXJB 3PWAA 4JGDA 3TC6A 2DZOB 2QDHA 3G0UA 1X1OA 3LRMA 4CQ9A 3O63A 3C2VA 2DZUA 3VNDA 1W5QA 4KFNA 3FIGA 3W7RA 5HUOA 1TJRA 1W3IA 4LC6A 3UNDA 5AHEA 2AGKA 3N3MA 2FB2A 1V5XA 3DI0A 4ZVJA 1MEWA 2J27A 1NY5A 2CHGA 5G2WA 1GVSA 1GQNA 2KRKA 3G3DA 4X22A 1XXHB 2DZXA 2OT1A 3HJZA 4L16A 3TAOA 1VCFA 3NG3A 3L65A 1LM1A 1SR9A 3NXFA 3IGSA 1GG1A 3TMQA 3GLHB 1PL9A 3DI1A 3OVPA 3R2GA 2NX3A 2HSAA 3B0UX 1YTKA 5FF4A 2YX0A 4LS1A 3JR2A 2ZA1A 2G96A 3EX3A 3O6CA 3T78A 3CEPA 5F2LA 3NEVA 3DHFA 4OT7A 4WXYA 3W22A 3W7MA 4CCEA 3O6YX 2E5BA 4UC5A 1GT8A 2C9CA 1ZFJA 4O14A 4PL1A 3QC3A 1D3GA 3MWAA 4JYFA 1C8VA 3W2KA 5D2VA 2DORA 3LTSA 4X3ZA 1G4TA 1WXJA 5FESA 4FNRA 3UWQA 1IXZA 3OG3A 3SYKA 1PV8A 3WK2A 4NQ1A 4UFIA 1JR3A 5BMWA 4WJEA 2GVGA 2W6RA 2CLOA 3QZEA 1P5BA 3D0CA 3K30A 1ME8A 5D2XA 2X1SA 3W2NA 3FOKA 3GR8A 3M0ZA 4ONVA 5TQLA 4Z1CA 1GTEA 4MJMA 5U4NA 3GIYA 3W2JA 5KZEA 4OQVA 2WOQA 2JBMA 3G1VA 3W7DA 1G4EA 4A3UA 2XN0A 3I7QA 1P0KA 2CLHA 4IWWA 4ZQOA 1OHLA 1IN7A 3NQMA 1IIHA 1YPFA 2DZVA 3W7JA 5EQTA 3G18A 3TE9A 2BZNA 4O12A 1T0OA 3TROA 2V82A 2ATSA 2QKFA 3BLEA 4ZPXA 1YDVA 1TPEA 1YYAA 4UNKA 3EX2A 4JTKA 4CNOA 2CLIA 1C29A 3P5YA 3KVMA 4JTHA 4ZQNA 4UIOA 1XL9A 3HOJA 4PEKA 1K8ZA 1C1KA 1R7RA 2CLMA 1OVDA 4N9EA 1GZGA 3KXQA 2E6AA 3NDOA 2NUXA 4EIVA 3GNDA 3MHUA 4JY8A 3SECA 1H61A 3L5AA 5AOUA 5TIMA 4GUHA 2VXNA 3KOFA 3P7YA 4MYAA 1PIIA 1R47A 1K03A 1BKSA 2QCMA 3W7CA 3SW6A 1ZHAA 1LCOA 1QCWA 4LJ7A 5C54A 2H6RA 4FNPA 2GPTA 1W37A 4H6KA 2BTMA 4O11A 1F74A 3BGGA 3LM7A 1KM6A 5EBUA 1C9DA 1PCKA 3DZDA 3W2UA 1LBFA 1VCGA 3U2OA 3GDRA 2ZRUA 2EKCA 5KTLA 5C6MA 1FY6A 4K38A 3NL5A 1KFEA 5LNSA 5HR7A 1TTIA 1QR7A 2E09A 1KSFX 3OIXA 3W7IA 3BG3A 3TUUA 3UXDA 1RQHA 5EXXA 2V1UA 1LDCA 4MZ8A 1W31A 4LV4A 3DAQA 1ZJIA 2B7NA 2VFGA 2JKAA 4QJ1A 4TR9A 2ZTKA 4IUOA 2B7QA 4XQ6A 1FX6A 2TPSA 5LGZA 3TFXA 3IVUA 1W1ZA 5G1TA 3L21A 4LJAA 5DXXA 4HIBA 3NQ2A 3W1UA 3QRHA 2WQPA 8TIMA 4ICNA 3CLMA 3O07A 4C1KA 2ZA3A 1FUYA 1P4CA 4DF1A 3KHJA 4X2RA 4UTTA 3NL6A 5C5YA 2CEAA 1NFBA 2VKZG 1JCLA 1T99A 3GLCA 4QOSA 4MY1A 3O6DA 4NNAA 1X7FA 2QAPA 2B7OA 3Q2DA 4Y90A 3C0JA 3UQNA 3W3OA 1TMHA 3HQ1A 3QFEA 4GUGA 3KVKA 4AH7A 2FJKA 5DELA 1F6KA 2Y70A 4O57A 1OF6A 5BW6A 4K8HA 3QMTA 4I81A 3M16A 3L0KA 3WJXA 1O95A 3R8RA 2CLEA 3ABQA 2FB3A 2YPIA 2ZYFA 4DPQA 2R14A 3WJYA 4KKXA 3E49A 4JTSA 2X1RA 3GX9A 3MYPA 5FTMA 2E1DA 4FW9A 1XI3A 4HPXA 3WK1A 3BLFA 1LRNA 2VFFA 3PXGA 3ATZA 1WAUA 5F2IA 3LCWA 3WFAA 1SU5A 1QZMA 3RLUA 4AAJA 5KZMA 4O4WA 2OX1A 3NQ7A 4NJHA 1IN6A 3LB0A 4IX2A 2Q3RA 1R6BX 1HL2A 1KV5A 5AC8A 2QCLA 3M5VA 3MO7A 3NNTA 4AWTA 1FNNA 1H1YA 2Y6ZA 3DFSA 1B57A 2CLLA 4LJ5A 3PM6A 1W3TA 1G69A 4W9TA 3TW7A 4D81A 2A0NA 3PSVA 3C52A 4O53A 2CWNA 2RDWA 3KRZA 5EY5A 1WQ5A 1IY2A 2V6ZM 3BW4A 2RKXA 3LCIA 4DXVA 2QBYA 1B4KA 2QDGA 1K7XA 2QJGA 4JNMA 4JS3A 3WJWA 5JI3E 1KV8A 1EP3A 3QEZA 2C98A 1I2PA 2XN1A 1TREA 3HF3A 5KSWA 1TV7A 2QEZA 1TV8A 3DHDA 4UR8A 1F05A 3HPZA 3ABSA 4LVDA 5G4EA 4BFAA 4UTTC 2J9YA 2NX9A 3ZS4A 4PA8A 1I2QA 1IN8A 3GAYA 4G1KA 1FDZA 3IGXA 1OYBA 4LY8A 1HQYE 1O94A 3T40A 4RLIA 5EP4A 4Q4KA 3G1YA 2A4AA 4UTWA 2ZRVA 2QENA 4OV9A 3SZ8A 3MP4A 5G1YA 5EPDA 4OBTA 3H55A 4R33A 1KBJA 2ZZ6A 2HTMA 1Q6OA 3IIPA 4GE8A 1LLZA 4LTSA 3CC1A 4JX6A 1IN5A 1DVJA 3BW3A 4XTIA 3P81A 1EP2A 2ALDA 2NUYA 1LROA 2Z0IA 3QMRA 3HPSA 1FBAA 3G1AA 3CHVA 5I3IA 5MHBA 2A85A 1UBSA 2VFHA 1OFOA 1KM2A 1F6PA 3GKAA 3INPA 2VELA 2Y89A 3NQDA 2Y7DA 4MZYA 2NZLA 3N2MA 4GUFA 4JD4A 4I7UA 3EWWA 3W6YA 1LTDA 2W0UA 4IMEA 5FF3A 3W1MA 1ME9A 3G1SA 1SO5A 1XUZA 5BRBA 1OJLA 1LYXA 3MMTA 3PVSA 3ABRA 4JIQA 3S9YA 1W3NA 4QM1A 4LUIA 1QMLA 1JCJA 3S1VA 2QR6A 3GLIB 2CU0A 4DBDA 4XUGA 4GITA 1W5NA 2UV8G 4LJ4A 4JTTA 5K7JA 1JQJC 3HGJA 1XWIA 2GVJA 4FD2A 2EHHA 2QCGA 2Y85A 1BWKA 1OX6A 3DFPA 3Q94A 4OU1A 4JXCA 3KRSA 3RNDA 3NL3A 4GXMA 1GYNA 2I9EA 2Z6JA 2JKPA 4NUWA 1RQBA 5HULA 4QISA 1FWRA 4OWGA 4H3DA 3N2XA 1JUBA 4FWHA 4XTDA 3LGEA 4Z08A 2NXHA 3UXAA 1QFEA 2VEKA 3W7KA 2YR1A 1XBXA 4POCA 3NQFA 1OYCA 3O1NA 4NJIA 3MI2A 2QCDB 1WDWA 5FTJA 3UWWA 5G5IA 3QSTA 3TX9A 3PFIA 3P84A 1KYIA 4OHQA 4N2YA 5IM51 4L4MA 1ZAHA 1ML1A 4FO4A 3KAOA 5AB3A 5J5RA 3LXBA 1DQWA 4NNCA 1GOXA 1KTBA 1OJXA 3A5FA 3TCEA 1H7NA 2DJXA 4EF8A 4LRSA 1KTCA 1Y0EA 1X6UA 1X1ZA 2TYSA 4M7SA 1MXSA 3LRKA 4TX9A 3LCHA 4U4MA 1ONRA 2BSLA 1JCYA 4KLNA 1N55A 2J9XA 4QIUA 2Z2UA 4DO5A 1QWGA 2R62A 4TU1A 3I7RA 1VCVA 5F2MA 1AW1A 2KZHA 2A7NA 3FFSA 1RV8A 2RDTA 3P82A 2ABAA 4FCVA 1JVNA 2VFEA 1E51A 1TV5A 3P80A 5HQEA 3PBVA 2V0TA 1G3IA 4HT3A 3PAJA 1FCUA 5I3FA 1LOSA 4UMAA 3MP5A 1EUAA 4MVAA 4XKYB 2YW3A 1QAPA 2RHGA 2ISVA 1TPH1 3M5YA 4U28A 4K7YA 5GVJA 1HT2E 4IOTA 3L0NA 5LHEA 3C6CA 1Z44A 3A23A 3UWZA 3QQ0A 5DN1A 4AXKA 3G1FA 4FNUA 5K4XA 3L5LA 2P1FA 1IIGA 2CZDA 1XXHA 5AFDA 3DKLA 4HSOA 1K8XA 5HNRA 1IM2A 3VFDA 1P1XA 4R53A 4RK8A 3W1TA 3P5ZA 2X16A 3LHWA 2R8WA 3MW7A 2JGQA 3IIZA 3M1ZA 1XBVA 4WY0F 3DFTA 5EMUA 1HUVA 5CZJA 3GLGB 3OEXA 3PB2A 4AMAA 4PFMA 3GK0A 5LKYA 4FX6M 2QPAA 5E0KA 1A50A 3BLIA 1LOLA 4WOZA 1YLVA 4NNBA 4NX5A 4YWIA 3BK0A 1Q6QA 3D8BA
chains in the Genus database with same CATH superfamily
3PBYA 1IQPA 1KGWA 4IPNB 4Q6XA 2V2HA 4DIAA 1F7BA 1GORA 1RP8A 3E5BA 1S2WA 2H3DA 4KEUA 3GXFA 1QI4A 1MZHA 1Z3NA 3P67A 1LZOA 3AMLA 2ZTJA 2D0FA 5ITQA 1E3ZA 1JUKA 1ZRQA 3LXCA 3B40A 5DQPA 2XH2A 1CB7B 2E4TA 4IBKA 4Q8PA 1NAL1 1QK0A 1JR1A 1LQ0A 3FY1A 4UCGA 4CQCA 3H12A 4NZCA 4NU7A 3BXWA 4ZA0A 3EWYA 2PSNA 5TF0A 4US5A 4AD5A 1JCTA 5FTKA 3CWOX 4S1FA 1HGYA 3IG8A 3EPMA 1BKHA 2IPWA 1KXHA 4FF5A 1D7KA 3MDUA 4BWLC 1C7YA 3N73A 3Q8XA 4HZ6A 5DCEA 3K4DA 3KM8A 4JDBA 2W5FA 1W5SA 1SSGA 4B7FA 3RGPA 3PZUA 3WBWA 1JRBA 1ZLPA 3W7QA 1XP3A 1O5XA 1RD5A 3E3HA 5AC5A 3KOWE 4AF0B 2G3FA 5D03A 4KODA 1XLAA 1FP9A 5JBDA 4IBIA 3DXIA 3KSXA 9CGTA 2BFGA 3GTHA 3QKZA 4AWEA 1AVAA 2QCEA 3NZQA 4V27A 3KVLA 1VIWA 1GOQA 5HATA 1TRDA 2OZ8A 4WEVX 3FUUA 3I4KA 2FZMA 2PDCA 3D6NA 3OYXA 3QZ6A 3EWBX 4YVPA 3DOAA 3VTRA 1JZ6A 5E26A 4KEVA 1TWSA 2AL2B 4RR4A 4CNTA 5D9MA 3WNKA 4EXAA 3MBFA 1OC5A 4GQQA 2I5QA 3GXPA 3QQ1A 4JN8A 4GIYA 3B9DA 2I56A 1TPUA 3T0DA 2QJHA 1L0PA 3UF9A 3WMLA 2ZRZA 4EANA 1OK4A 3ZC7B 3OTRA 3WQ8A 1MZRA 4YY3M 4KWVA 3BJFA 2ZZ4A 2FZ9A 4GRSA 3L4WA 4ZB5A 4DJFC 1DIEA 3PSWA 1DJGA 4JFVA 4E0CA 3FKKA 2K0BX 1WBHA 3DH7A 1F3EA 3L4UA 5CAKA 3E12A 3WQEA 3I4VA 1DHKA 5I24A 3GH7A 1M03A 2V3EA 2WNZA 3NSXA 3HJEA 4S39A 2HBXA 3PWIA 3MZNA 3UR5A 3BCFA 3GQYA 4NJGA 3J7HA 4REZA 1H62A 1OSEA 3MQTA 4G5DA 4WIWA 5D32A 2VJXA 2F5NA 2QBYB 2A5YB 1QBAA 4TXEA 1CCWB 2AAAA 1ELSA 3C61A 4NJJA 2X0YA 1UQYA 1LQ2A 3P74A 3W0LB 2GQ3A 3HG3A 1PYFA 1JYXA 1NSFA 3WHLA 3QPEA 4WDTA 2C7FA 2VMFA 2F2HA 3LDVA 2JXNA 3NGFA 2AQWA 1W2PA 3SMPA 1M1BA 2ODOA 1AJZA 4HMCA 3UPBA 4QQ3A 4PD2A 2XFSA 1FVPA 3PAOA 4DUOA 4UB9A 1PBGA 3GLFE 1LG2A 3C4UA 4D80A 3ZVHA 3B0XA 1WXYA 1P43A 3W9ZA 3USBA 3F4NA 4H2CA 1KM1A 3S5SA 2PTXA 3W1NA 3T38A 3SC3A 5EMMA 1G0CA 3B06A 1Z32X 2VGFA 1QVBA 1BTCA 4KBXA 2NQ9A 1KM3A 1H50A 2WSRA 2WBKA 3RE8A 4LV9A 3L29A 3ZVHB 4JTRA 3EIHA 3M0VA 2EJAA 1ZP4A 3I4YA 2FH8A 1V02E 2ESCA 3L2LA 3WSUA 1O5QA 2JY7A 2NLIA 4YVXA 1GVNA 3HA1A 3VKJA 4XZ9A 3M5ZA 3ITCA 4JCMA 4RXGA 2R1PA 1YDOA 4LF7M 3SM0A 3GG8A 3NPWA 5KZ6A 3CBWA 3T15A 3MKCA 1Q6LA 1VLWA 1YE4A 4MOZA 1QQWA 5HMSA 4DBEA 3FEMA 2X2GA 1U5JA 3KP1E 3VMNA 3S6DA 1QK2A 1FWWA 3MP3A 3GM8A 2QF7A 1M9HA 2OODA 3ZT5A 3HB9A 4A8IA 4UTIA 3KDOA 4WY0B 4LVAA 5D9PA 3VDUA 2KA6B 1H7OA 1JZ4A 4RZ4A 4G2DA 1E4NA 5FLXS 2AOSA 1DYSA 2XH7A 2GNOA 1IF2A 4MMWA 1ZAEA 5FJPA 3LMZA 1EJWC 5AVHA 5M03A 5B7YA 1NY6A 3QTPA 3MY9A 3TQVA 3OA3A 1JD7A 2D2HA 2V81A 5G2IA 1IR1A 1S3TC 3SCUA 1V3KA 1WA3A 2HS6A 3CQ0A 3W68A 1AW5A 1KBBA 4Q8MA 4WW0A 2OT0A 4WP2A 4B5XA 1Z69A 2E5CA 2GGIA 3L66A 4O0KA 3KW6A 3TONA 3QPYA 1S2UA 4GHRA 3F5LA 4HTYA 1OD8A 4IF2A 4AY1A 5TAOA 3S1WA 4MLRA 1JNEA 1QHZA 1TF0B 3QR0A 1N75A 3NO3A 4RPQA 4NOOB 5D33A 4GMEA 4EK7A 3EKZA 3RRAA 1P0EA 1V6TA 3S5OA 5I3GA 3DN5A 1CGYA 1UR3M 5J5DA 1YLAA 3WFZA 1TH2A 4AUBA 1MNSA 3AIUA 1KM4A 3UY8A 1Q6RA 1AD4A 5C8BB 2PDMA 2YL5A 5F4WA 3EMZA 1DXIA 2YXGA 4WDWA 3GXNA 4RDYA 5BU9A 1XPYA 3MSRA 1V92A 1UA7A 2O9RA 4NL1A 4LY6A 1GVOA 1ZY9A 3TJXA 3AL0C 2A79A 3VOCA 2PCEA 3ECQA 2DVWB 1JD9A 3SRDA 4C1NB 3IARA 1WZLA 3UA3A 3BLKA 3CWHA 2A1YA 2PRHA 3W4RA 3A98B 1XLKA 2VGIA 2QGHA 3HJSA 3WUBA 1ISWA 4M0WA 1PX4A 4E4PA 1VDLA 3PF3A 3WQOA 4KT0F 3MJMA 1RBAA 1XPGA 4PCNA 1HKWA 2GYIA 3F03K 2XDFA 3WQWA 1V0LA 1XR2A 3IVTA 4LUJA 1ZMUA 3KZPA 1KLZA 3FXGA 1N34M 1PCWA 2VQTA 4PUEA 5LIUX 4GMQA 3DZ1A 2VZTA 4C65A 4RNFA 3KBSA 1JIBA 1V3IA 2UY3A 5LNVA 3W87A 1XM3A 1E6ZA 1DXFA 3OVRA 1UKPA 3B8VA 1RZMA 3KP0A 1FJGM 1GK8A 4MGIE 5HOSA 3W2LA 5AHLA 2YL6A 3ZR4A 4D9PA 2CEQA 3PZIA 1OX4A 4ML9A 3CUJA 2Z4SA 5C55A 3R8GA 3GP1A 4Z1DA 4JXJA 2B81A 4ZR8A 1SXJC 4CN6A 5XINA 1H1ZA 3TSDA 2ZA2A 4QCEA 3PNUA 4L5ZA 3L4ZA 1XIFA 3VE7A 1K82A 2D20A 1FA2A 1J6OA 2BOEX 1GLNA 2HL7A 2ZCGA 1WKYA 3F5KA 3WLMA 4CJ6A 5AC4A 1XG4A 4W89A 3GLGE 1FH8A 4E5TA 2VO5A 1R5LA 1KGXA 3VK7A 5D02A 5ABFB 1HNZM 1UZ4A 3VOIA 1KBLA 1JJKA 3W86A 4AZHA 1Q13A 1YDNA 3FKRA 2BLEA 2J88A 1KCZA 3NQ8A 1RSCA 5I3KA 2DI0A 1X97A 1HG3A 1GYMA 3PZ9A 4OKDA 4O15A 2KNAA 4F2BA 3ARXA 4QSHA 1ENUA 3SATA 2XN2A 2K9DA 4LWWA 2PFHA 3WBAA 1W1YA 5D2WA 3O6AA 4NSRA 1V6VA 1TCDA 3EYPA 4QG9A 1KRCC 5FAJA 1N78A 1XCWA 3KVWA 2BWEA 3C2RA 3M44A 4YU1A 3U60A 1UPMB 4ZTYA 4AEFA 1J2WA 1ZV1A 3FLUA 4ZOCA 2OQHA 2XPKA 4HNTA 3FKEA 3N04A 4IQLA 2WHMA 1TE1A 4Y8FA 3TLQA 4WY0A 3VAVA 3M0LA 5CLWA 3LNPA 3GRUA 2GQ8A 1ONWA 1PHQA 1TCMA 4H6EA 3NYDA 1NU5A 1F76A 7CGTA 2NWRA 2BHUA 4LU0A 3WLJA 1LWHA 2NVDA 4HHPA 4R5EA 2Z00A 5AN7A 4B9YA 3PULA 5A1AA 4DV0M 3SAWA 4GABA 1X8CA 2CZVA 3H53A 5C71A 2BXZA 3R89A 4UFHA 3A4XA 4UQ9A 3ZCBB 1PTDA 5A94A 1UW9A 3SCRA 2J7BA 2PEVA 2QAFA 3HURA 3SCQA 4EACA 1UC4A 4I7WA 2ZIDA 4QOZC 3ANYA 2RGHA 5A2QS 1SZNA 3GPXA 2TRSA 4DR5M 3T1YM 3UD6A 4OFCA 3BMXA 1F2JA 1ICSA 1I0BA 1AQFA 2X1IA 1KWKA 2D7EA 3UGJA 1G6CA 9RUBA 3IIVA 2FHFA 1X37A 4LFBM 1D0MA 3GSMA 3WBYA 1P7TA 2D0HA 1BFNA 1VG5A 1XDMA 2VWSA 3KOXA 4TIMA 3CUGA 2W27A 1FCVA 1XLFA 4S3DA 1GWJA 3GDMA 4IGHA 3U5UA 3JAMS 3QC0A 1S5VA 4PUWA 4P7RA 4QNEA 3B9PA 5CC6A 2FGBA 3AIWA 2QZ4A 1EDQA 1VBHA 3DA1A 1K8YA 2R82A 4US5D 3Q4DA 1DTUA 2IQTA 3A45A 3W1PA 5C2GA 4UTLA 3NYZA 2IXUA 4GKTA 2R1NA 1R87A 1TPDA 2RJHA 3NPXA 4FR1A 3WDRA 3KHDA 1E4LA 1MQPA 4YCPA 2KX9A 3DYPA 3EDJA 1EZ2A 3E6EA 3DYOA 1GNXA 1TWWA 2W4XA 3WJZA 4H8UA 3ZLFA 1EJRC 3U3HA 1I94M 4LJ3A 4Q4RA 1A3XA 2VENA 3FUWA 4HA4A 1OX4B 4E3VA 1WDSA 4LZZA 3OZPA 3COTA 1V0NA 4G6ZA 5FF7A 2GK1A 4XISA 3W7HA 4M56A 2E25A 5IWAM 4UN2B 4FVMA 4MKNA 5HJLA 4YN5A 4LUSB 5CZSA 3UBPC 1IXPA 4K36A 4GKLA 3O7UA 2DAEA 1S2TA 2GDVA 1IWPA 2UUAM 4WXZA 4IIHA 3B8SA 1Q5MA 2JA2A 3O06A 1A3HA 2L09A 4G4QA 2FGLA 5KEZA 2XSBA 3WK3A 2JE8A 4KHPM 3CZLA 4AVFA 1EF3A 3LGGA 4PMXA 3OBKA 4R3DA 4EPKA 4AHPA 1CI1A 3GH5A 3QHNA 3V0TA 4ZTXA 2GVLA 1GO5A 3E0IA 1TJ2A 3CIWA 2HS8A 3FS2A 3M7SA 3AC0A 3BOFA 2DAMA 5SWUA 1GVEA 4AD2A 2QZRA 2J77A 3L12A 2EPLX 5GJPA 3GRYA 7A3HA 2VC5A 3W83A 2Y61A 1Q6DA 3J7AS 3GVGA 4MB4A 2BV9A 1RLCL 4O19A 2VC9A 5B80A 1L8NA 4JTIA 2XFYA 4JDYA 1LUCA 3J81S 1NDWA 3DENA 2AL2A 2FHBA 5EBAA 4DVOA 1NNUC 3JZUA 2YIHA 2DAKA 3BANA 3AV0A 4Z1BA 3BLLA 2GFTA 3TOPA 2Q02A 3WK0A 1V51A 3GU2A 1UUOA 3PVFA 4RNAA 5IBXC 4AZ7A 3IJ7A 2MNRA 1LBMA 3QV6A 4RNJA 1VZWA 1BRLA 2YL9A 2PRLA 2WJFA 3PNYA 3BG5A 1KQYA 2V30A 1D0LA 4HHLA 3N1AA 1T40A 3GQ5A 1SMDA 4DLMA 3UVAA 5DYGA 3ELFA 1QBBA 3OVGA 4N42A 1YDYA 4BA0A 5FF0A 2W67A 3RLVA 4GH3A 3GHSA 3B4UA 3GPUA 2J8FA 4MJ4A 2PTWA 1EQCA 3DC8A 3HU3A 3P8JA 3B0VC 1XLBA 4U31A 2J6XA 2MUCA 3WQ5A 1ZNNA 1A4MA 1MQRA 3H4XA 5IXEA 2YGYA 3OW1A 5K9XA 2QCCA 1VKFA 4PBEA 1RCOB 3M0MA 2ZZ7A 3NAVA 4FOKA 3WEOA 4EE9A 3QMSA 2YYUA 4Z0JA 1XLEA 1K6AA 4CGYB 2E68A 3E9SA 3GRVA 3GBEA 1K9TA 2QP9X 3SN4A 1ADOA 4PGLA 1KFBA 2GQ9A 1UZHA 4AZBA 1IXQA 1EGMA 3NXLA 3SCTA 3W1QA 4S2BA 4GVHA 3EB3A 3HQNA 5FI8A 3J7BA 2X1UA 2A21A 4O1EA 2G8LA 3EWUA 2X09A 2GQFA 4RZ6A 3SAUA 2HWGA 4XK2A 4BQ3A 4G1NA 2XFWA 2E6YA 5K9DA 4IT1A 4XAYA 4HMEA 3GKFA 4X60A 4UQAA 3AXIA 1U1UA 2OO0A 1S2VA 3S1XA 2GQAA 4GI4A 1RHCA 1X96A 1H0IA 1N2VA 4F66A 3QZAA 3E0WA 1R2RA 3ITLA 4Q22A 4H9VA 3NWRA 2YQZA 5DY3A 4MNJA 5RUBA 4HKPA 2DW6A 5HPCA 4V2XA 1IV8A 2GUUA 3H54A 1VPYA 1BVSA 5FSEC 2VDGA 1D9EA 4FAMA 2RFGA 1IXSB 4IQJA 4XD6A 1SFJA 2H3BA 4N6FA 2ISDA 3QF0A 4F40A 2XSAA 1L8QA 2WNQA 1E0VA 2NX1A 1WYIA 4XZNX 3VILA 2VOTA 4BR1A 2RDUA 1XF0A 5BU6A 2HNEA 3S0CA 2WHLA 3M0HA 4C1NA 3CT2A 1TUXA 4CVWA 2C16A 1TWZA 1TPB1 1J0YA 3U6OA 1J2BA 4L6OA 1JPDX 4D6GA 1AJ2A 4UZUA 4ZXLA 5ITUA 5D2YA 3T07A 3ALFA 3G1XA 1DORA 3WLRA 6REQA 5KPZA 4ORIA 3FTDA 3SDOA 3WG6A 1OFQA 3C86A 4W87A 5F4XA 2PMQA 3PR2A 5T91A 1B3YA 3MHVC 1VBRA 4QHTA 1XJBA 3FGCA 3HV8A 3HN3A 5A2BA 2ADAA 4ZQRA 3QYSA 3AS3A 4QJ3B 4NG3A 2X30A 3ARPA 3N11A 3M47A 3TC3A 3SASA 2E77A 3W72A 3EIEA 3J27B 4LGYA 4XVEA 1DJQA 4GY7A 3RM8A 4AG6A 5CC3A 3F7JA 3N14A 4NAFB 3E2SA 1UKOA 1PS9A 1S5WA 3K8ZA 3N18A 1OAIA 2R0IA 4MH0E 3ABXA 2Z3XA 4JQ2A 3Q58A 4AG5A 1JDCA 1MUMA 4JOMA 3KOZA 4QDWA 3H4GA 2E6DA 5HINA 1GQLA 3K46A 4KWSA 1TMQA 4Q8OA 1XXXA 3L4TA 2Y88A 3CT7A 1VFTA 1J0ZA 3EKLA 2FPYA 3RPDA 3VI2A 1LUCB 4DQWA 5EKYA 2C19A 3FYYA 4A8LA 3IUIA 1G67A 1L6YA 2BXYA 3FJLA 4L6DA 6TIMA 1IXNA 1EFUB 1N82A 2E40A 4B16A 2OZ0A 4MLJA 3Q67A 2CW6A 2CKSA 3CB3A 4AVOA 3LHVA 4EVZA 1E9RA 1Q65A 4HVXA 3DG3A 2WMGA 5F2GA 1KR1A 1TRIA 2XIIA 3KP0E 1BF2A 3GHUA 4ZO8A 4REQB 2KNZA 4P8XA 4ES4A 3B03A 1LORA 4D71A 4ZEPA 1P1MA 2YOCA 9XIAA 4GZJA 4F0SA 3SY8A 2XZFA 1BAGA 2HAKA 3TC6A 2OX4A 1AQHA 2J7DA 4LYQA 2DZUA 1V3LA 3FIGA 2A3CA 1TJRA 5EMYA 3UNDA 2R1KA 4NXNM 3PK7A 2ASHA 3HX3A 2FB2A 3WL0A 4Q8TA 4US6A 4CN1A 2CP8A 1AZ2A 4AD1A 4M9SA 2HWJA 4DJDA 2XGNA 1Z5BA 5CC5A 2OT1A 3TWMA 3NG3A 4GJIA 2SFPA 4BJHA 3P0WA 4H9TA 2JWSA 2OWXA 1DE5A 4ZB0A 3WDPP 1PL9A 3T8LA 4E4FA 4LCSA 2NX3A 4LS1A 2J62A 2QV5A 4GI9A 2YB4A 4PE8A 5F2LA 1R7OA 4GO9A 4OT7A 3O6YX 4UC5A 1GT8A 4XVDA 3TNBA 1I0DA 3R0UA 3H2EA 3MWAA 4B7HA 3U0HA 4U3AA 4AC7C 3M7GA 3GNXA 3NTYA 5D2VA 3WENA 4F1IA 4LF1A 5CSYA 3HHXA 1G4TA 4J7RA 3CAQA 2R44A 1PO9A 1E9YB 4PCTA 3VVGA 4NQ1A 3AMGA 5BWFA 2GVGA 2CYGA 5I03A 2XM2A 5D2XA 3WH9A 2X1SA 3W2NA 1DWGM 4M51A 2WVSA 3GR8A 2BHYA 3IGHX 4AU0A 3GIYA 3QVQA 2BNJA 2WOQA 1XSJA 3G1VA 3W7DA 2PGRA 4D8AA 1IIHA 4YYFA 2X0HA 1T0OA 1WIVA 2V82A 1GKIA 2QKFA 5D9OA 4ZPXA 2HV5A 5CZKA 1FWGC 4UNKA 3EX2A 2J8GA 3L4YA 1CXEA 1RK6A 1GEHA 3P5YA 4J2MA 2XZUA 2D0GA 2YA0A 2KXEA 2DH3A 3K13A 1W1IE 1C1KA 3TYDA 2YCLA 1E6XM 2ICSA 3KXQA 4X61A 3CO4A 3GNDA 4MAZA 4JY8A 4KRUA 2WNWA 4JHOA 2VXNA 1OINA 1DEDA 4I5UA 4DV7M 3RG6A 1IBLM 1PIIA 3KWSA 5C2CA 1R47A 3W7CA 4DX3A 3SW6A 3WLPA 2PGWA 5C9ZA 1LCOA 1OBAA 3VK8A 4LJ7A 2OEMA 2GPTA 1W37A 2BTMA 1K9FA 3URBA 1OC7A 3BGGA 1C9DA 1PCKA 3KCJA 5IFTA 4AKIA 2EEXA 2KAUC 5A8MA 4B2DA 3PZNA 3GDRA 2ZRUA 1FY6A 4IH3A 4K38A 3EWDA 1KFEA 4ZO6A 3MSGA 4GY1A 1QR7A 1KSFX 3UXDA 4M8UA 5EXXA 4HYWA 1ZGDA 2GSEA 1DJXA 2G3NA 2PDBA 2OEJA 4QJ1A 2ZTKA 4DBWA 1AA1B 2BY3A 5H37D 1OKSA 1E9IA 1W1VA 1BXNA 5G1TA 3M0KA 3NQ2A 5F3WA 3IJLA 8TIMA 3U4FA 2VT0A 3AOEC 3CLMA 2DIKA 1A49A 1FUYA 3K1GA 4X2RA 5DNYA 4IPLA 1PZ2A 3SN0A 2VKZG 1EJUC 3AHTA 2F5SA 2VP8A 4NNAA 3GE7A 2QAPA 2B7OA 2CXEA 4Y90A 2XWEA 4M1BA 4LG2A 4ROQA 4HPHA 4GUGA 3KVKA 4AH7A 1L6GA 2HNHA 4Q8WA 1WUFA 4I81A 1QU4A 1M68A 3L0KA 5REQB 1O95A 2C8NA 3QGVA 5BRPA 2M60A 3LYEA 2YPIA 2ZYFA 4DPQA 4RF1A 2F6XA 2X1RA 2FVKA 4HPXA 1Q2RA 5J8LA 3WLSA 3BLFA 4JHMA 2NT1A 1IGWA 3PXGA 5F2IA 2X4AA 1E9SA 4HU4A 1GPFA 3WFAA 1QZMA 4O4WA 3NQ7A 1C90A 2ZM6M 2PDFA 3OBEA 5FJUA 3H7UA 4NSBA 4PMNA 1DGFA 5AC8A 2QCLA 3NNTA 4AWTA 4L4OA 2CLLA 2FZDA 2IMRA 4W9TA 3TW7A 2CWNA 2RDWA 3CYVA 1IY2A 3IJDA 2V6ZM 3BW4A 4ICCX 4S3GA 2G5GX 4EP8C 3SUUA 4FMVA 3GUGA 2P8CA 2QDGA 4JNMA 4JS3A 1QNRA 3AU2A 1QZEA 2XEPA 3QEZA 5BWAA 1TREA 1IBMM 2G0WA 3NZGA 2QEZA 5KQDA 1F05A 3ABSA 4UTTC 4XZBA 2ACUA 3N6HA 4XK8F 2BY0A 1I2QA 4C91A 2O9OA 3GAYA 1ISXA 3VGEA 1FDZA 2WM1A 1O94A 1JYVA 4U3CA 5EP4A 2CERA 1XYMA 3G1YA 3I04M 2A4AA 2WYSA 1NM9A 3NIYA 1V3JA 2VZVA 3H2NA 4OBTA 1MXGA 3LNMA 1F4HA 4LBUA 2HROA 4JX6A 1IN5A 3BW3A 4XTIA 4C6FA 1WHCA 3CO8A 1VPQA 4B3RM 1LROA 2Z0IA 2O25A 2JY6B 3G1AA 2Q8XA 1K1DA 1UBSA 4MB7A 1KM2A 1A47A 3LD5A 3INPA 2VELA 3ZQ9A 3VD7A 4MZYA 2NZLA 4F9DA 5FKYA 3L27A 4BCEA 1OIMA 4PTXA 4I7UA 1XLJA 2DSUA 3W6YA 1XG3A 3W1MA 5IHRA 3G1SA 1LYXA 1W3NA 2VDHA 4IZGA 1FHUA 1MDRA 4XUGA 1WZAA 5T9BG 4NRSA 4LJ4A 3HPAA 3APYA 2J4GA 5CXPA 3AISA 3L2AA 1L1ZA 2UWFA 2GVJA 1UH4A 2KW0A 2Y85A 1BWKA 4M82A 4S23A 4BZYA 4KEZA 4OU1A 1XQKA 4GXMA 5XIAA 3AYTA 1KC7A 2XSXA 4LALA 3UYIA 1X39A 3B4YA 4LF4M 1AODA 4QISA 1FWRA 3KS5A 1VJSA 3N2XA 1XDJA 4CGTA 4DR6M 2E9LA 3CIVA 4K3ZA 1WDWA 5BXPA 4IBBA 3PFIA 1KYIA 4OHQA 3ZLGA 4L4MA 1ZAHA 1NDVA 4XZLX 3PN8A 1NOWA 5FCZA 3TN4A 4E4UA 3N2CA 2I7NA 3GC4A 1H7NA 3FAWA 4ATLA 4LAZA 4M7SA 3WLIA 3ES8A 1M04A 4NAEA 1FHDA 3GYCA 2TAAA 4PMRA 1ONRA 1N55A 3FHQA 2VR2A 3G2GA 2A3AA 3TTQA 2PWDA 4TU1A 3I7RA 1VCVA 4B5WA 2A7NA 2OGYA 1RV8A 4PUJA 2WBGA 4D6JA 1GW9A 3GTFA 2ABAA 1SJAA 4Q8UA 4YWSA 3ZJ6A 4PUNA 4RE2A 4UCFA 1CIUA 1R3WA 2PLKA 3J80S 1FCUA 3WLHA 4A8NA 3LUTA 1KXVA 4B3ZA 3LPOA 3A23A 3UWZA 4AXKA 1ZJBA 4QJ5B 4Y9PA 2VEFA 3NSNA 3V0UA 1C9WA 1XXHA 3DKLA 3V3WA 3VFDA 3W27A 4XZHA 3P5ZA 2X16A 5KETA 2R8WA 2UY4A 1REQB 3MW7A 2I57A 3M1ZA 2JALA 3IACA 4HPGA 2RUSA 3SFZA 2FZBA 3SCSA 4AMAA 1YSYA 1R0MA 5LIWX 1A50A 1L2BA 1C93A 4XAGA 3ALGA 3WYZA 3QGAC 5A5WA 4J1OA 1DV0A 1HL8A 4IIFA 1B5TA 4F0MA 4FEZA 3JR5A 1XC4A 3RHGA 3MDWA 2O56A 3KE0A 2J47A 2VNCA 4RDZA 5A95A 2OFJA 2WWCA 3QW4B 4MG4A 5FA5A 4AWSA 1ALDA 2WPBA 3KBJA 4AD3A 3QR3A 3LBMA 1JZ7A 3DBNA 4IJFA 3QLDA 2WJEA 3O15A 2P5TA 1QW7A 3VIFA 1NFPA 3GPPA 4N7QA 3WHKA 1GVRA 2PLJA 2Z4GA 4WGXA 1NWUA 2WQDA 4G4OA 4M6PA 2O55A 4C7DA 2NQLA 2VR5A 2D7HA 1W3LA 2YBUA 1TE6A 2NW0A 2C0AA 3HZ3A 4NRWA 1MUCA 1IT8A 4QS6A 1T3TA 2V2DA 1J12A 2WB5A 2PU0A 3MK6A 1F9CA 1OCJA 1XCXA 2WCAA 4Z0SA 3V5FA 2DHRA 4A6GA 1VIZA 2PU1A 1B3XA 2VUYA 3V75A 2WCGA 4BI6A 1KGUA 3BAIA 5FEZA 5E1QA 2C14A 1DO0A 4HYVA 3W38A 3GTXA 4IIDA 3ZWSA 2L2DA 1T7LA 5DFAA 1TQXA 3ILKA 2WZIA 3E46A 3R8HA 2R1LA 2GUYA 4IIWA 1DWJM 4FCWA 4R71A 4GBUA 1YQ2A 2XIMA 3ES7A 1Q4NX 4GYJA 4JL2A 1XRTA 4PSPA 1EA9C 4H2HA 4IJRA 2LVOC 4DO6A 5A8NA 3PJTA 3P60A 3N4FA 3KEHA 3CL6A 3LCLA 4ITQA 2CETA 1UR1A 1R2SA 4EAMA 5CH9A 2JEQA 3W73A 1JNDA 1ZALA 4F2UA 4UOZA 3FD9A 3MVIA 3GDLA 3A21A 4YCOA 2ZC1A 3VM5A 2JF6A 3VKKA 8XIAA 3G0SA 4BKNA 1LWJA 2HDJA 3VNKA 4HMNA 1L2DA 4O1DA 3RGSA 4LYRA 4CQ8A 1LWIA 2A3HA 3GUWA 2XVKA 4HMDA 4PT5A 1HJQA 4WKFA 1K7FA 3KL0A 1QXLA 3MUXA 4IHCA 1M5WA 4AY8A 3A4JA 3QPZA 3T2PA 1OX5A 3PZMA 4Q7NA 5FF2A 4XIMA 4LX4A 5GNXA 2WC7A 2KHHA 3EX6A 3UG4A 5EA9A 1Q3NA 1CXIA 4IPJA 4OVXA 3NPVA 3PG8A 3L23A 2LWXA 4HSNA 2XG9A 4JIIX 3SQLA 4M19A 4DR2M 1W9BM 1TV3A 3AMDA 3USZA 1JXKA 3QOMA 5HJXA 1R3SA 4DV3M 2PGFA 3QV7A 1BQCA 2ZADA 3T42A 4H83A 1UM8A 3FSUA 1I45A 4JQAA 4HCLA 4P5UA 4W88A 3W84A 4JIHA 4TTUA 1UJQA 1PJ9A 4XBKA 1E94E 3TC7A 3RCNA 4NL4H 4X66M 2FMNA 1Q02A 4EXBA 3DDMA 2DWZB 1UC5A 3BGAA 1G1YA 4V1YA 3HKPA 4QFUA 3BW2A 1JQVA 1DTNA 4P7NA 4QITA 3O3RA 5CGTA 1YADA 5DXYA 4DI8A 4JTUA 3QY8A 1GVIA 4INFA 2RDXA 5DO8A 3K4WA 1GOWA 4XBSA 1KFWA 1I60A 2EKKA 1SPQA 2W62A 3LZ5A 4XBOA 2WMIB 3S5ZA 4GUIA 1XWYA 2CZFA 4RZ5A 1J18A 2HZGA 3N19B 3RF9A 2VHLA 4NJKA 3GD6A 2GK1B 4JTEA 1WOAA 2UBPC 2EBNA 4TO8A 3GHRA 5BCAA 3D5HA 1XLMA 3GC2A 1SXJE 3TJLA 3VUSA 1NF7A 1H09A 1UD6A 1FXQA 1UR4A 4CQBA 3K1DA 1HXJA 2EKGA 1M7OA 3S9ZA 1V6WA 1WV2A 1V0KA 1WE5A 3PHAA 3G1HA 4PBGA 4JTQA 3KOXE 5LXXA 2MGWA 4JI7M 4M29A 4UTWC 4FS9A 2VX6A 3UT0A 4WD0A 4C1LA 2PP0A 4FXSA 1Q8JA 1UA3A 4WCJA 3R5EA 3TW9A 6XIMA 2FQIA 5TNVA 1H7RA 4WSHA 4WDXA 3IANA 5C7VA 1BSIA 1QASA 1NWRA 1J0JA 5D38A 4FIQA 3GTIA 4ADSA 4S3JA 3QW3A 3S2MA 4Z2JA 3NL2A 1PEZA 1XYAA 2IS7A 1VFLA 3VOGA 5LSMA 1EX5A 3ZSSA 4XZWA 3P0XA 2GWGA 4ROPA 4A3QA 1J0IA 1GONA 1XUUA 1LRTA 3FX4A 3TQ0A 3NZRA 2ZICA 4F0HA 1UD5A 3PPCA 4MGHA 1LQAA 3S8HA 1UWTA 3I6EA 1EXPA 1BSLA 5HQLA 5CEWA 1B1YA 4B3LA 5F1UA 1QHOA 3GLFB 4O4VA 1YUBA 3A9BA 1TZ9A 4MNLA 1I6NA 2WSFF 3JR4A 2NVCA 3OVQA 4DRSA 4JEQA 2I9UA 1A5UA 2ZXAA 1XHGA 4GHAA 1QO5A 3L4XA 2E9BA 3HJQA 3OHIA 4S12A 4MKVA 1BHGA 3VCRA 1X98A 2OSXA 3B0YA 3OG2A 3IECA 4LH8A 1XRFA 5I07A 1VLIA 1RCXB 3I01M 3CYJA 5LIYX 4UNLA 3LCFA 4IMFA 5H2ZA 3A13A 4NZ3A 5L6UA 4LCBA 5A6BA 1OWQA 1G59A 4FA3A 4GG9A 1UR8A 4K39A 1LOQA 1QOPA 1ZMVA 3QYEA 1OY0A 2OKTA 3B97A 2J7HA 4YHEA 4ZSTA 3FUTA 3GAKA 1GL6A 5LNRA 1Q3BA 1Z48A 1EIXA 4GJJA 2BY1A 1QYRA 2YFOA 1R46A 3CZKA 3MI3A 2PCQA 3OTOM 1EJTC 4OUIA 1PUDA 3NZ1A 3VABA 1OIZA 3A12A 3ITVA 1E0XA 2DKLA 3RMJA 3C3NA 3NQAA 4ADUA 1K3XA 1XD1A 4H9YA 1H0GA 2VCBA 4YTTA 4CISA 1S3SA 1IEVA 4AIUA 1JGMA 3LS9A 4GC9A 3SARA 4O18A 4YMZA 3N2OA 5MF5A 1OFPA 1RXOB 3TXZA 1ZAIA 4N9CA 4WVXA 1YNPA 4GYPA 1FKWA 2P76A 5F7UA 3UJFA 3E0LA 1KFKA 3ITOA 4AVNA 4JN6A 4G3OA 1KA9F 1ITQA 3PB0A 2W91A 2VRQA 4QHRA 3PNVA 4C6MA 4QSFA 3ENLA 4J4KA 3WUFA 2PWFA 5CQ1A 3WUEA 4HA0A 4OW0A 5H8UA 1QW8A 4IMGA 5EXSA 4H9MA 1ZBKA 4BQ2A 5LMUM 1QO2A 2C99A 1QPKA 3A5VA 1EWEA 1T8QA 2HK1A 3HZJA 3GLIA 1F3XA 3WQGA 3L4VA 4IBDA 1QUSA 1NJFA 4FXRA 2VX4A 4CCCA 4QQUA 4UTUA 3BZGA 1LLOA 4CD5A 3LTPA 3W1RA 2XUCA 5EP1A 4GC5A 1SZGA 5LA1A 3E74A 2B7PA 3UG3A 3EOEA 1QI5A 3HO8A 3TNOA 2DIEA 3KXEC 5G4WA 3G0XA 3IWPA 1OIPA 2EO2A 4HN8A 2QDDA 3KL3A 1Z59A 1Q6GA 3PTDA 3LPGA 3ZWTA 4RNIA 1TV2A 1BVZA 1Z6KA 3TYZA 4F0KA 3VKHA 1PX3A 3LI1A 2Y2WA 1RD6A 4UFLA 2LTUA 1N8FA 2Z8YM 3LA4A 2I7GA 5A6TC 3T6CA 3KTSA 1CXKA 1Z42A 5I3DA 3T4CA 2V5KA 4PB3A 2G50A 4URIA 3SQSA 3T1HM 4EAYA 3EGJA 2DUXA 3GVRA 4PTDA 1DGBA 1NFGA 3W23A 2D2OA 2VX7A 3HGSA 3NOEA 3DGBA 3S83A 1X7IA 1E0UA 2QCFA 4PC8A 2XISA 3JS3A 3BZJA 3XIMA 1A0EA 1NIUA 4MTVA 1KXQA 2PTZA 4BBAA 3T05A 2G97A 1A0CA 3MO4A 2E8ZA 4GD0A 2Y8KA 4F2TA 5ECVA 4GIAA 3B89A 3IK4A 2HVNA 4AD0A 5EXPA 3HIJA 1NDZA 4KGJA 4B2DD 1IWAA 1UP2A 4Y6GA 1KTNA 1CUKA 1VR6A 1E72M 1LRQA 4JTGA 2RJGA 1OQYA 3FTFA 1BPLB 3ZQJA 3SGGA 2A7PA 1W5MA 3WDHA 1CWYA 1WKDA 5HNUA 1R9YA 2EPMX 3I4EA 2BY2A 2R6FA 2Y62A 3DU0A 2ZRXA 3GZ3A 4AISA 2AGTA 3VZZA 2ZX8A 5C1BA 1C7TA 4TVCA 1GVQA 4QROA 3STCA 1R6WA 3CUXA 5K2ZA 3QHOA 3H23A 5JIPA 1Z6TA 2QMKA 1BXCA 4AIEA 4KRZA 4OGZA 1TTQA 4K7VA 4PODA 2H90A 3BO9A 4CCDA 2Q8ZA 2C18A 4LCRA 1QHPA 2C71A 1B31A 2XIOA 3BAJA 4S2CA 1EJVC 3A6OA 3GTNA 1W9VA 1QAQA 4OVZA 3DUGA 3VDGA 1T8XA 2PURA 3HGIA 5G2HA 3UR7A 4IG2A 3N2TA 3WO8A 3VIGA 4DBUA 4FIRA 4LJ9A 1H51A 3H7VA 1UBPC 1OABA 3UY7A 5ABFA 4H9XA 3DBPA 4D6FA 1DJYA 2JNHA 1OT2A 4PMQA 4GUJA 4GZ7A 4XBJA 1BEUA 1N8IA 4DUXA 3PUDA 4FWDA 3PBGA 2VQFM 4HJWA 3UJSA 3EAUA 1UOZA 1X1NA 2O7QA 4G56A 2X41A 2POZA 1Q7ZA 4PTMA 2Y7FA 3C2YA 1NARA 3GLHA 2OLSA 2GSJA 3UU0A 4LVBA 1DWAM 4MZ1A 1K7EA 3VDAA 4LS2A 1EKOA 1E32A 5T9CE 3R13A 1FHVA 5A8GA 4NI8A 2NV9A 4EWND 5EP2A 4RX0A 4HYRA 4KWUA 3L9CA 2NXGA 1J0HA 1UOKA 5C2XA 5D2TA 1QVRA 2DZBA 3GLGA 1D8WA 1E9LA 1SW3A 2VFIA 4IGSA 5LNUA 1A80A 3NA8A 4K1GA 1SVDA 4GIRA 4CNPA 1JI1A 3MU7A 4BK9A 5AC6A 1VAHA 3LG3A 4DR3M 1I8JA 2P88A 2DWMA 1QT1A 1KM5A 5DF0A 1GOIA 3QYQA 2W66A 2CV0A 3AU6A 2WCSA 1AW2A 5A6KA 1BYDA 1THFD 3DFNA 1W5TA 1RA0A 3BURA 3GFYA 4HPJA 2J9ZA 2OTDA 4GI8A 4HHMA 2V38A 3TWKA 3S9IA 1IFYA 5D37A 4B5NA 2A3BA 2DU2A 3CV2A 2VRJA 3SRKA 4JI5M 2H8ZA 1KWGA 1B9BA 1A5MC 2CFOA 4L61A 2VOMA 5A8QA 4L65A 3SSJA 3LLDA 3UERA 3WD4A 2ZANA 3CL8A 2YCJA 4I8YA 2D3LA 3DG6A 3A3XA 3N34A 3EA2A 3GYEA 2EA0A 1F5ZA 3K8LA 1JZ8A 4DR4M 1VH7A 1OC6A 1DJWA 2R4JA 1PJIA 2GOUA 3EMCA 5AZ0A 1QOQA 2KZSA 2UZ9A 1WGNA 3B74A 5D4YA 1G7UA 3FA5A 1IZJA 1O7AA 2L5HA 1XIHA 4J3UA 1ONEA 2XH4A 4TQTA 5LZLA 3V0SA 1H7WA 1G41A 1B4EA 2N35A 2F4VM 3NDYA 5BR8M 1R9XA 3UA4A 2GL5A 1ZBVA 1VF8A 2YNMD 5HXMA 4JYDA 1EXBA 1N36M 4LUTA 3WQPA 2VQEM 4JI2M 3GIPA 4C6LA 4BI5A 1XH1A 3GU1A 2Y7GA 5D8WA 4B3KA 4DWDA 4MJZA 4AZ6A 2ZAMA 3JZEA 4IMDA 3BUVA 4Q8VA 5I79A 3BC9A 2M5ZA 3ATYA 4KIEA 1T6OA 2K47A 3SY1A 3F4WA 1VGAA 1UD3A 3ITTA 2ZQ0A 5FL0A 4EOUA 1O5KA 4N4QA 2OOBA 3AIVA 4OX9M 2EXOA 3HU1A 1Q45A 5CPMA 4IXXA 4NZ5A 3UETA 2ZXQA 1DJHA 3OA5A 3U8GA 1VHCA 1D2NA 1QNVA 2ATMA 3UZZA 4JNZA 1XGDA 2OB3A 1OF8A 3AJXA 1HNXM 2AMXA 3M0IA 4HQVA 4ZOAA 1N33M 5K4ZA 3RPTA 3AQUA 4QAIA 4I9AA 1GEQA 3A4AA 3GBDA 4AZ5A 2HXTA 1JQXA 2G8ZA 3AHZA 1OYAA 4DJEA 3WDQA 1SG9A 4O28A 1AL7A 1SR0A 3WEMA 3KDSE 5IDZA 3IJIA 1KQZA 1C91A 1Z41A 4NVTA 2V2CA 5CCZA 3TTSA 1PKYA 4HZ8A 3A22A 2FDSA 4TV6A 3IAPA 2PF0A 2XVLA 4X65M 3U2CA 4HGXA 2DSVA 3L25A 4X9YA 4HLQA 2JGYA 3JUGA 2GUBA 3R94A 2G5WA 2YA2A 1FCBA 3DFOA 3TK7A 1YPIA 2X2YA 3IIOA 1W9DM 1MRAA 4L80A 3CQKA 1PAMA 2WJDA 1JR3D 4M6UA 1M53A 3A42A 3YPIA 1OFAA 2P53A 2OSYA 5DCDA 2FNAA 2RRUA 1E9ZB 1X38A 3WH5A 5FEXA 4GEWA 4A3VB 3TSBA 2ALRA 3CZJA 1PTGA 1R86A 4LOCA 3CV7A 3WQCA 3CQJA 1B3VA 1Q6CA 2PDHA 3VNZA 4V28A 1HJXA 4UTJA 3FE3A 2ZX6A 1K02A 4FNTA 3EPNA 2OG9A 4WOQA 2OQ4A 1YE6A 3M6YA 1L9WA 2WKGA 4DLFA 1N7KA 3V18A 3M6DA 5AYBA 4DJDD 2NXIA 4PN2A 3HGRA 1TX0A 4E8GA 4N6EA 2OO9A 3SRHA 1IHIA 2AMGA 1ECEA 1NWTA 1IR2A 5BNKA 4NXSA 3AUJA 1C8XA 1V02A 1SO3A 2E3ZA 3ARTA 3RR1A 4ZFMA 2QUMA 3I3BA 4PH6A 4S3FA 2O9PA 2V67A 3TYUA 3LHUA 1PX8A 4JIEA 4A3RA 3LPFA 3DERA 3IAQA 4YLWA 5FJIA 4AYSA 3BPWA 3Q37A 5DBTA 3GLFA 1G9HA 3VGBA 4AKGA 3SN1A 2V5LA 3NO1A 3HPXA 2BVYA 2OYMA 3PBWA 4MGGA 2NSXA 5CJ5A 1R3YA 4QNRA 5DMNA 3BJTA 2Y63A 4H6RA 3UJRA 3DCPA 2WSPA 3VE9A 5JI2E 2AL1A 1GJPA 1IT7A 3G6LA 3FDGA 4REQA 3OIHA 1YRRA 4Z2KA 4EPDC 4D8ZA 4O1FA 4DV5M 3VGGA 3U6EA 4ALDA 3AIBA 5HWNA 4JTLA 1XB2B 1W1TA 4AQLA 5KITA 3KS4A 4MFEA 1AUSL 1TQJA 1MYRA 2ZDRA 5F1VA 4CNUA 1YXYA 2XVNA 3IHPA 2ZXBA 3PZQA 4TMCA 5BOOA 1Y5WA 4XIAA 3CXOA 4KWOA 1OG6A 3ITGA 2L7HA 4GFSA 2F84A 2L4EA 2RKOA 4O8RA 2LNHC 1QUTA 1JYWA 3CU2A 4LW7A 3EB2A 4IMAA 4IM4A 5DANA 3LHTA 3RU6A 3B3DA 3ABZA 1OK6A 3DKJA 3VX0A 3R11A 2GVYA 3MT1A 2HCBA 2F5QA 5I3HA 3SGUA 4W5WA 1M65A 2Z1SA 4JKMA 3B9EA 2QCUA 1LP6A 1YEYA 2OXNA 3A47A 2NQ5A 1IY0A 4JIPA 3WD0A 5LIXX 4EF9A 1BQGA 3U5YA 1E6RA 3PWAA 1SXJB 2QDHA 3G0UA 2EJ1A 1LTMA 2J66A 3O63A 3MVTA 1W9UA 5A2CA 4KFNA 3V7PA 1Z5CA 2P0IA 3CF6E 3WLNA 2XH9A 2IKIA 2ZX5A 1V5XA 1S1RA 1AMYA 3STPA 3UG5A 4WDUA 3SBFA 1AJ0A 1MEWA 2J27A 3KFUG 1NY5A 1GVSA 1US0A 5JH1A 4XB3A 1GQNA 2KRKA 4XD5A 4C7GA 4X22A 2DZXA 3HJZA 2GGHA 1E5JA 3TAOA 2GOKA 5C9XA 4M9ZA 1PJSA 1YTKA 5FF4A 3F4VA 3NQBA 1KXTA 2G96A 2D24A 4PUDA 2X05A 3T78A 3CEPA 2DZLA 3H26A 1BXBA 4GRIA 1XLCA 3NEVA 1R2ZA 2G37A 4WXYA 4YTQA 3W7MA 3C58A 4CCEA 2E5BA 3C3EA 5CPTA 4DWSD 1TMLA 2CBUA 3KOYA 1K3WA 1ZFJA 4PL1A 1DJIA 1MX0A 3RCYA 1C8VA 1VENA 4PB5A 4KPLA 2J75A 3LTSA 3DIPA 4GISA 4F48A 4DWSA 3EOUA 3FSTA 1PV8A 1TTEA 4UFIA 3RN6A 1RBLA 4WJEA 2CLOA 1P5BA 3K30A 2CBVA 3GFZA 3FUVA 1M7JA 1QDTA 3HMCA 3N17A 3ZM8A 3EDKA 5U4NA 3RM4A 4LBRA 4I8DA 3I7QA 3MWCA 5FD0A 3SAVA 1OHLA 1PKMA 4Z17A 4DM1A 5EQTA 3TE9A 3VXGA 3GC5A 4U2ZA 5CSUA 4O12A 1POJA 2V3DA 3OQ8A 2FS1A 1TPEA 1T43A 1EBGA 3AXMA 4CU6A 2CLIA 2VDBB 4ZQNA 4UIOA 1XL9A 1B2YA 6A3HA 2JFEX 3PWGA 4LCQA 1BRLB 1R7RA 3MUAA 3VA8A 3ONBA 1UZ1A 1OVDA 1T6MA 3ZJKA 3NDOA 2NUXA 4A3HA 3SECA 1V03A 2R45A 5AOUA 5TIMA 3U6SA 3LY0A 3VZYA 3TVAA 1BKSA 4PSRA 4JCLA 2Z25A 3E21A 4Y28F 2D22A 4FNPA 3S4TA 4H6KA 4MHBA 1OGGA 1UD4A 3LM7A 4C6QA 2QMJA 2XHYA 4R3UA 5EBUA 4F79A 2QVNA 3DZDA 1CPUA 4CD8A 5GJNA 4RZBA 1SFTA 2W63A 1TTIA 3VIJA 1HR0M 4MB3A 2XZ9A 1RQHA 3K9PA 1JF5A 1VFMA 4YVVA 3DAQA 1ZJIA 2JIEA 3GRIA 5I78A 1Q85A 4I90A 1FX6A 1ZU8A 3BJSA 4FI4A 4GK8A 1S2CA 4RNHA 4B4HA 2CV1A 5DT7A 5DXXA 9XIMA 4HIBA 3T08A 3QRHA 3OGVA 2EQDA 4ICNA 1EHNA 3D47A 1XIBA 3O07A 2VF7A 4DF1A 1UR2A 2R18A 3KHJA 1BLIA 4TV5A 1NFBA 4R85A 3GLCA 4QOSA 4MY1A 4MGKE 1FFQA 3O6DA 3Q2DA 2YCIX 3C0JA 3PZVA 3QFEA 2ACQA 4G7EA 5BW6A 4K8HA 8A3HA 1F3TA 3M16A 3EDDA 1E6QM 3ABQA 2WVVA 2FB3A 2WXDM 1BG9A 3E49A 1R4GA 4PMJA 3NURA 5FTMA 4IP7A 3WK1A 2BB0A 2XFTA 3AOGA 4WR3A 5KZMA 5IZ7D 3ME3A 2OX1A 1TV4A 5A69A 4C6PA 4U10A 1XLDA 3WCZA 1HX0A 1EBHA 2GGJA 5E9XA 4YS1A 1TDHA 1FNNA 2Y6ZA 1B57A 4GZIA 4OUEA 1W3TA 1WZMA 1G69A 4P7OA 3C9PA 5IT9S 1WQ5A 3M0XA 2VR4A 1FWAC 1J9YA 3GHTA 3BSHA 4UQEA 1K7XA 2QJGA 1EP3A 1I2PA 2XN1A 3C5QA 1GJTA 5CGMA 1TV7A 2OOGA 3GU9A 1FWHC 5EMJA 3HPZA 4Z42C 1HT6A 3BTNA 1W1A1 4LVDA 5G4EA 3IV8A 4W7UA 2OU4A 3ZS4A 2FFIA 2FHCA 4QR6A 2D7GA 3H7RA 1IN8A 1VDDA 4DUWA 2FFJA 1Z9AA 4HK6A 4Q4KA 4ZODA 4NRVA 4XGIA 4NAFA 3UNTA 4GGBA 3S2JA 4QE4A 4OOZA 2O5RA 3TZNA 3MP4A 1C92A 3AFBA 3H55A 2HJPA 4D6EA 1Q6OA 3AAMA 1O68A 4MWAD 4GINA 4AZCB 2F61A 3IG5A 1E6SM 2NUYA 3T9PA 1FBAA 1N8WA 4B5TA 2YDQA 1QATA 2A85A 4RDWA 4DO7A 3GG1A 3AOEA 1F6PA 3MJ5A 4WKAA 1SJBA 3NQDA 3IRSA 1TDZA 2J25A 1FWIC 3MV11 1VFOA 4IMEA 5FF3A 3VKDA 1EJ7L 1SO5A 1XUZA 5BRBA 4G4RA 3ABRA 3K4AA 4JIQA 3S9YA 1QANA 4QM1A 1QMLA 5ITXA 2XM1A 4GITA 3TR9A 3EWCA 3KRBA 3HGJA 4LUYA 3DFHA 3AXKA 4WHBA 1J11A 3WDIA 4R9OA 3RNDA 3UJNA 4OTKA 4NUWA 1Y5VA 1GHRA 4L6HA 4Q7JA 3LGEA 2WM0A 4AY7A 3UXAA 3BLOA 2YR1A 1XBXA 2JQXA 1Z5AA 3CMGA 1OYCA 3MI2A 3CQIA 5FTJA 2EO7A 3ONCA 3TE6A 3G6MA 4ACZA 3WNLA 3TX9A 1J93A 2FTWA 3U48A 4ERAA 4N2YA 4ENLA 5BXTA 2FYMA 4MF4A 1ML1A 3KAOA 4DAIA 3LXBA 4C6NA 4DZIA 1KTBA 1PZ0A 1OJXA 1V6XA 2JY8A 4B4FA 3AICA 4DYKA 1F61A 3M64A 1E6PA 1W91A 4NF7A 2LXEA 1X1ZA 4PUMA 2TYSA 2R6OA 1TH4A 4TX9A 3WF1A 4U4MA 3OO2A 2VI0A 5A2AA 2BSLA 4QIUA 5E5CA 3CMJA 1PXGA 3SBJA 2Z2UA 3K8KA 4DO5A 5ABGA 2R62A 4I9MA 1XLHA 3TWBA 4Z2GA 3VC6A 2KZHA 3W0KA 2RDTA 1AUAA 2AQOA 3MTWA 4OU7A 4MB5A 3BE7A 4IUGA 4FSAA 1E51A 6TAAA 3B9AA 3K9OA 3QV8A 1G3IA 1V79A 1OD0A 1K9EA 4XD4A 1EPVA 3PAJA 3BAXA 2H9AA 3MP5A 1EUAA 4MVAA 1E3XA 2RHGA 2HKJA 3B9NA 2ISVA 4TUFA 5GVJA 4IOTA 3L0NA 2WK2A 2GLKA 3W67A 1Z44A 5DN1A 2X7VA 2BGQA 1AD1A 3G1FA 4FNUA 3SUWA 2LVNC 3L5LA 4RW3A 4LYKA 3FRHA 3IUHA 5HNRA 5EMKA 1IM2A 4R53A 4RK8A 2QIIA 2WSCF 3LHWA 1I75A 3IIZA 1PIGA 1MW1A 5HAOA 3VNIA 1LT8A 1HUVA 5CZJA 3GLGB 5M1TA 5JVLA 4YYCA 3FYDA 1V77A 3LVVA 1XV8A 5E0KA 4XV0A 5JBEA 5ITYA 1LOLA 1CT5A 4YWIA 3CUZA 2XWDA 1E15A 1Q6QA 2XZ7A 2DIJA 3AZTA 2OWWA 4I7VA 1TPFA 1TTJA 1XBYA 1BF6A 5CJNA 3LCXA 3S1UA 4B15A 1DXEA 4HOZA 2OKOA 3G24A 4ZQCA 1VYRA 5GQBA 3XISA 2EPOA 8CATA 3GVVA 2WW5A 4GGHA 3CASA 3EMQA 3E96A 2ZE0A 3S1GA 3TOYA 1DGGA 2FDMA 3UZYA 2FOIC 5JH2A 3QQWA 3GNNA 1OG0A 3WDJA 3THQA 4GYKA 1O66A 3HBLA 1IZCA 4UTHA 3GZAA 2VDIA 3TA9A 4C7FA 2G95A 3MUIA 4M5PA 3WELA 5ABTA 3TQKA 2W3ZA 3UW6A 4UFMA 1H3GA 4FPSA 3WF3A 1TTPA 5H6HA 2PP1A 4ZQMA 4F2LA 3G3MA 4B5SA 4ZCWA 2Y7EA 5HMFA 2VZUA 1JCMP 2F5PA 3RILA 3S6TA 3VFLA 4O16A 3VKBA 4J3TA 5JU6A 3LQLA 1XNQM 5E6ZA 4AHQA 4IL2A 1UMLA 5I23A 4DR7M 1J8VA 4GJ1A 3EX1A 1MWOA 2PBOA 3ZR6A 5HK4A 5JBFA 3OLEA 3MHGA 2P8BA 1OFDA 3LSCA 1IGSA 4Q4QA 1XYFA 2ZWZA 1GHSA 2R4EA 1JCXA 1CLKA 3J2PB 2PDWA 2YYTA 4G7FA 4RF0A 4ZXOA 3LM3A 3ZLHA 2PC4A 3BOXA 3CLWA 3AI0A 2LH0A 4MPQA 2NQZA 4CKQA 2HVOA 3CZGA 1A4LA 1GJUA 3MSYA 3B7QA 1SZFA 4PUUA 4ZSUA 4OE7A 5LXEA 3IJQA 3RJXA 3F1QA 2WKLA 4GX9A 1ZCOA 5CG7A 4MWAC 4EX4A 1ZB5A 2L6OA 2DWLA 1XYCA 3TTYA 1HO4A 1RY0A 3TSMA 1UASA 3SI9A 3R58A 2DGAA 3DEQA 3HY5A 2A2IA 2X8RA 2FIQA 4KGLA 4GNJA 2Y8VA 5A6MA 1JB0F 3H4JA 3P93A 1TVNA 3BOSA