1NVPB

Human tfiia/tbp/dna complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
43
structure length
43
Chain Sequence
TVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
pubmed doi rcsb
molecule keywords 5'-D(*GP*GP*GP*GP*GP*GP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*G)-3'
molecule tags Transcription/dna
source organism Homo sapiens
total genus 16
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2003-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1nvpB00
2P90A 3E35A 3W7TA 1NH2B 1NVPB 1RM1C 1S3JA 3W7WA 3W7XA 3W7SA 2HR3A 4HAMA 5GW7A 2WAMA 3D3IA 3IC7A 5CA3A 3BY6A 3W7UA 1YTFB
chains in the Genus database with same CATH superfamily
1VQKV 1MOFA 5LYJB 3AG4B 3ZJZA 5KMGB 2HHHO 2PF4E 3CP1A 4FLWA 2VRZA 3LSQA 3F7YC 4OPAA 3CRCA 3CHXA 2KB1A 4JYCA 5IDJA 4CS2A 3TXQA 4JI6O 3B77A 2CTPA 1TUBB 4JYAB 3JAMN 2OCCC 5CMUA 2VQEB 1OCOB 4DV3O 1LUVA 3ZX6A 1Q6IA 4LF7O 2DYSC 3JSNA 1XHZA 1VQOV 2XHBA 4OX9B 3ZHVA 5IJ0B 3B8MA 1GN2A 2DYSB 4TT3G 1GK9A 1NTZH 4HNAB 4X88A 1NT2B 1N0JA 4EB6A 1QQCA 1JFFB 3OUSA 1FJGB 3ZEDA 3CC2V 2XT9A 3A0RA 3SYPA 3B40A 4CS4A 4JPRA 3RBZA 3L74H 2M6YA 2R9IA 1FFXB 2AGAA 2ZDIC 1EN4A 1Q90D 3DC6A 2MK3A 3ZMUA 5EZYA 2AHYA 3ZRVA 1WA8B 5FPOA 1HP8A 3EVKA 1IVSA 3NR7A 4D7TA 4B3RO 1D2DA 1KP2A 4CH5A 3JAWB 5KAIZ 4MVRA 5LHGA 1G1XB 4ZHQB 4WBNB 2OWOA 4DV5O 4CC6A 1IBMO 3ZRSA 3OMIB 4DV2O 1BGYH 4HZ3A 4UVCA 3JASB 2GUZB 2HR3A 3D36C 3C3SA 4FVMA 3PJSK 1FYJA 3T4ZA 2ZQMA 1HW7A 2W6JG 1GMGA 2F23A 3RT3C 5CB4B 5L3GA 4LNUA 4QIWF 1BMFG 5LOVB 2P06A 4K8XA 1Z5VA 4RAIA 1P49A 3GVMA 1H8EG 1OCRC 2CAZC 4D6TH 5H6QA 4CH3A 1VP7A 1AILA 2P4VA 1OCRB 2Q73A 1AR1B 4JI0O 4JI2O 1SA0B 4OX9O 5JQGA 1JQ0A 4DRXB 3SYOA 4UCRA 4K3AA 1R3IC 4JI3O 3PN1A 5H2FZ 1FXVA 1HNXB 3T1HO 1VQ5V 3D8CA 1B6QA 4NKGB 3W7TA 1ORQC 4G27B 5EBLC 4JI4B 2ATKC 5CBHA 1Y66A 2EIMC 3K03A 1US6A 4LC1A 4QPJA 3J81N 5IYCO 2EIMB 5L3FA 1NKDA 5C8YA 3ZN1A 3X2QC 3RVYA 1K4CC 4J41A 1EN6A 1W0JG 3QO5A 1I08A 3X2QB 3UO2A 3T4DA 1H2MA 1SESA 4NTWA 4MTXA 5JCOC 4DV4O 2E74B 4DV7O 4WFEA 1J5EB 4C7UA 2FYUH 4OXSA 5IE9A 5HFLA 2ZE5A 4WFAV 4O4IB 3WU2Z 1JX9A 2GV9A 3A8TA 1V54C 3BAAA 3JATA 4UCOA 1Q43A 1MG1A 1K92A 4W4KA 4R8CA 4PA4A 4UVBA 4H13B 1V54B 3K9SA 4J9ZB 3OEHG 4JAAA 1SQXH 2X6AA 4TV9B 1MSWD 5B1AB 3WFVA 1K8AW 4JI5B 4DK1A 1J95A 3CMEV 1SQGA 2Q4PA 3T1YO 4AI8A 3JD2A 3SPGA 1IURA 4I55A 1QHTA 2XTAA 4DR7O 1I0HA 5FNVA 3ASOC 2Y0IA 5L3EA 4PA3A 3ASOB 5EBMC 4K0KO 2NNUA 3JARB 1IBKB 5GONA 1L1FA 3B8NA 5LGNA 1K97A 2LQTA 2HP8A 5HFMA 2DW4A 5B66Z 4DR4B 1ZLZA 1VARA 2Q7HA 4PDRA 3T2MA 2FTKA 3OFNG 4K35A 4NTYA 2AZ0A 1BHBA 3KCYA 3BRCA 4LF5O 1IBLB 4YJ3A 1E79G 4O4HB 1VEWA 2QWRB 3RYIA 3FYEB 3E35A 3WB2A 2F4VO 5IYZB 1NH2B 1NS1A 2HJDA 3HKBA 2UUBB 4DR1O 2OCHA 1YIJV 3OT7A 2JS3A 4JI1O 1NBMG 2YXLA 2V7QG 4MT8A 1NI8A 1CEZA 1G4YB 4U3JB 5F2VO 1FXKC 1KECA 3IJ4A 2BTQA 1OCCB 2FL4A 2BTOA 3HKDB 4EFEA 2QM7A 4KXRA 2V4DA 3F5WC 1FXKB 5DECA 3JD4A 2CK3G 2GDSA 5KA6A 3QVNA 4LF8B 1QR9A 4XDKA 2ZR3A 1XL4A 2Y4TA 2B1GA 3H1LH 2YEVA 1YEWA 1YJWV 4L87A 4MSWC 2A9HA 1NJIW 1XI1A 4YJ2B 3K5OA 2YIBD 1Q5OA 1V55C 1PD3A 3BFRA 1ZL8A 3NXSA 4N21A 2DQ3A 4QE7A 5J9PC 1V55B 2ODMA 3W7WA 3RYIB 3G6EV 4LF9O 2UUCO 1XNRB 1M5IA 1WAZA 2X0LA 1M9NA 3FFQA 4JAVA 1ROPA 4BWAA 3QNEA 1R3LC 4PELA 4XBFA 4FLTA 2X7RB 3CCUV 5EBWC 2YICA 2JEUA 2UUAO 3ZRWA 2UU9O 1EFRG 3CJHB 1WLEA 3B4SA 5H6RA 1VQ4V 2HFEC 4DR3B 2OYQA 3KG2A 3SJCC 4GX1A 1IBLO 2DN9A 1EZJA 2B9ZA 3A0BZ 4LWSB 1SQPH 2C2AA 2D2CB 2YEVB 3Q4HB 3OTFA 1WPBA 3RN4A 4B08A 2ITDC 5BMVA 3RYFB 3RGBA 1PL4A 2F1MA 2YIDA 3SPIA 3BVOA 1PL0A 1V9PA 5IJ9B 4DUYB 1WB7A 1P7BA 4PI0A 4I0XA 2K9PA 2W0FC 1BSMA 3D3IA 3E2EA 4GCZA 4ZI7A 4ZIBA 2IH1C 4Q20A 3E89A 1N32O 4O2AB 1NR7A 3K04A 3CCMV 1AJNA 3STZC 3R65A 4O2BB 3JYCA 3FB7C 1JJOA 2A3QA 1SERA 2WSSG 1NVPD 2A0LA 3FKSG 4KUMA 1SS3A 4GT1A 1M4UA 1XEQA 2M7WA 3VQVA 4B3MO 3KKYA 5BR8B 2PTMA 3I56V 3AG3C 4FLUA 1M90W 1EZVH 3K0DA 4X1YA 1N36B 3ETDA 2WLHA 4D7SA 2ZKOA 4GX0A 1S72V 3AG3B 3CRRA 1MZEA 1PP9H 4WFHA 2ZR2A 3ZS8C 4ASUG 5L3BA 5DM6V 1MZFA 2HVJC 2HHHB 1Y74B 5LXTA 5JVDB 1DF4A 3DXRA 4LF4O 4X20B 4DUZO 1H38A 5EYPA 5KHGA 1FS0G 1SKVA 3ABTA 3E8BA 4QGPA 4IL6Z 4IIJA 3ZIAG 4JI6B 3RYCA 1AI4A 3E22A 5IY5B 1AR4A 2XAQA 1ZWIC 1Q81W 2LP7A 1G6UA 1KBHA 2CH7A 4I5SA 1UFIA 4NB5A 3P32A 4JI7O 4DV3B 2DYRB 4LF7B 3ICXA 1UPGA 5KA5A 5JJNB 4FMTA 3ZMVA 3UKMA 4IHJB 3L70H 5LYJA 3SYQA 5KMGA 3MHHC 3OUFA 4X1YB 1VQPV 2ETNA 5LMNO 4MVQA 4UUJC 4XDJA 4DO2A 3U0ZA 4AQYO 1QCEA 1TUBA 3ASNC 2X6CA 4NVPA 1YITV 3K08A 2YIAA 3ABLC 2QA4V 3JD0A 3P3PA 3ASNB 1HR0O 4MTOA 3ABLB 4YY3O 4B3RB 2V1DA 4JF3A 5IJ0A 1BL8A 4MTGA 3THOA 4J11A 1E1QG 4RWUA 4HNAA 1IBMB 3GWKC 4DV2B 1JFFA 1H2LA 1JMKC 4MS2A 3ZCCA 2ARHA 4WFBV 4FM1A 1GN6A 1FFXA 5B1OA 4KL1A 3FAVB 1Q8IA 1N34O 1DK1A 2JEXA 2ZDIA 1WA8A 1AI5A 4JTCB 4GKJO 1IX9A 3JAWA 1Y67A 1MNGA 4ZHQA 1H2SB 1L0LH 5EC2C 4WBNA 3K58A 2XAJA 4GYCB 2OTJV 1N33O 1SZTA 2F93B 3JASA 2GUZA 4JI0B 2CGOA 2EILC 3A2FA 2JRIA 1NU1H 2OCCB 2QKCA 3LUTB 4JI2B 1JJ2U 3D36A 2EILB 4NXMO 1YXBA 4A5UB 3H9VA 3IC7A 4PDLA 5CB4A 4JI3B 3F7VC 3KZIZ 3T1HB 5LOVA 1XMOO 2LGQA 2UXNA 3LSSA 2B5UA 3OAAG 4UXNA 4B7EA 2LFSA 1SQQH 2XNDG 3AG1C 1QLNA 4O4LB 1NR1A 1Z5WA 2VS0A 4P9OA 2QWQB 5IWAO 3AG1B 2YUAA 5IT9N 1YSCA 1SA0A 3FB6C 4DR6O 3VOUA 4DRXA 1HNWO 5D5PA 4X1KB 2XAHA 3STLC 2LO1A 4H44B 4Q6GA 1O9HA 3SYCA 5CA1B 5LGUA 4DW1A 1AI7A 4QJFB 4FLXA 1U96A 4RO2A 2QDOA 3GWOA 3LNNA 2EZOA 1VQ7V 3BY6A 4DV4B 2WLIB 1GN3A 2IJKA 4UCTA 4O4JB 3CCLV 4DV7B 1VQMV 5LP6C 4E2LA 2JGUA 2ZE7A 3FB5C 4HYOA 3U10A 5KHJA 5LP6B 2HG5C 2HVKC 3QF7A 3B2EE 4I50B 1PPJH 4J9YB 2OT5A 1ZSPA 1K9MW 1M56C 3J7AU 5CA3A 2CTWA 4W4LA 3CB2A 4JZ2A 3BHPA 2IJIA 1M56B 3JD1A 4X1IB 5EC1C 1S76D 2QR4A 3T1YB 1BZKA 5JH7B 4K8ZA 2Q0OC 2PI4A 4F6RB 3RWRD 4DR7B 4O4IA 5JCOA 1GAXA 3ZHTA 1YJ9V 1R6NA 4UB8Z 4K0KB 2ZE6A 3QO8A 4TUYB 1MSDA 1WN7A 3HKCB 3JAKB 1I94O 1THZA 4TV9A 4R7CA 2QKSA 3N27A 2NLJC 3APOA 4TSFG 1KC8W 3K0GA 2AW9A 4OPHA 4FFBB 5TISZ 3KCXA 2QM8A 2PY5A 2L6LA 2GBOA 1VF6C 2QM4A 1R3KC 1WPXA 3CX5F 3HKEB 1YHQV 1DGSA 2ZE8A 4LF5B 2O57A 4PDMA 4J80A 3HB3B 1XMQO 3JARA 3H1KH 2F4VB 1IXMA 1QLEC 4YIPA 4DR1B 4JI1B 3L71H 2GSMB 1DLBA 2UXDO 1QLEB 2E5LO 3CYOA 1AVMA 1D5AA 4L8JA 3ZBHA 5LA6B 3APQA 3JSLA 1UJWB 4X89A 3SPCA 4RUFA 1TA8A 1XILA 5B1BC 4P9PA 1Q86W 3CSXA 1GM9A 5ITZB 1HNZO 4O4HA 5B1BB 1N4CA 3CRAA 5IYZA 5A9GA 2UXCO 2YDEA 4FK5C 1H2NA 1P4RA 1NVPB 1CPYA 4B3SO 3SJAC 2VQFO 2EJ7A 4DW0A 1R73A 2KSDA 4U3JA 4DV0O 4MTFA 3N2KB 2F95B 4DR2O 3HKDA 4LF9B 1QVGU 4Z2WA 2UUCB 1FXKA 5KHIA 1AB3A 2P4KA 5B3SC 5LL6Y 2N04A 2DJVA 2CGNA 1BHAA 4LFCB 2GHYA 1AR5A 4JASA 4PHZA 5B3SB 1BE3H 1QBZA 2BSKB 1LR1A 2UUAB 1VQNV 1XREA 2XOKG 3ZN0A 4I4TB 4YJ2A 2UU9B 2EULA 4TQFA 3JCZA 4OGQB 2Y48A 4PA7A 2W6IG 2ZM6O 4BR6A 4UCUA 1S77D 4CZZA 4RQFA 3OMAB 4DR5O 5J2TB 1TVKB 1YZBA 4PV1B 1Q6UA 4UCVA 1OZ0A 5EIBD 4PD4F 2E3CA 3VQYA 2RNBA 5K1PA 3MD0A 2XUMA 1D5NA 2R9RB 1RFYA 2FMLA 2YI9A 2YI8A 4JYYA 3ETQA 1KD1W 3FX7A 2N74A 3S3WA 1GM7A 3CJHA 2KG7B 3CCVV 4NXNO 3LDCA 2IBZH 4PDVA 1N32B 4LWSA 3RYHB 4YHHO 1KKCA 2YSUB 2Q9LA 3Q4HA 1KB9F 5AG2A 4LR3A 2WPDG 3RYFA 5KX5B 2H3OA 1I5YA 3K5MA 5IJ9A 4B3MB 5D5QA 1GTOA 4GUNA 3P3NA 2L35A 3OTOO 4AILC 2PUSA 1OCZC 5J2UB 1K5SA 2Y69C 1OCZB 3AK1A 2KKWA 2LGWA 1QNMA 4O2AA 5IYBO 4LFCO 1KP3A 2Y69B 4O2BA 4LF4B 2ZCEA 3CCQV 1R6KA 4DUZB 4UCSA 4FZ0A 1F7YA 3S3XA 1XNQO 3CD6V 1S3JA 1N8RW 4ZOLB 2EBOA 4G2KA 4X62O 1K7DA 1H2GA 2AHZA 2Z0AA 4MVZA 1PNKA 3K3WA 4BIZA 1GKFA 1EM1A 2DWEC 2GTAA 4FLZA 2BCCH 4E4EA 1SC5B 2R9AA 1PM9A 3D3QA 4JI7B 2IM9A 4IT5A 1Q3EA 1URFA 3RFRA 2WA4A 1WJZA 4MVOA 2E76B 5E79Z 4LFAO 1Y74A 3G67A 5JVDA 3OR7C 4X20A 5JWPA 2XAGA 1QVFU 3HPLC 3I55V 3BEHA 5LMNB 1TUEB 4AQYB 3ZHUA 4F6EA 3C90A 4QE9A 3TCUA 2P5OA 5BZBA 3CEIA 3E8GA 3ZRXA 1QR8A 3UT5B 2Q7GA 4LP8A 4U7OA 1HR0B 1JOYA 4YY3B 1RSOB 1YJNV 4IHJA 4DK0A 4JTAB 1F51A 2AZ2A 3N2GA 1YVWA 3CCSV 3H01A 1MA1A 4J7KA 2JJ2G 3RVZA 3W7UA 3ZMZA 4X66O 2WLMA 1VQLV 1WP7A 1W2BU 4BAYA 1SQFA 2QKAA 3ABUA 5H5NA 2Q0AA 4UVAA 3TGUH 1FFTB 1GM8A 1N34B 2HEPA 2IU3A 3QTCA 4DV1O 5FL7G 1T5EA 4GKJB 2WWWA 3SJQC 2RQ6A 1PV0A 2XASA 3ZMTA 1MABG 2Q7EA 2CUGA 3H1JH 3G4SV 1N33B 2MW2B 3OGCC 3SPJA 4MW8A 2LJ2A 4Z1VA 2EIJC 3LSUA 4JV5O 1AJQA 3LDEA 3L73H 2IJJA 4NXMB 2EIJB 2Z5UA 1L0NH 3FAVA 3GB7C 3N2GB 1Y76B 1EBOA 5CN0A 5LMUO 1RM1C 1Y4MA 4FIPC 1XMOB 1LUWA 3SR2C 2ZNIA 1R1BA 1RM1B 3K57A 4QNHB 2A7WA 2P7TC 2VWJA 3DC5A 1XOUA 4GZRB 2P6JA 4ZBMA 2UXBO 1GO3F 1RPOA 5IWAB 1ENVA 1SZXA 4TV8B 4LH7A 4DR6B 1CXZB 2EINC 1HNWB 3K79A 4J7ZA 4R50A 4TQDA 4DXWA 2QE7G 3SGIA 1WNSA 2EINB 1AROP 3M99B 2OIGA 4UV9A 4H37A 2Q68A 1FAFA 3ETEA 3C3TA 1NQTA 2EX3A 2WLNA 2WA3A 2ADQB 4H0LB 3CXCU 3CXHF 1IDSA 1G8MA 3CE2A 4O4LA 1TAEA 2WLLB 4FZ1A 1JVMA 1MMMA 3OE7G 4DV6B 2UXXA 3EHBB 1KQSU 4KP4A 3JALA 1ZAUA 4NTXA 4LFBO 1VQ9V 2PYLA 4QPKA 4X1KA 5GTIZ 3I5DA 1YTFD 2F43G 5CA0B 2OIEA 5CA1A 3CRQA 3R66A 2YS8A 2QWOB 5LHIA 2JGDB 1F4NA 1K73W 3IGAC 2WLIA 4O4JA 1KMIZ 1TGOA 1DTOA 3L72H 1OCOC 3T1CA 4LF6B 1KUQA 2RN9A 1VF7A 1XL6A 3OMNB 2YXYA 5LP6A 3OR6C 3QO7A 5LHHA 4YXWG 2W0XA 1L8DA 3CWBH 3IAYA 3K06A 4I50A 4ZKIA 2RCVA 3E8FA 2WAMA 3K5LA 2Y4UA 1A32A 1JA8A 1I94B 1WB8A 3TK1A 1VIBA 4X1IA 2A06H 3JALB 5JH7A 3OW2U 4MVMA 4GKKB 4F6RA 1M93A 4IGGA 2QTOA 5KAFZ 4FPPA 2YIBA 2BOBC 3AG2C 2D3OW 3TJTA 1YI2V 1P7GA 4PA6A 4N23A 1DF5A 2EIKC 1VQ6V 3AG2B 3A0HZ 5EIBC 1XMQB 1FXHA 1VMGA 4TUYA 2KQXA 3F5TA 3HKCA 4CBCA 2EIKB 4PI2A 3JAKA 2QGNA 1M57C 2UXDB 2OTLV 4DV6O 2E5LB 3UCSC 4XDLA 2QJ1A 1AP5A 1NTMH 3W7SA 4X65B 4RQEA 2A79B 1M57B 4FFBA 1IXBA 2QWPB 5LGTA 2JDIG 3HKEA 4P2ZA 1HNZB 1VF6A 2P90A 4EB6B 2EZPA 1K34A 4X9QA 4PA9A 3FYIB 3K9AA 3TXSA 2UXCB 1YCIA 5GTHZ 2JS5A 4WFGA 1CP9A 2Q5ZA 1I7FA 1VF5B 4LF6O 3CCEV 4B3SB 2WLJA 4JYAO 3JCUZ 2VQFB 1W59A 5LA6A 5EZYB 2VQEO 1KU9A 4DV0B 2LFRA 1Z2GA 3CC4V 4DR2B 3AG7A 4P30A 5DN6G 4JI8B 4X8AA 1Q82W 5IYDO 3H1HH 2ADPA 1O9GA 4MW3A 4KFMA 4H33A 4FFKA 5ITZA 2CDYA 3SYAA 1FJGO 1AP6A 1YF2A 1ZTEA 4GKKO 4GLXA 2ZIOA 4CH4A 1NTKH 4LNUB 2FB5A 2ZM6B 4TOIA 3ZHRA 4DYLA 3N2KA 3W7XA 4DR5B 3VQXA 4FLYA 4J10A 2AXTZ 2PI5A 2RDCA 5B5EZ 1JCHA 1BCCH 2FKXA 3BA9A 4X65O 3P30A 4BW9A 2BSKA 5EK0A 2P67A 4BW5A 1QU7A 3ETGA 2R70A 3J80N 1SRYA 2H8PC 4I4TA 5JQGB 4RUEA 2F66C 1JR9A 4NXNB 2WLKA 1GN4A 3L75H 2X6BA 4IYHA 3LDDA 1PKXA 4YHHB 5J2TA 2Q6AA 1TVKA 2N05A 2QTSA 1K3EA 4NR1A 1GRJA 2Q69A 5B1AC 2CE4A 1S5HC 2ZXWC 3O9OA 3VQWA 3ZHQA 2LW1A 3OTOB 2ZXWB 4JI8O 5JJJB 2KG7A 1KKDA 5C8YB 1ZX3A 2CTRA 1B3QA 3DSQA 3RW0A 2IU0A 3RYHA 1HNXO 1VQ8V 1SF9A 1XNQB 1S5LZ 3SDLA 5KX5A 5LBQA 4GX2A 4X62B 3BPZA 1BS3A 1P84F 2LW7A 4JI4O 4WCEV 2ILMA 2YXHA 3JD3A 4X64B 1H8HG 3CMAV 2R72A 2VWKA 5L3DA 3JATB 5J2UA 1JPXA 3E86A 3BA8A 1RP3B 2DMXA 4HAMA 1OV9A 3MDSA 5KUMA 2P22C 4WFFA 4LFAB 3SPHA 3EXAA 3ML0A 1LNQA 1XHXA 1X4TA 3G6BA 1GH6A 1SQVH 4UV8A 1X59A 2PGGA 4ZOLA 3MHSC 3E83A 4B3TB 1XBLA 5KHKA 1J5EO 5FLXN 2NN4A 5FPRA 4I55B 1W0KG 1Y6XA 2QEXV 1OCCC 5FNVB 1U97A 2DE0X 1NZ6A 2JK5C 2DQ0A 4EEQA 4J42A 1YDXA 3AK2A 3MAQA 4NYKA 1R3JC 3OM3B 3SJBC 4I9WA 3H1IH 1BQ0A 4CC5A 5GONB 3OD4A 1XDCA 5A2QN 4X66B 3G80A 3K59A 4CH6A 3ZHSA 3ZMSA 3G71V 5L3CA 4JI5O 1N0NA 1KYOF 5C93A 4KHPB 4FM2A 5H9CA 3UQ8A 2PYJA 1PNMA 1HWYA 4YJ3B 2E75B 4DV1B 4JYBA 4JGSA 3UT5A 1FKAO 3UM7A 1AI6A 1RSOA 3HKBB 1IBKO 4FJCC 1SETA 2ZINA 3AK3A 3M8AA 1K4DC 2ZNJA 4X64O 2Z3YA 2ZIMA 1RPRA 1ZUQA 2HLDG 4MVSA 1OHHG 3WG7C 4DR4O 1YTFB 4MVUA 4ABMA 4WF9V 2BTQB 5BY1A 4JV5B 1FPOA 5BXZA 3WG7B 3EFFK 4Z1MG 5LMUB 3U11A 3WB1A 2QWNB 4B3TO 3L9DA 2UUBO 4I7ZB 2Q8VA 3ABKC 1ZL8B 2JJ1G 5E1AC 2UXBB 2G38A 4UFZA 5B1NA 3ABKB 2YC0A 1S5JA 4U3FH 3K5NA 2BE3A 4BIOA 4JAUA 4LCUC 4LF8O 1Y76A 2HKOA 3OEEG 1WP8A 4HBNA 3E8HA 2H94A 3TETA 2Y0PA 4JZGA 1BT8A 2DOSA 3ZRWB 4FM0A 2IH3C 1H2KA 3DTUB 3O65A 5JJEB 4KHPO 1F23A 5CBGA 1XUQA 3CPWU 4B7KA 4FLVA 1IZ3A 4UB6Z 4CS3A 4TV8A 3FB8C 4YIOA 1XNRO 5KUKA 2GTSA 1XQ8A 5BMVB 2B1IA 4LFBB 5KHHA 3CRMA 1PNLA 3B09A 4GX5A 1F4MA 3ABMC 4LBEC 4IYIA 2HJFC 1Q6HA 4I0XB 3M7MX 3ABMB 2K1EA 4U7NA 4ZI7B 5IY5C 4ICGA 2IW5A 2XAFA 4DR3O 2CTQA 2WLLA 5K1XA 4TWKA 1K33A 2DYRC 1Q7YW 5DEDA 2NR5A 4F4LA 1NH2D 3CCRV 2ZT9B 4G28B 2IJHA 1E1RG 4R6ZA 1R6TA 1K5QA 4I9QA 2ZD9A 1I5XA 2QSAA 1COWG 1B04A 4DUYO 1M1KW 3HR0A 5CA0A 1BQZA 2DWDC 1AJPA 3IC9A 2JGDA 2RJZA 3DGEA 3IFXA 2BOCC 3UO3A 2ITCC 4EFBA 1B06A 3LNMB 5LXTB 3CC7V 3DXRB 3WB0A 3CCJV 4JTDB 2PZSA 1OJHA 3VBBA 4PJ0Z 3BCCH 5EYPB 3QG5A 1EN5A 4LH6A 5BR8O 4EKWA 4IIJB 1FD9A 3RYCB 3E22B 2Q67A 2JIZG 4J7JA 4DV5B 5CBFA 1N36O 5GW7A 3AEIA 4AHCA 2RMKB 2EJRA 4BIUA 1SQBH 1HDJA 2CH7B 5KLVH 3AG4C 3BABA 1S0VA 3CS5A 3OGIB 3FD9A 2JVDA
chains in the Genus database with same CATH topology
4RQFA 1AJNA 3OMAB 4X8AA 1Q82W 1VQKV 5IYDO 1MOFA 3AG4B 3STZC 3R65A 3ZJZA 3CP1A 3JYCA 3FB7C 1OZ0A 4MW3A 1SERA 3LSQA 4KFMA 3F7YC 2WSSG 4H33A 2A0LA 3FKSG 4KUMA 1NVPD 4GT1A 3MD0A 3SYAA 2M7WA 2KB1A 4JYCA 5IDJA 3I56V 2R9RB 3AG3C 1M90W 3B77A 3K0DA 3ETDA 2WLHA 1KD1W 4GX0A 1S72V 1GM7A 2OCCC 3AG3B 5CMUA 3CCVV 1OCOB 3LDCA 4PDVA 4WFHA 2ZR2A 2DYSC 3W7XA 4ASUG 5L3BA 5DM6V 1VQOV 2HVJC 3B8MA 2YSUB 2DYSB 2PI5A 1DF4A 4TT3G 1GK9A 4X88A 2WPDG 1H38A 1JCHA 1I5YA 1FS0G 3ABTA 3OUSA 1GTOA 3E8BA 3CC2V 3A0RA 3P30A 3SYPA 5EK0A 2P67A 3ZIAG 4BW5A 1AI4A 4JPRA 3RBZA 5IY5B 3ETGA 2XAQA 1ZWIC 2R9IA 1Q81W 2LP7A 1SRYA 1OCZC 2H8PC 2ZDIC 4I5SA 4RUEA 1K5SA 2MK3A 3P32A 3ZMUA 2DYRB 2WLKA 2Y69C 2AHYA 1OCZB 5KA5A 3ZRVA 2X6BA 4FMTA 3ZMVA 3UKMA 3LDDA 5IYBO 1PKXA 1KP3A 1KP2A 3SYQA 2Q6AA 2Y69B 4MVRA 5LHGA 3MHHC 3CCQV 1K3EA 3OUFA 1R6KA 1VQPV 2Q69A 3CD6V 1S3JA 5B1AC 3ZRSA 3OMIB 1S5HC 2EBOA 4G2KA 1N8RW 2ZXWC 4HZ3A 4UVCA 1K7DA 1H2GA 2AHZA 4MVZA 1PNKA 2HR3A 3K3WA 3PJSK 4BIZA 4MVQA 4UUJC 4XDJA 4DO2A 3T4ZA 1GKFA 2DWEC 1QCEA 2ZQMA 2ZXWB 2W6JG 3ASNC 1GMGA 2X6CA 1YITV 3K08A 3ABLC 1KKDA 2QA4V 3JD0A 5L3GA 4QIWF 3ASNB 1BMFG 4MTOA 3ABLB 3RW0A 2IU0A 2V1DA 4JF3A 4MVOA 1VQ8V 1BL8A 4RAIA 4MTGA 1H8EG 3OR7C 1E1QG 1OCRC 2XAGA 5H6QA 1QVFU 3HPLC 5LBQA 4GX2A 1OCRB 4MS2A 1AR1B 3ZCCA 3I55V 3BEHA 4WCEV 4WFBV 3JD3A 1TUEB 1H8HG 3CMAV 5B1OA 4QE9A 5L3DA 3TCUA 1JQ0A 5BZBA 1JPXA 3E86A 3SYOA 3E8GA 3ZRXA 1QR8A 4LP8A 1R3IC 2JEXA 4U7OA 2ZDIA 4HAMA 1AI5A 1JOYA 4JTCB 1FXVA 5KUMA 1YJNV 4WFFA 1VQ5V 4JTAB 1F51A 3SPHA 3CCSV 3H01A 2JJ2G 5EC2C 3RVZA 3ML0A 3W7UA 1LNQA 3ZMZA 1B6QA 2WLMA 2XAJA 1VQLV 4UV8A 2OTJV 1W2BU 1SZTA 4BAYA 3MHSC 3ABUA 3E83A 1ORQC 4G27B 3W7TA 5EBLC 2ATKC 2EILC 5CBHA 1Y66A 2EIMC 3K03A 1W0KG 4LC1A 2OCCB 3LUTB 2QEXV 1OCCC 4QPJA 4UVAA 1JJ2U 5IYCO 1FFTB 1GM8A 2JK5C 2EILB 3D36A 2DQ0A 2EIMB 5L3FA 3IC7A 2IU3A 4PDLA 1NKDA 3ZN1A 3X2QC 5FL7G 3RVYA 3F7VC 1K4CC 1R3JC 1W0JG 2WWWA 3OM3B 3QO5A 3SJQC 2UXNA 4I9WA 3LSSA 3X2QB 2B5UA 3OAAG 2XASA 4UXNA 3T4DA 3ZMTA 1MABG 1SESA 2LFSA 3G4SV 2XNDG 4MTXA 3AG1C 1QLNA 3ZMSA 3OGCC 3G71V 1NR1A 5L3CA 3SPJA 4MW8A 4P9OA 4WFEA 2EIJC 4OXSA 5HFLA 5C93A 3AG1B 1AJQA 4WFAV 1YSCA 5H9CA 3LDEA 1JX9A 2IJJA 3FB6C 2EIJB 2Z5UA 1V54C 1PNMA 3GB7C 3VOUA 1HWYA 1MG1A 1K92A 4JGSA 4JYBA 1EBOA 4R8CA 4PA4A 4UVBA 5CN0A 2XAHA 1RM1C 3STLC 1V54B 3UM7A 1AI6A 4J9ZB 1Y4MA 3OEHG 4FIPC 4FJCC 3SYCA 1SETA 5LGUA 1RM1B 2X6AA 1AI7A 1K4DC 4QJFB 5B1AB 4QNHB 1MSWD 4RO2A 2P7TC 2Z3YA 3GWOA 3WFVA 1K8AW 1RPRA 2EZOA 4MVSA 2HLDG 1VQ7V 3BY6A 1OHHG 2WLIB 3WG7C 2IJKA 1J95A 3CMEV 3CCLV 1YTFB 1VQMV 4MVUA 4WF9V 2P6JA 4ZBMA 1GO3F 1RPOA 4E2LA 3JD2A 3SPGA 1ENVA 3FB5C 4HYOA 3WG7B 3EFFK 4Z1MG 3ASOC 5L3EA 2EINC 2HG5C 2HVKC 3K79A 4R50A 4DXWA 4PA3A 3ASOB 5EBMC 2QE7G 4J9YB 2EINB 2OT5A 1K9MW 2NNUA 1AROP 1M56C 3M99B 4UV9A 4H37A 5CA3A 2Q68A 1L1FA 3ETEA 3B8NA 2IJIA 1M56B 1NQTA 2WLNA 5LGNA 3JD1A 1K97A 5EC1C 1S76D 3CXCU 5HFMA 3ABKC 2JJ1G 1G8MA 2DW4A 5E1AC 2WLLB 1JVMA 2PI4A 5B1NA 3OE7G 3ABKB 3T2MA 4PDRA 2UXXA 2FTKA 3OFNG 3EHBB 1KQSU 4KP4A 1BHBA 4JAUA 4LCUC 1VQ9V 2HKOA 1E79G 1YJ9V 3OEEG 1R6NA 4QPKA 3E8HA 2H94A 3FYEB 3E35A 3QO8A 1YTFD 3TETA 2F43G 1NH2B 3ZRWB 1YIJV 1THZA 2IH3C 1NBMG 4R7CA 2QKSA 3DTUB 2NLJC 5LHIA 2V7QG 4MT8A 1F23A 5CBGA 1F4NA 4TSFG 3CPWU 1K73W 1KC8W 3IGAC 3K0GA 2WLIA 1CEZA 1G4YB 1FXKC 1KECA 1DTOA 2QM8A 1OCCB 1OCOC 3T1CA 1XL6A 1R3KC 2QM7A 3OMNB 1WPXA 3F5WC 3FB8C 1FXKB 3OR6C 3QO7A 5LHHA 4YXWG 1YHQV 5KUKA 3JD4A 2CK3G 5KA6A 1QR9A 2B1IA 4XDKA 3K06A 1PNLA 4PDMA 2ZR3A 1XL4A 4ZKIA 3HB3B 1F4MA 4GX5A 3ABMC 4LBEC 3E8FA 2B1GA 1IXMA 2WAMA 2YEVA 1QLEC 2HJFC 1YJWV 4L87A 4MSWC 2A9HA 1NJIW 3ABMB 2K1EA 4U7NA 2GSMB 1DLBA 3TK1A 1QLEB 5IY5C 1V55C 3CYOA 2IW5A 1PD3A 2XAFA 3NXSA 4N21A 2DQ3A 2WLLA 1UJWB 4QE7A 4X89A 3OW2U 4MVMA 5J9PC 4TWKA 3SPCA 1V55B 1K33A 2DYRC 1Q7YW 3W7WA 4RUFA 4F4LA 2QTOA 3G6EV 1NH2D 4FPPA 3CCRV 2BOBC 3AG2C 5B1BC 4P9PA 2D3OW 1Q86W 1YI2V 2X0LA 1M9NA 4PA6A 4G28B 1GM9A 4JAVA 1ROPA 2IJHA 1DF5A 4N23A 2EIKC 3QNEA 1E1RG 1VQ6V 4R6ZA 1K5QA 1R3LC 3AG2B 5B1BB 4PELA 4XBFA 2ZD9A 1I5XA 1FXHA 1COWG 2X7RB 3CCUV 5EBWC 4CBCA 1M1KW 2EIKB 2JEUA 3ZRWA 2DWDC 1M57C 1AJPA 4FK5C 1P4RA 2OTLV 1NVPB 1CPYA 1EFRG 1WLEA 5H6RA 4XDLA 1VQ4V 2HFEC 3W7SA 4RQEA 2A79B 1R73A 1M57B 3KG2A 3DGEA 4GX1A 4MTFA 3IFXA 2BOCC 1EZJA 2ITCC 2C2AA 3LNMB 1QVGU 2YEVB 2JDIG 5LGTA 3CC7V 1FXKA 2ITDC 4P2ZA 3CCJV 4JTDB 3VBBA 5B3SC 2P90A 3SPIA 2EZPA 1PL0A 1BHAA 2GHYA 1K34A 4JASA 4PA9A 3FYIB 5B3SB 4EKWA 1QBZA 3K9AA 1P7BA 1VQNV 2Q67A 2JIZG 2W0FC 5CBFA 3AEIA 1CP9A 4WFGA 2XOKG 5GW7A 3ZN0A 3D3IA 3CCEV 2EJRA 4BIUA 2WLJA 4GCZA 3E2EA 3JCZA 2IH1C 2Y48A 4PA7A 2W6IG 3AG4C 1S0VA 4Q20A 2LFRA 3E89A 3CC4V 1NR7A 1S77D 3K04A 4P30A 5DN6G 4CZZA 3CCMV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P90 A;  3E35 A;  3W7T A;  1NH2 B;  1NVP B;  1RM1 C;  1S3J A;  3W7W A;  3W7X A;  3W7S A;  2HR3 A;  4HAM A;  5GW7 A;  2WAM A;  3D3I A;  3IC7 A;  5CA3 A;  3BY6 A;  3W7U A;  1YTF B; 
#chains in the Genus database with same CATH topology
 1VQK V;  1MOF A;  5LYJ B;  3AG4 B;  3ZJZ A;  5KMG B;  2HHH O;  2PF4 E;  3CP1 A;  4FLW A;  2VRZ A;  3LSQ A;  3F7Y C;  4OPA A;  3CRC A;  3CHX A;  2KB1 A;  4JYC A;  5IDJ A;  4CS2 A;  3TXQ A;  4JI6 O;  3B77 A;  2CTP A;  1TUB B;  4JYA B;  3JAM N;  2OCC C;  5CMU A;  2VQE B;  1OCO B;  4DV3 O;  1LUV A;  3ZX6 A;  1Q6I A;  4LF7 O;  2DYS C;  3JSN A;  1XHZ A;  1VQO V;  2XHB A;  4OX9 B;  3ZHV A;  5IJ0 B;  3B8M A;  1GN2 A;  2DYS B;  4TT3 G;  1GK9 A;  1NTZ H;  4HNA B;  4X88 A;  1NT2 B;  1N0J A;  4EB6 A;  1QQC A;  1JFF B;  3OUS A;  1FJG B;  3ZED A;  3CC2 V;  2XT9 A;  3A0R A;  3SYP A;  3B40 A;  4CS4 A;  4JPR A;  3RBZ A;  3L74 H;  2M6Y A;  2R9I A;  1FFX B;  2AGA A;  2ZDI C;  1EN4 A;  1Q90 D;  3DC6 A;  2MK3 A;  3ZMU A;  5EZY A;  2AHY A;  3ZRV A;  1WA8 B;  5FPO A;  1HP8 A;  3EVK A;  1IVS A;  3NR7 A;  4D7T A;  4B3R O;  1D2D A;  1KP2 A;  4CH5 A;  3JAW B;  5KAI Z;  4MVR A;  5LHG A;  1G1X B;  4ZHQ B;  4WBN B;  2OWO A;  4DV5 O;  4CC6 A;  1IBM O;  3ZRS A;  3OMI B;  4DV2 O;  1BGY H;  4HZ3 A;  4UVC A;  3JAS B;  2GUZ B;  2HR3 A;  3D36 C;  3C3S A;  4FVM A;  3PJS K;  1FYJ A;  3T4Z A;  2ZQM A;  1HW7 A;  2W6J G;  1GMG A;  2F23 A;  3RT3 C;  5CB4 B;  5L3G A;  4LNU A;  4QIW F;  1BMF G;  5LOV B;  2P06 A;  4K8X A;  1Z5V A;  4RAI A;  1P49 A;  3GVM A;  1H8E G;  1OCR C;  2CAZ C;  4D6T H;  5H6Q A;  4CH3 A;  1VP7 A;  1AIL A;  2P4V A;  1OCR B;  2Q73 A;  1AR1 B;  4JI0 O;  4JI2 O;  1SA0 B;  4OX9 O;  5JQG A;  1JQ0 A;  4DRX B;  3SYO A;  4UCR A;  4K3A A;  1R3I C;  4JI3 O;  3PN1 A;  5H2F Z;  1FXV A;  1HNX B;  3T1H O;  1VQ5 V;  3D8C A;  1B6Q A;  4NKG B;  3W7T A;  1ORQ C;  4G27 B;  5EBL C;  4JI4 B;  2ATK C;  5CBH A;  1Y66 A;  2EIM C;  3K03 A;  1US6 A;  4LC1 A;  4QPJ A;  3J81 N;  5IYC O;  2EIM B;  5L3F A;  1NKD A;  5C8Y A;  3ZN1 A;  3X2Q C;  3RVY A;  1K4C C;  4J41 A;  1EN6 A;  1W0J G;  3QO5 A;  1I08 A;  3X2Q B;  3UO2 A;  3T4D A;  1H2M A;  1SES A;  4NTW A;  4MTX A;  5JCO C;  4DV4 O;  2E74 B;  4DV7 O;  4WFE A;  1J5E B;  4C7U A;  2FYU H;  4OXS A;  5IE9 A;  5HFL A;  2ZE5 A;  4WFA V;  4O4I B;  3WU2 Z;  1JX9 A;  2GV9 A;  3A8T A;  1V54 C;  3BAA A;  3JAT A;  4UCO A;  1Q43 A;  1MG1 A;  1K92 A;  4W4K A;  4R8C A;  4PA4 A;  4UVB A;  4H13 B;  1V54 B;  3K9S A;  4J9Z B;  3OEH G;  4JAA A;  1SQX H;  2X6A A;  4TV9 B;  1MSW D;  5B1A B;  3WFV A;  1K8A W;  4JI5 B;  4DK1 A;  1J95 A;  3CME V;  1SQG A;  2Q4P A;  3T1Y O;  4AI8 A;  3JD2 A;  3SPG A;  1IUR A;  4I55 A;  1QHT A;  2XTA A;  4DR7 O;  1I0H A;  5FNV A;  3ASO C;  2Y0I A;  5L3E A;  4PA3 A;  3ASO B;  5EBM C;  4K0K O;  2NNU A;  3JAR B;  1IBK B;  5GON A;  1L1F A;  3B8N A;  5LGN A;  1K97 A;  2LQT A;  2HP8 A;  5HFM A;  2DW4 A;  5B66 Z;  4DR4 B;  1ZLZ A;  1VAR A;  2Q7H A;  4PDR A;  3T2M A;  2FTK A;  3OFN G;  4K35 A;  4NTY A;  2AZ0 A;  1BHB A;  3KCY A;  3BRC A;  4LF5 O;  1IBL B;  4YJ3 A;  1E79 G;  4O4H B;  1VEW A;  2QWR B;  3RYI A;  3FYE B;  3E35 A;  3WB2 A;  2F4V O;  5IYZ B;  1NH2 B;  1NS1 A;  2HJD A;  3HKB A;  2UUB B;  4DR1 O;  2OCH A;  1YIJ V;  3OT7 A;  2JS3 A;  4JI1 O;  1NBM G;  2YXL A;  2V7Q G;  4MT8 A;  1NI8 A;  1CEZ A;  1G4Y B;  4U3J B;  5F2V O;  1FXK C;  1KEC A;  3IJ4 A;  2BTQ A;  1OCC B;  2FL4 A;  2BTO A;  3HKD B;  4EFE A;  2QM7 A;  4KXR A;  2V4D A;  3F5W C;  1FXK B;  5DEC A;  3JD4 A;  2CK3 G;  2GDS A;  5KA6 A;  3QVN A;  4LF8 B;  1QR9 A;  4XDK A;  2ZR3 A;  1XL4 A;  2Y4T A;  2B1G A;  3H1L H;  2YEV A;  1YEW A;  1YJW V;  4L87 A;  4MSW C;  2A9H A;  1NJI W;  1XI1 A;  4YJ2 B;  3K5O A;  2YIB D;  1Q5O A;  1V55 C;  1PD3 A;  3BFR A;  1ZL8 A;  3NXS A;  4N21 A;  2DQ3 A;  4QE7 A;  5J9P C;  1V55 B;  2ODM A;  3W7W A;  3RYI B;  3G6E V;  4LF9 O;  2UUC O;  1XNR B;  1M5I A;  1WAZ A;  2X0L A;  1M9N A;  3FFQ A;  4JAV A;  1ROP A;  4BWA A;  3QNE A;  1R3L C;  4PEL A;  4XBF A;  4FLT A;  2X7R B;  3CCU V;  5EBW C;  2YIC A;  2JEU A;  2UUA O;  3ZRW A;  2UU9 O;  1EFR G;  3CJH B;  1WLE A;  3B4S A;  5H6R A;  1VQ4 V;  2HFE C;  4DR3 B;  2OYQ A;  3KG2 A;  3SJC C;  4GX1 A;  1IBL O;  2DN9 A;  1EZJ A;  2B9Z A;  3A0B Z;  4LWS B;  1SQP H;  2C2A A;  2D2C B;  2YEV B;  3Q4H B;  3OTF A;  1WPB A;  3RN4 A;  4B08 A;  2ITD C;  5BMV A;  3RYF B;  3RGB A;  1PL4 A;  2F1M A;  2YID A;  3SPI A;  3BVO A;  1PL0 A;  1V9P A;  5IJ9 B;  4DUY B;  1WB7 A;  1P7B A;  4PI0 A;  4I0X A;  2K9P A;  2W0F C;  1BSM A;  3D3I A;  3E2E A;  4GCZ A;  4ZI7 A;  4ZIB A;  2IH1 C;  4Q20 A;  3E89 A;  1N32 O;  4O2A B;  1NR7 A;  3K04 A;  3CCM V;  1AJN A;  3STZ C;  3R65 A;  4O2B B;  3JYC A;  3FB7 C;  1JJO A;  2A3Q A;  1SER A;  2WSS G;  1NVP D;  2A0L A;  3FKS G;  4KUM A;  1SS3 A;  4GT1 A;  1M4U A;  1XEQ A;  2M7W A;  3VQV A;  4B3M O;  3KKY A;  5BR8 B;  2PTM A;  3I56 V;  3AG3 C;  4FLU A;  1M90 W;  1EZV H;  3K0D A;  4X1Y A;  1N36 B;  3ETD A;  2WLH A;  4D7S A;  2ZKO A;  4GX0 A;  1S72 V;  3AG3 B;  3CRR A;  1MZE A;  1PP9 H;  4WFH A;  2ZR2 A;  3ZS8 C;  4ASU G;  5L3B A;  5DM6 V;  1MZF A;  2HVJ C;  2HHH B;  1Y74 B;  5LXT A;  5JVD B;  1DF4 A;  3DXR A;  4LF4 O;  4X20 B;  4DUZ O;  1H38 A;  5EYP A;  5KHG A;  1FS0 G;  1SKV A;  3ABT A;  3E8B A;  4QGP A;  4IL6 Z;  4IIJ A;  3ZIA G;  4JI6 B;  3RYC A;  1AI4 A;  3E22 A;  5IY5 B;  1AR4 A;  2XAQ A;  1ZWI C;  1Q81 W;  2LP7 A;  1G6U A;  1KBH A;  2CH7 A;  4I5S A;  1UFI A;  4NB5 A;  3P32 A;  4JI7 O;  4DV3 B;  2DYR B;  4LF7 B;  3ICX A;  1UPG A;  5KA5 A;  5JJN B;  4FMT A;  3ZMV A;  3UKM A;  4IHJ B;  3L70 H;  5LYJ A;  3SYQ A;  5KMG A;  3MHH C;  3OUF A;  4X1Y B;  1VQP V;  2ETN A;  5LMN O;  4MVQ A;  4UUJ C;  4XDJ A;  4DO2 A;  3U0Z A;  4AQY O;  1QCE A;  1TUB A;  3ASN C;  2X6C A;  4NVP A;  1YIT V;  3K08 A;  2YIA A;  3ABL C;  2QA4 V;  3JD0 A;  3P3P A;  3ASN B;  1HR0 O;  4MTO A;  3ABL B;  4YY3 O;  4B3R B;  2V1D A;  4JF3 A;  5IJ0 A;  1BL8 A;  4MTG A;  3THO A;  4J11 A;  1E1Q G;  4RWU A;  4HNA A;  1IBM B;  3GWK C;  4DV2 B;  1JFF A;  1H2L A;  1JMK C;  4MS2 A;  3ZCC A;  2ARH A;  4WFB V;  4FM1 A;  1GN6 A;  1FFX A;  5B1O A;  4KL1 A;  3FAV B;  1Q8I A;  1N34 O;  1DK1 A;  2JEX A;  2ZDI A;  1WA8 A;  1AI5 A;  4JTC B;  4GKJ O;  1IX9 A;  3JAW A;  1Y67 A;  1MNG A;  4ZHQ A;  1H2S B;  1L0L H;  5EC2 C;  4WBN A;  3K58 A;  2XAJ A;  4GYC B;  2OTJ V;  1N33 O;  1SZT A;  2F93 B;  3JAS A;  2GUZ A;  4JI0 B;  2CGO A;  2EIL C;  3A2F A;  2JRI A;  1NU1 H;  2OCC B;  2QKC A;  3LUT B;  4JI2 B;  1JJ2 U;  3D36 A;  2EIL B;  4NXM O;  1YXB A;  4A5U B;  3H9V A;  3IC7 A;  4PDL A;  5CB4 A;  4JI3 B;  3F7V C;  3KZI Z;  3T1H B;  5LOV A;  1XMO O;  2LGQ A;  2UXN A;  3LSS A;  2B5U A;  3OAA G;  4UXN A;  4B7E A;  2LFS A;  1SQQ H;  2XND G;  3AG1 C;  1QLN A;  4O4L B;  1NR1 A;  1Z5W A;  2VS0 A;  4P9O A;  2QWQ B;  5IWA O;  3AG1 B;  2YUA A;  5IT9 N;  1YSC A;  1SA0 A;  3FB6 C;  4DR6 O;  3VOU A;  4DRX A;  1HNW O;  5D5P A;  4X1K B;  2XAH A;  3STL C;  2LO1 A;  4H44 B;  4Q6G A;  1O9H A;  3SYC A;  5CA1 B;  5LGU A;  4DW1 A;  1AI7 A;  4QJF B;  4FLX A;  1U96 A;  4RO2 A;  2QDO A;  3GWO A;  3LNN A;  2EZO A;  1VQ7 V;  3BY6 A;  4DV4 B;  2WLI B;  1GN3 A;  2IJK A;  4UCT A;  4O4J B;  3CCL V;  4DV7 B;  1VQM V;  5LP6 C;  4E2L A;  2JGU A;  2ZE7 A;  3FB5 C;  4HYO A;  3U10 A;  5KHJ A;  5LP6 B;  2HG5 C;  2HVK C;  3QF7 A;  3B2E E;  4I50 B;  1PPJ H;  4J9Y B;  2OT5 A;  1ZSP A;  1K9M W;  1M56 C;  3J7A U;  5CA3 A;  2CTW A;  4W4L A;  3CB2 A;  4JZ2 A;  3BHP A;  2IJI A;  1M56 B;  3JD1 A;  4X1I B;  5EC1 C;  1S76 D;  2QR4 A;  3T1Y B;  1BZK A;  5JH7 B;  4K8Z A;  2Q0O C;  2PI4 A;  4F6R B;  3RWR D;  4DR7 B;  4O4I A;  5JCO A;  1GAX A;  3ZHT A;  1YJ9 V;  1R6N A;  4UB8 Z;  4K0K B;  2ZE6 A;  3QO8 A;  4TUY B;  1MSD A;  1WN7 A;  3HKC B;  3JAK B;  1I94 O;  1THZ A;  4TV9 A;  4R7C A;  2QKS A;  3N27 A;  2NLJ C;  3APO A;  4TSF G;  1KC8 W;  3K0G A;  2AW9 A;  4OPH A;  4FFB B;  5TIS Z;  3KCX A;  2QM8 A;  2PY5 A;  2L6L A;  2GBO A;  1VF6 C;  2QM4 A;  1R3K C;  1WPX A;  3CX5 F;  3HKE B;  1YHQ V;  1DGS A;  2ZE8 A;  4LF5 B;  2O57 A;  4PDM A;  4J80 A;  3HB3 B;  1XMQ O;  3JAR A;  3H1K H;  2F4V B;  1IXM A;  1QLE C;  4YIP A;  4DR1 B;  4JI1 B;  3L71 H;  2GSM B;  1DLB A;  2UXD O;  1QLE B;  2E5L O;  3CYO A;  1AVM A;  1D5A A;  4L8J A;  3ZBH A;  5LA6 B;  3APQ A;  3JSL A;  1UJW B;  4X89 A;  3SPC A;  4RUF A;  1TA8 A;  1XIL A;  5B1B C;  4P9P A;  1Q86 W;  3CSX A;  1GM9 A;  5ITZ B;  1HNZ O;  4O4H A;  5B1B B;  1N4C A;  3CRA A;  5IYZ A;  5A9G A;  2UXC O;  2YDE A;  4FK5 C;  1H2N A;  1P4R A;  1NVP B;  1CPY A;  4B3S O;  3SJA C;  2VQF O;  2EJ7 A;  4DW0 A;  1R73 A;  2KSD A;  4U3J A;  4DV0 O;  4MTF A;  3N2K B;  2F95 B;  4DR2 O;  3HKD A;  4LF9 B;  1QVG U;  4Z2W A;  2UUC B;  1FXK A;  5KHI A;  1AB3 A;  2P4K A;  5B3S C;  5LL6 Y;  2N04 A;  2DJV A;  2CGN A;  1BHA A;  4LFC B;  2GHY A;  1AR5 A;  4JAS A;  4PHZ A;  5B3S B;  1BE3 H;  1QBZ A;  2BSK B;  1LR1 A;  2UUA B;  1VQN V;  1XRE A;  2XOK G;  3ZN0 A;  4I4T B;  4YJ2 A;  2UU9 B;  2EUL A;  4TQF A;  3JCZ A;  4OGQ B;  2Y48 A;  4PA7 A;  2W6I G;  2ZM6 O;  4BR6 A;  4UCU A;  1S77 D;  4CZZ A;  4RQF A;  3OMA B;  4DR5 O;  5J2T B;  1TVK B;  1YZB A;  4PV1 B;  1Q6U A;  4UCV A;  1OZ0 A;  5EIB D;  4PD4 F;  2E3C A;  3VQY A;  2RNB A;  5K1P A;  3MD0 A;  2XUM A;  1D5N A;  2R9R B;  1RFY A;  2FML A;  2YI9 A;  2YI8 A;  4JYY A;  3ETQ A;  1KD1 W;  3FX7 A;  2N74 A;  3S3W A;  1GM7 A;  3CJH A;  2KG7 B;  3CCV V;  4NXN O;  3LDC A;  2IBZ H;  4PDV A;  1N32 B;  4LWS A;  3RYH B;  4YHH O;  1KKC A;  2YSU B;  2Q9L A;  3Q4H A;  1KB9 F;  5AG2 A;  4LR3 A;  2WPD G;  3RYF A;  5KX5 B;  2H3O A;  1I5Y A;  3K5M A;  5IJ9 A;  4B3M B;  5D5Q A;  1GTO A;  4GUN A;  3P3N A;  2L35 A;  3OTO O;  4AIL C;  2PUS A;  1OCZ C;  5J2U B;  1K5S A;  2Y69 C;  1OCZ B;  3AK1 A;  2KKW A;  2LGW A;  1QNM A;  4O2A A;  5IYB O;  4LFC O;  1KP3 A;  2Y69 B;  4O2B A;  4LF4 B;  2ZCE A;  3CCQ V;  1R6K A;  4DUZ B;  4UCS A;  4FZ0 A;  1F7Y A;  3S3X A;  1XNQ O;  3CD6 V;  1S3J A;  1N8R W;  4ZOL B;  2EBO A;  4G2K A;  4X62 O;  1K7D A;  1H2G A;  2AHZ A;  2Z0A A;  4MVZ A;  1PNK A;  3K3W A;  4BIZ A;  1GKF A;  1EM1 A;  2DWE C;  2GTA A;  4FLZ A;  2BCC H;  4E4E A;  1SC5 B;  2R9A A;  1PM9 A;  3D3Q A;  4JI7 B;  2IM9 A;  4IT5 A;  1Q3E A;  1URF A;  3RFR A;  2WA4 A;  1WJZ A;  4MVO A;  2E76 B;  5E79 Z;  4LFA O;  1Y74 A;  3G67 A;  5JVD A;  3OR7 C;  4X20 A;  5JWP A;  2XAG A;  1QVF U;  3HPL C;  3I55 V;  3BEH A;  5LMN B;  1TUE B;  4AQY B;  3ZHU A;  4F6E A;  3C90 A;  4QE9 A;  3TCU A;  2P5O A;  5BZB A;  3CEI A;  3E8G A;  3ZRX A;  1QR8 A;  3UT5 B;  2Q7G A;  4LP8 A;  4U7O A;  1HR0 B;  1JOY A;  4YY3 B;  1RSO B;  1YJN V;  4IHJ A;  4DK0 A;  4JTA B;  1F51 A;  2AZ2 A;  3N2G A;  1YVW A;  3CCS V;  3H01 A;  1MA1 A;  4J7K A;  2JJ2 G;  3RVZ A;  3W7U A;  3ZMZ A;  4X66 O;  2WLM A;  1VQL V;  1WP7 A;  1W2B U;  4BAY A;  1SQF A;  2QKA A;  3ABU A;  5H5N A;  2Q0A A;  4UVA A;  3TGU H;  1FFT B;  1GM8 A;  1N34 B;  2HEP A;  2IU3 A;  3QTC A;  4DV1 O;  5FL7 G;  1T5E A;  4GKJ B;  2WWW A;  3SJQ C;  2RQ6 A;  1PV0 A;  2XAS A;  3ZMT A;  1MAB G;  2Q7E A;  2CUG A;  3H1J H;  3G4S V;  1N33 B;  2MW2 B;  3OGC C;  3SPJ A;  4MW8 A;  2LJ2 A;  4Z1V A;  2EIJ C;  3LSU A;  4JV5 O;  1AJQ A;  3LDE A;  3L73 H;  2IJJ A;  4NXM B;  2EIJ B;  2Z5U A;  1L0N H;  3FAV A;  3GB7 C;  3N2G B;  1Y76 B;  1EBO A;  5CN0 A;  5LMU O;  1RM1 C;  1Y4M A;  4FIP C;  1XMO B;  1LUW A;  3SR2 C;  2ZNI A;  1R1B A;  1RM1 B;  3K57 A;  4QNH B;  2A7W A;  2P7T C;  2VWJ A;  3DC5 A;  1XOU A;  4GZR B;  2P6J A;  4ZBM A;  2UXB O;  1GO3 F;  1RPO A;  5IWA B;  1ENV A;  1SZX A;  4TV8 B;  4LH7 A;  4DR6 B;  1CXZ B;  2EIN C;  1HNW B;  3K79 A;  4J7Z A;  4R50 A;  4TQD A;  4DXW A;  2QE7 G;  3SGI A;  1WNS A;  2EIN B;  1ARO P;  3M99 B;  2OIG A;  4UV9 A;  4H37 A;  2Q68 A;  1FAF A;  3ETE A;  3C3T A;  1NQT A;  2EX3 A;  2WLN A;  2WA3 A;  2ADQ B;  4H0L B;  3CXC U;  3CXH F;  1IDS A;  1G8M A;  3CE2 A;  4O4L A;  1TAE A;  2WLL B;  4FZ1 A;  1JVM A;  1MMM A;  3OE7 G;  4DV6 B;  2UXX A;  3EHB B;  1KQS U;  4KP4 A;  3JAL A;  1ZAU A;  4NTX A;  4LFB O;  1VQ9 V;  2PYL A;  4QPK A;  4X1K A;  5GTI Z;  3I5D A;  1YTF D;  2F43 G;  5CA0 B;  2OIE A;  5CA1 A;  3CRQ A;  3R66 A;  2YS8 A;  2QWO B;  5LHI A;  2JGD B;  1F4N A;  1K73 W;  3IGA C;  2WLI A;  4O4J A;  1KMI Z;  1TGO A;  1DTO A;  3L72 H;  1OCO C;  3T1C A;  4LF6 B;  1KUQ A;  2RN9 A;  1VF7 A;  1XL6 A;  3OMN B;  2YXY A;  5LP6 A;  3OR6 C;  3QO7 A;  5LHH A;  4YXW G;  2W0X A;  1L8D A;  3CWB H;  3IAY A;  3K06 A;  4I50 A;  4ZKI A;  2RCV A;  3E8F A;  2WAM A;  3K5L A;  2Y4U A;  1A32 A;  1JA8 A;  1I94 B;  1WB8 A;  3TK1 A;  1VIB A;  4X1I A;  2A06 H;  3JAL B;  5JH7 A;  3OW2 U;  4MVM A;  4GKK B;  4F6R A;  1M93 A;  4IGG A;  2QTO A;  5KAF Z;  4FPP A;  2YIB A;  2BOB C;  3AG2 C;  2D3O W;  3TJT A;  1YI2 V;  1P7G A;  4PA6 A;  4N23 A;  1DF5 A;  2EIK C;  1VQ6 V;  3AG2 B;  3A0H Z;  5EIB C;  1XMQ B;  1FXH A;  1VMG A;  4TUY A;  2KQX A;  3F5T A;  3HKC A;  4CBC A;  2EIK B;  4PI2 A;  3JAK A;  2QGN A;  1M57 C;  2UXD B;  2OTL V;  4DV6 O;  2E5L B;  3UCS C;  4XDL A;  2QJ1 A;  1AP5 A;  1NTM H;  3W7S A;  4X65 B;  4RQE A;  2A79 B;  1M57 B;  4FFB A;  1IXB A;  2QWP B;  5LGT A;  2JDI G;  3HKE A;  4P2Z A;  1HNZ B;  1VF6 A;  2P90 A;  4EB6 B;  2EZP A;  1K34 A;  4X9Q A;  4PA9 A;  3FYI B;  3K9A A;  3TXS A;  2UXC B;  1YCI A;  5GTH Z;  2JS5 A;  4WFG A;  1CP9 A;  2Q5Z A;  1I7F A;  1VF5 B;  4LF6 O;  3CCE V;  4B3S B;  2WLJ A;  4JYA O;  3JCU Z;  2VQF B;  1W59 A;  5LA6 A;  5EZY B;  2VQE O;  1KU9 A;  4DV0 B;  2LFR A;  1Z2G A;  3CC4 V;  4DR2 B;  3AG7 A;  4P30 A;  5DN6 G;  4JI8 B;  4X8A A;  1Q82 W;  5IYD O;  3H1H H;  2ADP A;  1O9G A;  4MW3 A;  4KFM A;  4H33 A;  4FFK A;  5ITZ A;  2CDY A;  3SYA A;  1FJG O;  1AP6 A;  1YF2 A;  1ZTE A;  4GKK O;  4GLX A;  2ZIO A;  4CH4 A;  1NTK H;  4LNU B;  2FB5 A;  2ZM6 B;  4TOI A;  3ZHR A;  4DYL A;  3N2K A;  3W7X A;  4DR5 B;  3VQX A;  4FLY A;  4J10 A;  2AXT Z;  2PI5 A;  2RDC A;  5B5E Z;  1JCH A;  1BCC H;  2FKX A;  3BA9 A;  4X65 O;  3P30 A;  4BW9 A;  2BSK A;  5EK0 A;  2P67 A;  4BW5 A;  1QU7 A;  3ETG A;  2R70 A;  3J80 N;  1SRY A;  2H8P C;  4I4T A;  5JQG B;  4RUE A;  2F66 C;  1JR9 A;  4NXN B;  2WLK A;  1GN4 A;  3L75 H;  2X6B A;  4IYH A;  3LDD A;  1PKX A;  4YHH B;  5J2T A;  2Q6A A;  1TVK A;  2N05 A;  2QTS A;  1K3E A;  4NR1 A;  1GRJ A;  2Q69 A;  5B1A C;  2CE4 A;  1S5H C;  2ZXW C;  3O9O A;  3VQW A;  3ZHQ A;  2LW1 A;  3OTO B;  2ZXW B;  4JI8 O;  5JJJ B;  2KG7 A;  1KKD A;  5C8Y B;  1ZX3 A;  2CTR A;  1B3Q A;  3DSQ A;  3RW0 A;  2IU0 A;  3RYH A;  1HNX O;  1VQ8 V;  1SF9 A;  1XNQ B;  1S5L Z;  3SDL A;  5KX5 A;  5LBQ A;  4GX2 A;  4X62 B;  3BPZ A;  1BS3 A;  1P84 F;  2LW7 A;  4JI4 O;  4WCE V;  2ILM A;  2YXH A;  3JD3 A;  4X64 B;  1H8H G;  3CMA V;  2R72 A;  2VWK A;  5L3D A;  3JAT B;  5J2U A;  1JPX A;  3E86 A;  3BA8 A;  1RP3 B;  2DMX A;  4HAM A;  1OV9 A;  3MDS A;  5KUM A;  2P22 C;  4WFF A;  4LFA B;  3SPH A;  3EXA A;  3ML0 A;  1LNQ A;  1XHX A;  1X4T A;  3G6B A;  1GH6 A;  1SQV H;  4UV8 A;  1X59 A;  2PGG A;  4ZOL A;  3MHS C;  3E83 A;  4B3T B;  1XBL A;  5KHK A;  1J5E O;  5FLX N;  2NN4 A;  5FPR A;  4I55 B;  1W0K G;  1Y6X A;  2QEX V;  1OCC C;  5FNV B;  1U97 A;  2DE0 X;  1NZ6 A;  2JK5 C;  2DQ0 A;  4EEQ A;  4J42 A;  1YDX A;  3AK2 A;  3MAQ A;  4NYK A;  1R3J C;  3OM3 B;  3SJB C;  4I9W A;  3H1I H;  1BQ0 A;  4CC5 A;  5GON B;  3OD4 A;  1XDC A;  5A2Q N;  4X66 B;  3G80 A;  3K59 A;  4CH6 A;  3ZHS A;  3ZMS A;  3G71 V;  5L3C A;  4JI5 O;  1N0N A;  1KYO F;  5C93 A;  4KHP B;  4FM2 A;  5H9C A;  3UQ8 A;  2PYJ A;  1PNM A;  1HWY A;  4YJ3 B;  2E75 B;  4DV1 B;  4JYB A;  4JGS A;  3UT5 A;  1FKA O;  3UM7 A;  1AI6 A;  1RSO A;  3HKB B;  1IBK O;  4FJC C;  1SET A;  2ZIN A;  3AK3 A;  3M8A A;  1K4D C;  2ZNJ A;  4X64 O;  2Z3Y A;  2ZIM A;  1RPR A;  1ZUQ A;  2HLD G;  4MVS A;  1OHH G;  3WG7 C;  4DR4 O;  1YTF B;  4MVU A;  4ABM A;  4WF9 V;  2BTQ B;  5BY1 A;  4JV5 B;  1FPO A;  5BXZ A;  3WG7 B;  3EFF K;  4Z1M G;  5LMU B;  3U11 A;  3WB1 A;  2QWN B;  4B3T O;  3L9D A;  2UUB O;  4I7Z B;  2Q8V A;  3ABK C;  1ZL8 B;  2JJ1 G;  5E1A C;  2UXB B;  2G38 A;  4UFZ A;  5B1N A;  3ABK B;  2YC0 A;  1S5J A;  4U3F H;  3K5N A;  2BE3 A;  4BIO A;  4JAU A;  4LCU C;  4LF8 O;  1Y76 A;  2HKO A;  3OEE G;  1WP8 A;  4HBN A;  3E8H A;  2H94 A;  3TET A;  2Y0P A;  4JZG A;  1BT8 A;  2DOS A;  3ZRW B;  4FM0 A;  2IH3 C;  1H2K A;  3DTU B;  3O65 A;  5JJE B;  4KHP O;  1F23 A;  5CBG A;  1XUQ A;  3CPW U;  4B7K A;  4FLV A;  1IZ3 A;  4UB6 Z;  4CS3 A;  4TV8 A;  3FB8 C;  4YIO A;  1XNR O;  5KUK A;  2GTS A;  1XQ8 A;  5BMV B;  2B1I A;  4LFB B;  5KHH A;  3CRM A;  1PNL A;  3B09 A;  4GX5 A;  1F4M A;  3ABM C;  4LBE C;  4IYI A;  2HJF C;  1Q6H A;  4I0X B;  3M7M X;  3ABM B;  2K1E A;  4U7N A;  4ZI7 B;  5IY5 C;  4ICG A;  2IW5 A;  2XAF A;  4DR3 O;  2CTQ A;  2WLL A;  5K1X A;  4TWK A;  1K33 A;  2DYR C;  1Q7Y W;  5DED A;  2NR5 A;  4F4L A;  1NH2 D;  3CCR V;  2ZT9 B;  4G28 B;  2IJH A;  1E1R G;  4R6Z A;  1R6T A;  1K5Q A;  4I9Q A;  2ZD9 A;  1I5X A;  2QSA A;  1COW G;  1B04 A;  4DUY O;  1M1K W;  3HR0 A;  5CA0 A;  1BQZ A;  2DWD C;  1AJP A;  3IC9 A;  2JGD A;  2RJZ A;  3DGE A;  3IFX A;  2BOC C;  3UO3 A;  2ITC C;  4EFB A;  1B06 A;  3LNM B;  5LXT B;  3CC7 V;  3DXR B;  3WB0 A;  3CCJ V;  4JTD B;  2PZS A;  1OJH A;  3VBB A;  4PJ0 Z;  3BCC H;  5EYP B;  3QG5 A;  1EN5 A;  4LH6 A;  5BR8 O;  4EKW A;  4IIJ B;  1FD9 A;  3RYC B;  3E22 B;  2Q67 A;  2JIZ G;  4J7J A;  4DV5 B;  5CBF A;  1N36 O;  5GW7 A;  3AEI A;  4AHC A;  2RMK B;  2EJR A;  4BIU A;  1SQB H;  1HDJ A;  2CH7 B;  5KLV H;  3AG4 C;  3BAB A;  1S0V A;  3CS5 A;  3OGI B;  3FD9 A;  2JVD A; 
#chains in the Genus database with same CATH homology
 4RQF A;  1AJN A;  3OMA B;  4X8A A;  1Q82 W;  1VQK V;  5IYD O;  1MOF A;  3AG4 B;  3STZ C;  3R65 A;  3ZJZ A;  3CP1 A;  3JYC A;  3FB7 C;  1OZ0 A;  4MW3 A;  1SER A;  3LSQ A;  4KFM A;  3F7Y C;  2WSS G;  4H33 A;  2A0L A;  3FKS G;  4KUM A;  1NVP D;  4GT1 A;  3MD0 A;  3SYA A;  2M7W A;  2KB1 A;  4JYC A;  5IDJ A;  3I56 V;  2R9R B;  3AG3 C;  1M90 W;  3B77 A;  3K0D A;  3ETD A;  2WLH A;  1KD1 W;  4GX0 A;  1S72 V;  1GM7 A;  2OCC C;  3AG3 B;  5CMU A;  3CCV V;  1OCO B;  3LDC A;  4PDV A;  4WFH A;  2ZR2 A;  2DYS C;  3W7X A;  4ASU G;  5L3B A;  5DM6 V;  1VQO V;  2HVJ C;  3B8M A;  2YSU B;  2DYS B;  2PI5 A;  1DF4 A;  4TT3 G;  1GK9 A;  4X88 A;  2WPD G;  1H38 A;  1JCH A;  1I5Y A;  1FS0 G;  3ABT A;  3OUS A;  1GTO A;  3E8B A;  3CC2 V;  3A0R A;  3P30 A;  3SYP A;  5EK0 A;  2P67 A;  3ZIA G;  4BW5 A;  1AI4 A;  4JPR A;  3RBZ A;  5IY5 B;  3ETG A;  2XAQ A;  1ZWI C;  2R9I A;  1Q81 W;  2LP7 A;  1SRY A;  1OCZ C;  2H8P C;  2ZDI C;  4I5S A;  4RUE A;  1K5S A;  2MK3 A;  3P32 A;  3ZMU A;  2DYR B;  2WLK A;  2Y69 C;  2AHY A;  1OCZ B;  5KA5 A;  3ZRV A;  2X6B A;  4FMT A;  3ZMV A;  3UKM A;  3LDD A;  5IYB O;  1PKX A;  1KP3 A;  1KP2 A;  3SYQ A;  2Q6A A;  2Y69 B;  4MVR A;  5LHG A;  3MHH C;  3CCQ V;  1K3E A;  3OUF A;  1R6K A;  1VQP V;  2Q69 A;  3CD6 V;  1S3J A;  5B1A C;  3ZRS A;  3OMI B;  1S5H C;  2EBO A;  4G2K A;  1N8R W;  2ZXW C;  4HZ3 A;  4UVC A;  1K7D A;  1H2G A;  2AHZ A;  4MVZ A;  1PNK A;  2HR3 A;  3K3W A;  3PJS K;  4BIZ A;  4MVQ A;  4UUJ C;  4XDJ A;  4DO2 A;  3T4Z A;  1GKF A;  2DWE C;  1QCE A;  2ZQM A;  2ZXW B;  2W6J G;  3ASN C;  1GMG A;  2X6C A;  1YIT V;  3K08 A;  3ABL C;  1KKD A;  2QA4 V;  3JD0 A;  5L3G A;  4QIW F;  3ASN B;  1BMF G;  4MTO A;  3ABL B;  3RW0 A;  2IU0 A;  2V1D A;  4JF3 A;  4MVO A;  1VQ8 V;  1BL8 A;  4RAI A;  4MTG A;  1H8E G;  3OR7 C;  1E1Q G;  1OCR C;  2XAG A;  5H6Q A;  1QVF U;  3HPL C;  5LBQ A;  4GX2 A;  1OCR B;  4MS2 A;  1AR1 B;  3ZCC A;  3I55 V;  3BEH A;  4WCE V;  4WFB V;  3JD3 A;  1TUE B;  1H8H G;  3CMA V;  5B1O A;  4QE9 A;  5L3D A;  3TCU A;  1JQ0 A;  5BZB A;  1JPX A;  3E86 A;  3SYO A;  3E8G A;  3ZRX A;  1QR8 A;  4LP8 A;  1R3I C;  2JEX A;  4U7O A;  2ZDI A;  4HAM A;  1AI5 A;  1JOY A;  4JTC B;  1FXV A;  5KUM A;  1YJN V;  4WFF A;  1VQ5 V;  4JTA B;  1F51 A;  3SPH A;  3CCS V;  3H01 A;  2JJ2 G;  5EC2 C;  3RVZ A;  3ML0 A;  3W7U A;  1LNQ A;  3ZMZ A;  1B6Q A;  2WLM A;  2XAJ A;  1VQL V;  4UV8 A;  2OTJ V;  1W2B U;  1SZT A;  4BAY A;  3MHS C;  3ABU A;  3E83 A;  1ORQ C;  4G27 B;  3W7T A;  5EBL C;  2ATK C;  2EIL C;  5CBH A;  1Y66 A;  2EIM C;  3K03 A;  1W0K G;  4LC1 A;  2OCC B;  3LUT B;  2QEX V;  1OCC C;  4QPJ A;  4UVA A;  1JJ2 U;  5IYC O;  1FFT B;  1GM8 A;  2JK5 C;  2EIL B;  3D36 A;  2DQ0 A;  2EIM B;  5L3F A;  3IC7 A;  2IU3 A;  4PDL A;  1NKD A;  3ZN1 A;  3X2Q C;  5FL7 G;  3RVY A;  3F7V C;  1K4C C;  1R3J C;  1W0J G;  2WWW A;  3OM3 B;  3QO5 A;  3SJQ C;  2UXN A;  4I9W A;  3LSS A;  3X2Q B;  2B5U A;  3OAA G;  2XAS A;  4UXN A;  3T4D A;  3ZMT A;  1MAB G;  1SES A;  2LFS A;  3G4S V;  2XND G;  4MTX A;  3AG1 C;  1QLN A;  3ZMS A;  3OGC C;  3G71 V;  1NR1 A;  5L3C A;  3SPJ A;  4MW8 A;  4P9O A;  4WFE A;  2EIJ C;  4OXS A;  5HFL A;  5C93 A;  3AG1 B;  1AJQ A;  4WFA V;  1YSC A;  5H9C A;  3LDE A;  1JX9 A;  2IJJ A;  3FB6 C;  2EIJ B;  2Z5U A;  1V54 C;  1PNM A;  3GB7 C;  3VOU A;  1HWY A;  1MG1 A;  1K92 A;  4JGS A;  4JYB A;  1EBO A;  4R8C A;  4PA4 A;  4UVB A;  5CN0 A;  2XAH A;  1RM1 C;  3STL C;  1V54 B;  3UM7 A;  1AI6 A;  4J9Z B;  1Y4M A;  3OEH G;  4FIP C;  4FJC C;  3SYC A;  1SET A;  5LGU A;  1RM1 B;  2X6A A;  1AI7 A;  1K4D C;  4QJF B;  5B1A B;  4QNH B;  1MSW D;  4RO2 A;  2P7T C;  2Z3Y A;  3GWO A;  3WFV A;  1K8A W;  1RPR A;  2EZO A;  4MVS A;  2HLD G;  1VQ7 V;  3BY6 A;  1OHH G;  2WLI B;  3WG7 C;  2IJK A;  1J95 A;  3CME V;  3CCL V;  1YTF B;  1VQM V;  4MVU A;  4WF9 V;  2P6J A;  4ZBM A;  1GO3 F;  1RPO A;  4E2L A;  3JD2 A;  3SPG A;  1ENV A;  3FB5 C;  4HYO A;  3WG7 B;  3EFF K;  4Z1M G;  3ASO C;  5L3E A;  2EIN C;  2HG5 C;  2HVK C;  3K79 A;  4R50 A;  4DXW A;  4PA3 A;  3ASO B;  5EBM C;  2QE7 G;  4J9Y B;  2EIN B;  2OT5 A;  1K9M W;  2NNU A;  1ARO P;  1M56 C;  3M99 B;  4UV9 A;  4H37 A;  5CA3 A;  2Q68 A;  1L1F A;  3ETE A;  3B8N A;  2IJI A;  1M56 B;  1NQT A;  2WLN A;  5LGN A;  3JD1 A;  1K97 A;  5EC1 C;  1S76 D;  3CXC U;  5HFM A;  3ABK C;  2JJ1 G;  1G8M A;  2DW4 A;  5E1A C;  2WLL B;  1JVM A;  2PI4 A;  5B1N A;  3OE7 G;  3ABK B;  3T2M A;  4PDR A;  2UXX A;  2FTK A;  3OFN G;  3EHB B;  1KQS U;  4KP4 A;  1BHB A;  4JAU A;  4LCU C;  1VQ9 V;  2HKO A;  1E79 G;  1YJ9 V;  3OEE G;  1R6N A;  4QPK A;  3E8H A;  2H94 A;  3FYE B;  3E35 A;  3QO8 A;  1YTF D;  3TET A;  2F43 G;  1NH2 B;  3ZRW B;  1YIJ V;  1THZ A;  2IH3 C;  1NBM G;  4R7C A;  2QKS A;  3DTU B;  2NLJ C;  5LHI A;  2V7Q G;  4MT8 A;  1F23 A;  5CBG A;  1F4N A;  4TSF G;  3CPW U;  1K73 W;  1KC8 W;  3IGA C;  3K0G A;  2WLI A;  1CEZ A;  1G4Y B;  1FXK C;  1KEC A;  1DTO A;  2QM8 A;  1OCC B;  1OCO C;  3T1C A;  1XL6 A;  1R3K C;  2QM7 A;  3OMN B;  1WPX A;  3F5W C;  3FB8 C;  1FXK B;  3OR6 C;  3QO7 A;  5LHH A;  4YXW G;  1YHQ V;  5KUK A;  3JD4 A;  2CK3 G;  5KA6 A;  1QR9 A;  2B1I A;  4XDK A;  3K06 A;  1PNL A;  4PDM A;  2ZR3 A;  1XL4 A;  4ZKI A;  3HB3 B;  1F4M A;  4GX5 A;  3ABM C;  4LBE C;  3E8F A;  2B1G A;  1IXM A;  2WAM A;  2YEV A;  1QLE C;  2HJF C;  1YJW V;  4L87 A;  4MSW C;  2A9H A;  1NJI W;  3ABM B;  2K1E A;  4U7N A;  2GSM B;  1DLB A;  3TK1 A;  1QLE B;  5IY5 C;  1V55 C;  3CYO A;  2IW5 A;  1PD3 A;  2XAF A;  3NXS A;  4N21 A;  2DQ3 A;  2WLL A;  1UJW B;  4QE7 A;  4X89 A;  3OW2 U;  4MVM A;  5J9P C;  4TWK A;  3SPC A;  1V55 B;  1K33 A;  2DYR C;  1Q7Y W;  3W7W A;  4RUF A;  4F4L A;  2QTO A;  3G6E V;  1NH2 D;  4FPP A;  3CCR V;  2BOB C;  3AG2 C;  5B1B C;  4P9P A;  2D3O W;  1Q86 W;  1YI2 V;  2X0L A;  1M9N A;  4PA6 A;  4G28 B;  1GM9 A;  4JAV A;  1ROP A;  2IJH A;  1DF5 A;  4N23 A;  2EIK C;  3QNE A;  1E1R G;  1VQ6 V;  4R6Z A;  1K5Q A;  1R3L C;  3AG2 B;  5B1B B;  4PEL A;  4XBF A;  2ZD9 A;  1I5X A;  1FXH A;  1COW G;  2X7R B;  3CCU V;  5EBW C;  4CBC A;  1M1K W;  2EIK B;  2JEU A;  3ZRW A;  2DWD C;  1M57 C;  1AJP A;  4FK5 C;  1P4R A;  2OTL V;  1NVP B;  1CPY A;  1EFR G;  1WLE A;  5H6R A;  4XDL A;  1VQ4 V;  2HFE C;  3W7S A;  4RQE A;  2A79 B;  1R73 A;  1M57 B;  3KG2 A;  3DGE A;  4GX1 A;  4MTF A;  3IFX A;  2BOC C;  1EZJ A;  2ITC C;  2C2A A;  3LNM B;  1QVG U;  2YEV B;  2JDI G;  5LGT A;  3CC7 V;  1FXK A;  2ITD C;  4P2Z A;  3CCJ V;  4JTD B;  3VBB A;  5B3S C;  2P90 A;  3SPI A;  2EZP A;  1PL0 A;  1BHA A;  2GHY A;  1K34 A;  4JAS A;  4PA9 A;  3FYI B;  5B3S B;  4EKW A;  1QBZ A;  3K9A A;  1P7B A;  1VQN V;  2Q67 A;  2JIZ G;  2W0F C;  5CBF A;  3AEI A;  1CP9 A;  4WFG A;  2XOK G;  5GW7 A;  3ZN0 A;  3D3I A;  3CCE V;  2EJR A;  4BIU A;  2WLJ A;  4GCZ A;  3E2E A;  3JCZ A;  2IH1 C;  2Y48 A;  4PA7 A;  2W6I G;  3AG4 C;  1S0V A;  4Q20 A;  2LFR A;  3E89 A;  3CC4 V;  1NR7 A;  1S77 D;  3K04 A;  4P30 A;  5DN6 G;  4CZZ A;  3CCM V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...