1NVPB

Human tfiia/tbp/dna complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
43
structure length
43
Chain Sequence
TVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*GP*GP*GP*GP*GP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*G)-3'
publication title Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 16
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2003-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1nvpB00
5CA3A 3D3IA 1NVPB 5GW7A 1NH2B 3E35A 3W7UA 2P90A 1YTFB 3IC7A 3BY6A 3W7TA 4HAMA 3W7XA 1RM1C 3W7WA 1S3JA 3W7SA 2HR3A 2WAMA
chains in the Genus database with same CATH superfamily
4K35A 4H13B 1Q7YW 4NTWA 2UUCO 1WNSA 1KKDA 2R70A 3AG4C 4O4HA 1YTFB 4MVRA 1TUBA 2UUCB 5H6RA 1BHBA 2EIJC 1SS3A 3AK1A 3OGIB 1VARA 1TUEB 2OT5A 3RYCA 1PL0A 2Q5ZA 2JS3A 2FTKA 1QBZA 2QWPB 4ZOLB 4P2ZA 1OCOC 3B2EE 4DV5O 2X6AA 1NI8A 1RSOB 3JARA 4OPHA 1QVFU 5IWAO 5EBMC 4G27B 3HKEB 3ABMB 4DV5B 2W0XA 5IWAB 1VQ5V 5CA1A 1GM8A 4BIOA 2L6LA 3Q4HA 1AP6A 3FD9A 4PA4A 4XDKA 4IL6Z 5KHJA 5IYBO 1I5YA 3CJHA 4J80A 3IC7A 4DV3O 5CMUA 3CCUV 4YJ3A 1SESA 2AW9A 4RQFA 4TQDA 4DRXA 2ZQMA 5FPOA 1DGSA 3RYFA 2YEVA 1V9PA 3BPZA 2ZM6O 1GN6A 1SF9A 2PGGA 2QM4A 3TJTA 4YJ2A 2ZM6B 2B9ZA 2WLNA 4CC6A 4UFZA 4K0KO 3E8HA 5H6QA 1SZXA 5ITZA 1N33B 4K0KB 4PV1B 4MTGA 4J9ZB 2EINB 2HJFC 3CCQV 1EN6A 3AG2B 1Z5WA 2XHBA 1JA8A 2FMLA 2ZXWB 1GO3F 1AJNA 1EZVH 3WB0A 1VF6A 4JI5O 2DYSB 5FPRA 1AVMA 2RQ6A 3OT7A 4JI5B 1W2BU 4CH6A 1CP9A 1JR9A 1P4RA 5L3FA 1F4NA 4MVUA 2LGWA 3K08A 4DR5O 1GH6A 4MT8A 3GWKC 2Y48A 3ZN1A 2DYRB 2BTOA 3H1LH 4DR5B 4JI4B 5E1AC 2V4DA 4NYKA 4R7CA 4B3SO 3N2GB 4ZBMA 3H1IH 1GM7A 1YDXA 4PD4F 4X8AA 2WSSG 4EFEA 3ABKB 2ADPA 4MVSA 5L3DA 3DSQA 2PI4A 1GMGA 4WFBV 1FYJA 4O2BA 3UT5A 1SQQH 1HW7A 1Y74A 4H0LB 1VF6C 3OMNB 2M7WA 3E89A 2IJHA 1MSDA 4QE9A 1Y76B 4J7KA 1JJOA 1GN2A 4QPJA 1I08A 4WFHA 4TV8A 4MTXA 4I55B 3LSQA 3VQXA 2GDSA 2BCCH 1JX9A 1KP3A 2HVKC 2QEXV 4I4TB 3SPJA 3TXQA 1HR0O 1O9HA 4ASUG 1MNGA 1AROP 1EM1A 2JRIA 1QLEC 4TSFG 1AJQA 2EIJB 5CBHA 3CPWU 3RGBA 1SQBH 3AEIA 1M93A 4F6EA 1IBLB 1Q6UA 4FVMA 4I50A 5LOVA 4JASA 4W4KA 1KMIZ 3IFXA 1KKCA 4FFBB 3GWOA 1M56C 1OCOB 4PDMA 4AHCA 1L0NH 3H9VA 5BR8O 1ENVA 3E2EA 1AR5A 5CA0A 1S5LZ 2BSKA 3MHSC 4LR3A 3ZHQA 3H1KH 1I0HA 2ZKOA 4YHHO 4JPRA 3SYQA 1SQXH 4YHHB 2QTSA 5KHKA 4LH6A 4O4HB 1QU7A 1HNXO 1TUBB 3E35A 4ZKIA 1R3IC 2LFSA 5H2FZ 1H2MA 1HNXB 3RYCB 3W7XA 2XNDG 4FJCC 3WU2Z 5CN0A 5JVDA 1W0KG 3SPHA 3UCSC 3JARB 3QVNA 3OMAB 2HFEC 2AGAA 3U0ZA 4MW3A 4PA3A 4NVPA 4L8JA 2JEXA 5L3CA 2DN9A 4GCZA 3DTUB 5CA1B 1WLEA 3J80N 3Q4HB 1EFRG 1VQ7V 1F51A 1AB3A 4I7ZB 4MTFA 4LF6O 3SYCA 3CXCU 1PD3A 3CJHB 1Q82W 1VQOV 4LF6B 4NR1A 1R6NA 5LXTB 3WB2A 4YJ3B 3LSSA 1N4CA 2EZOA 3L9DA 4OX9O 4DRXB 2EX3A 4HAMA 2JS5A 3ZS8C 1DLBA 3RYFB 1Q5OA 2YEVB 5KLVH 1IURA 4OX9B 1VQ4V 2F43G 4PDRA 2CK3G 4J42A 3BFRA 3FFQA 1TGOA 4YJ2B 1BL8A 3CB2A 4UCOA 1WA8A 2GBOA 2QKCA 3SDLA 4F4LA 3JD4A 3BA9A 4KUMA 4Z1VA 1NVPD 1KQSU 3CRRA 5ITZB 2P5OA 5KAIZ 5LL6Y 4DV7O 4IGGA 2YC0A 4DV7B 3FB7C 4O2AA 1WB8A 3UM7A 2HG5C 1CPYA 4TUYA 4C7UA 1K7DA 1FAFA 2YSUB 5KA6A 4FIPC 1R6KA 5B1NA 1YJ9V 2NNUA 2HVJC 3LNMB 4E4EA 4PI2A 5JJEB 1QNMA 1RM1C 4LP8A 1VQLV 4FLUA 4DR3B 1M90W 3FB6C 3ZMTA 1QCEA 2IU0A 2QM7A 2M6YA 3CWBH 3C3TA 1YXBA 1GRJA 1HWYA 3QO7A 4ZIBA 2JGUA 1JOYA 1J5EB 4WBNA 4I5SA 1K73W 2Z5UA 2X6CA 1DK1A 1SQGA 1MMMA 5B1BC 3OEEG 1QLEB 3ZMUA 1VIBA 2HEPA 1OCRC 2Q0OC 2UXDB 4MTOA 4O2BB 2QJ1A 3UT5B 1Y74B 1I5XA 2H94A 1FFTB 3SR2C 1OCZC 1M56B 2CGNA 5LYJA 1Y6XA 3H1JH 5GTIZ 2WA3A 2WAMA 4GX2A 1TAEA 3ASNC 3JALA 4TV8B 1E1RG 1RFYA 1PV0A 1EBOA 2UU9O 1N0JA 2A7WA 1NVPB 4B3MO 2Y4TA 1YZBA 3JASA 1XBLA 4E2LA 2UU9B 4B3MB 4JV5B 1P49A 1Q3EA 1K4DC 4DR1O 3ICXA 3M8AA 5E79Z 1H2SB 1GK9A 2Y69C 3K9AA 3T1HO 2WLHA 4DR1B 3D8CA 1AI4A 3T1HB 1Z2GA 3SJCC 1FXHA 3CD6V 3RN4A 2YIBA 4N23A 4DR6O 4TOIA 5GTHZ 2PYJA 4I50B 5LOVB 2IW5A 4DW1A 4DR6B 2P22C 4JZGA 2IBZH 3T2MA 1T5EA 2UXBO 2WWWA 2EILC 4IYHA 3PN1A 2OYQA 3ETEA 2W0FC 2UXBB 5CA0B 2BSKB 4OGQB 3LDEA 1Q6IA 4B7EA 1ZL8A 3E8FA 3T4ZA 4LC1A 4CH3A 1F23A 4Q6GA 4LFCO 1M1KW 1SQFA 3CSXA 2AHYA 1FXKA 5EK0A 2LW7A 1MOFA 3HKCA 2IJKA 4JI8B 1JVMA 4FLZA 2QWNB 1SETA 5JVDB 1M4UA 1X59A 2LJ2A 3ZHTA 3K5NA 3C90A 4J41A 5KAFZ 5D5QA 1JQ0A 1IZ3A 1QQCA 3RFRA 2GSMB 4GZRB 1YHQV 3KCYA 3R65A 3UO3A 3G67A 3K5MA 1YI2V 4IYIA 4LCUC 1VQMV 4LF9O 4Z2WA 4DR2B 4UCVA 4DW0A 3ZHUA 1NZ6A 2P4KA 1XI1A 4LF9B 1XMQB 1R3KC 3K04A 2XAQA 1XNRO 4HNAA 3BEHA 1FXKC 1Y4MA 2FKXA 3B4SA 1XNRB 5EYPA 1OJHA 2YDEA 2N74A 3CCEV 3NXSA 3B40A 1HNZB 5DEDA 1WAZA 2QE7G 1PNKA 1BZKA 4CH4A 1LNQA 2PI5A 2GV9A 3VQVA 1J95A 4JI1O 3J81N 3T1YO 1WA8B 4X1KA 4JI1B 1S5HC 3WB1A 1Y66A 3T1YB 4RUEA 4B7KA 3MAQA 1NTMH 4UCUA 2X6BA 2DQ0A 3CX5F 5LXTA 5CBGA 5B1BB 5KUMA 2KKWA 5KHHA 3ML0A 1V54C 2YXLA 3ETDA 1VQNV 1OCRB 4O4IA 5IYDO 4O2AB 3ZX6A 1BQ0A 3LUTB 4MSWC 1PNLA 3CHXA 4TUYB 1VMGA 1N34O 2YIBD 1OCZB 1OCCC 2OCHA 3BA8A 4NB5A 1ZTEA 1N34B 2WLJA 2OIEA 3X2QC 4X64O 2UXCO 1N33O 2UXXA 1AJPA 3ASNB 1JCHA 1JFFA 4X64B 2UXCB 1FJGO 1G6UA 5EBLC 3CCJV 1MABG 2P6JA 5IYZA 3STLC 3A0BZ 4ZI7A 5JQGA 1FJGB 1ZUQA 1B6QA 2FL4A 5IJ0A 2OWOA 4QIWF 1K33A 4P9OA 3GVMA 3S3WA 2BOCC 2Y69B 3VQWA 3TETA 4WBNB 3L75H 4JTCB 2YI8A 1ZWIC 2JDIG 2XT9A 2F95B 2R9AA 1K34A 5B3SC 1XQ8A 2IU3A 2OIGA 4JI4O 1FFXA 4NTXA 5LYJB 4GKKO 1XDCA 3OUFA 1XMOO 2EILB 3KZIZ 3DC5A 3K57A 4GKKB 3B09A 4UB8Z 1XMOB 3JALB 1M5IA 3W7WA 4GX5A 1NTKH 3W7SA 3A8TA 3K9SA 4I9WA 3CC2V 5J2UA 3HB3B 3JASB 1L1FA 1OHHG 3BABA 5JJNB 1AILA 3T1CA 4DV1B 4FLYA 3K5LA 4WFEA 4X20A 3TCUA 3C3SA 1K8AW 1I94O 3N27A 1GN3A 1X4TA 2KB1A 5IT9N 4PA9A 2XTAA 4WF9V 3J7AU 4FLTA 1I94B 2ILMA 3ABLB 5JWPA 3VQYA 4FZ0A 3SPIA 2PTMA 2UUAO 3VOUA 4J10A 1MG1A 4QNHB 2ZCEA 1FD9A 4NKGB 4O4LA 3CRAA 4JYYA 3OTOB 2UUAB 3KKYA 2DMXA 2F66C 4G2KA 2W6IG 4FLVA 3KG2A 4D7TA 1GTOA 1XILA 1PPJH 3CMAV 1G4YB 3FX7A 2D3OW 3B8NA 1XL6A 3AG4B 1ZL8B 4UCRA 3ZRVA 2ZE7A 4DK1A 4PA6A 2CH7A 1IBLO 2QKSA 2BE3A 5EIBC 2Z0AA 1FXKB 3P30A 4J11A 2GUZA 2XAFA 3HKCB 2CE4A 1R3JC 5CA3A 4GX0A 2Q0AA 1K5SA 3OE7G 2XAJA 5EC2C 1XHZA 3OR6C 3G71V 1L0LH 5LA6A 3AG7A 5EZYA 2WLIA 2WPDG 5B66Z 2Q6AA 2Y0PA 3L70H 3TXSA 4YIPA 3ZRXA 4NTYA 4CC5A 1FKAO 2YS8A 2ZT9B 2A3QA 2ZIOA 1ZSPA 3DGEA 2AXTZ 2R9RB 4HZ3A 2YXYA 4BIZA 2DE0X 1QLNA 2K9PA 3UO2A 1BHAA 1V54B 5KX5A 1H2NA 5DECA 2XUMA 2IJIA 2QKAA 4HNAB 5EC1C 1AI7A 1YF2A 3JAKA 4LFBO 2F93B 3I55V 1OCCB 4L87A 1S72V 5EYPB 4H44B 4NXMO 4LFBB 4UV9A 4DV0O 2NN4A 3X2QB 4FLXA 3ETQA 2NR5A 4NXMB 4LWSA 4DV0B 5L3GA 3RVZA 1IBKO 4ZHQA 4IIJA 4UVAA 2N04A 1IBKB 4DV2O 2CUGA 1KECA 1GM9A 2E75B 4U3FH 5LP6A 4X1KB 1RPOA 1F4MA 1KC8W 3JAWA 1DTOA 4DV2B 2XAHA 1IXMA 2ADQB 5LMUO 5BMVA 1NR7A 2GTAA 5FLXN 2EJRA 4B3TO 5LMUB 3PJSK 1A32A 1H2GA 3OTFA 2JJ2G 2LW1A 3RYIA 2HJDA 1H2LA 1TVKA 4O4IB 5EIBD 4B3TB 4X1YA 5BXZA 3ZHVA 3GB7C 5B3SB 3CRCA 3EXAA 2HR3A 4YXWG 1NJIW 2ZE6A 1W0JG 1BT8A 3RW0A 4LFAO 5GW7A 2ZR2A 3B8MA 3SYAA 1RP3B 1D5AA 1Q90D 4LFAB 4Z1MG 1JFFB 1TA8A 4JZ2A 3FYIB 4PHZA 3FAVA 1JPXA 3LDCA 5IYZB 4ZI7B 5JQGB 5BZBA 4K8ZA 4FFKA 3JSLA 5LP6C 3RT3C 3G4SV 5IJ0B 1S5JA 2QM8A 5B1AC 2DWDC 3H1HH 2C2AA 5C8YA 1WN7A 3B77A 1NU1H 2PYLA 4UXNA 2QR4A 2Q9LA 3JCUZ 2PUSA 1EN5A 4DR3O 3O9OA 1MZEA 1YJNV 1NT2B 4PELA 3K58A 1FFXB 4AQYB 2L35A 4IT5A 2VQFB 3JYCA 1Q81W 4JAUA 3CCRV 4GX1A 3QTCA 1J5EO 2P06A 3LNNA 4J7JA 4JI3B 3T4DA 1L8DA 4O4JA 1Y67A 3I56V 3ZMZA 3BAAA 3IAYA 2E76B 5J2UB 1H38A 2EULA 4BAYA 3JATA 1AI5A 2UXDO 2ODMA 5A9GA 3UQ8A 3F5TA 2VWKA 4CZZA 2K1EA 4TT3G 4UUJC 3LSUA 2ZE5A 4X20B 1WB7A 5IYCO 3OMIB 3ZMVA 3AG1C 4UB6Z 4LF4B 1PL4A 1S77D 5TISZ 4KXRA 5J2TA 4PJ0Z 3AG3C 1SRYA 5IDJA 1BSMA 4U3JA 4BW5A 3ZMSA 5LMNO 2ITCC 4EB6A 4JV5O 4O4LB 2QWOB 2B1GA 4GLXA 4D7SA 5LMNB 1SA0A 3QO5A 1XL4A 2VS0A 1E79G 2V7QG 2JVDA 3ZN0A 4K8XA 5IJ9A 1NQTA 3M7MX 4CS3A 1SQPH 1PNMA 5B1OA 4RWUA 1Q43A 2ZR3A 2JJ1G 2CH7B 5H5NA 3K06A 1O9GA 4D6TH 5LHHA 1SERA 5CB4A 3F7VC 3I5DA 2EINC 1P7BA 2YXHA 4KHPO 2IJJA 4K3AA 3APOA 3AK3A 5D5PA 4NXNO 1COWG 2LGQA 3SPGA 4JF3A 2GUZB 4KHPB 2KG7A 2RN9A 1Q8IA 4H37A 4NXNB 5IE9A 1IBMO 2FYUH 1YJWV 2LQTA 5LA6B 4AILC 3CE2A 5EZYB 2WLIB 4UCTA 2D2CB 1IBMB 1YITV 3HR0A 1BGYH 1M57C 2QSAA 2HP8A 1BMFG 2EIKC 3O65A 3UKMA 4PI0A 1NR1A 3N2KA 1US6A 2WLLA 4ABMA 5KUKA 1V55C 3EVKA 3QG5A 3ZIAG 1AR4A 1AI6A 4JI8O 3ZBHA 1P7GA 3D3QA 4FM0A 2JK5C 5KX5B 4UCSA 3FKSG 1NBMG 3IJ4A 4F6RA 3CEIA 1UJWB 1I7FA 2DJVA 4DV6O 1DF4A 2DW4A 3JAKB 2DWEC 4IHJA 3BHPA 2V1DA 2PZSA 3AK2A 4DV6B 1HDJA 1M9NA 4FMTA 3CMEV 2QA4V 2CTQA 4JI2B 1SQVH 2Q8VA 2IH3C 3ETGA 1G8MA 4A5UB 3RBZA 4LWSB 2E74B 3G6BA 3HKBA 1XUQA 3OR7C 4X88A 4DR2O 4ZHQB 2CTPA 4IIJB 4JTDB 4XDJA 2A06H 4LNUA 4JAVA 4BWAA 2AZ0A 4AI8A 1VQPV 1PP9H 4FK5C 1XMQO 4R8CA 2QWQB 1DF5A 2B5UA 3K5OA 5LP6B 4TWKA 1VF5B 3JAWB 5AG2A 5BMVB 5B1AB 4QGPA 3OD4A 2GTSA 1VQ6V 1HNZO 3KCXA 3RYIB 1TVKB 4X89A 1AR1B 1RM1B 2CTRA 4X1YB 3W7TA 4X66O 4U7OA 1FS0G 3D36A 3P3PA 4X66B 1R3LC 3L74H 3ZHSA 1QR8A 2OTJV 5J9PC 3DXRA 1S76D 4WFFA 4PDLA 3OM3B 3FAVB 1N36O 3CCVV 2QTOA 5CBFA 2ATKC 2UXNA 1N36B 2RDCA 3FB8C 2ARHA 3NR7A 3OW2U 3CYOA 2WA4A 4MVOA 5C8YB 2YUAA 3AG1B 5FNVA 3ZRSA 4BR6A 1XOUA 2EIMC 5IY5C 4PDVA 1CXZB 3AG3B 4DV3B 1LR1A 3OUSA 4W4LA 1BE3H 3D36C 3MD0A 3G6EV 3JCZA 4DO2A 2CTWA 1U97A 3TGUH 1NKDA 3ZEDA 4J7ZA 1KU9A 1JJ2U 4LF5O 5HFLA 4KFMA 4O4JB 2YI9A 4LF5B 2WLKA 1D2DA 2FB5A 5H9CA 3ZRWA 2JEUA 3WG7C 4PA7A 3JATB 4YY3O 1SC5B 4X65O 1K97A 2Y0IA 1ZX3A 2RNBA 4MW8A 5KHIA 4YY3B 1H2KA 4X65B 1KBHA 5GONA 2VQEO 4MVZA 3ABUA 4X9QA 2RMKB 4YIOA 2Q67A 2JGDA 2XOKG 2QGNA 4DXWA 2VQEB 3HKDA 2ZDIA 2OCCC 1KP2A 5J2TB 4U3JB 5LHIA 2R72A 3K0GA 4QE7A 4X62O 4EB6B 4EEQA 2AZ2A 1M57B 3IC9A 4MVQA 1SA0B 4X62B 1QR9A 4DV1O 5KMGA 1K5QA 2EIKB 2IM9A 1W59A 4RQEA 3WFVA 1IX9A 2A9HA 1SKVA 5IJ9B 3RVYA 1V55B 1YVWA 1ORQC 1LUWA 2CAZC 1VP7A 4ICGA 3E8GA 1YEWA 3RYHA 1G1XB 1FPOA 5CB4B 1N0NA 1D5NA 4B3SB 1YCIA 5DM6V 3DC6A 1XREA 3IGAC 1UPGA 4UVBA 4BW9A 3K0DA 3OTOO 2E5LO 4MVMA 2RJZA 3E83A 1NS1A 3VBBA 2PY5A 2KG7B 4LF7O 2E5LB 2MW2B 2ZDIC 2ZE8A 4TQFA 1IDSA 1OV9A 2Q69A 3SJBC 4LF7B 5JCOA 2CDYA 1MSWD 1QVGU 1WP7A 1MA1A 1UFIA 2G38A 1KYOF 1BS3A 4XDLA 4DV4O 3N2KB 2WLLB 4X1IA 3K79A 4CS2A 4JI6O 4DV4B 4R50A 2YICA 4JI6B 4FPPA 4CS4A 4JAAA 2HKOA 1GN4A 3BVOA 3R66A 4GYCB 1HR0B 4F6RB 2N05A 4IHJB 1VQ8V 4N21A 2A0LA 4LBEC 2VRZA 4H33A 5LHGA 1LUVA 5LGTA 4I0XA 5JH7A 5JCOC 3HKBB 4R6ZA 2OTLV 4FM1A 2WLMA 4JYCA 4TV9A 1XEQA 1IXBA 1WJZA 4LNUB 3FB5C 5BR8B 1RPRA 4DK0A 2ZNIA 1PM9A 2HHHO 2UUBO 2H3OA 4HYOA 3ASOC 3P32A 5B5EZ 2EBOA 1R73A 2HHHB 2UUBB 4GT1A 2LO1A 2BTQA 3U10A 2EIMB 2PF4E 4QPKA 3ZCCA 4JTAB 5IY5B 1N8RW 3OFNG 1Q6HA 2Y4UA 4DYLA 4OXSA 4EKWA 2AHZA 1U96A 1WPXA 4JYAO 3K59A 2Z3YA 1B06A 2E3CA 5LGNA 2H8PC 3BCCH 3DXRB 4JYAB 3K3WA 5KHGA 3A0HZ 3E22A 3CC7V 4UV8A 4FLWA 4RO2A 5A2QN 1VEWA 3L73H 4RUFA 3WG7B 4FZ1A 2RCVA 2Q68A 4MS2A 2P67A 5LGUA 4DR4O 3ZJZA 5KA5A 1MZFA 4DR4B 5FNVB 3D3IA 1PKXA 1YIJV 3ZHRA 3THOA 4JI7O 4ZOLA 3CXHF 1BCCH 3L71H 2OCCB 3JAMN 4LF8O 1RSOA 4QJFB 4JI7B 4LF8B 3F7YC 3HKEA 1NH2D 4G28B 3CCSV 2XAGA 5L3BA 2ZD9A 5EBWC 2Q7EA 3ABTA 3SGIA 3CCMV 3W7UA 2VWJA 5FL7G 2QDOA 3ZRWB 5C93A 4I9QA 2Q73A 2KSDA 1KB9F 3E8BA 2BOBC 4B08A 1H8HG 1ROPA 5F2VO 1S3JA 1HNWO 2HLDG 3M99B 1K92A 4AQYO 5GONB 4CBCA 4GKJO 2VQFO 1HNWB 2X0LA 2IH1C 4KL1A 1N32O 2JGDB 3HKDB 1K4CC 2F1MA 4JI3O 3SYOA 4GKJB 3E86A 1IVSA 1JMKC 1THZA 1N32B 1WPBA 4XBFA 3ABMC 2JIZG 1GAXA 2YIAA 5K1XA 2LFRA 1VF7A 1BQZA 3CS5A 4WFAV 1AP5A 4OPAA 2GHYA 4Q20A 5KMGB 4DUZO 4P9PA 3U11A 2F23A 4UVCA 4HBNA 2R9IA 1XNQO 3JD2A 4DUZB 3A2FA 4LF4O 3JD3A 3SPCA 1XNQB 1QHTA 3RYHB 3P3NA 2P4VA 4DR7O 1YSCA 2DQ3A 1XHXA 2YIDA 4RAIA 4JGSA 4DR7B 1Q86W 5L3EA 3F5WC 1S0VA 1ZLZA 1NH2B 2B1IA 5JJJB 4DUYO 5LBQA 1CEZA 3L72H 2KQXA 4P30A 4CH5A 2A79B 1R6TA 2MK3A 4DUYB 1NTZH 3MDSA 4GUNA 3N2GA 3LDDA 1EN4A 1GKFA 2W6JG 4X1IB 2P90A 5BY1A 1WP8A 3A0RA 3ASOB 3H01A 1B3QA 2ZINA 3AG2C 2EJ7A 3APQA 3JD0A 3K03A 2ETNA 2QWRB 1FXVA 5HFMA 1OZ0A 2ZXWC 1YTFD 3HPLC 4JYBA 2XASA 1R1BA 1KUQA 2DYSC 4BIUA 1P84F 1K9MW 1Y76A 3MHHC 1H8EG 3CRMA 2ZNJA 4I55A 2F4VO 3QO8A 3BRCA 2DYRC 3CC4V 4I0XB 3RWRD 5JH7B 3EFFK 1EZJA 1Z5VA 2ZIMA 2F4VB 3OGCC 3TK1A 1F7YA 4TV9B 3SJAC 4KP4A 4I4TA 2P7TC 2NLJC 4WCEV 2EZPA 1K3EA 1ZAUA 3CP1A 5DN6G 3STZC 3ABKC 1B04A 3G80A 1E1QG 3BY6A 3EHBB 4WFGA 5K1PA 1URFA 3CRQA 3OAAG 2LP7A 4B3RO 1SZTA 2Q7GA 4JI2O 3SJQC 2CGOA 2X7RB 2Q7HA 4LFCB 3S3XA 2BTQB 4B3RB 4FFBA 1VQ9V 3OEHG 1KD1W 4JI0O 4EFBA 4FM2A 3FYEB 3CCLV 2O57A 1VQKV 3ABLC 4U7NA 4JI0B 2ITDC 4LH7A 3QNEA 3JSNA 2DOSA 3QF7A 4J9YB 1HP8A 2Q4PA 3SYPA 3JD1A 3E22B
chains in the Genus database with same CATH topology
3ZMUA 4L87A 1S72V 1Q7YW 1M57B 1OCRC 4UV9A 4MVQA 4MTOA 3X2QB 1QR9A 1K5QA 2EIKB 1KKDA 3AG4C 1I5XA 2H94A 1YTFB 5L3GA 4RQEA 3WFVA 2A9HA 1FFTB 4MVRA 3RVZA 1OCZC 5H6RA 1M56B 1BHBA 2EIJC 3RVYA 4UVAA 1V55B 1ORQC 2OT5A 1KECA 1GM9A 1TUEB 3E8GA 1PL0A 2WAMA 4GX2A 1RPOA 1F4MA 2FTKA 3ASNC 1KC8W 1DTOA 1QBZA 1E1RG 2XAHA 1IXMA 5DM6V 4P2ZA 1EBOA 1NR7A 1OCOC 3IGAC 1NVPB 2X6AA 4UVBA 3K0DA 1QVFU 5EBMC 2EJRA 4G27B 3PJSK 4MVMA 4E2LA 3ABMB 3E83A 3VBBA 1H2GA 2JJ2G 1K4DC 2ZDIC 1GK9A 1VQ5V 2Y69C 3K9AA 1GM8A 2WLHA 3GB7C 5B3SB 2Q69A 4PA4A 2HR3A 4XDKA 4YXWG 1MSWD 1AI4A 1NJIW 1QVGU 1FXHA 3CD6V 1W0JG 3RW0A 5IYBO 1I5YA 2ZR2A 4N23A 5GW7A 3B8MA 3SYAA 4XDLA 3IC7A 2IW5A 5CMUA 4Z1MG 3CCUV 2WLLB 3K79A 3FYIB 1SESA 3T2MA 1JPXA 4R50A 3LDCA 4RQFA 2WWWA 2EILC 4FPPA 2ZQMA 3I55V 5BZBA 2HKOA 3ETEA 2YEVA 2W0FC 3G4SV 3LDEA 2QM8A 5B1AC 2DWDC 2C2AA 3B77A 3E8FA 4UXNA 4N21A 1VQ8V 3T4ZA 2WLNA 4LC1A 2A0LA 1F23A 3E8HA 4LBEC 1M1KW 5H6QA 4H33A 5LHGA 5LGTA 1YJNV 2AHYA 1FXKA 5EK0A 4MTGA 4R6ZA 2OTLV 4J9ZB 2EINB 4PELA 1MOFA 2HJFC 2WLMA 4JYCA 3CCQV 3FB5C 2IJKA 3AG2B 1RPRA 3JYCA 1JVMA 1Q81W 4JAUA 3CCRV 4GX1A 2ZXWB 1SETA 1GO3F 1AJNA 3T4DA 3I56V 3ZMZA 4HYOA 2DYSB 3ASOC 3P32A 2EBOA 1H38A 1JQ0A 1R73A 4BAYA 1W2BU 1AI5A 1CP9A 1P4RA 2GSMB 4GT1A 5L3FA 1F4NA 4MVUA 4CZZA 3K08A 1YHQV 2K1EA 3R65A 4TT3G 2EIMB 4MT8A 2Y48A 4QPKA 4UUJC 3ZCCA 3ZN1A 4JTAB 2DYRB 5IY5B 1YI2V 4LCUC 1VQMV 1N8RW 3OFNG 5IYCO 3OMIB 4OXSA 5E1AC 3ZMVA 4EKWA 3AG1C 2AHZA 4R7CA 1WPXA 1S77D 1R3KC 3K04A 2XAQA 2Z3YA 5LGNA 4ZBMA 2H8PC 3BEHA 3AG3C 3K3WA 1FXKC 1GM7A 1SRYA 1Y4MA 5IDJA 4X8AA 2WSSG 3ABKB 4BW5A 4MVSA 3CC7V 3ZMSA 5L3DA 2ITCC 4UV8A 2PI4A 1GMGA 4RO2A 4WFBV 3CCEV 4RUFA 2B1GA 3NXSA 3WG7B 3QO5A 1XL4A 2QE7G 1PNKA 2Q68A 1E79G 2V7QG 4MS2A 2P67A 3OMNB 1LNQA 2M7WA 3E89A 3ZN0A 5LGUA 2PI5A 1NQTA 2IJHA 4QE9A 1PNMA 5B1OA 1J95A 3ZJZA 5KA5A 2ZR3A 4QPJA 2JJ1G 3K06A 5LHHA 4WFHA 1SERA 3D3IA 1PKXA 1YIJV 3F7VC 1S5HC 4MTXA 1Y66A 2EINC 3LSQA 4RUEA 1P7BA 2OCCB 2IJJA 2X6BA 2DQ0A 4QJFB 1COWG 3SPGA 4JF3A 3F7YC 5B1BB 5CBGA 1NH2D 5KUMA 1JX9A 4G28B 1KP3A 2HVKC 2XAGA 4H37A 3CCSV 3ML0A 1V54C 2QEXV 5L3BA 3ETDA 1VQNV 1OCRB 2ZD9A 3SPJA 5IYDO 1YJWV 3LUTB 4MSWC 1PNLA 5EBWC 4ASUG 1AROP 3ABTA 2WLIB 3CCMV 1OCZB 1QLEC 1OCCC 1YITV 4TSFG 1AJQA 3W7UA 2EIJB 5CBHA 1M57C 5FL7G 3CPWU 3ZRWB 5C93A 2WLJA 3AEIA 3X2QC 1BMFG 2EIKC 2UXXA 1AJPA 3E8BA 3UKMA 3ASNB 4JASA 2BOBC 3IFXA 1NR1A 1H8HG 1JCHA 1ROPA 2WLLA 1S3JA 3GWOA 1M56C 5KUKA 2HLDG 1OCOB 4PDMA 3M99B 1K92A 1V55C 3ZIAG 5EBLC 3CCJV 1MABG 2P6JA 4CBCA 1AI6A 3STLC 1ENVA 2X0LA 2IH1C 3E2EA 2JK5C 1B6QA 1K4CC 3MHSC 4QIWF 3SYOA 3FKSG 3E86A 1K33A 1NBMG 4P9OA 2BOCC 2Y69B 1THZA 3TETA 1UJWB 4JTCB 1DF4A 1ZWIC 2DW4A 2DWEC 4XBFA 3ABMC 4JPRA 2JDIG 2JIZG 2V1DA 3SYQA 1M9NA 4FMTA 3CMEV 2LFRA 2QA4V 4WFAV 2GHYA 4Q20A 1K34A 2IH3C 3ETGA 1G8MA 5B3SC 3RBZA 4P9PA 2IU3A 3OR7C 4X88A 3E35A 4ZKIA 1R3IC 4UVCA 4JTDB 2LFSA 4XDJA 2R9IA 3OUFA 3JD2A 4JAVA 1VQPV 3JD3A 4FK5C 2EILB 4R8CA 3SPCA 1DF5A 2B5UA 2XNDG 4FJCC 3W7XA 4TWKA 1YSCA 2DQ3A 3W7WA 4GX5A 5CN0A 3W7SA 1W0KG 4I9WA 3SPHA 4RAIA 5B1AB 4JGSA 3CC2V 1Q86W 3HB3B 5L3EA 3OMAB 2HFEC 3F5WC 1L1FA 1VQ6V 4MW3A 1S0VA 1OHHG 4PA3A 2JEXA 5L3CA 1NH2B 3T1CA 2B1IA 4GCZA 3DTUB 4X89A 5LBQA 1AR1B 1RM1B 1CEZA 4WFEA 1WLEA 3TCUA 4P30A 3W7TA 2A79B 1EFRG 1VQ7V 2MK3A 1F51A 1FS0G 4U7OA 1K8AW 3D36A 4MTFA 2KB1A 3SYCA 3CXCU 4PA9A 4WF9V 1PD3A 1R3LC 1Q82W 1QR8A 3ABLB 2OTJV 3LDDA 1VQOV 5J9PC 1GKFA 3SPIA 1R6NA 2W6JG 3VOUA 1MG1A 2P90A 1S76D 4WFFA 4PDLA 4QNHB 3LSSA 3ASOB 3A0RA 3OM3B 3H01A 2EZOA 3AG2C 3CCVV 4G2KA 3JD0A 3K03A 2QTOA 4HAMA 5CBFA 1FXVA 5HFMA 2W6IG 1DLBA 1OZ0A 2ATKC 2ZXWC 2UXNA 2YEVB 3KG2A 1YTFD 3HPLC 4JYBA 2XASA 1VQ4V 1GTOA 2F43G 3FB8C 4PDRA 2CK3G 2DYSC 3CYOA 3CMAV 3OW2U 1G4YB 2D3OW 4BIUA 3B8NA 1XL6A 4MVOA 1K9MW 3AG4B 3MHHC 1H8EG 3ZRVA 1BL8A 4PA6A 3AG1B 3ZRSA 4F4LA 2QKSA 3JD4A 2EIMC 4KUMA 1NVPD 1KQSU 3QO8A 5IY5C 2DYRC 4PDVA 3CC4V 3AG3B 3EFFK 1FXKB 3OUSA 1EZJA 3MD0A 3P30A 3OGCC 3G6EV 2XAFA 3TK1A 3JCZA 4DO2A 4KP4A 1NKDA 1R3JC 3FB7C 5CA3A 4GX0A 2P7TC 2NLJC 1K5SA 4WCEV 3OE7G 2EZPA 1K3EA 5DN6G 3CP1A 1JJ2U 2XAJA 5EC2C 3OR6C 3UM7A 3G71V 2HG5C 1CPYA 5HFLA 3STZC 1K7DA 4KFMA 3ABKC 2WLIA 2WPDG 2YSUB 5KA6A 1E1QG 2Q6AA 3BY6A 4FIPC 1R6KA 5B1NA 1YJ9V 2NNUA 2WLKA 3EHBB 2HVJC 3LNMB 5H9CA 4WFGA 3ZRWA 2JEUA 3WG7C 4PA7A 3OAAG 2LP7A 1RM1C 1SZTA 4LP8A 3ZRXA 3SJQC 1VQLV 2X7RB 1M90W 1K97A 3FB6C 3ZMTA 3DGEA 4MW8A 1VQ9V 2R9RB 3OEHG 4HZ3A 1QCEA 1KD1W 4BIZA 2IU0A 1QLNA 2QM7A 3FYEB 3CCLV 1VQKV 4MVZA 1HWYA 3ABUA 3ABLC 4U7NA 2ITDC 3QO7A 3QNEA 1BHAA 1V54B 2Q67A 2XOKG 4DXWA 4J9YB 2ZDIA 1JOYA 2OCCC 1KP2A 2IJIA 4I5SA 3SYPA 1K73W 2Z5UA 2X6CA 3JD1A 5LHIA 5EC1C 1AI7A 3K0GA 4QE7A 5B1BC 3OEEG 1QLEB 1OCCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CA3 A;  3D3I A;  1NVP B;  5GW7 A;  1NH2 B;  3E35 A;  3W7U A;  2P90 A;  1YTF B;  3IC7 A;  3BY6 A;  3W7T A;  4HAM A;  3W7X A;  1RM1 C;  3W7W A;  1S3J A;  3W7S A;  2HR3 A;  2WAM A; 
#chains in the Genus database with same CATH topology
 4K35 A;  4H13 B;  1Q7Y W;  4NTW A;  2UUC O;  1WNS A;  1KKD A;  2R70 A;  3AG4 C;  4O4H A;  1YTF B;  4MVR A;  1TUB A;  2UUC B;  5H6R A;  1BHB A;  2EIJ C;  1SS3 A;  3AK1 A;  3OGI B;  1VAR A;  1TUE B;  2OT5 A;  3RYC A;  1PL0 A;  2Q5Z A;  2JS3 A;  2FTK A;  1QBZ A;  2QWP B;  4ZOL B;  4P2Z A;  1OCO C;  3B2E E;  4DV5 O;  2X6A A;  1NI8 A;  1RSO B;  3JAR A;  4OPH A;  1QVF U;  5IWA O;  5EBM C;  4G27 B;  3HKE B;  3ABM B;  4DV5 B;  2W0X A;  5IWA B;  1VQ5 V;  5CA1 A;  1GM8 A;  4BIO A;  2L6L A;  3Q4H A;  1AP6 A;  3FD9 A;  4PA4 A;  4XDK A;  4IL6 Z;  5KHJ A;  5IYB O;  1I5Y A;  3CJH A;  4J80 A;  3IC7 A;  4DV3 O;  5CMU A;  3CCU V;  4YJ3 A;  1SES A;  2AW9 A;  4RQF A;  4TQD A;  4DRX A;  2ZQM A;  5FPO A;  1DGS A;  3RYF A;  2YEV A;  1V9P A;  3BPZ A;  2ZM6 O;  1GN6 A;  1SF9 A;  2PGG A;  2QM4 A;  3TJT A;  4YJ2 A;  2ZM6 B;  2B9Z A;  2WLN A;  4CC6 A;  4UFZ A;  4K0K O;  3E8H A;  5H6Q A;  1SZX A;  5ITZ A;  1N33 B;  4K0K B;  4PV1 B;  4MTG A;  4J9Z B;  2EIN B;  2HJF C;  3CCQ V;  1EN6 A;  3AG2 B;  1Z5W A;  2XHB A;  1JA8 A;  2FML A;  2ZXW B;  1GO3 F;  1AJN A;  1EZV H;  3WB0 A;  1VF6 A;  4JI5 O;  2DYS B;  5FPR A;  1AVM A;  2RQ6 A;  3OT7 A;  4JI5 B;  1W2B U;  4CH6 A;  1CP9 A;  1JR9 A;  1P4R A;  5L3F A;  1F4N A;  4MVU A;  2LGW A;  3K08 A;  4DR5 O;  1GH6 A;  4MT8 A;  3GWK C;  2Y48 A;  3ZN1 A;  2DYR B;  2BTO A;  3H1L H;  4DR5 B;  4JI4 B;  5E1A C;  2V4D A;  4NYK A;  4R7C A;  4B3S O;  3N2G B;  4ZBM A;  3H1I H;  1GM7 A;  1YDX A;  4PD4 F;  4X8A A;  2WSS G;  4EFE A;  3ABK B;  2ADP A;  4MVS A;  5L3D A;  3DSQ A;  2PI4 A;  1GMG A;  4WFB V;  1FYJ A;  4O2B A;  3UT5 A;  1SQQ H;  1HW7 A;  1Y74 A;  4H0L B;  1VF6 C;  3OMN B;  2M7W A;  3E89 A;  2IJH A;  1MSD A;  4QE9 A;  1Y76 B;  4J7K A;  1JJO A;  1GN2 A;  4QPJ A;  1I08 A;  4WFH A;  4TV8 A;  4MTX A;  4I55 B;  3LSQ A;  3VQX A;  2GDS A;  2BCC H;  1JX9 A;  1KP3 A;  2HVK C;  2QEX V;  4I4T B;  3SPJ A;  3TXQ A;  1HR0 O;  1O9H A;  4ASU G;  1MNG A;  1ARO P;  1EM1 A;  2JRI A;  1QLE C;  4TSF G;  1AJQ A;  2EIJ B;  5CBH A;  3CPW U;  3RGB A;  1SQB H;  3AEI A;  1M93 A;  4F6E A;  1IBL B;  1Q6U A;  4FVM A;  4I50 A;  5LOV A;  4JAS A;  4W4K A;  1KMI Z;  3IFX A;  1KKC A;  4FFB B;  3GWO A;  1M56 C;  1OCO B;  4PDM A;  4AHC A;  1L0N H;  3H9V A;  5BR8 O;  1ENV A;  3E2E A;  1AR5 A;  5CA0 A;  1S5L Z;  2BSK A;  3MHS C;  4LR3 A;  3ZHQ A;  3H1K H;  1I0H A;  2ZKO A;  4YHH O;  4JPR A;  3SYQ A;  1SQX H;  4YHH B;  2QTS A;  5KHK A;  4LH6 A;  4O4H B;  1QU7 A;  1HNX O;  1TUB B;  3E35 A;  4ZKI A;  1R3I C;  2LFS A;  5H2F Z;  1H2M A;  1HNX B;  3RYC B;  3W7X A;  2XND G;  4FJC C;  3WU2 Z;  5CN0 A;  5JVD A;  1W0K G;  3SPH A;  3UCS C;  3JAR B;  3QVN A;  3OMA B;  2HFE C;  2AGA A;  3U0Z A;  4MW3 A;  4PA3 A;  4NVP A;  4L8J A;  2JEX A;  5L3C A;  2DN9 A;  4GCZ A;  3DTU B;  5CA1 B;  1WLE A;  3J80 N;  3Q4H B;  1EFR G;  1VQ7 V;  1F51 A;  1AB3 A;  4I7Z B;  4MTF A;  4LF6 O;  3SYC A;  3CXC U;  1PD3 A;  3CJH B;  1Q82 W;  1VQO V;  4LF6 B;  4NR1 A;  1R6N A;  5LXT B;  3WB2 A;  4YJ3 B;  3LSS A;  1N4C A;  2EZO A;  3L9D A;  4OX9 O;  4DRX B;  2EX3 A;  4HAM A;  2JS5 A;  3ZS8 C;  1DLB A;  3RYF B;  1Q5O A;  2YEV B;  5KLV H;  1IUR A;  4OX9 B;  1VQ4 V;  2F43 G;  4PDR A;  2CK3 G;  4J42 A;  3BFR A;  3FFQ A;  1TGO A;  4YJ2 B;  1BL8 A;  3CB2 A;  4UCO A;  1WA8 A;  2GBO A;  2QKC A;  3SDL A;  4F4L A;  3JD4 A;  3BA9 A;  4KUM A;  4Z1V A;  1NVP D;  1KQS U;  3CRR A;  5ITZ B;  2P5O A;  5KAI Z;  5LL6 Y;  4DV7 O;  4IGG A;  2YC0 A;  4DV7 B;  3FB7 C;  4O2A A;  1WB8 A;  3UM7 A;  2HG5 C;  1CPY A;  4TUY A;  4C7U A;  1K7D A;  1FAF A;  2YSU B;  5KA6 A;  4FIP C;  1R6K A;  5B1N A;  1YJ9 V;  2NNU A;  2HVJ C;  3LNM B;  4E4E A;  4PI2 A;  5JJE B;  1QNM A;  1RM1 C;  4LP8 A;  1VQL V;  4FLU A;  4DR3 B;  1M90 W;  3FB6 C;  3ZMT A;  1QCE A;  2IU0 A;  2QM7 A;  2M6Y A;  3CWB H;  3C3T A;  1YXB A;  1GRJ A;  1HWY A;  3QO7 A;  4ZIB A;  2JGU A;  1JOY A;  1J5E B;  4WBN A;  4I5S A;  1K73 W;  2Z5U A;  2X6C A;  1DK1 A;  1SQG A;  1MMM A;  5B1B C;  3OEE G;  1QLE B;  3ZMU A;  1VIB A;  2HEP A;  1OCR C;  2Q0O C;  2UXD B;  4MTO A;  4O2B B;  2QJ1 A;  3UT5 B;  1Y74 B;  1I5X A;  2H94 A;  1FFT B;  3SR2 C;  1OCZ C;  1M56 B;  2CGN A;  5LYJ A;  1Y6X A;  3H1J H;  5GTI Z;  2WA3 A;  2WAM A;  4GX2 A;  1TAE A;  3ASN C;  3JAL A;  4TV8 B;  1E1R G;  1RFY A;  1PV0 A;  1EBO A;  2UU9 O;  1N0J A;  2A7W A;  1NVP B;  4B3M O;  2Y4T A;  1YZB A;  3JAS A;  1XBL A;  4E2L A;  2UU9 B;  4B3M B;  4JV5 B;  1P49 A;  1Q3E A;  1K4D C;  4DR1 O;  3ICX A;  3M8A A;  5E79 Z;  1H2S B;  1GK9 A;  2Y69 C;  3K9A A;  3T1H O;  2WLH A;  4DR1 B;  3D8C A;  1AI4 A;  3T1H B;  1Z2G A;  3SJC C;  1FXH A;  3CD6 V;  3RN4 A;  2YIB A;  4N23 A;  4DR6 O;  4TOI A;  5GTH Z;  2PYJ A;  4I50 B;  5LOV B;  2IW5 A;  4DW1 A;  4DR6 B;  2P22 C;  4JZG A;  2IBZ H;  3T2M A;  1T5E A;  2UXB O;  2WWW A;  2EIL C;  4IYH A;  3PN1 A;  2OYQ A;  3ETE A;  2W0F C;  2UXB B;  5CA0 B;  2BSK B;  4OGQ B;  3LDE A;  1Q6I A;  4B7E A;  1ZL8 A;  3E8F A;  3T4Z A;  4LC1 A;  4CH3 A;  1F23 A;  4Q6G A;  4LFC O;  1M1K W;  1SQF A;  3CSX A;  2AHY A;  1FXK A;  5EK0 A;  2LW7 A;  1MOF A;  3HKC A;  2IJK A;  4JI8 B;  1JVM A;  4FLZ A;  2QWN B;  1SET A;  5JVD B;  1M4U A;  1X59 A;  2LJ2 A;  3ZHT A;  3K5N A;  3C90 A;  4J41 A;  5KAF Z;  5D5Q A;  1JQ0 A;  1IZ3 A;  1QQC A;  3RFR A;  2GSM B;  4GZR B;  1YHQ V;  3KCY A;  3R65 A;  3UO3 A;  3G67 A;  3K5M A;  1YI2 V;  4IYI A;  4LCU C;  1VQM V;  4LF9 O;  4Z2W A;  4DR2 B;  4UCV A;  4DW0 A;  3ZHU A;  1NZ6 A;  2P4K A;  1XI1 A;  4LF9 B;  1XMQ B;  1R3K C;  3K04 A;  2XAQ A;  1XNR O;  4HNA A;  3BEH A;  1FXK C;  1Y4M A;  2FKX A;  3B4S A;  1XNR B;  5EYP A;  1OJH A;  2YDE A;  2N74 A;  3CCE V;  3NXS A;  3B40 A;  1HNZ B;  5DED A;  1WAZ A;  2QE7 G;  1PNK A;  1BZK A;  4CH4 A;  1LNQ A;  2PI5 A;  2GV9 A;  3VQV A;  1J95 A;  4JI1 O;  3J81 N;  3T1Y O;  1WA8 B;  4X1K A;  4JI1 B;  1S5H C;  3WB1 A;  1Y66 A;  3T1Y B;  4RUE A;  4B7K A;  3MAQ A;  1NTM H;  4UCU A;  2X6B A;  2DQ0 A;  3CX5 F;  5LXT A;  5CBG A;  5B1B B;  5KUM A;  2KKW A;  5KHH A;  3ML0 A;  1V54 C;  2YXL A;  3ETD A;  1VQN V;  1OCR B;  4O4I A;  5IYD O;  4O2A B;  3ZX6 A;  1BQ0 A;  3LUT B;  4MSW C;  1PNL A;  3CHX A;  4TUY B;  1VMG A;  1N34 O;  2YIB D;  1OCZ B;  1OCC C;  2OCH A;  3BA8 A;  4NB5 A;  1ZTE A;  1N34 B;  2WLJ A;  2OIE A;  3X2Q C;  4X64 O;  2UXC O;  1N33 O;  2UXX A;  1AJP A;  3ASN B;  1JCH A;  1JFF A;  4X64 B;  2UXC B;  1FJG O;  1G6U A;  5EBL C;  3CCJ V;  1MAB G;  2P6J A;  5IYZ A;  3STL C;  3A0B Z;  4ZI7 A;  5JQG A;  1FJG B;  1ZUQ A;  1B6Q A;  2FL4 A;  5IJ0 A;  2OWO A;  4QIW F;  1K33 A;  4P9O A;  3GVM A;  3S3W A;  2BOC C;  2Y69 B;  3VQW A;  3TET A;  4WBN B;  3L75 H;  4JTC B;  2YI8 A;  1ZWI C;  2JDI G;  2XT9 A;  2F95 B;  2R9A A;  1K34 A;  5B3S C;  1XQ8 A;  2IU3 A;  2OIG A;  4JI4 O;  1FFX A;  4NTX A;  5LYJ B;  4GKK O;  1XDC A;  3OUF A;  1XMO O;  2EIL B;  3KZI Z;  3DC5 A;  3K57 A;  4GKK B;  3B09 A;  4UB8 Z;  1XMO B;  3JAL B;  1M5I A;  3W7W A;  4GX5 A;  1NTK H;  3W7S A;  3A8T A;  3K9S A;  4I9W A;  3CC2 V;  5J2U A;  3HB3 B;  3JAS B;  1L1F A;  1OHH G;  3BAB A;  5JJN B;  1AIL A;  3T1C A;  4DV1 B;  4FLY A;  3K5L A;  4WFE A;  4X20 A;  3TCU A;  3C3S A;  1K8A W;  1I94 O;  3N27 A;  1GN3 A;  1X4T A;  2KB1 A;  5IT9 N;  4PA9 A;  2XTA A;  4WF9 V;  3J7A U;  4FLT A;  1I94 B;  2ILM A;  3ABL B;  5JWP A;  3VQY A;  4FZ0 A;  3SPI A;  2PTM A;  2UUA O;  3VOU A;  4J10 A;  1MG1 A;  4QNH B;  2ZCE A;  1FD9 A;  4NKG B;  4O4L A;  3CRA A;  4JYY A;  3OTO B;  2UUA B;  3KKY A;  2DMX A;  2F66 C;  4G2K A;  2W6I G;  4FLV A;  3KG2 A;  4D7T A;  1GTO A;  1XIL A;  1PPJ H;  3CMA V;  1G4Y B;  3FX7 A;  2D3O W;  3B8N A;  1XL6 A;  3AG4 B;  1ZL8 B;  4UCR A;  3ZRV A;  2ZE7 A;  4DK1 A;  4PA6 A;  2CH7 A;  1IBL O;  2QKS A;  2BE3 A;  5EIB C;  2Z0A A;  1FXK B;  3P30 A;  4J11 A;  2GUZ A;  2XAF A;  3HKC B;  2CE4 A;  1R3J C;  5CA3 A;  4GX0 A;  2Q0A A;  1K5S A;  3OE7 G;  2XAJ A;  5EC2 C;  1XHZ A;  3OR6 C;  3G71 V;  1L0L H;  5LA6 A;  3AG7 A;  5EZY A;  2WLI A;  2WPD G;  5B66 Z;  2Q6A A;  2Y0P A;  3L70 H;  3TXS A;  4YIP A;  3ZRX A;  4NTY A;  4CC5 A;  1FKA O;  2YS8 A;  2ZT9 B;  2A3Q A;  2ZIO A;  1ZSP A;  3DGE A;  2AXT Z;  2R9R B;  4HZ3 A;  2YXY A;  4BIZ A;  2DE0 X;  1QLN A;  2K9P A;  3UO2 A;  1BHA A;  1V54 B;  5KX5 A;  1H2N A;  5DEC A;  2XUM A;  2IJI A;  2QKA A;  4HNA B;  5EC1 C;  1AI7 A;  1YF2 A;  3JAK A;  4LFB O;  2F93 B;  3I55 V;  1OCC B;  4L87 A;  1S72 V;  5EYP B;  4H44 B;  4NXM O;  4LFB B;  4UV9 A;  4DV0 O;  2NN4 A;  3X2Q B;  4FLX A;  3ETQ A;  2NR5 A;  4NXM B;  4LWS A;  4DV0 B;  5L3G A;  3RVZ A;  1IBK O;  4ZHQ A;  4IIJ A;  4UVA A;  2N04 A;  1IBK B;  4DV2 O;  2CUG A;  1KEC A;  1GM9 A;  2E75 B;  4U3F H;  5LP6 A;  4X1K B;  1RPO A;  1F4M A;  1KC8 W;  3JAW A;  1DTO A;  4DV2 B;  2XAH A;  1IXM A;  2ADQ B;  5LMU O;  5BMV A;  1NR7 A;  2GTA A;  5FLX N;  2EJR A;  4B3T O;  5LMU B;  3PJS K;  1A32 A;  1H2G A;  3OTF A;  2JJ2 G;  2LW1 A;  3RYI A;  2HJD A;  1H2L A;  1TVK A;  4O4I B;  5EIB D;  4B3T B;  4X1Y A;  5BXZ A;  3ZHV A;  3GB7 C;  5B3S B;  3CRC A;  3EXA A;  2HR3 A;  4YXW G;  1NJI W;  2ZE6 A;  1W0J G;  1BT8 A;  3RW0 A;  4LFA O;  5GW7 A;  2ZR2 A;  3B8M A;  3SYA A;  1RP3 B;  1D5A A;  1Q90 D;  4LFA B;  4Z1M G;  1JFF B;  1TA8 A;  4JZ2 A;  3FYI B;  4PHZ A;  3FAV A;  1JPX A;  3LDC A;  5IYZ B;  4ZI7 B;  5JQG B;  5BZB A;  4K8Z A;  4FFK A;  3JSL A;  5LP6 C;  3RT3 C;  3G4S V;  5IJ0 B;  1S5J A;  2QM8 A;  5B1A C;  2DWD C;  3H1H H;  2C2A A;  5C8Y A;  1WN7 A;  3B77 A;  1NU1 H;  2PYL A;  4UXN A;  2QR4 A;  2Q9L A;  3JCU Z;  2PUS A;  1EN5 A;  4DR3 O;  3O9O A;  1MZE A;  1YJN V;  1NT2 B;  4PEL A;  3K58 A;  1FFX B;  4AQY B;  2L35 A;  4IT5 A;  2VQF B;  3JYC A;  1Q81 W;  4JAU A;  3CCR V;  4GX1 A;  3QTC A;  1J5E O;  2P06 A;  3LNN A;  4J7J A;  4JI3 B;  3T4D A;  1L8D A;  4O4J A;  1Y67 A;  3I56 V;  3ZMZ A;  3BAA A;  3IAY A;  2E76 B;  5J2U B;  1H38 A;  2EUL A;  4BAY A;  3JAT A;  1AI5 A;  2UXD O;  2ODM A;  5A9G A;  3UQ8 A;  3F5T A;  2VWK A;  4CZZ A;  2K1E A;  4TT3 G;  4UUJ C;  3LSU A;  2ZE5 A;  4X20 B;  1WB7 A;  5IYC O;  3OMI B;  3ZMV A;  3AG1 C;  4UB6 Z;  4LF4 B;  1PL4 A;  1S77 D;  5TIS Z;  4KXR A;  5J2T A;  4PJ0 Z;  3AG3 C;  1SRY A;  5IDJ A;  1BSM A;  4U3J A;  4BW5 A;  3ZMS A;  5LMN O;  2ITC C;  4EB6 A;  4JV5 O;  4O4L B;  2QWO B;  2B1G A;  4GLX A;  4D7S A;  5LMN B;  1SA0 A;  3QO5 A;  1XL4 A;  2VS0 A;  1E79 G;  2V7Q G;  2JVD A;  3ZN0 A;  4K8X A;  5IJ9 A;  1NQT A;  3M7M X;  4CS3 A;  1SQP H;  1PNM A;  5B1O A;  4RWU A;  1Q43 A;  2ZR3 A;  2JJ1 G;  2CH7 B;  5H5N A;  3K06 A;  1O9G A;  4D6T H;  5LHH A;  1SER A;  5CB4 A;  3F7V C;  3I5D A;  2EIN C;  1P7B A;  2YXH A;  4KHP O;  2IJJ A;  4K3A A;  3APO A;  3AK3 A;  5D5P A;  4NXN O;  1COW G;  2LGQ A;  3SPG A;  4JF3 A;  2GUZ B;  4KHP B;  2KG7 A;  2RN9 A;  1Q8I A;  4H37 A;  4NXN B;  5IE9 A;  1IBM O;  2FYU H;  1YJW V;  2LQT A;  5LA6 B;  4AIL C;  3CE2 A;  5EZY B;  2WLI B;  4UCT A;  2D2C B;  1IBM B;  1YIT V;  3HR0 A;  1BGY H;  1M57 C;  2QSA A;  2HP8 A;  1BMF G;  2EIK C;  3O65 A;  3UKM A;  4PI0 A;  1NR1 A;  3N2K A;  1US6 A;  2WLL A;  4ABM A;  5KUK A;  1V55 C;  3EVK A;  3QG5 A;  3ZIA G;  1AR4 A;  1AI6 A;  4JI8 O;  3ZBH A;  1P7G A;  3D3Q A;  4FM0 A;  2JK5 C;  5KX5 B;  4UCS A;  3FKS G;  1NBM G;  3IJ4 A;  4F6R A;  3CEI A;  1UJW B;  1I7F A;  2DJV A;  4DV6 O;  1DF4 A;  2DW4 A;  3JAK B;  2DWE C;  4IHJ A;  3BHP A;  2V1D A;  2PZS A;  3AK2 A;  4DV6 B;  1HDJ A;  1M9N A;  4FMT A;  3CME V;  2QA4 V;  2CTQ A;  4JI2 B;  1SQV H;  2Q8V A;  2IH3 C;  3ETG A;  1G8M A;  4A5U B;  3RBZ A;  4LWS B;  2E74 B;  3G6B A;  3HKB A;  1XUQ A;  3OR7 C;  4X88 A;  4DR2 O;  4ZHQ B;  2CTP A;  4IIJ B;  4JTD B;  4XDJ A;  2A06 H;  4LNU A;  4JAV A;  4BWA A;  2AZ0 A;  4AI8 A;  1VQP V;  1PP9 H;  4FK5 C;  1XMQ O;  4R8C A;  2QWQ B;  1DF5 A;  2B5U A;  3K5O A;  5LP6 B;  4TWK A;  1VF5 B;  3JAW B;  5AG2 A;  5BMV B;  5B1A B;  4QGP A;  3OD4 A;  2GTS A;  1VQ6 V;  1HNZ O;  3KCX A;  3RYI B;  1TVK B;  4X89 A;  1AR1 B;  1RM1 B;  2CTR A;  4X1Y B;  3W7T A;  4X66 O;  4U7O A;  1FS0 G;  3D36 A;  3P3P A;  4X66 B;  1R3L C;  3L74 H;  3ZHS A;  1QR8 A;  2OTJ V;  5J9P C;  3DXR A;  1S76 D;  4WFF A;  4PDL A;  3OM3 B;  3FAV B;  1N36 O;  3CCV V;  2QTO A;  5CBF A;  2ATK C;  2UXN A;  1N36 B;  2RDC A;  3FB8 C;  2ARH A;  3NR7 A;  3OW2 U;  3CYO A;  2WA4 A;  4MVO A;  5C8Y B;  2YUA A;  3AG1 B;  5FNV A;  3ZRS A;  4BR6 A;  1XOU A;  2EIM C;  5IY5 C;  4PDV A;  1CXZ B;  3AG3 B;  4DV3 B;  1LR1 A;  3OUS A;  4W4L A;  1BE3 H;  3D36 C;  3MD0 A;  3G6E V;  3JCZ A;  4DO2 A;  2CTW A;  1U97 A;  3TGU H;  1NKD A;  3ZED A;  4J7Z A;  1KU9 A;  1JJ2 U;  4LF5 O;  5HFL A;  4KFM A;  4O4J B;  2YI9 A;  4LF5 B;  2WLK A;  1D2D A;  2FB5 A;  5H9C A;  3ZRW A;  2JEU A;  3WG7 C;  4PA7 A;  3JAT B;  4YY3 O;  1SC5 B;  4X65 O;  1K97 A;  2Y0I A;  1ZX3 A;  2RNB A;  4MW8 A;  5KHI A;  4YY3 B;  1H2K A;  4X65 B;  1KBH A;  5GON A;  2VQE O;  4MVZ A;  3ABU A;  4X9Q A;  2RMK B;  4YIO A;  2Q67 A;  2JGD A;  2XOK G;  2QGN A;  4DXW A;  2VQE B;  3HKD A;  2ZDI A;  2OCC C;  1KP2 A;  5J2T B;  4U3J B;  5LHI A;  2R72 A;  3K0G A;  4QE7 A;  4X62 O;  4EB6 B;  4EEQ A;  2AZ2 A;  1M57 B;  3IC9 A;  4MVQ A;  1SA0 B;  4X62 B;  1QR9 A;  4DV1 O;  5KMG A;  1K5Q A;  2EIK B;  2IM9 A;  1W59 A;  4RQE A;  3WFV A;  1IX9 A;  2A9H A;  1SKV A;  5IJ9 B;  3RVY A;  1V55 B;  1YVW A;  1ORQ C;  1LUW A;  2CAZ C;  1VP7 A;  4ICG A;  3E8G A;  1YEW A;  3RYH A;  1G1X B;  1FPO A;  5CB4 B;  1N0N A;  1D5N A;  4B3S B;  1YCI A;  5DM6 V;  3DC6 A;  1XRE A;  3IGA C;  1UPG A;  4UVB A;  4BW9 A;  3K0D A;  3OTO O;  2E5L O;  4MVM A;  2RJZ A;  3E83 A;  1NS1 A;  3VBB A;  2PY5 A;  2KG7 B;  4LF7 O;  2E5L B;  2MW2 B;  2ZDI C;  2ZE8 A;  4TQF A;  1IDS A;  1OV9 A;  2Q69 A;  3SJB C;  4LF7 B;  5JCO A;  2CDY A;  1MSW D;  1QVG U;  1WP7 A;  1MA1 A;  1UFI A;  2G38 A;  1KYO F;  1BS3 A;  4XDL A;  4DV4 O;  3N2K B;  2WLL B;  4X1I A;  3K79 A;  4CS2 A;  4JI6 O;  4DV4 B;  4R50 A;  2YIC A;  4JI6 B;  4FPP A;  4CS4 A;  4JAA A;  2HKO A;  1GN4 A;  3BVO A;  3R66 A;  4GYC B;  1HR0 B;  4F6R B;  2N05 A;  4IHJ B;  1VQ8 V;  4N21 A;  2A0L A;  4LBE C;  2VRZ A;  4H33 A;  5LHG A;  1LUV A;  5LGT A;  4I0X A;  5JH7 A;  5JCO C;  3HKB B;  4R6Z A;  2OTL V;  4FM1 A;  2WLM A;  4JYC A;  4TV9 A;  1XEQ A;  1IXB A;  1WJZ A;  4LNU B;  3FB5 C;  5BR8 B;  1RPR A;  4DK0 A;  2ZNI A;  1PM9 A;  2HHH O;  2UUB O;  2H3O A;  4HYO A;  3ASO C;  3P32 A;  5B5E Z;  2EBO A;  1R73 A;  2HHH B;  2UUB B;  4GT1 A;  2LO1 A;  2BTQ A;  3U10 A;  2EIM B;  2PF4 E;  4QPK A;  3ZCC A;  4JTA B;  5IY5 B;  1N8R W;  3OFN G;  1Q6H A;  2Y4U A;  4DYL A;  4OXS A;  4EKW A;  2AHZ A;  1U96 A;  1WPX A;  4JYA O;  3K59 A;  2Z3Y A;  1B06 A;  2E3C A;  5LGN A;  2H8P C;  3BCC H;  3DXR B;  4JYA B;  3K3W A;  5KHG A;  3A0H Z;  3E22 A;  3CC7 V;  4UV8 A;  4FLW A;  4RO2 A;  5A2Q N;  1VEW A;  3L73 H;  4RUF A;  3WG7 B;  4FZ1 A;  2RCV A;  2Q68 A;  4MS2 A;  2P67 A;  5LGU A;  4DR4 O;  3ZJZ A;  5KA5 A;  1MZF A;  4DR4 B;  5FNV B;  3D3I A;  1PKX A;  1YIJ V;  3ZHR A;  3THO A;  4JI7 O;  4ZOL A;  3CXH F;  1BCC H;  3L71 H;  2OCC B;  3JAM N;  4LF8 O;  1RSO A;  4QJF B;  4JI7 B;  4LF8 B;  3F7Y C;  3HKE A;  1NH2 D;  4G28 B;  3CCS V;  2XAG A;  5L3B A;  2ZD9 A;  5EBW C;  2Q7E A;  3ABT A;  3SGI A;  3CCM V;  3W7U A;  2VWJ A;  5FL7 G;  2QDO A;  3ZRW B;  5C93 A;  4I9Q A;  2Q73 A;  2KSD A;  1KB9 F;  3E8B A;  2BOB C;  4B08 A;  1H8H G;  1ROP A;  5F2V O;  1S3J A;  1HNW O;  2HLD G;  3M99 B;  1K92 A;  4AQY O;  5GON B;  4CBC A;  4GKJ O;  2VQF O;  1HNW B;  2X0L A;  2IH1 C;  4KL1 A;  1N32 O;  2JGD B;  3HKD B;  1K4C C;  2F1M A;  4JI3 O;  3SYO A;  4GKJ B;  3E86 A;  1IVS A;  1JMK C;  1THZ A;  1N32 B;  1WPB A;  4XBF A;  3ABM C;  2JIZ G;  1GAX A;  2YIA A;  5K1X A;  2LFR A;  1VF7 A;  1BQZ A;  3CS5 A;  4WFA V;  1AP5 A;  4OPA A;  2GHY A;  4Q20 A;  5KMG B;  4DUZ O;  4P9P A;  3U11 A;  2F23 A;  4UVC A;  4HBN A;  2R9I A;  1XNQ O;  3JD2 A;  4DUZ B;  3A2F A;  4LF4 O;  3JD3 A;  3SPC A;  1XNQ B;  1QHT A;  3RYH B;  3P3N A;  2P4V A;  4DR7 O;  1YSC A;  2DQ3 A;  1XHX A;  2YID A;  4RAI A;  4JGS A;  4DR7 B;  1Q86 W;  5L3E A;  3F5W C;  1S0V A;  1ZLZ A;  1NH2 B;  2B1I A;  5JJJ B;  4DUY O;  5LBQ A;  1CEZ A;  3L72 H;  2KQX A;  4P30 A;  4CH5 A;  2A79 B;  1R6T A;  2MK3 A;  4DUY B;  1NTZ H;  3MDS A;  4GUN A;  3N2G A;  3LDD A;  1EN4 A;  1GKF A;  2W6J G;  4X1I B;  2P90 A;  5BY1 A;  1WP8 A;  3A0R A;  3ASO B;  3H01 A;  1B3Q A;  2ZIN A;  3AG2 C;  2EJ7 A;  3APQ A;  3JD0 A;  3K03 A;  2ETN A;  2QWR B;  1FXV A;  5HFM A;  1OZ0 A;  2ZXW C;  1YTF D;  3HPL C;  4JYB A;  2XAS A;  1R1B A;  1KUQ A;  2DYS C;  4BIU A;  1P84 F;  1K9M W;  1Y76 A;  3MHH C;  1H8E G;  3CRM A;  2ZNJ A;  4I55 A;  2F4V O;  3QO8 A;  3BRC A;  2DYR C;  3CC4 V;  4I0X B;  3RWR D;  5JH7 B;  3EFF K;  1EZJ A;  1Z5V A;  2ZIM A;  2F4V B;  3OGC C;  3TK1 A;  1F7Y A;  4TV9 B;  3SJA C;  4KP4 A;  4I4T A;  2P7T C;  2NLJ C;  4WCE V;  2EZP A;  1K3E A;  1ZAU A;  3CP1 A;  5DN6 G;  3STZ C;  3ABK C;  1B04 A;  3G80 A;  1E1Q G;  3BY6 A;  3EHB B;  4WFG A;  5K1P A;  1URF A;  3CRQ A;  3OAA G;  2LP7 A;  4B3R O;  1SZT A;  2Q7G A;  4JI2 O;  3SJQ C;  2CGO A;  2X7R B;  2Q7H A;  4LFC B;  3S3X A;  2BTQ B;  4B3R B;  4FFB A;  1VQ9 V;  3OEH G;  1KD1 W;  4JI0 O;  4EFB A;  4FM2 A;  3FYE B;  3CCL V;  2O57 A;  1VQK V;  3ABL C;  4U7N A;  4JI0 B;  2ITD C;  4LH7 A;  3QNE A;  3JSN A;  2DOS A;  3QF7 A;  4J9Y B;  1HP8 A;  2Q4P A;  3SYP A;  3JD1 A;  3E22 B; 
#chains in the Genus database with same CATH homology
 3ZMU A;  4L87 A;  1S72 V;  1Q7Y W;  1M57 B;  1OCR C;  4UV9 A;  4MVQ A;  4MTO A;  3X2Q B;  1QR9 A;  1K5Q A;  2EIK B;  1KKD A;  3AG4 C;  1I5X A;  2H94 A;  1YTF B;  5L3G A;  4RQE A;  3WFV A;  2A9H A;  1FFT B;  4MVR A;  3RVZ A;  1OCZ C;  5H6R A;  1M56 B;  1BHB A;  2EIJ C;  3RVY A;  4UVA A;  1V55 B;  1ORQ C;  2OT5 A;  1KEC A;  1GM9 A;  1TUE B;  3E8G A;  1PL0 A;  2WAM A;  4GX2 A;  1RPO A;  1F4M A;  2FTK A;  3ASN C;  1KC8 W;  1DTO A;  1QBZ A;  1E1R G;  2XAH A;  1IXM A;  5DM6 V;  4P2Z A;  1EBO A;  1NR7 A;  1OCO C;  3IGA C;  1NVP B;  2X6A A;  4UVB A;  3K0D A;  1QVF U;  5EBM C;  2EJR A;  4G27 B;  3PJS K;  4MVM A;  4E2L A;  3ABM B;  3E83 A;  3VBB A;  1H2G A;  2JJ2 G;  1K4D C;  2ZDI C;  1GK9 A;  1VQ5 V;  2Y69 C;  3K9A A;  1GM8 A;  2WLH A;  3GB7 C;  5B3S B;  2Q69 A;  4PA4 A;  2HR3 A;  4XDK A;  4YXW G;  1MSW D;  1AI4 A;  1NJI W;  1QVG U;  1FXH A;  3CD6 V;  1W0J G;  3RW0 A;  5IYB O;  1I5Y A;  2ZR2 A;  4N23 A;  5GW7 A;  3B8M A;  3SYA A;  4XDL A;  3IC7 A;  2IW5 A;  5CMU A;  4Z1M G;  3CCU V;  2WLL B;  3K79 A;  3FYI B;  1SES A;  3T2M A;  1JPX A;  4R50 A;  3LDC A;  4RQF A;  2WWW A;  2EIL C;  4FPP A;  2ZQM A;  3I55 V;  5BZB A;  2HKO A;  3ETE A;  2YEV A;  2W0F C;  3G4S V;  3LDE A;  2QM8 A;  5B1A C;  2DWD C;  2C2A A;  3B77 A;  3E8F A;  4UXN A;  4N21 A;  1VQ8 V;  3T4Z A;  2WLN A;  4LC1 A;  2A0L A;  1F23 A;  3E8H A;  4LBE C;  1M1K W;  5H6Q A;  4H33 A;  5LHG A;  5LGT A;  1YJN V;  2AHY A;  1FXK A;  5EK0 A;  4MTG A;  4R6Z A;  2OTL V;  4J9Z B;  2EIN B;  4PEL A;  1MOF A;  2HJF C;  2WLM A;  4JYC A;  3CCQ V;  3FB5 C;  2IJK A;  3AG2 B;  1RPR A;  3JYC A;  1JVM A;  1Q81 W;  4JAU A;  3CCR V;  4GX1 A;  2ZXW B;  1SET A;  1GO3 F;  1AJN A;  3T4D A;  3I56 V;  3ZMZ A;  4HYO A;  2DYS B;  3ASO C;  3P32 A;  2EBO A;  1H38 A;  1JQ0 A;  1R73 A;  4BAY A;  1W2B U;  1AI5 A;  1CP9 A;  1P4R A;  2GSM B;  4GT1 A;  5L3F A;  1F4N A;  4MVU A;  4CZZ A;  3K08 A;  1YHQ V;  2K1E A;  3R65 A;  4TT3 G;  2EIM B;  4MT8 A;  2Y48 A;  4QPK A;  4UUJ C;  3ZCC A;  3ZN1 A;  4JTA B;  2DYR B;  5IY5 B;  1YI2 V;  4LCU C;  1VQM V;  1N8R W;  3OFN G;  5IYC O;  3OMI B;  4OXS A;  5E1A C;  3ZMV A;  4EKW A;  3AG1 C;  2AHZ A;  4R7C A;  1WPX A;  1S77 D;  1R3K C;  3K04 A;  2XAQ A;  2Z3Y A;  5LGN A;  4ZBM A;  2H8P C;  3BEH A;  3AG3 C;  3K3W A;  1FXK C;  1GM7 A;  1SRY A;  1Y4M A;  5IDJ A;  4X8A A;  2WSS G;  3ABK B;  4BW5 A;  4MVS A;  3CC7 V;  3ZMS A;  5L3D A;  2ITC C;  4UV8 A;  2PI4 A;  1GMG A;  4RO2 A;  4WFB V;  3CCE V;  4RUF A;  2B1G A;  3NXS A;  3WG7 B;  3QO5 A;  1XL4 A;  2QE7 G;  1PNK A;  2Q68 A;  1E79 G;  2V7Q G;  4MS2 A;  2P67 A;  3OMN B;  1LNQ A;  2M7W A;  3E89 A;  3ZN0 A;  5LGU A;  2PI5 A;  1NQT A;  2IJH A;  4QE9 A;  1PNM A;  5B1O A;  1J95 A;  3ZJZ A;  5KA5 A;  2ZR3 A;  4QPJ A;  2JJ1 G;  3K06 A;  5LHH A;  4WFH A;  1SER A;  3D3I A;  1PKX A;  1YIJ V;  3F7V C;  1S5H C;  4MTX A;  1Y66 A;  2EIN C;  3LSQ A;  4RUE A;  1P7B A;  2OCC B;  2IJJ A;  2X6B A;  2DQ0 A;  4QJF B;  1COW G;  3SPG A;  4JF3 A;  3F7Y C;  5B1B B;  5CBG A;  1NH2 D;  5KUM A;  1JX9 A;  4G28 B;  1KP3 A;  2HVK C;  2XAG A;  4H37 A;  3CCS V;  3ML0 A;  1V54 C;  2QEX V;  5L3B A;  3ETD A;  1VQN V;  1OCR B;  2ZD9 A;  3SPJ A;  5IYD O;  1YJW V;  3LUT B;  4MSW C;  1PNL A;  5EBW C;  4ASU G;  1ARO P;  3ABT A;  2WLI B;  3CCM V;  1OCZ B;  1QLE C;  1OCC C;  1YIT V;  4TSF G;  1AJQ A;  3W7U A;  2EIJ B;  5CBH A;  1M57 C;  5FL7 G;  3CPW U;  3ZRW B;  5C93 A;  2WLJ A;  3AEI A;  3X2Q C;  1BMF G;  2EIK C;  2UXX A;  1AJP A;  3E8B A;  3UKM A;  3ASN B;  4JAS A;  2BOB C;  3IFX A;  1NR1 A;  1H8H G;  1JCH A;  1ROP A;  2WLL A;  1S3J A;  3GWO A;  1M56 C;  5KUK A;  2HLD G;  1OCO B;  4PDM A;  3M99 B;  1K92 A;  1V55 C;  3ZIA G;  5EBL C;  3CCJ V;  1MAB G;  2P6J A;  4CBC A;  1AI6 A;  3STL C;  1ENV A;  2X0L A;  2IH1 C;  3E2E A;  2JK5 C;  1B6Q A;  1K4C C;  3MHS C;  4QIW F;  3SYO A;  3FKS G;  3E86 A;  1K33 A;  1NBM G;  4P9O A;  2BOC C;  2Y69 B;  1THZ A;  3TET A;  1UJW B;  4JTC B;  1DF4 A;  1ZWI C;  2DW4 A;  2DWE C;  4XBF A;  3ABM C;  4JPR A;  2JDI G;  2JIZ G;  2V1D A;  3SYQ A;  1M9N A;  4FMT A;  3CME V;  2LFR A;  2QA4 V;  4WFA V;  2GHY A;  4Q20 A;  1K34 A;  2IH3 C;  3ETG A;  1G8M A;  5B3S C;  3RBZ A;  4P9P A;  2IU3 A;  3OR7 C;  4X88 A;  3E35 A;  4ZKI A;  1R3I C;  4UVC A;  4JTD B;  2LFS A;  4XDJ A;  2R9I A;  3OUF A;  3JD2 A;  4JAV A;  1VQP V;  3JD3 A;  4FK5 C;  2EIL B;  4R8C A;  3SPC A;  1DF5 A;  2B5U A;  2XND G;  4FJC C;  3W7X A;  4TWK A;  1YSC A;  2DQ3 A;  3W7W A;  4GX5 A;  5CN0 A;  3W7S A;  1W0K G;  4I9W A;  3SPH A;  4RAI A;  5B1A B;  4JGS A;  3CC2 V;  1Q86 W;  3HB3 B;  5L3E A;  3OMA B;  2HFE C;  3F5W C;  1L1F A;  1VQ6 V;  4MW3 A;  1S0V A;  1OHH G;  4PA3 A;  2JEX A;  5L3C A;  1NH2 B;  3T1C A;  2B1I A;  4GCZ A;  3DTU B;  4X89 A;  5LBQ A;  1AR1 B;  1RM1 B;  1CEZ A;  4WFE A;  1WLE A;  3TCU A;  4P30 A;  3W7T A;  2A79 B;  1EFR G;  1VQ7 V;  2MK3 A;  1F51 A;  1FS0 G;  4U7O A;  1K8A W;  3D36 A;  4MTF A;  2KB1 A;  3SYC A;  3CXC U;  4PA9 A;  4WF9 V;  1PD3 A;  1R3L C;  1Q82 W;  1QR8 A;  3ABL B;  2OTJ V;  3LDD A;  1VQO V;  5J9P C;  1GKF A;  3SPI A;  1R6N A;  2W6J G;  3VOU A;  1MG1 A;  2P90 A;  1S76 D;  4WFF A;  4PDL A;  4QNH B;  3LSS A;  3ASO B;  3A0R A;  3OM3 B;  3H01 A;  2EZO A;  3AG2 C;  3CCV V;  4G2K A;  3JD0 A;  3K03 A;  2QTO A;  4HAM A;  5CBF A;  1FXV A;  5HFM A;  2W6I G;  1DLB A;  1OZ0 A;  2ATK C;  2ZXW C;  2UXN A;  2YEV B;  3KG2 A;  1YTF D;  3HPL C;  4JYB A;  2XAS A;  1VQ4 V;  1GTO A;  2F43 G;  3FB8 C;  4PDR A;  2CK3 G;  2DYS C;  3CYO A;  3CMA V;  3OW2 U;  1G4Y B;  2D3O W;  4BIU A;  3B8N A;  1XL6 A;  4MVO A;  1K9M W;  3AG4 B;  3MHH C;  1H8E G;  3ZRV A;  1BL8 A;  4PA6 A;  3AG1 B;  3ZRS A;  4F4L A;  2QKS A;  3JD4 A;  2EIM C;  4KUM A;  1NVP D;  1KQS U;  3QO8 A;  5IY5 C;  2DYR C;  4PDV A;  3CC4 V;  3AG3 B;  3EFF K;  1FXK B;  3OUS A;  1EZJ A;  3MD0 A;  3P30 A;  3OGC C;  3G6E V;  2XAF A;  3TK1 A;  3JCZ A;  4DO2 A;  4KP4 A;  1NKD A;  1R3J C;  3FB7 C;  5CA3 A;  4GX0 A;  2P7T C;  2NLJ C;  1K5S A;  4WCE V;  3OE7 G;  2EZP A;  1K3E A;  5DN6 G;  3CP1 A;  1JJ2 U;  2XAJ A;  5EC2 C;  3OR6 C;  3UM7 A;  3G71 V;  2HG5 C;  1CPY A;  5HFL A;  3STZ C;  1K7D A;  4KFM A;  3ABK C;  2WLI A;  2WPD G;  2YSU B;  5KA6 A;  1E1Q G;  2Q6A A;  3BY6 A;  4FIP C;  1R6K A;  5B1N A;  1YJ9 V;  2NNU A;  2WLK A;  3EHB B;  2HVJ C;  3LNM B;  5H9C A;  4WFG A;  3ZRW A;  2JEU A;  3WG7 C;  4PA7 A;  3OAA G;  2LP7 A;  1RM1 C;  1SZT A;  4LP8 A;  3ZRX A;  3SJQ C;  1VQL V;  2X7R B;  1M90 W;  1K97 A;  3FB6 C;  3ZMT A;  3DGE A;  4MW8 A;  1VQ9 V;  2R9R B;  3OEH G;  4HZ3 A;  1QCE A;  1KD1 W;  4BIZ A;  2IU0 A;  1QLN A;  2QM7 A;  3FYE B;  3CCL V;  1VQK V;  4MVZ A;  1HWY A;  3ABU A;  3ABL C;  4U7N A;  2ITD C;  3QO7 A;  3QNE A;  1BHA A;  1V54 B;  2Q67 A;  2XOK G;  4DXW A;  4J9Y B;  2ZDI A;  1JOY A;  2OCC C;  1KP2 A;  2IJI A;  4I5S A;  3SYP A;  1K73 W;  2Z5U A;  2X6C A;  3JD1 A;  5LHI A;  5EC1 C;  1AI7 A;  3K0G A;  4QE7 A;  5B1B C;  3OEE G;  1QLE B;  1OCC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...