1NVPB

Human tfiia/tbp/dna complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
43
structure length
43
Chain Sequence
TVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords 5'-D(*GP*GP*GP*GP*GP*GP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*G)-3'
total genus 16
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2003-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1nvpB00
4HAMA 3W7UA 5GW7A 5CA3A 3BY6A 1NH2B 2WAMA 1S3JA 3E35A 1YTFB 3W7SA 3IC7A 2P90A 3D3IA 3W7XA 3W7WA 2HR3A 1RM1C 3W7TA 1NVPB
chains in the Genus database with same CATH superfamily
4QJFB 2KSDA 2E3CA 4GX2A 4JI8O 4OX9O 2ZCEA 1BSMA 4DV2O 2YXHA 4JI6B 1SZTA 1H2NA 5K1PA 2A7WA 2LO1A 3TJTA 1IVSA 5CA0B 3AG1B 3ZMVA 5DECA 3OM3B 5CBFA 4X1KB 1TA8A 1YF2A 2N74A 3RYIB 2Q69A 3BY6A 4WFFA 1K92A 3R65A 4E2LA 4FM0A 2OWOA 2E76B 3ASOC 1M57C 4LBEC 4MT8A 1XHZA 4GX1A 1P4RA 3BA9A 3TK1A 5L3CA 1RPRA 1AR4A 2Z0AA 2H3OA 3FX7A 2LGQA 4O4JA 1LNQA 4G28B 2P67A 3TCUA 1X4TA 2N05A 2WLJA 5DM6V 2XHBA 2YIDA 2X0LA 3QO7A 1XHXA 3RYHA 2WA4A 5LP6C 3WFVA 2P4KA 2ITDC 3S3XA 2UXCB 3QVNA 1Q82W 2F95B 3TXQA 4I50B 1VF7A 1Z5WA 2LFSA 2Z5UA 3ZRXA 4X89A 1K9MW 2RNBA 4BW5A 1R1BA 4LR3A 1UFIA 3BVOA 1XNRO 4OXSA 2GUZA 1N0JA 4ZOLA 1FFXA 2OIGA 3CC4V 3CP1A 2UXXA 2X6AA 2B5UA 1K7DA 2UUCO 1YEWA 1HNXB 1EZVH 4J9YB 5IT9N 4UVAA 1IX9A 2V4DA 4N21A 2P90A 5JH7B 4UCOA 3CCMV 2WSSG 5CA1B 3CSXA 2BE3A 5E1AC 1DGSA 1NH2B 3VQXA 4PI2A 1Q6UA 3AG7A 5IJ9A 2HLDG 1UJWB 4I50A 5TISZ 3RYIA 5LYJB 3SYCA 2AW9A 4O4HA 1S3JA 3JD2A 1BZKA 3RW0A 1R73A 1HR0O 3JYCA 5CA0A 1V9PA 4JASA 3ZEDA 5J2UA 4DV1O 1AI4A 4IIJB 4PD4F 4O2BA 4X62O 2EILB 5H6QA 4L87A 1EN6A 3HKBB 4X1IA 3JD0A 3RBZA 1QVGU 4I4TA 4CC5A 1XL6A 3WG7B 2QM7A 2VWJA 4TQDA 3CCUV 4P9OA 1N0NA 3N27A 5C93A 2ZM6O 3FYEB 4LH6A 3DXRA 3SJBC 1H8HG 3B4SA 4XDKA 4K8XA 3SPCA 4QE9A 1M5IA 4GX0A 1PNKA 4IL6Z 1AI7A 5FPOA 5A9GA 4DXWA 3OMIB 2PZSA 1Y74B 5B1BB 3UO2A 3E83A 1RFYA 3MHHC 1XREA 1H2KA 2WLLA 3UCSC 3JCZA 4UVBA 4NR1A 5LXTB 4X62B 4JF3A 1IXMA 1K5SA 5B5EZ 2UXDO 2FKXA 5GTIZ 2HP8A 1NU1H 5JCOA 2A79B 3IFXA 4O2BB 2WPDG 4KUMA 3E22B 2QTOA 1GKFA 3RYCA 3DC5A 3K9AA 3Q4HA 2JJ1G 2RCVA 4JZ2A 1QNMA 2IJJA 2JS3A 2JS5A 5IY5B 3CMAV 2CUGA 2P6JA 2CDYA 3HKDA 5HFMA 3K5MA 3T2MA 3G6BA 3QG5A 1TVKA 3ETGA 4IHJA 1Y76B 5KHIA 3FB6C 2G38A 2YSUB 4JI7B 1GN4A 4LCUC 3JAMN 5B1OA 2JK5C 2QGNA 3AK1A 1YZBA 1L0NH 3SR2C 1EM1A 4HNAA 3B8NA 3ASOB 4X8AA 3SPIA 3DTUB 3DSQA 3HKDB 3P32A 1SQFA 3K5OA 3B8MA 4GKKB 2A06H 4JI6O 4RQFA 4GZRB 3AEIA 1P84F 2Q8VA 3SDLA 2KQXA 3L71H 4DV3B 2R9IA 1YXBA 2E75B 2JIZG 4I55B 5JJNB 1N32O 2EIKB 1T5EA 1SF9A 5FNVB 5CN0A 5KAIZ 5KHKA 1XMQB 2PTMA 2PF4E 4O2AB 5BZBA 1G1XB 3F7VC 4GYCB 2WLLB 1NTKH 1BHBA 4A5UB 1NH2D 5LA6A 1NJIW 4JI8B 2ADPA 1VQKV 3LSUA 4R7CA 2F1MA 4FFBA 3CEIA 5DEDA 1BCCH 1KB9F 2F93B 5AG2A 5CB4A 2GBOA 2Q5ZA 3LSQA 1N33B 4MVSA 1K33A 3E22A 3SJAC 3RYCB 3M99B 4B7KA 2IU0A 4LP8A 3KG2A 3W7TA 1NVPB 1PL0A 4GKKO 5EZYA 1I94O 1DF4A 1K4CC 5IYZA 5JVDA 1HNZO 1OCCC 5LXTA 1SQVH 2AHZA 1Z5VA 3OMNB 3IGAC 2Y69C 1XBLA 1ZLZA 2P7TC 3ZMZA 4LF6B 4CH4A 4TUYB 3CRRA 1Q6IA 4ZHQB 1YJNV 2CK3G 3K5NA 3CCSV 4JTCB 1I0HA 4QPKA 4GKJB 2R70A 4HBNA 5L3DA 5LMNB 2PYJA 1QU7A 4PA9A 3U10A 1BHAA 5LBQA 5IYDO 4Q6GA 3ICXA 1VQ9V 2ZNIA 2OT5A 3K0GA 4AQYB 1KYOF 5KHJA 2VQFB 3TXSA 4ZKIA 2M7WA 5J2TA 5GTHZ 1KMIZ 3WU2Z 1VQOV 4DUYO 3AG1C 4DR6O 1KBHA 2IM9A 4DR2B 4YY3O 4P30A 1GTOA 2R9RB 4JYCA 4QPJA 4DV6O 5LL6Y 5B1AB 1NR7A 3ZHSA 3JATA 5K1XA 1HNZB 1JJOA 4FLZA 2V7QG 1SQQH 2AZ2A 1NZ6A 3D36C 4JV5O 3RYFA 2OCHA 4NTYA 4X65B 1LUVA 1NVPD 3HPLC 1AVMA 2OCCC 4PELA 1COWG 4DR6B 3E86A 3T4ZA 1ZTEA 1Q3EA 3OR6C 4LWSB 5B1BC 4CZZA 4DYLA 4J80A 4KP4A 2QR4A 1TUBA 4UV9A 4JI1O 1F4MA 3A8TA 5EYPA 1WPXA 4DRXB 5BMVB 3P3PA 2CTQA 4J42A 2BSKB 3E8GA 2AXTZ 3SYPA 4OPHA 4UCRA 3CPWU 4CS3A 1JPXA 4C7UA 1Q5OA 4TV9A 1Q7YW 2IJHA 1WAZA 4DR7O 1GM7A 2JGDA 1OV9A 2RDCA 4NXNB 4RWUA 2YXLA 1J5EB 1AJNA 4K35A 1FKAO 1R6KA 4LF5B 5LMUO 2XASA 4IGGA 5EBLC 2QDOA 4X88A 4X1YA 3KZIZ 2QKCA 1U96A 3K08A 2LGWA 5KUKA 4FLYA 2HFEC 2P06A 5CMUA 2IW5A 1F51A 4JI0O 4B3RO 4K8ZA 4JI5B 1OCCB 5IDJA 4LF9B 3FYIB 4JI3B 4DR4O 4NXMO 3JALA 1FFXB 4X64B 2ZD9A 1YVWA 3JASA 2UU9B 2LW1A 3LSSA 4QE7A 3JAWA 3CRCA 2YC0A 1PKXA 3CJHB 1WNSA 1F4NA 3JSNA 4EEQA 5KA6A 4D7SA 1XMOB 1VQMV 4JTDB 3H9VA 5LMUB 4FLTA 1URFA 2QWRB 4PDMA 5JJEB 1OZ0A 1JA8A 5LGUA 2F23A 2CTWA 1KKDA 1WJZA 5FLXN 3OTFA 5LGTA 4U3JB 2GTSA 3SPGA 4HAMA 2JDIG 5F2VO 5B1AC 4B3MO 1IBMB 4JI1B 3E8BA 5L3FA 3DC6A 2JGUA 5H6RA 5EIBC 4ZIBA 2ILMA 2YIBA 5EZYB 2LQTA 2YEVB 4DR3O 2CGOA 2K1EA 4WBNA 1XUQA 4DV5O 2DWEC 4MSWC 5JQGB 1HW7A 2KG7A 3NXSA 1WB8A 5IJ0A 1D5NA 2EIMC 3W7SA 3AG3C 1W2BU 3CMEV 3CCEV 2DWDC 3LNMB 4LFCO 4LF7O 3FAVB 2KKWA 1U97A 1QLNA 2YEVA 3QO8A 1NT2B 2WLIA 3AK3A 3W7UA 5IY5C 2EILC 1HP8A 3ZCCA 2DYSB 2ATKC 1EN5A 3L75H 2YICA 1E1RG 5B66Z 1XEQA 5J2UB 1NI8A 3E8FA 2IU3A 3ZHUA 3T1YB 2IBZH 4ZHQA 5L3BA 4FVMA 3WB2A 3MDSA 3H1KH 3T1HO 2GHYA 1WN7A 3B40A 2EINC 3DGEA 1SERA 3CWBH 1GMGA 2DOSA 3IC9A 4DO2A 5JJJB 4LF8B 1N34O 4D7TA 4X66O 1Y6XA 1YHQV 1FXKA 4H33A 1BGYH 3ZBHA 3RGBA 1KKCA 5FPRA 1DF5A 1R6NA 1M4UA 1P7BA 1AB3A 4YY3B 1DLBA 4I0XA 4UXNA 1NQTA 5KHHA 3HB3B 4FLXA 2QKAA 3RYFB 2EZOA 3E35A 2EX3A 1M57B 2OYQA 3CHXA 2P22C 2ZDIC 2W0FC 3K06A 2F4VB 4BWAA 3RVYA 4LFAB 4U7NA 4JYAB 3T1HB 1FAFA 1KUQA 4LNUB 4RAIA 4MTXA 1MZEA 3ZJZA 1QR8A 1TVKB 1Y66A 1AI6A 5BMVA 2PI4A 2HG5C 1YITV 2E5LB 4GKJO 1W0JG 2EJRA 4J7ZA 1N34B 2LFRA 1XNQO 3BAAA 3ABTA 1H2LA 4CS4A 1YCIA 2OTLV 3L70H 3KKYA 5C8YB 1PD3A 3FB8C 4GX5A 4XDJA 3VQVA 2Y0PA 4FIPC 3TGUH 2CH7B 3ASNB 4RQEA 1M56B 2B1GA 1FFTB 2HHHB 1JX9A 1BL8A 4XBFA 1SESA 4MVRA 1KD1W 1F7YA 5EIBD 2Y4UA 4NB5A 4U3FH 4DV2B 4DK1A 2CAZC 4KL1A 3O65A 4WFBV 2EIKC 3E8HA 2XTAA 2X6BA 5JH7A 2IH3C 1SZXA 4X20A 1FS0G 1RPOA 3CC2V 4MW8A 2A9HA 1WPBA 4H13B 5BR8B 1CP9A 1I5YA 4UCTA 1HR0B 2WA3A 4MS2A 2Y69B 3W7XA 2UXNA 4DR2O 4DR5O 3L72H 5IJ9B 5JQGA 3OTOO 2RMKB 3C3SA 2BOBC 1GN3A 5GW7A 3ZMUA 4KHPB 3AG2B 4DUYB 4DK0A 4MTGA 3K5LA 3OUFA 2DW4A 1IBLB 2DE0X 4OX9B 4FFBB 4H44B 1O9GA 3JATB 3KCYA 2Q0OC 2XAGA 2XNDG 3BFRA 1KP3A 2ZQMA 4WFHA 2UUAB 3K04A 1J95A 1JVMA 4KHPO 5JVDB 2XAJA 2GTAA 2KB1A 1GN6A 4YJ2B 3CCJV 3D8CA 3OTOB 1AP5A 1XMOO 1GN2A 3MD0A 4OGQB 3ZHQA 3BPZA 3ETEA 5BY1A 2LW7A 4LF9O 3CRMA 3ZS8C 4JAUA 1S77D 1THZA 3G80A 1ZX3A 4U3JA 2Q0AA 3OFNG 3M7MX 3OGCC 3OEHG 1PNMA 2QJ1A 4LF4O 3ZIAG 5KMGA 4JI3O 4ZOLB 1SA0B 4GUNA 2UU9O 4UFZA 3OEEG 4I5SA 4O4LB 1PPJH 1SS3A 4MTFA 3M8AA 4JI5O 1K4DC 5E79Z 4ZI7B 4ZBMA 3CC7V 1VQ6V 1GO3F 1N36B 2NNUA 4MVMA 3VQYA 5LA6B 3JD4A 1V54C 1XOUA 1SQXH 2Y4TA 1MSDA 2ZE6A 2ZR2A 1AROP 3CCQV 2HJDA 1EN4A 4I0XB 2Q6AA 5LYJA 1FJGB 2RN9A 2GUZB 2V1DA 2ETNA 2YIAA 2Q7HA 3SJCC 5LHGA 2LP7A 3EFFK 3VBBA 1ENVA 1ORQC 1RP3B 2JJ2G 1IBLO 3F5WC 2YUAA 4JPRA 1Q6HA 3OT7A 5BXZA 1K5QA 3H1HH 1YTFD 4HZ3A 3UQ8A 4PA7A 1OCZB 1V55C 3AG2C 2EIJB 2VS0A 4J9ZB 1VF6C 3EHBB 4X66B 1RM1B 5KX5B 4I9QA 4NTWA 4Z2WA 4NVPA 1Q8IA 3ABLB 4YXWG 3PJSK 4IYIA 3PN1A 1PV0A 4LF8O 2Q7GA 2AZ0A 4TT3G 1M56C 1NTZH 4FLVA 3L73H 3H01A 4JGSA 4W4KA 2X6CA 1I08A 1FXKC 2VQEB 3SGIA 4CS2A 1D5AA 1BQZA 3QTCA 3CXCU 2D3OW 1QR9A 2JVDA 2L35A 4DUZB 2VWKA 4LFAO 4AHCA 3DXRB 2QSAA 1Q81W 4J11A 4L8JA 3UT5B 2Q67A 4AQYO 2QWNB 3OAAG 4FPPA 2H8PC 1QCEA 4KFMA 3BEHA 2Q73A 3FAVA 2XT9A 3X2QB 4UV8A 2P4VA 3AG4C 1O9HA 1VMGA 2IJIA 3QNEA 1YTFB 4JYAO 2YS8A 4PI0A 2ZKOA 1MNGA 2DQ0A 3CE2A 1EBOA 3FKSG 3A2FA 3K57A 4DR1O 2B9ZA 5EK0A 5LGNA 3I55V 1E1QG 1A32A 3IJ4A 3ZHRA 1N33O 2DYRC 2KG7B 4JYBA 2BTOA 3ZRVA 2RJZA 3A0BZ 4CH6A 5IE9A 1AP6A 2DYSC 2WLNA 4O2AA 1E79G 2CE4A 3AG3B 4YIPA 2WLIB 3A0RA 3ZMTA 3IC7A 2UXCO 3L9DA 2O57A 1JJ2U 1Y76A 3APOA 2FL4A 4B3SB 4JI7O 1B06A 5KX5A 4PDRA 5IWAO 3H1JH 1PP9H 2Q68A 1XNRB 3LUTB 1YJWV 2PGGA 1S5JA 3JARA 4EFEA 3H1LH 2ZINA 1I94B 4J10A 2OIEA 4CC6A 1VQ7V 1P7GA 4YHHO 1GM9A 1R3LC 3N2GA 3NR7A 2QWQB 1XILA 4NTXA 5LMNO 4DR7B 4H0LB 1K3EA 4PJ0Z 4UB8Z 1ZSPA 2HJFC 2QM8A 2R72A 2HVKC 3OR7C 5H5NA 2PYLA 2XOKG 4JYYA 3RVZA 4H37A 1XDCA 1CXZB 3VOUA 4YJ3B 2DQ3A 2C2AA 3N2KA 1R3IC 3ZRSA 3THOA 5H9CA 1UPGA 5CA3A 1K97A 4DR5B 3JSLA 5L3EA 2VQFO 4ICGA 4IT5A 3FD9A 5KHGA 4MVUA 4NYKA 3ABKB 1KP2A 1YDXA 4P9PA 1FYJA 2HHHO 4I4TB 1N8RW 3T4DA 1VQPV 4TV8B 3GWOA 1HNWO 2UUCB 3H1IH 3JAWB 5LOVA 2FB5A 3JASB 4CH5A 2FMLA 3QO5A 1G4YB 1M1KW 1IZ3A 4F6EA 2W6JG 2CTRA 4UVCA 3X2QC 1R3KC 5LHHA 1CEZA 5KUMA 4K0KB 3TETA 1OCRC 4F6RB 4B3SO 2N04A 1SQGA 1J5EO 4BW9A 1MMMA 1QLEB 4GT1A 4QIWF 2L6LA 3N2GB 2Q9LA 4J7JA 4I9WA 3K59A 5A2QN 2HR3A 3FB5C 1GAXA 4PDVA 4DR3B 4BAYA 4DV4O 4X64O 4PV1B 3E89A 1BQ0A 2XAHA 3LNNA 4FM2A 2EJ7A 3SPHA 1VQ5V 1WP8A 3B2EE 2ZE7A 5J9PC 1TAEA 4XDLA 1TUBB 3OD4A 4DV0B 1NKDA 1WLEA 2B1IA 2ADQB 1VF5B 5IYBO 2P5OA 4RO2A 4AILC 3SYOA 4FMTA 1RSOB 1S72V 2JEUA 1MA1A 4B3RB 5GONB 3ASNC 3KCXA 5CA1A 2ZIMA 4F4LA 2W0XA 4NXNO 2CGNA 2ZXWB 1FJGO 1M93A 2F43G 1FXVA 2MW2B 4U7OA 4HNAB 5CBHA 5EBMC 4P2ZA 1KQSU 2R9AA 3HKEA 3ABMB 4DW0A 3K3WA 2BTQA 3WB1A 3GVMA 4DUZO 1N36O 5EBWC 3E2EA 3B09A 4LNUA 3UT5A 4WFGA 3SJQC 2DN9A 4K3AA 2WAMA 1SA0A 3BHPA 4DV0O 3OUSA 1I5XA 5B3SC 2VRZA 4GCZA 3JALB 3T1CA 4B3TO 1MG1A 2FYUH 3ABKC 4IYHA 5CBGA 3ZRWB 1DTOA 1IDSA 2ZR3A 1H2SB 4MVOA 2YXYA 5GONA 1ROPA 2WWWA 1G8MA 3L74H 2BCCH 1OCOC 3N2KB 3W7WA 3IAYA 2YIBD 2ODMA 2PI5A 4NKGB 2JEXA 3MHSC 3CCRV 3JD3A 4DR1B 4PHZA 3HKEB 3ZMSA 4UCSA 1SETA 1XMQO 2E5LO 2E74B 2RQ6A 4TQFA 2ZE5A 4EKWA 4Q20A 4TOIA 4JI4B 1L1FA 3D3QA 1YI2V 3JAKA 5KA5A 3JARB 2FTKA 2UXBB 5IWAB 5DN6G 1BT8A 3C3TA 4TWKA 4TUYA 2Q4PA 3CXHF 4B08A 4O4IA 2ZDIA 1SKVA 2GDSA 1H2GA 4ZI7A 3JD1A 4FLUA 1AR5A 3FB7C 2OTJV 3P30A 3UO3A 1VQNV 1VEWA 3CX5F 3OMAB 1V55B 3U0ZA 2CH7A 1W59A 4EFBA 1VQ8V 3LDDA 2Y48A 4PA3A 4WFAV 3SYQA 3ZN1A 2DJVA 2GV9A 1HDJA 2IH1C 1XI1A 2BOCC 3C90A 3A0HZ 3ZX6A 5LHIA 1M9NA 3CCVV 5HFLA 3I56V 1ZAUA 3Q4HB 2BSKA 3ZRWA 1JQ0A 5KAFZ 1S0VA 4DRXA 3CS5A 2QE7G 1NBMG 4YJ3A 3CB2A 4LFBO 2Q7EA 2ZXWC 2EIJC 4WFEA 5IYCO 5J2TB 4YJ2A 4ASUG 4X9QA 4FZ0A 4LWSA 2JGDB 1AR1B 2LJ2A 5JCOC 1EZJA 3ABLC 4LF6O 4FFKA 3ETDA 3OW2U 2A0LA 4CH3A 3S3WA 3D3IA 3K03A 5B1NA 4FZ1A 4YHHB 4R50A 1XNQB 1H38A 1JFFB 5LOVB 4FLWA 1K73W 2UUBO 4JAAA 5JWPA 1Q86W 1FXKB 1Q90D 3HKCA 1K8AW 4OPAA 1WB7A 4QGPA 2ITCC 4I7ZB 4Z1VA 4JTAB 1GK9A 3MAQA 2M6YA 1JMKC 4CBCA 5D5PA 1H2MA 1SC5B 3HKBA 4X1IB 1KU9A 2H94A 4JI0B 2WLMA 4JV5B 3LDEA 1ZL8B 2QKSA 1RM1C 5EC1C 4X65O 5H2FZ 4EB6B 2UXBO 1MZFA 4B7EA 1VQ4V 5BR8O 1JFFA 1WA8A 3K79A 4NXMB 4ABMA 1EFRG 4PDLA 3HKCB 2ZE8A 1AJPA 1SQBH 1DK1A 3WG7C 1SRYA 3AK2A 5ITZA 2NLJC 3HR0A 4DV4B 4D6TH 3GWKC 3J80N 1Z2GA 1GH6A 1IBKO 1MOFA 3ABUA 4PA6A 3G6EV 1R3JC 3OGIB 1US6A 3BABA 3BA8A 1H8EG 2DYRB 3APQA 1FXHA 4O4LA 4K0KO 4LF5O 4AI8A 2DMXA 1BE3H 4MTOA 2JRIA 1XL4A 1HWYA 1B3QA 4JAVA 2EBOA 1TGOA 4UCVA 1G6UA 1S5HC 1PM9A 5ITZB 2Y0IA 1VQLV 1GRJA 2PY5A 1JR9A 1IBKB 3RYHB 4O4JB 3EXAA 1NTMH 3F5TA 2XAFA 1FD9A 4W4LA 3RFRA 2ARHA 1VF6A 3UM7A 1D2DA 1SQPH 1HNWB 1L0LH 3CRAA 2QTSA 1VIBA 3I5DA 3ZN0A 2MK3A 3VQWA 1I7FA 4DV5B 2XUMA 3CJHA 3OE7G 4G27B 1YJ9V 4YIOA 2YI8A 1AI5A 3G4SV 4O4IB 1IXBA 2PUSA 4HYOA 4LFCB 4LF7B 2A3QA 4Z1MG 2HVJC 5IJ0B 4N23A 1FPOA 1QLEC 2NR5A 4BIUA 2QM4A 4B3TB 3BCCH 4DR4B 3J81N 1QHTA 2K9PA 5LP6A 2GSMB 3STZC 1JOYA 2UXDB 4BIOA 1NR1A 1L8DA 3BRCA 2CTPA 1OCZC 2EULA 4F6RA 1K34A 1ZWIC 1VP7A 3B77A 1QVFU 5KLVH 3JAKB 3FFQA 4BIZA 1IBMO 3CCLV 2ZM6B 3LDCA 1JCHA 1W0KG 1XQ8A 2UUAO 4UB6Z 1AJQA 5D5QA 2F66C 1N4CA 1IURA 1PL4A 3J7AU 1BS3A 4R8CA 3K58A 4E4EA 4RUFA 2X7RB 4DV1B 1QQCA 1LUWA 4TV8A 5FL7G 4BR6A 4KXRA 1KC8W 3QF7A 1V54B 4DV7O 2EIMB 5FNVA 5EYPB 5IYZB 3D36A 4J7KA 4X1YB 3SPJA 3STLC 2YDEA 2AGAA 1OJHA 1B6QA 4JI2B 4FK5C 4MVQA 1TUEB 1B04A 3RWRD 4TV9B 5CB4B 4FJCC 1WP7A 2QWOB 4UCUA 2HKOA 2F4VO 1X59A 3F7YC 5L3GA 4LF4B 1MSWD 2QEXV 1Y74A 4JZGA 4DW1A 1R6TA 3CD6V 2QWPB 4QNHB 4FM1A 3RT3C 2WLHA 3JCUZ 4EB6A 3O9OA 3ZHVA 1P49A 1LR1A 1OHHG 4JI2O 5LP6B 2ZT9B 1BMFG 2ZIOA 2VQEO 1KECA 5KMGB 2EINB 3RN4A 3WB0A 4J41A 1VARA 1OCRB 4RUEA 1PNLA 4IIJA 3ABMC 2WLKA 1Y4MA 4B3MB 5C8YA 1QBZA 1S76D 1CPYA 2EZPA 4WBNB 4WCEV 3T1YO 1ZL8A 2QA4V 4PA4A 4O4HB 4X20B 3ZHTA 1M90W 1RSOA 2AHYA 2UUBB 3G71V 4LH7A 1AILA 2D2CB 4JI4O 2BTQB 5EC2C 1MABG 1Q43A 4IHJB 4LFBB 3SYAA 2YI9A 1YIJV 2OCCB 4G2KA 1OCOB 3GB7C 4X1KA 1F23A 2XAQA 2IJKA 2ZNJA 4GLXA 1NS1A 3R66A 2NN4A 3U11A 3EVKA 5B3SB 1WA8B 3AG4B 4TSFG 3CRQA 4MVZA 2HEPA 3G67A 4DV7B 1YSCA 2Z3YA 3CYOA 1HNXO 3K9SA 1S5LZ 3UKMA 4UUJC 4MW3A 4DV3O 2W6IG 1GM8A 3ETQA 4DV6B 3K0DA 1Y67A 4WF9V 1N32B 4R6ZA 3P3NA 4I55A 4LC1A 1ZUQA 3ML0A
chains in the Genus database with same CATH topology
4QJFB 1K4DC 4GX2A 3ZMSA 4ZBMA 3CC7V 1VQ6V 3E8GA 1GO3F 1SETA 2NNUA 3SYPA 4EKWA 3CPWU 4Q20A 1JPXA 4MVMA 1SZTA 1L1FA 1YI2V 1Q7YW 3JD4A 1V54C 5KA5A 3AG1B 3ZMVA 2IJHA 2FTKA 1GM7A 3OM3B 5DN6G 2ZR2A 5CBFA 1AROP 3CCQV 2Q6AA 1AJNA 4TWKA 1R6KA 2Q69A 2V1DA 2XASA 3BY6A 4WFFA 2ZDIA 5EBLC 1K92A 3R65A 4E2LA 4X88A 3ASOC 1H2GA 1M57C 4LBEC 4MT8A 3JD1A 4GX1A 1P4RA 5LHGA 3TK1A 5L3CA 2LP7A 3EFFK 1RPRA 3FB7C 1ENVA 1ORQC 3VBBA 3K08A 2OTJV 3P30A 1VQNV 2JJ2G 5KUKA 3OMAB 2HFEC 1V55B 3F5WC 5CMUA 2IW5A 4JPRA 1F51A 1VQ8V 1LNQA 3LDDA 2Y48A 1K5QA 4G28B 1YTFD 4PA3A 2P67A 4HZ3A 3TCUA 4WFAV 2WLJA 5DM6V 3SYQA 3ZN1A 4PA7A 1OCCB 2IH1C 1OCZB 2X0LA 5IDJA 2BOCC 3QO7A 3FYIB 5LHIA 1V55C 3AG2C 3WFVA 1M9NA 2EIJB 5HFLA 3I56V 2ZD9A 3CCVV 2ITDC 3LSSA 3ZRWA 4J9ZB 3EHBB 1JQ0A 4QE7A 1RM1B 1Q82W 1S0VA 1PKXA 2Z5UA 2LFSA 3ZRXA 1F4NA 2QE7G 4X89A 1NBMG 5KA6A 3ABLB 4YXWG 1K9MW 3PJSK 4BW5A 2ZXWC 2EIJC 1VQMV 4WFEA 4JTDB 5IYCO 4ASUG 4PDMA 4TT3G 1M56C 1OZ0A 3H01A 4JGSA 4OXSA 1AR1B 5LGUA 2X6CA 1EZJA 1FXKC 3ABLC 3ETDA 1KKDA 3OW2U 2A0LA 3CC4V 3D3IA 3CP1A 2UXXA 2X6AA 3K03A 5B1NA 2B5UA 4R50A 1K7DA 5LGTA 1H38A 3CXCU 2D3OW 1QR9A 4J9YB 3SPGA 1K73W 4HAMA 2JDIG 1Q86W 1FXKB 4UVAA 5B1AC 4N21A 2P90A 1K8AW 3CCMV 1Q81W 3E8BA 2WSSG 2ITCC 5L3FA 2Q67A 4JTAB 1GK9A 4CBCA 5E1AC 3OAAG 4FPPA 5H6RA 1NH2B 2H8PC 1QCEA 4KFMA 3BEHA 2H94A 3X2QB 4UV8A 2HLDG 3AG4C 2IJIA 2WLMA 2YEVB 3LDEA 3QNEA 1UJWB 1YTFB 2K1EA 2QKSA 2DQ0A 2DWEC 1RM1C 5EC1C 3SYCA 1EBOA 4MSWC 3FKSG 1S3JA 1VQ4V 3NXSA 3JD2A 3RW0A 3K79A 1R73A 5EK0A 5LGNA 1EFRG 4PDLA 3I55V 1E1QG 3JYCA 4JASA 2DYRC 2EIMC 3W7SA 3AG3C 1AJPA 1W2BU 4JYBA 3WG7C 1SRYA 3ZRVA 3CMEV 3CCEV 2NLJC 2DWDC 3LNMB 1AI4A 1MOFA 3ABUA 2EILB 4PA6A 3G6EV 5H6QA 1R3JC 4L87A 2DYSC 3JD0A 3RBZA 1H8EG 2DYRB 2WLNA 1E79G 1QVGU 1FXHA 3AG3B 1QLNA 2YEVA 1XL6A 3WG7B 2QM7A 3QO8A 2WLIB 3A0RA 3ZMTA 3IC7A 3CCUV 2WLIA 4P9OA 3W7UA 5IY5C 1JJ2U 2EILC 3ZCCA 2DYSB 4MTOA 2ATKC 5C93A 1XL4A 1E1RG 1HWYA 4PDRA 3FYEB 4JAVA 2EBOA 1H8HG 4XDKA 2Q68A 1S5HC 1VQLV 3E8FA 3SPCA 4QE9A 2IU3A 4GX0A 1PNKA 3LUTB 1YJWV 1AI7A 4DXWA 3OMIB 5B1BB 5L3BA 3E83A 3MHHC 1VQ7V 2GHYA 2XAFA 1GM9A 1R3LC 2EINC 3DGEA 1SERA 3UM7A 1GMGA 2WLLA 4DO2A 1K3EA 2HJFC 3ZN0A 2QM8A 3JCZA 2MK3A 4UVBA 2HVKC 3OR7C 2XOKG 3OE7G 4JF3A 4G27B 3RVZA 1IXMA 1K5SA 4H37A 1YHQV 1FXKA 4H33A 3VOUA 2A79B 3IFXA 1YJ9V 2DQ3A 2C2AA 2WPDG 1DF5A 1R3IC 1AI5A 1R6NA 4KUMA 2QTOA 1GKFA 3ZRSA 3G4SV 1P7BA 5H9CA 3K9AA 1DLBA 4HYOA 2JJ1G 4UXNA 1NQTA 3HB3B 5CA3A 2EZOA 3E35A 4Z1MG 2HVJC 2IJJA 1K97A 5L3EA 5IY5B 1M57B 4N23A 1QLEC 3CMAV 2P6JA 4BIUA 5HFMA 2ZDIC 2W0FC 3K06A 3T2MA 4MVUA 3ETGA 2GSMB 3STZC 3ABKB 1JOYA 3FB6C 2YSUB 3RVYA 4U7NA 1NR1A 1KP2A 4P9PA 4LCUC 4RAIA 4MTXA 5B1OA 3ZJZA 1QR8A 1Y66A 2JK5C 1AI6A 2PI4A 2HG5C 1YITV 1N8RW 3T4DA 1VQPV 3GWOA 1OCZC 1K34A 1ZWIC 1W0JG 2EJRA 2LFRA 3ABTA 3B8NA 3B77A 3ASOB 1QVFU 4X8AA 2OTLV 3SPIA 3DTUB 3QO5A 1G4YB 1M1KW 3P32A 2W6JG 4BIZA 3CCLV 3B8MA 1JCHA 1PD3A 3FB8C 3LDCA 1W0KG 4GX5A 4UVCA 4RQFA 3X2QC 1R3KC 1AJQA 4XDJA 3AEIA 5LHHA 1CEZA 5KUMA 4FIPC 2R9IA 3ASNB 3TETA 4R8CA 4RQEA 2JIZG 1M56B 2B1GA 1FFTB 1OCRC 2EIKB 4RUFA 1JX9A 1BL8A 4XBFA 1SESA 2X7RB 4MVRA 1KD1W 5FL7G 5CN0A 1KC8W 1V54B 2EIMB 3D36A 5BZBA 1QLEB 4GT1A 4QIWF 3SPJA 3STLC 3F7VC 4WFBV 2EIKC 3E8HA 4I9WA 1B6QA 2WLLB 2X6BA 1BHBA 2IH3C 2HR3A 3FB5C 4PDVA 4FK5C 4BAYA 1NH2D 4MVQA 1TUEB 1FS0G 1NJIW 1RPOA 4FJCC 3CC2V 4MW8A 2A9HA 1VQKV 2HKOA 3E89A 4R7CA 1MSWD 3F7YC 5L3GA 1CP9A 1I5YA 2QEXV 2XAHA 3CD6V 3SPHA 3LSQA 4QNHB 4MS2A 2WLHA 4MVSA 1VQ5V 1K33A 3M99B 5J9PC 2Y69B 3W7XA 2IU0A 2UXNA 3KG2A 4LP8A 3W7TA 1NVPB 1PL0A 4XDLA 1NKDA 1WLEA 2BOBC 2B1IA 1DF4A 1K4CC 5IYBO 5GW7A 3ZMUA 1OCCC 4RO2A 3SYOA 1OHHG 2AHZA 4FMTA 3OMNB 3AG2B 1S72V 3IGAC 2JEUA 2Y69C 1BMFG 3ZMZA 2P7TC 4MTGA 1KECA 2EINB 3ASNC 1YJNV 2CK3G 3OUFA 3CCSV 4RUEA 1OCRB 4JTCB 4QPKA 4F4LA 1PNLA 2DW4A 3ABMC 5L3DA 2ZXWB 4PA9A 1BHAA 2F43G 2WLKA 5LBQA 5IYDO 1Y4MA 1FXVA 2XAGA 2XNDG 1VQ9V 1QBZA 4U7OA 1KP3A 1CPYA 2EZPA 2OT5A 2ZQMA 4WFHA 1S76D 4WCEV 3K0GA 2QA4V 4PA4A 5CBHA 5EBMC 4P2ZA 1KQSU 1M90W 3ABMB 2AHYA 4ZKIA 3K04A 1J95A 2M7WA 3K3WA 1JVMA 2XAJA 1VQOV 3G71V 5EBWC 3E2EA 3AG1C 4WFGA 2KB1A 3SJQC 3CCJV 2WAMA 4P30A 1GTOA 2R9RB 5EC2C 1MABG 4JYCA 3OUSA 1I5XA 4QPJA 3MD0A 3SYAA 5B3SC 5B1AB 1NR7A 3ETEA 1YIJV 2OCCB 4G2KA 4GCZA 1OCOB 2V7QG 3GB7C 3T1CA 1F23A 1MG1A 3ABKC 2XAQA 2IJKA 5CBGA 3ZRWB 1DTOA 4JAUA 1S77D 2ZR3A 1THZA 4MVOA 1ROPA 5B3SB 1NVPD 3HPLC 2WWWA 3OFNG 1G8MA 3AG4B 2OCCC 3OGCC 3OEHG 1OCOC 4TSFG 1PNMA 4MVZA 4PELA 3ZIAG 3W7WA 1COWG 1YSCA 2Z3YA 3CYOA 2PI5A 3UKMA 3E86A 3T4ZA 3OR6C 4UUJC 5B1BC 4MW3A 4CZZA 2W6IG 3OEEG 4KP4A 1GM8A 4I5SA 2JEXA 3MHSC 4UV9A 1F4MA 3CCRV 3K0DA 3JD3A 4WF9V 1WPXA 4R6ZA 4LC1A 4MTFA 3ML0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HAM A;  3W7U A;  5GW7 A;  5CA3 A;  3BY6 A;  1NH2 B;  2WAM A;  1S3J A;  3E35 A;  1YTF B;  3W7S A;  3IC7 A;  2P90 A;  3D3I A;  3W7X A;  3W7W A;  2HR3 A;  1RM1 C;  3W7T A;  1NVP B; 
#chains in the Genus database with same CATH topology
 4QJF B;  2KSD A;  2E3C A;  4GX2 A;  4JI8 O;  4OX9 O;  2ZCE A;  1BSM A;  4DV2 O;  2YXH A;  4JI6 B;  1SZT A;  1H2N A;  5K1P A;  2A7W A;  2LO1 A;  3TJT A;  1IVS A;  5CA0 B;  3AG1 B;  3ZMV A;  5DEC A;  3OM3 B;  5CBF A;  4X1K B;  1TA8 A;  1YF2 A;  2N74 A;  3RYI B;  2Q69 A;  3BY6 A;  4WFF A;  1K92 A;  3R65 A;  4E2L A;  4FM0 A;  2OWO A;  2E76 B;  3ASO C;  1M57 C;  4LBE C;  4MT8 A;  1XHZ A;  4GX1 A;  1P4R A;  3BA9 A;  3TK1 A;  5L3C A;  1RPR A;  1AR4 A;  2Z0A A;  2H3O A;  3FX7 A;  2LGQ A;  4O4J A;  1LNQ A;  4G28 B;  2P67 A;  3TCU A;  1X4T A;  2N05 A;  2WLJ A;  5DM6 V;  2XHB A;  2YID A;  2X0L A;  3QO7 A;  1XHX A;  3RYH A;  2WA4 A;  5LP6 C;  3WFV A;  2P4K A;  2ITD C;  3S3X A;  2UXC B;  3QVN A;  1Q82 W;  2F95 B;  3TXQ A;  4I50 B;  1VF7 A;  1Z5W A;  2LFS A;  2Z5U A;  3ZRX A;  4X89 A;  1K9M W;  2RNB A;  4BW5 A;  1R1B A;  4LR3 A;  1UFI A;  3BVO A;  1XNR O;  4OXS A;  2GUZ A;  1N0J A;  4ZOL A;  1FFX A;  2OIG A;  3CC4 V;  3CP1 A;  2UXX A;  2X6A A;  2B5U A;  1K7D A;  2UUC O;  1YEW A;  1HNX B;  1EZV H;  4J9Y B;  5IT9 N;  4UVA A;  1IX9 A;  2V4D A;  4N21 A;  2P90 A;  5JH7 B;  4UCO A;  3CCM V;  2WSS G;  5CA1 B;  3CSX A;  2BE3 A;  5E1A C;  1DGS A;  1NH2 B;  3VQX A;  4PI2 A;  1Q6U A;  3AG7 A;  5IJ9 A;  2HLD G;  1UJW B;  4I50 A;  5TIS Z;  3RYI A;  5LYJ B;  3SYC A;  2AW9 A;  4O4H A;  1S3J A;  3JD2 A;  1BZK A;  3RW0 A;  1R73 A;  1HR0 O;  3JYC A;  5CA0 A;  1V9P A;  4JAS A;  3ZED A;  5J2U A;  4DV1 O;  1AI4 A;  4IIJ B;  4PD4 F;  4O2B A;  4X62 O;  2EIL B;  5H6Q A;  4L87 A;  1EN6 A;  3HKB B;  4X1I A;  3JD0 A;  3RBZ A;  1QVG U;  4I4T A;  4CC5 A;  1XL6 A;  3WG7 B;  2QM7 A;  2VWJ A;  4TQD A;  3CCU V;  4P9O A;  1N0N A;  3N27 A;  5C93 A;  2ZM6 O;  3FYE B;  4LH6 A;  3DXR A;  3SJB C;  1H8H G;  3B4S A;  4XDK A;  4K8X A;  3SPC A;  4QE9 A;  1M5I A;  4GX0 A;  1PNK A;  4IL6 Z;  1AI7 A;  5FPO A;  5A9G A;  4DXW A;  3OMI B;  2PZS A;  1Y74 B;  5B1B B;  3UO2 A;  3E83 A;  1RFY A;  3MHH C;  1XRE A;  1H2K A;  2WLL A;  3UCS C;  3JCZ A;  4UVB A;  4NR1 A;  5LXT B;  4X62 B;  4JF3 A;  1IXM A;  1K5S A;  5B5E Z;  2UXD O;  2FKX A;  5GTI Z;  2HP8 A;  1NU1 H;  5JCO A;  2A79 B;  3IFX A;  4O2B B;  2WPD G;  4KUM A;  3E22 B;  2QTO A;  1GKF A;  3RYC A;  3DC5 A;  3K9A A;  3Q4H A;  2JJ1 G;  2RCV A;  4JZ2 A;  1QNM A;  2IJJ A;  2JS3 A;  2JS5 A;  5IY5 B;  3CMA V;  2CUG A;  2P6J A;  2CDY A;  3HKD A;  5HFM A;  3K5M A;  3T2M A;  3G6B A;  3QG5 A;  1TVK A;  3ETG A;  4IHJ A;  1Y76 B;  5KHI A;  3FB6 C;  2G38 A;  2YSU B;  4JI7 B;  1GN4 A;  4LCU C;  3JAM N;  5B1O A;  2JK5 C;  2QGN A;  3AK1 A;  1YZB A;  1L0N H;  3SR2 C;  1EM1 A;  4HNA A;  3B8N A;  3ASO B;  4X8A A;  3SPI A;  3DTU B;  3DSQ A;  3HKD B;  3P32 A;  1SQF A;  3K5O A;  3B8M A;  4GKK B;  2A06 H;  4JI6 O;  4RQF A;  4GZR B;  3AEI A;  1P84 F;  2Q8V A;  3SDL A;  2KQX A;  3L71 H;  4DV3 B;  2R9I A;  1YXB A;  2E75 B;  2JIZ G;  4I55 B;  5JJN B;  1N32 O;  2EIK B;  1T5E A;  1SF9 A;  5FNV B;  5CN0 A;  5KAI Z;  5KHK A;  1XMQ B;  2PTM A;  2PF4 E;  4O2A B;  5BZB A;  1G1X B;  3F7V C;  4GYC B;  2WLL B;  1NTK H;  1BHB A;  4A5U B;  1NH2 D;  5LA6 A;  1NJI W;  4JI8 B;  2ADP A;  1VQK V;  3LSU A;  4R7C A;  2F1M A;  4FFB A;  3CEI A;  5DED A;  1BCC H;  1KB9 F;  2F93 B;  5AG2 A;  5CB4 A;  2GBO A;  2Q5Z A;  3LSQ A;  1N33 B;  4MVS A;  1K33 A;  3E22 A;  3SJA C;  3RYC B;  3M99 B;  4B7K A;  2IU0 A;  4LP8 A;  3KG2 A;  3W7T A;  1NVP B;  1PL0 A;  4GKK O;  5EZY A;  1I94 O;  1DF4 A;  1K4C C;  5IYZ A;  5JVD A;  1HNZ O;  1OCC C;  5LXT A;  1SQV H;  2AHZ A;  1Z5V A;  3OMN B;  3IGA C;  2Y69 C;  1XBL A;  1ZLZ A;  2P7T C;  3ZMZ A;  4LF6 B;  4CH4 A;  4TUY B;  3CRR A;  1Q6I A;  4ZHQ B;  1YJN V;  2CK3 G;  3K5N A;  3CCS V;  4JTC B;  1I0H A;  4QPK A;  4GKJ B;  2R70 A;  4HBN A;  5L3D A;  5LMN B;  2PYJ A;  1QU7 A;  4PA9 A;  3U10 A;  1BHA A;  5LBQ A;  5IYD O;  4Q6G A;  3ICX A;  1VQ9 V;  2ZNI A;  2OT5 A;  3K0G A;  4AQY B;  1KYO F;  5KHJ A;  2VQF B;  3TXS A;  4ZKI A;  2M7W A;  5J2T A;  5GTH Z;  1KMI Z;  3WU2 Z;  1VQO V;  4DUY O;  3AG1 C;  4DR6 O;  1KBH A;  2IM9 A;  4DR2 B;  4YY3 O;  4P30 A;  1GTO A;  2R9R B;  4JYC A;  4QPJ A;  4DV6 O;  5LL6 Y;  5B1A B;  1NR7 A;  3ZHS A;  3JAT A;  5K1X A;  1HNZ B;  1JJO A;  4FLZ A;  2V7Q G;  1SQQ H;  2AZ2 A;  1NZ6 A;  3D36 C;  4JV5 O;  3RYF A;  2OCH A;  4NTY A;  4X65 B;  1LUV A;  1NVP D;  3HPL C;  1AVM A;  2OCC C;  4PEL A;  1COW G;  4DR6 B;  3E86 A;  3T4Z A;  1ZTE A;  1Q3E A;  3OR6 C;  4LWS B;  5B1B C;  4CZZ A;  4DYL A;  4J80 A;  4KP4 A;  2QR4 A;  1TUB A;  4UV9 A;  4JI1 O;  1F4M A;  3A8T A;  5EYP A;  1WPX A;  4DRX B;  5BMV B;  3P3P A;  2CTQ A;  4J42 A;  2BSK B;  3E8G A;  2AXT Z;  3SYP A;  4OPH A;  4UCR A;  3CPW U;  4CS3 A;  1JPX A;  4C7U A;  1Q5O A;  4TV9 A;  1Q7Y W;  2IJH A;  1WAZ A;  4DR7 O;  1GM7 A;  2JGD A;  1OV9 A;  2RDC A;  4NXN B;  4RWU A;  2YXL A;  1J5E B;  1AJN A;  4K35 A;  1FKA O;  1R6K A;  4LF5 B;  5LMU O;  2XAS A;  4IGG A;  5EBL C;  2QDO A;  4X88 A;  4X1Y A;  3KZI Z;  2QKC A;  1U96 A;  3K08 A;  2LGW A;  5KUK A;  4FLY A;  2HFE C;  2P06 A;  5CMU A;  2IW5 A;  1F51 A;  4JI0 O;  4B3R O;  4K8Z A;  4JI5 B;  1OCC B;  5IDJ A;  4LF9 B;  3FYI B;  4JI3 B;  4DR4 O;  4NXM O;  3JAL A;  1FFX B;  4X64 B;  2ZD9 A;  1YVW A;  3JAS A;  2UU9 B;  2LW1 A;  3LSS A;  4QE7 A;  3JAW A;  3CRC A;  2YC0 A;  1PKX A;  3CJH B;  1WNS A;  1F4N A;  3JSN A;  4EEQ A;  5KA6 A;  4D7S A;  1XMO B;  1VQM V;  4JTD B;  3H9V A;  5LMU B;  4FLT A;  1URF A;  2QWR B;  4PDM A;  5JJE B;  1OZ0 A;  1JA8 A;  5LGU A;  2F23 A;  2CTW A;  1KKD A;  1WJZ A;  5FLX N;  3OTF A;  5LGT A;  4U3J B;  2GTS A;  3SPG A;  4HAM A;  2JDI G;  5F2V O;  5B1A C;  4B3M O;  1IBM B;  4JI1 B;  3E8B A;  5L3F A;  3DC6 A;  2JGU A;  5H6R A;  5EIB C;  4ZIB A;  2ILM A;  2YIB A;  5EZY B;  2LQT A;  2YEV B;  4DR3 O;  2CGO A;  2K1E A;  4WBN A;  1XUQ A;  4DV5 O;  2DWE C;  4MSW C;  5JQG B;  1HW7 A;  2KG7 A;  3NXS A;  1WB8 A;  5IJ0 A;  1D5N A;  2EIM C;  3W7S A;  3AG3 C;  1W2B U;  3CME V;  3CCE V;  2DWD C;  3LNM B;  4LFC O;  4LF7 O;  3FAV B;  2KKW A;  1U97 A;  1QLN A;  2YEV A;  3QO8 A;  1NT2 B;  2WLI A;  3AK3 A;  3W7U A;  5IY5 C;  2EIL C;  1HP8 A;  3ZCC A;  2DYS B;  2ATK C;  1EN5 A;  3L75 H;  2YIC A;  1E1R G;  5B66 Z;  1XEQ A;  5J2U B;  1NI8 A;  3E8F A;  2IU3 A;  3ZHU A;  3T1Y B;  2IBZ H;  4ZHQ A;  5L3B A;  4FVM A;  3WB2 A;  3MDS A;  3H1K H;  3T1H O;  2GHY A;  1WN7 A;  3B40 A;  2EIN C;  3DGE A;  1SER A;  3CWB H;  1GMG A;  2DOS A;  3IC9 A;  4DO2 A;  5JJJ B;  4LF8 B;  1N34 O;  4D7T A;  4X66 O;  1Y6X A;  1YHQ V;  1FXK A;  4H33 A;  1BGY H;  3ZBH A;  3RGB A;  1KKC A;  5FPR A;  1DF5 A;  1R6N A;  1M4U A;  1P7B A;  1AB3 A;  4YY3 B;  1DLB A;  4I0X A;  4UXN A;  1NQT A;  5KHH A;  3HB3 B;  4FLX A;  2QKA A;  3RYF B;  2EZO A;  3E35 A;  2EX3 A;  1M57 B;  2OYQ A;  3CHX A;  2P22 C;  2ZDI C;  2W0F C;  3K06 A;  2F4V B;  4BWA A;  3RVY A;  4LFA B;  4U7N A;  4JYA B;  3T1H B;  1FAF A;  1KUQ A;  4LNU B;  4RAI A;  4MTX A;  1MZE A;  3ZJZ A;  1QR8 A;  1TVK B;  1Y66 A;  1AI6 A;  5BMV A;  2PI4 A;  2HG5 C;  1YIT V;  2E5L B;  4GKJ O;  1W0J G;  2EJR A;  4J7Z A;  1N34 B;  2LFR A;  1XNQ O;  3BAA A;  3ABT A;  1H2L A;  4CS4 A;  1YCI A;  2OTL V;  3L70 H;  3KKY A;  5C8Y B;  1PD3 A;  3FB8 C;  4GX5 A;  4XDJ A;  3VQV A;  2Y0P A;  4FIP C;  3TGU H;  2CH7 B;  3ASN B;  4RQE A;  1M56 B;  2B1G A;  1FFT B;  2HHH B;  1JX9 A;  1BL8 A;  4XBF A;  1SES A;  4MVR A;  1KD1 W;  1F7Y A;  5EIB D;  2Y4U A;  4NB5 A;  4U3F H;  4DV2 B;  4DK1 A;  2CAZ C;  4KL1 A;  3O65 A;  4WFB V;  2EIK C;  3E8H A;  2XTA A;  2X6B A;  5JH7 A;  2IH3 C;  1SZX A;  4X20 A;  1FS0 G;  1RPO A;  3CC2 V;  4MW8 A;  2A9H A;  1WPB A;  4H13 B;  5BR8 B;  1CP9 A;  1I5Y A;  4UCT A;  1HR0 B;  2WA3 A;  4MS2 A;  2Y69 B;  3W7X A;  2UXN A;  4DR2 O;  4DR5 O;  3L72 H;  5IJ9 B;  5JQG A;  3OTO O;  2RMK B;  3C3S A;  2BOB C;  1GN3 A;  5GW7 A;  3ZMU A;  4KHP B;  3AG2 B;  4DUY B;  4DK0 A;  4MTG A;  3K5L A;  3OUF A;  2DW4 A;  1IBL B;  2DE0 X;  4OX9 B;  4FFB B;  4H44 B;  1O9G A;  3JAT B;  3KCY A;  2Q0O C;  2XAG A;  2XND G;  3BFR A;  1KP3 A;  2ZQM A;  4WFH A;  2UUA B;  3K04 A;  1J95 A;  1JVM A;  4KHP O;  5JVD B;  2XAJ A;  2GTA A;  2KB1 A;  1GN6 A;  4YJ2 B;  3CCJ V;  3D8C A;  3OTO B;  1AP5 A;  1XMO O;  1GN2 A;  3MD0 A;  4OGQ B;  3ZHQ A;  3BPZ A;  3ETE A;  5BY1 A;  2LW7 A;  4LF9 O;  3CRM A;  3ZS8 C;  4JAU A;  1S77 D;  1THZ A;  3G80 A;  1ZX3 A;  4U3J A;  2Q0A A;  3OFN G;  3M7M X;  3OGC C;  3OEH G;  1PNM A;  2QJ1 A;  4LF4 O;  3ZIA G;  5KMG A;  4JI3 O;  4ZOL B;  1SA0 B;  4GUN A;  2UU9 O;  4UFZ A;  3OEE G;  4I5S A;  4O4L B;  1PPJ H;  1SS3 A;  4MTF A;  3M8A A;  4JI5 O;  1K4D C;  5E79 Z;  4ZI7 B;  4ZBM A;  3CC7 V;  1VQ6 V;  1GO3 F;  1N36 B;  2NNU A;  4MVM A;  3VQY A;  5LA6 B;  3JD4 A;  1V54 C;  1XOU A;  1SQX H;  2Y4T A;  1MSD A;  2ZE6 A;  2ZR2 A;  1ARO P;  3CCQ V;  2HJD A;  1EN4 A;  4I0X B;  2Q6A A;  5LYJ A;  1FJG B;  2RN9 A;  2GUZ B;  2V1D A;  2ETN A;  2YIA A;  2Q7H A;  3SJC C;  5LHG A;  2LP7 A;  3EFF K;  3VBB A;  1ENV A;  1ORQ C;  1RP3 B;  2JJ2 G;  1IBL O;  3F5W C;  2YUA A;  4JPR A;  1Q6H A;  3OT7 A;  5BXZ A;  1K5Q A;  3H1H H;  1YTF D;  4HZ3 A;  3UQ8 A;  4PA7 A;  1OCZ B;  1V55 C;  3AG2 C;  2EIJ B;  2VS0 A;  4J9Z B;  1VF6 C;  3EHB B;  4X66 B;  1RM1 B;  5KX5 B;  4I9Q A;  4NTW A;  4Z2W A;  4NVP A;  1Q8I A;  3ABL B;  4YXW G;  3PJS K;  4IYI A;  3PN1 A;  1PV0 A;  4LF8 O;  2Q7G A;  2AZ0 A;  4TT3 G;  1M56 C;  1NTZ H;  4FLV A;  3L73 H;  3H01 A;  4JGS A;  4W4K A;  2X6C A;  1I08 A;  1FXK C;  2VQE B;  3SGI A;  4CS2 A;  1D5A A;  1BQZ A;  3QTC A;  3CXC U;  2D3O W;  1QR9 A;  2JVD A;  2L35 A;  4DUZ B;  2VWK A;  4LFA O;  4AHC A;  3DXR B;  2QSA A;  1Q81 W;  4J11 A;  4L8J A;  3UT5 B;  2Q67 A;  4AQY O;  2QWN B;  3OAA G;  4FPP A;  2H8P C;  1QCE A;  4KFM A;  3BEH A;  2Q73 A;  3FAV A;  2XT9 A;  3X2Q B;  4UV8 A;  2P4V A;  3AG4 C;  1O9H A;  1VMG A;  2IJI A;  3QNE A;  1YTF B;  4JYA O;  2YS8 A;  4PI0 A;  2ZKO A;  1MNG A;  2DQ0 A;  3CE2 A;  1EBO A;  3FKS G;  3A2F A;  3K57 A;  4DR1 O;  2B9Z A;  5EK0 A;  5LGN A;  3I55 V;  1E1Q G;  1A32 A;  3IJ4 A;  3ZHR A;  1N33 O;  2DYR C;  2KG7 B;  4JYB A;  2BTO A;  3ZRV A;  2RJZ A;  3A0B Z;  4CH6 A;  5IE9 A;  1AP6 A;  2DYS C;  2WLN A;  4O2A A;  1E79 G;  2CE4 A;  3AG3 B;  4YIP A;  2WLI B;  3A0R A;  3ZMT A;  3IC7 A;  2UXC O;  3L9D A;  2O57 A;  1JJ2 U;  1Y76 A;  3APO A;  2FL4 A;  4B3S B;  4JI7 O;  1B06 A;  5KX5 A;  4PDR A;  5IWA O;  3H1J H;  1PP9 H;  2Q68 A;  1XNR B;  3LUT B;  1YJW V;  2PGG A;  1S5J A;  3JAR A;  4EFE A;  3H1L H;  2ZIN A;  1I94 B;  4J10 A;  2OIE A;  4CC6 A;  1VQ7 V;  1P7G A;  4YHH O;  1GM9 A;  1R3L C;  3N2G A;  3NR7 A;  2QWQ B;  1XIL A;  4NTX A;  5LMN O;  4DR7 B;  4H0L B;  1K3E A;  4PJ0 Z;  4UB8 Z;  1ZSP A;  2HJF C;  2QM8 A;  2R72 A;  2HVK C;  3OR7 C;  5H5N A;  2PYL A;  2XOK G;  4JYY A;  3RVZ A;  4H37 A;  1XDC A;  1CXZ B;  3VOU A;  4YJ3 B;  2DQ3 A;  2C2A A;  3N2K A;  1R3I C;  3ZRS A;  3THO A;  5H9C A;  1UPG A;  5CA3 A;  1K97 A;  4DR5 B;  3JSL A;  5L3E A;  2VQF O;  4ICG A;  4IT5 A;  3FD9 A;  5KHG A;  4MVU A;  4NYK A;  3ABK B;  1KP2 A;  1YDX A;  4P9P A;  1FYJ A;  2HHH O;  4I4T B;  1N8R W;  3T4D A;  1VQP V;  4TV8 B;  3GWO A;  1HNW O;  2UUC B;  3H1I H;  3JAW B;  5LOV A;  2FB5 A;  3JAS B;  4CH5 A;  2FML A;  3QO5 A;  1G4Y B;  1M1K W;  1IZ3 A;  4F6E A;  2W6J G;  2CTR A;  4UVC A;  3X2Q C;  1R3K C;  5LHH A;  1CEZ A;  5KUM A;  4K0K B;  3TET A;  1OCR C;  4F6R B;  4B3S O;  2N04 A;  1SQG A;  1J5E O;  4BW9 A;  1MMM A;  1QLE B;  4GT1 A;  4QIW F;  2L6L A;  3N2G B;  2Q9L A;  4J7J A;  4I9W A;  3K59 A;  5A2Q N;  2HR3 A;  3FB5 C;  1GAX A;  4PDV A;  4DR3 B;  4BAY A;  4DV4 O;  4X64 O;  4PV1 B;  3E89 A;  1BQ0 A;  2XAH A;  3LNN A;  4FM2 A;  2EJ7 A;  3SPH A;  1VQ5 V;  1WP8 A;  3B2E E;  2ZE7 A;  5J9P C;  1TAE A;  4XDL A;  1TUB B;  3OD4 A;  4DV0 B;  1NKD A;  1WLE A;  2B1I A;  2ADQ B;  1VF5 B;  5IYB O;  2P5O A;  4RO2 A;  4AIL C;  3SYO A;  4FMT A;  1RSO B;  1S72 V;  2JEU A;  1MA1 A;  4B3R B;  5GON B;  3ASN C;  3KCX A;  5CA1 A;  2ZIM A;  4F4L A;  2W0X A;  4NXN O;  2CGN A;  2ZXW B;  1FJG O;  1M93 A;  2F43 G;  1FXV A;  2MW2 B;  4U7O A;  4HNA B;  5CBH A;  5EBM C;  4P2Z A;  1KQS U;  2R9A A;  3HKE A;  3ABM B;  4DW0 A;  3K3W A;  2BTQ A;  3WB1 A;  3GVM A;  4DUZ O;  1N36 O;  5EBW C;  3E2E A;  3B09 A;  4LNU A;  3UT5 A;  4WFG A;  3SJQ C;  2DN9 A;  4K3A A;  2WAM A;  1SA0 A;  3BHP A;  4DV0 O;  3OUS A;  1I5X A;  5B3S C;  2VRZ A;  4GCZ A;  3JAL B;  3T1C A;  4B3T O;  1MG1 A;  2FYU H;  3ABK C;  4IYH A;  5CBG A;  3ZRW B;  1DTO A;  1IDS A;  2ZR3 A;  1H2S B;  4MVO A;  2YXY A;  5GON A;  1ROP A;  2WWW A;  1G8M A;  3L74 H;  2BCC H;  1OCO C;  3N2K B;  3W7W A;  3IAY A;  2YIB D;  2ODM A;  2PI5 A;  4NKG B;  2JEX A;  3MHS C;  3CCR V;  3JD3 A;  4DR1 B;  4PHZ A;  3HKE B;  3ZMS A;  4UCS A;  1SET A;  1XMQ O;  2E5L O;  2E74 B;  2RQ6 A;  4TQF A;  2ZE5 A;  4EKW A;  4Q20 A;  4TOI A;  4JI4 B;  1L1F A;  3D3Q A;  1YI2 V;  3JAK A;  5KA5 A;  3JAR B;  2FTK A;  2UXB B;  5IWA B;  5DN6 G;  1BT8 A;  3C3T A;  4TWK A;  4TUY A;  2Q4P A;  3CXH F;  4B08 A;  4O4I A;  2ZDI A;  1SKV A;  2GDS A;  1H2G A;  4ZI7 A;  3JD1 A;  4FLU A;  1AR5 A;  3FB7 C;  2OTJ V;  3P30 A;  3UO3 A;  1VQN V;  1VEW A;  3CX5 F;  3OMA B;  1V55 B;  3U0Z A;  2CH7 A;  1W59 A;  4EFB A;  1VQ8 V;  3LDD A;  2Y48 A;  4PA3 A;  4WFA V;  3SYQ A;  3ZN1 A;  2DJV A;  2GV9 A;  1HDJ A;  2IH1 C;  1XI1 A;  2BOC C;  3C90 A;  3A0H Z;  3ZX6 A;  5LHI A;  1M9N A;  3CCV V;  5HFL A;  3I56 V;  1ZAU A;  3Q4H B;  2BSK A;  3ZRW A;  1JQ0 A;  5KAF Z;  1S0V A;  4DRX A;  3CS5 A;  2QE7 G;  1NBM G;  4YJ3 A;  3CB2 A;  4LFB O;  2Q7E A;  2ZXW C;  2EIJ C;  4WFE A;  5IYC O;  5J2T B;  4YJ2 A;  4ASU G;  4X9Q A;  4FZ0 A;  4LWS A;  2JGD B;  1AR1 B;  2LJ2 A;  5JCO C;  1EZJ A;  3ABL C;  4LF6 O;  4FFK A;  3ETD A;  3OW2 U;  2A0L A;  4CH3 A;  3S3W A;  3D3I A;  3K03 A;  5B1N A;  4FZ1 A;  4YHH B;  4R50 A;  1XNQ B;  1H38 A;  1JFF B;  5LOV B;  4FLW A;  1K73 W;  2UUB O;  4JAA A;  5JWP A;  1Q86 W;  1FXK B;  1Q90 D;  3HKC A;  1K8A W;  4OPA A;  1WB7 A;  4QGP A;  2ITC C;  4I7Z B;  4Z1V A;  4JTA B;  1GK9 A;  3MAQ A;  2M6Y A;  1JMK C;  4CBC A;  5D5P A;  1H2M A;  1SC5 B;  3HKB A;  4X1I B;  1KU9 A;  2H94 A;  4JI0 B;  2WLM A;  4JV5 B;  3LDE A;  1ZL8 B;  2QKS A;  1RM1 C;  5EC1 C;  4X65 O;  5H2F Z;  4EB6 B;  2UXB O;  1MZF A;  4B7E A;  1VQ4 V;  5BR8 O;  1JFF A;  1WA8 A;  3K79 A;  4NXM B;  4ABM A;  1EFR G;  4PDL A;  3HKC B;  2ZE8 A;  1AJP A;  1SQB H;  1DK1 A;  3WG7 C;  1SRY A;  3AK2 A;  5ITZ A;  2NLJ C;  3HR0 A;  4DV4 B;  4D6T H;  3GWK C;  3J80 N;  1Z2G A;  1GH6 A;  1IBK O;  1MOF A;  3ABU A;  4PA6 A;  3G6E V;  1R3J C;  3OGI B;  1US6 A;  3BAB A;  3BA8 A;  1H8E G;  2DYR B;  3APQ A;  1FXH A;  4O4L A;  4K0K O;  4LF5 O;  4AI8 A;  2DMX A;  1BE3 H;  4MTO A;  2JRI A;  1XL4 A;  1HWY A;  1B3Q A;  4JAV A;  2EBO A;  1TGO A;  4UCV A;  1G6U A;  1S5H C;  1PM9 A;  5ITZ B;  2Y0I A;  1VQL V;  1GRJ A;  2PY5 A;  1JR9 A;  1IBK B;  3RYH B;  4O4J B;  3EXA A;  1NTM H;  3F5T A;  2XAF A;  1FD9 A;  4W4L A;  3RFR A;  2ARH A;  1VF6 A;  3UM7 A;  1D2D A;  1SQP H;  1HNW B;  1L0L H;  3CRA A;  2QTS A;  1VIB A;  3I5D A;  3ZN0 A;  2MK3 A;  3VQW A;  1I7F A;  4DV5 B;  2XUM A;  3CJH A;  3OE7 G;  4G27 B;  1YJ9 V;  4YIO A;  2YI8 A;  1AI5 A;  3G4S V;  4O4I B;  1IXB A;  2PUS A;  4HYO A;  4LFC B;  4LF7 B;  2A3Q A;  4Z1M G;  2HVJ C;  5IJ0 B;  4N23 A;  1FPO A;  1QLE C;  2NR5 A;  4BIU A;  2QM4 A;  4B3T B;  3BCC H;  4DR4 B;  3J81 N;  1QHT A;  2K9P A;  5LP6 A;  2GSM B;  3STZ C;  1JOY A;  2UXD B;  4BIO A;  1NR1 A;  1L8D A;  3BRC A;  2CTP A;  1OCZ C;  2EUL A;  4F6R A;  1K34 A;  1ZWI C;  1VP7 A;  3B77 A;  1QVF U;  5KLV H;  3JAK B;  3FFQ A;  4BIZ A;  1IBM O;  3CCL V;  2ZM6 B;  3LDC A;  1JCH A;  1W0K G;  1XQ8 A;  2UUA O;  4UB6 Z;  1AJQ A;  5D5Q A;  2F66 C;  1N4C A;  1IUR A;  1PL4 A;  3J7A U;  1BS3 A;  4R8C A;  3K58 A;  4E4E A;  4RUF A;  2X7R B;  4DV1 B;  1QQC A;  1LUW A;  4TV8 A;  5FL7 G;  4BR6 A;  4KXR A;  1KC8 W;  3QF7 A;  1V54 B;  4DV7 O;  2EIM B;  5FNV A;  5EYP B;  5IYZ B;  3D36 A;  4J7K A;  4X1Y B;  3SPJ A;  3STL C;  2YDE A;  2AGA A;  1OJH A;  1B6Q A;  4JI2 B;  4FK5 C;  4MVQ A;  1TUE B;  1B04 A;  3RWR D;  4TV9 B;  5CB4 B;  4FJC C;  1WP7 A;  2QWO B;  4UCU A;  2HKO A;  2F4V O;  1X59 A;  3F7Y C;  5L3G A;  4LF4 B;  1MSW D;  2QEX V;  1Y74 A;  4JZG A;  4DW1 A;  1R6T A;  3CD6 V;  2QWP B;  4QNH B;  4FM1 A;  3RT3 C;  2WLH A;  3JCU Z;  4EB6 A;  3O9O A;  3ZHV A;  1P49 A;  1LR1 A;  1OHH G;  4JI2 O;  5LP6 B;  2ZT9 B;  1BMF G;  2ZIO A;  2VQE O;  1KEC A;  5KMG B;  2EIN B;  3RN4 A;  3WB0 A;  4J41 A;  1VAR A;  1OCR B;  4RUE A;  1PNL A;  4IIJ A;  3ABM C;  2WLK A;  1Y4M A;  4B3M B;  5C8Y A;  1QBZ A;  1S76 D;  1CPY A;  2EZP A;  4WBN B;  4WCE V;  3T1Y O;  1ZL8 A;  2QA4 V;  4PA4 A;  4O4H B;  4X20 B;  3ZHT A;  1M90 W;  1RSO A;  2AHY A;  2UUB B;  3G71 V;  4LH7 A;  1AIL A;  2D2C B;  4JI4 O;  2BTQ B;  5EC2 C;  1MAB G;  1Q43 A;  4IHJ B;  4LFB B;  3SYA A;  2YI9 A;  1YIJ V;  2OCC B;  4G2K A;  1OCO B;  3GB7 C;  4X1K A;  1F23 A;  2XAQ A;  2IJK A;  2ZNJ A;  4GLX A;  1NS1 A;  3R66 A;  2NN4 A;  3U11 A;  3EVK A;  5B3S B;  1WA8 B;  3AG4 B;  4TSF G;  3CRQ A;  4MVZ A;  2HEP A;  3G67 A;  4DV7 B;  1YSC A;  2Z3Y A;  3CYO A;  1HNX O;  3K9S A;  1S5L Z;  3UKM A;  4UUJ C;  4MW3 A;  4DV3 O;  2W6I G;  1GM8 A;  3ETQ A;  4DV6 B;  3K0D A;  1Y67 A;  4WF9 V;  1N32 B;  4R6Z A;  3P3N A;  4I55 A;  4LC1 A;  1ZUQ A;  3ML0 A; 
#chains in the Genus database with same CATH homology
 4QJF B;  1K4D C;  4GX2 A;  3ZMS A;  4ZBM A;  3CC7 V;  1VQ6 V;  3E8G A;  1GO3 F;  1SET A;  2NNU A;  3SYP A;  4EKW A;  3CPW U;  4Q20 A;  1JPX A;  4MVM A;  1SZT A;  1L1F A;  1YI2 V;  1Q7Y W;  3JD4 A;  1V54 C;  5KA5 A;  3AG1 B;  3ZMV A;  2IJH A;  2FTK A;  1GM7 A;  3OM3 B;  5DN6 G;  2ZR2 A;  5CBF A;  1ARO P;  3CCQ V;  2Q6A A;  1AJN A;  4TWK A;  1R6K A;  2Q69 A;  2V1D A;  2XAS A;  3BY6 A;  4WFF A;  2ZDI A;  5EBL C;  1K92 A;  3R65 A;  4E2L A;  4X88 A;  3ASO C;  1H2G A;  1M57 C;  4LBE C;  4MT8 A;  3JD1 A;  4GX1 A;  1P4R A;  5LHG A;  3TK1 A;  5L3C A;  2LP7 A;  3EFF K;  1RPR A;  3FB7 C;  1ENV A;  1ORQ C;  3VBB A;  3K08 A;  2OTJ V;  3P30 A;  1VQN V;  2JJ2 G;  5KUK A;  3OMA B;  2HFE C;  1V55 B;  3F5W C;  5CMU A;  2IW5 A;  4JPR A;  1F51 A;  1VQ8 V;  1LNQ A;  3LDD A;  2Y48 A;  1K5Q A;  4G28 B;  1YTF D;  4PA3 A;  2P67 A;  4HZ3 A;  3TCU A;  4WFA V;  2WLJ A;  5DM6 V;  3SYQ A;  3ZN1 A;  4PA7 A;  1OCC B;  2IH1 C;  1OCZ B;  2X0L A;  5IDJ A;  2BOC C;  3QO7 A;  3FYI B;  5LHI A;  1V55 C;  3AG2 C;  3WFV A;  1M9N A;  2EIJ B;  5HFL A;  3I56 V;  2ZD9 A;  3CCV V;  2ITD C;  3LSS A;  3ZRW A;  4J9Z B;  3EHB B;  1JQ0 A;  4QE7 A;  1RM1 B;  1Q82 W;  1S0V A;  1PKX A;  2Z5U A;  2LFS A;  3ZRX A;  1F4N A;  2QE7 G;  4X89 A;  1NBM G;  5KA6 A;  3ABL B;  4YXW G;  1K9M W;  3PJS K;  4BW5 A;  2ZXW C;  2EIJ C;  1VQM V;  4WFE A;  4JTD B;  5IYC O;  4ASU G;  4PDM A;  4TT3 G;  1M56 C;  1OZ0 A;  3H01 A;  4JGS A;  4OXS A;  1AR1 B;  5LGU A;  2X6C A;  1EZJ A;  1FXK C;  3ABL C;  3ETD A;  1KKD A;  3OW2 U;  2A0L A;  3CC4 V;  3D3I A;  3CP1 A;  2UXX A;  2X6A A;  3K03 A;  5B1N A;  2B5U A;  4R50 A;  1K7D A;  5LGT A;  1H38 A;  3CXC U;  2D3O W;  1QR9 A;  4J9Y B;  3SPG A;  1K73 W;  4HAM A;  2JDI G;  1Q86 W;  1FXK B;  4UVA A;  5B1A C;  4N21 A;  2P90 A;  1K8A W;  3CCM V;  1Q81 W;  3E8B A;  2WSS G;  2ITC C;  5L3F A;  2Q67 A;  4JTA B;  1GK9 A;  4CBC A;  5E1A C;  3OAA G;  4FPP A;  5H6R A;  1NH2 B;  2H8P C;  1QCE A;  4KFM A;  3BEH A;  2H94 A;  3X2Q B;  4UV8 A;  2HLD G;  3AG4 C;  2IJI A;  2WLM A;  2YEV B;  3LDE A;  3QNE A;  1UJW B;  1YTF B;  2K1E A;  2QKS A;  2DQ0 A;  2DWE C;  1RM1 C;  5EC1 C;  3SYC A;  1EBO A;  4MSW C;  3FKS G;  1S3J A;  1VQ4 V;  3NXS A;  3JD2 A;  3RW0 A;  3K79 A;  1R73 A;  5EK0 A;  5LGN A;  1EFR G;  4PDL A;  3I55 V;  1E1Q G;  3JYC A;  4JAS A;  2DYR C;  2EIM C;  3W7S A;  3AG3 C;  1AJP A;  1W2B U;  4JYB A;  3WG7 C;  1SRY A;  3ZRV A;  3CME V;  3CCE V;  2NLJ C;  2DWD C;  3LNM B;  1AI4 A;  1MOF A;  3ABU A;  2EIL B;  4PA6 A;  3G6E V;  5H6Q A;  1R3J C;  4L87 A;  2DYS C;  3JD0 A;  3RBZ A;  1H8E G;  2DYR B;  2WLN A;  1E79 G;  1QVG U;  1FXH A;  3AG3 B;  1QLN A;  2YEV A;  1XL6 A;  3WG7 B;  2QM7 A;  3QO8 A;  2WLI B;  3A0R A;  3ZMT A;  3IC7 A;  3CCU V;  2WLI A;  4P9O A;  3W7U A;  5IY5 C;  1JJ2 U;  2EIL C;  3ZCC A;  2DYS B;  4MTO A;  2ATK C;  5C93 A;  1XL4 A;  1E1R G;  1HWY A;  4PDR A;  3FYE B;  4JAV A;  2EBO A;  1H8H G;  4XDK A;  2Q68 A;  1S5H C;  1VQL V;  3E8F A;  3SPC A;  4QE9 A;  2IU3 A;  4GX0 A;  1PNK A;  3LUT B;  1YJW V;  1AI7 A;  4DXW A;  3OMI B;  5B1B B;  5L3B A;  3E83 A;  3MHH C;  1VQ7 V;  2GHY A;  2XAF A;  1GM9 A;  1R3L C;  2EIN C;  3DGE A;  1SER A;  3UM7 A;  1GMG A;  2WLL A;  4DO2 A;  1K3E A;  2HJF C;  3ZN0 A;  2QM8 A;  3JCZ A;  2MK3 A;  4UVB A;  2HVK C;  3OR7 C;  2XOK G;  3OE7 G;  4JF3 A;  4G27 B;  3RVZ A;  1IXM A;  1K5S A;  4H37 A;  1YHQ V;  1FXK A;  4H33 A;  3VOU A;  2A79 B;  3IFX A;  1YJ9 V;  2DQ3 A;  2C2A A;  2WPD G;  1DF5 A;  1R3I C;  1AI5 A;  1R6N A;  4KUM A;  2QTO A;  1GKF A;  3ZRS A;  3G4S V;  1P7B A;  5H9C A;  3K9A A;  1DLB A;  4HYO A;  2JJ1 G;  4UXN A;  1NQT A;  3HB3 B;  5CA3 A;  2EZO A;  3E35 A;  4Z1M G;  2HVJ C;  2IJJ A;  1K97 A;  5L3E A;  5IY5 B;  1M57 B;  4N23 A;  1QLE C;  3CMA V;  2P6J A;  4BIU A;  5HFM A;  2ZDI C;  2W0F C;  3K06 A;  3T2M A;  4MVU A;  3ETG A;  2GSM B;  3STZ C;  3ABK B;  1JOY A;  3FB6 C;  2YSU B;  3RVY A;  4U7N A;  1NR1 A;  1KP2 A;  4P9P A;  4LCU C;  4RAI A;  4MTX A;  5B1O A;  3ZJZ A;  1QR8 A;  1Y66 A;  2JK5 C;  1AI6 A;  2PI4 A;  2HG5 C;  1YIT V;  1N8R W;  3T4D A;  1VQP V;  3GWO A;  1OCZ C;  1K34 A;  1ZWI C;  1W0J G;  2EJR A;  2LFR A;  3ABT A;  3B8N A;  3B77 A;  3ASO B;  1QVF U;  4X8A A;  2OTL V;  3SPI A;  3DTU B;  3QO5 A;  1G4Y B;  1M1K W;  3P32 A;  2W6J G;  4BIZ A;  3CCL V;  3B8M A;  1JCH A;  1PD3 A;  3FB8 C;  3LDC A;  1W0K G;  4GX5 A;  4UVC A;  4RQF A;  3X2Q C;  1R3K C;  1AJQ A;  4XDJ A;  3AEI A;  5LHH A;  1CEZ A;  5KUM A;  4FIP C;  2R9I A;  3ASN B;  3TET A;  4R8C A;  4RQE A;  2JIZ G;  1M56 B;  2B1G A;  1FFT B;  1OCR C;  2EIK B;  4RUF A;  1JX9 A;  1BL8 A;  4XBF A;  1SES A;  2X7R B;  4MVR A;  1KD1 W;  5FL7 G;  5CN0 A;  1KC8 W;  1V54 B;  2EIM B;  3D36 A;  5BZB A;  1QLE B;  4GT1 A;  4QIW F;  3SPJ A;  3STL C;  3F7V C;  4WFB V;  2EIK C;  3E8H A;  4I9W A;  1B6Q A;  2WLL B;  2X6B A;  1BHB A;  2IH3 C;  2HR3 A;  3FB5 C;  4PDV A;  4FK5 C;  4BAY A;  1NH2 D;  4MVQ A;  1TUE B;  1FS0 G;  1NJI W;  1RPO A;  4FJC C;  3CC2 V;  4MW8 A;  2A9H A;  1VQK V;  2HKO A;  3E89 A;  4R7C A;  1MSW D;  3F7Y C;  5L3G A;  1CP9 A;  1I5Y A;  2QEX V;  2XAH A;  3CD6 V;  3SPH A;  3LSQ A;  4QNH B;  4MS2 A;  2WLH A;  4MVS A;  1VQ5 V;  1K33 A;  3M99 B;  5J9P C;  2Y69 B;  3W7X A;  2IU0 A;  2UXN A;  3KG2 A;  4LP8 A;  3W7T A;  1NVP B;  1PL0 A;  4XDL A;  1NKD A;  1WLE A;  2BOB C;  2B1I A;  1DF4 A;  1K4C C;  5IYB O;  5GW7 A;  3ZMU A;  1OCC C;  4RO2 A;  3SYO A;  1OHH G;  2AHZ A;  4FMT A;  3OMN B;  3AG2 B;  1S72 V;  3IGA C;  2JEU A;  2Y69 C;  1BMF G;  3ZMZ A;  2P7T C;  4MTG A;  1KEC A;  2EIN B;  3ASN C;  1YJN V;  2CK3 G;  3OUF A;  3CCS V;  4RUE A;  1OCR B;  4JTC B;  4QPK A;  4F4L A;  1PNL A;  2DW4 A;  3ABM C;  5L3D A;  2ZXW B;  4PA9 A;  1BHA A;  2F43 G;  2WLK A;  5LBQ A;  5IYD O;  1Y4M A;  1FXV A;  2XAG A;  2XND G;  1VQ9 V;  1QBZ A;  4U7O A;  1KP3 A;  1CPY A;  2EZP A;  2OT5 A;  2ZQM A;  4WFH A;  1S76 D;  4WCE V;  3K0G A;  2QA4 V;  4PA4 A;  5CBH A;  5EBM C;  4P2Z A;  1KQS U;  1M90 W;  3ABM B;  2AHY A;  4ZKI A;  3K04 A;  1J95 A;  2M7W A;  3K3W A;  1JVM A;  2XAJ A;  1VQO V;  3G71 V;  5EBW C;  3E2E A;  3AG1 C;  4WFG A;  2KB1 A;  3SJQ C;  3CCJ V;  2WAM A;  4P30 A;  1GTO A;  2R9R B;  5EC2 C;  1MAB G;  4JYC A;  3OUS A;  1I5X A;  4QPJ A;  3MD0 A;  3SYA A;  5B3S C;  5B1A B;  1NR7 A;  3ETE A;  1YIJ V;  2OCC B;  4G2K A;  4GCZ A;  1OCO B;  2V7Q G;  3GB7 C;  3T1C A;  1F23 A;  1MG1 A;  3ABK C;  2XAQ A;  2IJK A;  5CBG A;  3ZRW B;  1DTO A;  4JAU A;  1S77 D;  2ZR3 A;  1THZ A;  4MVO A;  1ROP A;  5B3S B;  1NVP D;  3HPL C;  2WWW A;  3OFN G;  1G8M A;  3AG4 B;  2OCC C;  3OGC C;  3OEH G;  1OCO C;  4TSF G;  1PNM A;  4MVZ A;  4PEL A;  3ZIA G;  3W7W A;  1COW G;  1YSC A;  2Z3Y A;  3CYO A;  2PI5 A;  3UKM A;  3E86 A;  3T4Z A;  3OR6 C;  4UUJ C;  5B1B C;  4MW3 A;  4CZZ A;  2W6I G;  3OEE G;  4KP4 A;  1GM8 A;  4I5S A;  2JEX A;  3MHS C;  4UV9 A;  1F4M A;  3CCR V;  3K0D A;  3JD3 A;  4WF9 V;  1WPX A;  4R6Z A;  4LC1 A;  4MTF A;  3ML0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...