1NVPB

Human tfiia/tbp/dna complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
43
structure length
43
Chain Sequence
TVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords 5'-D(*GP*GP*GP*GP*GP*GP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*G)-3'
total genus 16
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2003-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.100 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1nvpB00
3W7TA 3W7WA 2WAMA 3D3IA 1NVPB 3BY6A 3W7UA 1RM1C 5GW7A 5CA3A 3IC7A 2P90A 4HAMA 1S3JA 3W7SA 1NH2B 2HR3A 1YTFB 3W7XA 3E35A
chains in the Genus database with same CATH superfamily
2LW1A 3JCZA 4FVMA 4MVMA 1MNGA 3PN1A 4K3AA 4FFKA 4DV5B 2PGGA 2CAZC 3CS5A 1I94O 1FXHA 2UXDO 3RYHA 1XNRB 2GV9A 4QE7A 5EZYA 2CTWA 4X1IA 4PJ0Z 4GT1A 3K08A 5IYZA 2QWNB 1EN4A 3QG5A 4JI8O 1VQ9V 4TSFG 1G6UA 4AILC 1JPXA 3F7YC 4PV1B 3K0GA 1R1BA 3S3XA 2PYJA 4Z1MG 2X7RB 3CCUV 4DUYB 2UU9B 4UV9A 2XNDG 3OTFA 4X62B 4ICGA 1N33B 1SA0B 1VP7A 5CBGA 1HP8A 4KL1A 2UUBB 4F4LA 4CH6A 1B6QA 1XOUA 5C8YA 3CWBH 2XAFA 4JI3O 1L0NH 5LMUB 2UXDB 2AW9A 3F5TA 3RYIB 1W0KG 1IXBA 5LXTA 1TA8A 3AEIA 5FPRA 3JALB 3OUFA 1IZ3A 1Q6HA 5LYJA 4GX0A 4ZIBA 4YJ2B 3OW2U 1F51A 2GDSA 1GM9A 2B1IA 2JS5A 2UXBB 1PV0A 5LA6B 5ITZA 4PDLA 1QQCA 3SJBC 1XMOO 2Y0PA 4O4LB 4WFAV 5JQGB 2QM4A 1FJGB 1XILA 1VQ6V 3ZN1A 1HWYA 4B3MB 2A3QA 4ZOLB 4JI2O 3H01A 1WN7A 4DR1B 2LW7A 1FXKB 2OYQA 4FFBA 5IDJA 3QNEA 3E22B 1F4MA 4DV1O 3LNMB 1YITV 5J2TA 4EB6B 3JSLA 4NVPA 4DV0O 1H2NA 3RFRA 4J41A 5LBQA 1Y76B 3K5MA 1NTMH 1Q86W 5LGNA 1Z5WA 3ZMUA 1IBMO 3BCCH 3ETDA 4RUFA 2E74B 2YS8A 2AXTZ 3OM3B 4O2BA 4AQYB 4G28B 5JJEB 1S72V 2K1EA 5L3EA 3UKMA 2LO1A 2YICA 3C3SA 3N2KB 2JIZG 2BTOA 1J5EO 1G4YB 5KMGB 4PA4A 1EZJA 3DXRA 4JF3A 1NBMG 1Q43A 1R6KA 1XQ8A 3B09A 3HKEB 1KU9A 1QVGU 1GH6A 3OD4A 4D6TH 1SERA 3AG2C 2OWOA 4TQFA 3MDSA 4MVZA 5L3CA 2RNBA 3WG7B 4DR7B 3LDDA 1XMQO 5K1XA 1XMQB 1K97A 1NR1A 4EEQA 4DV6B 1UPGA 1VMGA 2EIJC 1V55C 4O4LA 3JARB 3SYQA 4PA9A 1WPBA 4DV6O 3KKYA 4DW0A 4YY3O 4J42A 1ZTEA 4DV7B 2R9IA 3CJHA 4NXMO 5L3DA 1EZVH 4W4LA 3OMIB 5J2UA 1IX9A 1OCOC 3K0DA 3SPJA 2HHHO 1TUBB 5EIBC 1OJHA 4PELA 1SC5B 1IURA 1Y67A 4IHJB 4GKKO 1AR5A 2VQFB 3JATA 2UXBO 3CC2V 1GAXA 2WLMA 1NI8A 1URFA 4R7CA 2EIKB 5LMNO 2DQ3A 3P3PA 2G38A 3RVYA 2F66C 5L3GA 4BW5A 3L75H 2KG7A 3JATB 4FIPC 4IIJA 1WAZA 3ZHUA 3U10A 3WFVA 5H6RA 5ITZB 1KECA 1DLBA 2A79B 2CH7A 4B3TB 5A9GA 3K5LA 3CE2A 3ETGA 5EBLC 3G67A 1PKXA 2Q6AA 1ZSPA 1S3JA 1M57C 4TV9B 2ITCC 2QKSA 2JVDA 3A0HZ 4JASA 4DV4O 1DF4A 1A32A 3BEHA 2GUZA 2Z5UA 3ZN0A 5K1PA 4NR1A 2YIBD 3EFFK 1ZUQA 4YJ3A 3FD9A 1WB7A 2AZ2A 2FKXA 3K59A 5D5QA 2PYLA 3E35A 3OAAG 4JTDB 5FPOA 3CRMA 3ZRVA 3L74H 2H8PC 4P9PA 4WBNA 2NR5A 3QF7A 2ZQMA 4DK1A 2PTMA 1I0HA 1GN6A 4B3SO 3LDEA 3ASNB 4YIOA 5IE9A 4FPPA 1J95A 4TQDA 2WSSG 1S77D 5KMGA 4X88A 1H8EG 2ZKOA 4KHPO 5D5PA 1F7YA 1MZEA 5IY5C 1P49A 5DECA 3ZRSA 5IJ0A 2PZSA 1GRJA 5CA1B 1AR1B 2Y4TA 2EIJB 4MSWC 5EIBD 2WLNA 1RFYA 2IH3C 2W0XA 4TV8B 5LGUA 5EBWC 3TXSA 5LXTB 4A5UB 1EN5A 3S3WA 2V4DA 1GM7A 4LBEC 4GX2A 1QVFU 5H2FZ 2IJHA 4EB6A 1IDSA 5JVDA 2FYUH 3UO3A 4BAYA 2R72A 5LP6B 5JCOA 1YI2V 2W6IG 3X2QB 3BA8A 1XREA 5B1AC 2QTSA 4P9OA 5CBHA 3L73H 1Q81W 1NH2D 2RMKB 4J11A 1KP3A 2IH1C 2AZ0A 2ARHA 1YCIA 3RYFB 3ABKB 5CB4A 1CP9A 3N27A 3J7AU 2Q7GA 4X1YA 1OCRC 2JK5C 2QM8A 2QWRB 3ABLC 4YJ2A 5B1BB 1V54C 1D5AA 1PNKA 1M5IA 2ETNA 4CC6A 4X64B 4U3FH 2QA4V 1XNQO 3J81N 3JARA 2CDYA 5B1BC 2C2AA 4PI0A 3FYEB 3JAMN 1T5EA 4FMTA 1ZL8B 1IBKB 2EJ7A 4B08A 4WBNB 4DV4B 1KQSU 4PDRA 4NXMB 4LFAO 5DM6V 1NS1A 2UXXA 3IC7A 4DR4B 2YDEA 1XHXA 4FJCC 1KB9F 5F2VO 3OFNG 3E2EA 2OTJV 1VF5B 2JGUA 3RBZA 2EZPA 3GVMA 2E76B 1MOFA 2OTLV 3TK1A 4TT3G 2QR4A 2H3OA 2ZE8A 1Q6IA 2MK3A 2QWOB 4IL6Z 2XHBA 5EYPB 1WP8A 3T1CA 1P4RA 4O4JB 4LF4B 2WLHA 3GWKC 4I4TA 5LMNB 4DR6B 4MT8A 1QU7A 2JDIG 5EK0A 2YXLA 1DK1A 1YJNV 2CGNA 4DR5O 5KHHA 3SYPA 2EX3A 5L3BA 2M6YA 4FLUA 4DR5B 4R6ZA 5KX5A 5KAIZ 1VF7A 1SETA 2XT9A 5J2TB 3CEIA 3K9AA 1FXKC 2FL4A 1I5XA 2OCCB 1GTOA 4IIJB 1Q6UA 1PL0A 2Q0OC 4BIZA 4P30A 3M99B 1FXKA 4JAUA 5CBFA 3LNNA 2IJIA 1M4UA 3B8NA 2DMXA 2L35A 2RN9A 2F1MA 2GHYA 1XDCA 1BS3A 3J80N 3SR2C 2WLIA 2ZNJA 4FK5C 4LNUA 3OR7C 2VQEB 1N34O 4IYHA 2P06A 4HNAB 4KUMA 3IFXA 4DR1O 4OXSA 3K5NA 1JQ0A 2BTQA 4DUZB 1W59A 3B40A 3C90A 5LHHA 1LUVA 2CE4A 1W2BU 4NXNO 1AROP 2B9ZA 1SQVH 4GCZA 2BOCC 1SS3A 5EYPA 3DC6A 4CS3A 1MG1A 3CXCU 4B3RO 1JOYA 3FB6C 4X64O 3JYCA 2P67A 4G2KA 4I55A 5IJ9B 1MSWD 1XL4A 4Q20A 1G8MA 2A9HA 2R9AA 3WB0A 1HW7A 4IHJA 2IU3A 3U0ZA 4WFGA 4LFCO 2OT5A 3T1YB 2LFSA 1HNWB 1N34B 3SGIA 4B7KA 3BABA 4RQEA 3RT3C 2GUZB 1BGYH 3K06A 3ZHSA 1VQ8V 3ETEA 2R70A 4PHZA 3HR0A 3UM7A 4FZ0A 1SKVA 1SQPH 3H1IH 4CH4A 3FKSG 1SQFA 4JTCB 2XOKG 1N33O 4B3RB 2PI5A 3QVNA 5E79Z 1MABG 2WLIB 2JEXA 5LHIA 1YSCA 1PP9H 1BL8A 1Q3EA 2KG7B 2EIMC 2P22C 1SQGA 1SQBH 3WB2A 1XNRO 1N8RW 3W7UA 4UCOA 4JI6O 3EXAA 1L1FA 3T1YO 3VQWA 5IWAO 5JJJB 2YSUB 3D8CA 3ZMSA 2CTQA 1X59A 3SYCA 2ZINA 4GUNA 3CMEV 5J2UB 2ZD9A 1ZX3A 1YVWA 1VQLV 1M1KW 5FLXN 4LF5B 2RJZA 4GKKB 2B1GA 5EBMC 4X1YB 2VQFO 1N36O 2YIAA 1WLEA 4LCUC 3A0RA 1OCRB 3SYOA 3ZHTA 1Y76A 2IBZH 3B77A 4J9YB 5FL7G 3SPGA 3CC4V 5B1NA 2EIKC 3H9VA 1US6A 1Z5VA 5LHGA 1COWG 2XAJA 3H1HH 3TGUH 1ZAUA 3CD6V 1UFIA 4J10A 5J9PC 3RWRD 4DUZO 4U3JB 1BE3H 2DWEC 5B1OA 4JZ2A 3E8GA 4KHPB 5IJ9A 4IYIA 5CA0B 4FM1A 1YIJV 4GX5A 4UCUA 5KHIA 1QLEB 3HKCA 2P6JA 2HHHB 3N2GB 3JD2A 4JV5B 3E83A 1I5YA 3L9DA 3BVOA 4WFFA 2FB5A 1N32B 1XL6A 3B4SA 3ABTA 4LFBO 2PUSA 1OZ0A 2JJ2G 1FFTB 5H5NA 4O2AB 5DEDA 2LFRA 3L70H 5CA1A 3DC5A 2LP7A 3CJHB 3ZHQA 2DW4A 2DYRB 1H2GA 5BY1A 2OIEA 1H8HG 1Q82W 4BWAA 4UB8Z 2X6CA 4Z1VA 2DYSC 3CX5F 2IJKA 4JI7B 1N0JA 1XEQA 1PPJH 1GM8A 3OR6C 1AI5A 1NJIW 3D3QA 4ZBMA 1JCHA 1QBZA 1EM1A 2QE7G 2ZE6A 2ODMA 4X8AA 3VQVA 2Y69C 1L0LH 5B1AB 2ITDC 2NLJC 1NH2B 1IBLB 3QTCA 1YJWV 1HNZB 4JAAA 2OIGA 2IJJA 1XI1A 3T1HO 2OCCC 1Y6XA 2Y0IA 4GKJO 4K0KB 1FD9A 2ADQB 3R66A 3A8TA 4LFBB 2Q69A 1VQPV 1OCZB 1GO3F 4UVCA 2ATKC 1KYOF 2CUGA 4YY3B 4DRXB 1QR8A 4DV5O 3UCSC 1HNXB 2DN9A 1EFRG 3BRCA 2P7TC 1R73A 4BW9A 4UUJC 3CB2A 4BIUA 4I0XB 2PY5A 2X6AA 3SPCA 1J5EB 4HZ3A 3SJQC 5E1AC 2ZXWC 2L6LA 4FZ1A 3GB7C 3JAKA 4UFZA 4IGGA 3JD0A 3HB3B 3IJ4A 1Q8IA 2QEXV 2CTPA 3BHPA 3E8HA 3QO8A 1ZWIC 1K5SA 2DE0X 4KP4A 3G4SV 1AP6A 5GONA 1SQQH 1R6TA 3T2MA 1WA8A 1MA1A 1AVMA 3K03A 2DQ0A 4HAMA 2VWKA 1IBMB 4U7OA 3ML0A 3SPIA 1PM9A 4FLWA 3M7MX 1I94B 4AQYO 1SA0A 4X1KB 1VQ7V 1WJZA 4EKWA 1DGSA 2KSDA 5CN0A 4CH3A 3HKDA 4JPRA 2ZT9B 3THOA 3G71V 4R8CA 2WLLA 4MVOA 1OV9A 3W7WA 4JI0O 4NB5A 4QE9A 5B66Z 3FX7A 4I9QA 1GMGA 2F43G 5KUMA 1V55B 4PA7A 1RM1C 4X62O 4BIOA 1MMMA 2F93B 2FTKA 2F4VB 2LJ2A 1RP3B 2JJ1G 3FB7C 4IT5A 4DK0A 4R50A 2F23A 2ZCEA 1P7BA 4JYBA 2Z0AA 1RPRA 4I55B 1SZTA 3JD4A 2JGDA 5JCOC 5LMUO 4XDLA 4DO2A 4E2LA 4DV3O 2A06H 3VBBA 4B3TO 1OHHG 1BHBA 1V9PA 2PI4A 1CEZA 2LGWA 1NTZH 1NZ6A 3QO5A 3G80A 2Q4PA 3JAKB 5IYCO 2VWJA 2ZM6O 2WWWA 1GN3A 1L8DA 3CCQV 4I50A 5IYBO 3ABMB 3B8MA 2UUCB 2EBOA 4GLXA 2Q9LA 5JH7B 3DSQA 3LSQA 5GTHZ 4TUYB 1HR0B 2YXYA 3F7VC 4B3MO 1BMFG 2XASA 3K79A 3TXQA 3ETQA 3AG4B 3MD0A 4QPJA 2HKOA 2XAQA 4O4HB 1K73W 4J7JA 5C8YB 1QCEA 1S76D 3HPLC 1AI7A 2Y69B 1R3IC 4F6RA 3JD1A 2K9PA 1MSDA 3NR7A 5H6QA 4CZZA 4PA6A 1KD1W 1TAEA 5TISZ 2X6BA 4DV0B 2ZDIC 4O4IA 1TUBA 2YEVB 1ZL8A 4LF9B 4CS4A 1IBLO 1VF6A 3T4ZA 4X20A 4UVAA 3SJCC 3CMAV 5LL6Y 2Q0AA 3CYOA 2ZDIA 5HFMA 1FXVA 4XDKA 2BSKA 3DGEA 1Z2GA 1Q90D 4YIPA 1JFFA 2R9RB 4CS2A 1JFFB 2Y48A 4RUEA 2EZOA 3E8BA 5IJ0B 2RCVA 4CH5A 1XMOB 2XAGA 5L3FA 1AJQA 2BCCH 2ZIOA 4H33A 4RQFA 4FLVA 3RYHB 3ZX6A 3E8FA 2D2CB 3UQ8A 1YZBA 2EIMB 4DR2O 1I08A 1KP2A 3OMNB 3G6BA 1NTKH 4JI0B 4ZI7A 2QKCA 3Q4HA 3A2FA 1E1RG 4UV8A 2GBOA 5BMVA 4LH6A 4UCRA 4ZOLA 5JJNB 3OTOB 1OCCC 3QO7A 3R65A 3I5DA 4BR6A 3K9SA 2YUAA 1Y66A 3TCUA 4JYAB 3ZHVA 1N0NA 3L71H 5B3SB 4TUYA 3ZRWB 5JWPA 2Q68A 2HVKC 4YXWG 4LF7B 1YTFB 4DR3B 1S0VA 3ZEDA 2HP8A 4XBFA 2MW2B 4TV9A 4TOIA 1R3KC 3VQYA 2Q7HA 2ZXWB 5KHGA 2EINB 4DYLA 1JMKC 1O9HA 3ASOB 4LNUB 3JCUZ 4JYCA 2CH7B 4JI6B 2YEVA 2DJVA 4N23A 3EHBB 4DR2B 1OCZC 4KFMA 2QM7A 2V1DA 4JZGA 3ZMTA 1BQ0A 2UU9O 4FM2A 4E4EA 4WCEV 3ASNC 5BMVB 5FNVA 3AG2B 4MTFA 1WA8B 4LC1A 3CRAA 3I56V 3RW0A 2WA3A 3AK2A 2Z3YA 4RWUA 1N36B 3CCJV 5LP6A 3AG4C 3HKEA 1JJOA 4UB6Z 3BA9A 3OMAB 4MS2A 4C7UA 4X66B 2VS0A 3UT5B 3LDCA 3DXRB 4JI5O 1OCOB 1WPXA 4YJ3B 3HKBB 4U7NA 3ZMZA 4DV3B 1G1XB 4JI3B 2YC0A 4H13B 2GTAA 1JJ2U 1VQOV 5KA5A 3ZJZA 4TV8A 1THZA 2A0LA 1IBKO 1K8AW 3CCLV 4JV5O 2KKWA 4DV1B 2EJRA 4OPAA 2RDCA 3VOUA 3W7TA 1E79G 3RGBA 1H2KA 3T1HB 4O4JA 3FAVA 1R3JC 4YHHO 2UUCO 1P84F 1FYJA 4O4IB 4YHHB 4LR3A 2QSAA 1SQXH 3ZBHA 1RSOA 4ZHQB 4ZI7B 3K57A 4L8JA 2W0FC 4ZHQA 4LF6B 4MVSA 3BFRA 3AG3B 3SJAC 2UXCO 4B3SB 4DR6O 1ROPA 5LOVB 5BZBA 2IU0A 2VQEO 4UCTA 1AR4A 4P2ZA 4GYCB 1NT2B 1Y74A 1CXZB 2DOSA 1TUEB 3OEHG 2EULA 2D3OW 2JRIA 3FB8C 1EN6A 2F95B 1QHTA 1Q5OA 1V54B 2H94A 1K3EA 4J7KA 2BE3A 2PF4E 1F4NA 3N2KA 5IYZB 4FLXA 4J7ZA 4FLZA 4K35A 2YI8A 4WFEA 3ABKC 3ASOC 1YXBA 3FFQA 3OEEG 1HNZO 4JI4B 2OCHA 2XAHA 1AI6A 4J80A 4X20B 5LGTA 4JGSA 4PD4F 3ZRWA 5BXZA 2Q5ZA 2WPDG 3ZCCA 4HNAA 4I9WA 3O65A 2KB1A 1M9NA 4MVUA 1RPOA 2B5UA 3RYIA 5KLVH 2Q7EA 2UUAO 4G27B 1K9MW 1KUQA 2A7WA 2HJDA 4L87A 2ZNIA 1VQ4V 5CA0A 3C3TA 2ZIMA 3MAQA 3E22A 2W6JG 1P7GA 3WU2Z 1IXMA 4NYKA 4W4KA 2ZR2A 1YDXA 5CMUA 1HDJA 4AHCA 1B3QA 2QWPB 4OX9O 1QLNA 2QDOA 3APOA 4X89A 2V7QG 3JAWA 2EILB 1B04A 4KXRA 4JYYA 1WNSA 1ORQC 5LA6A 3OTOO 1SESA 4MTOA 5KX5B 2CK3G 1M93A 1NU1H 3CSXA 3CCSV 4HBNA 4DR7O 4WFBV 4I5SA 2HFEC 3CCMV 1ZLZA 3BY6A 5H9CA 1AP5A 1YEWA 4QJFB 2WLLB 1DF5A 4X66O 3W7XA 1K34A 3L72H 3ABLB 4I4TB 1IVSA 2AGAA 1VEWA 2DWDC 3RYCB 4JI1O 4PDVA 1JX9A 2UUAB 1LR1A 4JAVA 5LOVA 3JALA 1QNMA 3FB5C 4JI1B 3JD3A 3AG1B 2JGDB 1AJPA 1FPOA 1YF2A 1TVKA 4NKGB 3O9OA 2YIDA 1NVPD 2NNUA 4LF5O 4U3JA 3X2QC 4JI8B 2ZE5A 1Q7YW 3ZRXA 1FFXB 3I55V 3FAVB 2FMLA 5C93A 3P30A 3RYCA 3LUTB 3LSUA 1MZFA 4MW8A 4Z2WA 3CPWU 5JQGA 4LF4O 3APQA 3A0BZ 2LQTA 1O9GA 4FLTA 1KKDA 4ZKIA 3JASA 2UUBO 1U97A 2XUMA 1H2MA 2BSKB 4I50B 1SF9A 4X1IB 1KBHA 5B3SC 5CB4B 1D5NA 4JI2B 1VQNV 1WB8A 2E5LB 1VQKV 2CTRA 3OUSA 1VIBA 2QTOA 3DTUB 2ADPA 3RN4A 1QLEC 3G6EV 1S5JA 1AI4A 4OGQB 5B5EZ 4LF8O 3OE7G 4LFAB 1VQ5V 1H2LA 2QKAA 4WFHA 1FKAO 3JAWB 2JS3A 4QPKA 3ZS8C 3CP1A 1OCCB 5GONB 2ZR3A 4LH7A 1AB3A 4O4HA 1EBOA 2GTSA 1YJ9V 2WA4A 1TGOA 1GK9A 1D2DA 4DV2O 4HYOA 3ZIAG 1HNXO 3KCYA 2WLKA 4NTXA 4LFCB 3JSNA 4LF6O 4DXWA 1VF6C 2DYRC 1R3LC 4JI5B 3BPZA 4I7ZB 4MTGA 4TWKA 4QIWF 1GN2A 1KKCA 4DW1A 5LYJB 2O57A 3ZMVA 3IAYA 4QNHB 3FYIB 2EILC 3HKDB 1H2SB 3H1JH 3HKBA 3KZIZ 4LF8B 2YI9A 3W7SA 4FM0A 2Q73A 1N4CA 4RO2A 1F23A 1SRYA 3CXHF 1SZXA 2N04A 4UVBA 1K5QA 1S5LZ 5FNVB 3IGAC 5HFLA 1HR0O 4OPHA 3SDLA 2P4VA 1DTOA 1RSOB 3TJTA 3F5WC 1X4TA 2P90A 1FAFA 3CCRV 2QJ1A 2ZE7A 2IM9A 4OX9B 5IWAB 5EC1C 3CRQA 3UO2A 3H1KH 5KA6A 1HNWO 3ZHRA 1KC8W 3CRCA 1XHZA 4GX1A 1R6NA 2AHZA 2HG5C 2YXHA 4I0XA 3STZC 3BAAA 4O2AA 4D7SA 1PL4A 4UXNA 1JVMA 4GZRB 3B2EE 3AK1A 2P4KA 2KQXA 4JI4O 1LNQA 2BOBC 1FFXA 1GN4A 1NVPB 2UXNA 2X0LA 3N2GA 1WP7A 2HJFC 3MHHC 4K8ZA 4AI8A 1XNQB 2AHYA 3AG1C 3LSSA 4X9QA 4FLYA 4LF7O 1JR9A 4DR3O 2LGQA 4RAIA 3AK3A 4F6RB 4X65O 4DV7O 1PNMA 3OGIB 2IW5A 4EFEA 3E89A 1JA8A 3D3IA 5KHKA 3T4DA 1YTFD 1BHAA 2QWQB 3H1LH 3PJSK 4NTYA 2DYSB 1VARA 2Q8VA 1XBLA 1BT8A 3GWOA 4PA3A 4ASUG 3KCXA 4H37A 4EFBA 1ENVA 3EVKA 4O2BB 5GW7A 1M56C 4QGPA 1H38A 3K5OA 3K04A 5KAFZ 4LP8A 1E1QG 1M56B 1FS0G 3AG7A 2F4VO 3CHXA 1FJGO 4PDMA 2NN4A 4MW3A 3VQXA 2HR3A 2M7WA 2N05A 4H44B 2E5LO 1I7FA 3RVZA 4CBCA 4F6EA 2N74A 2VRZA 3WB1A 4ABMA 2ILMA 3Q4HB 4PI2A 3WG7C 2E3CA 4FFBB 3ABUA 3MHSC 3ICXA 1PD3A 1K7DA 3D36C 3K58A 4LF9O 1TVKB 2ZM6B 2Q67A 4J9ZB 4JTAB 3CCVV 1BSMA 5BR8O 2EINC 3D36A 1W0JG 4K0KO 2WLJA 3K3WA 1Y4MA 5BR8B 1CPYA 3IC9A 3SYAA 1N32O 1YHQV 3CCEV 1NQTA 2CGOA 1B06A 3OGCC 1LUWA 4DV2B 3ABMC 1VQMV 3JASB 1K33A 4MTXA 1UJWB 3P3NA 5EZYB 4UCVA 3AG3C 5KUKA 4JI7O 4K8XA 2JEUA 3UT5A 4N21A 4NXNB 4X1KA 3HKCB 2WAMA 5CA3A 4UCSA 2HLDG 2GSMB 5GTIZ 2RQ6A 5IT9N 3NXSA 1BQZA 1AJNA 4XDJA 1M90W 4LWSA 4JYAO 3STLC 1U96A 4GKJB 1QR9A 2P5OA 1S5HC 4MVQA 5JH7A 5DN6G 5LP6C 1XUQA 2HVJC 1NKDA 1PNLA 2BTQB 1K92A 1RM1B 4CC5A 2YIBA 4X65B 1AILA 4WF9V 3U11A 5AG2A 1GKFA 3OT7A 2UXCB 4Q6GA 4DR4O 4MVRA 3E86A 1M57B 3TETA 3P32A 3CC7V 3RYFA 3KG2A 4DRXA 4H0LB 3CRRA 1K4DC 5KHJA 1BCCH 5A2QN 2QGNA 5IYDO 4D7TA 5EC2C 1KMIZ 5IY5B 3SPHA 2XTAA 1BZKA 1Y74B 4DUYO 4NTWA 2HEPA 4B7EA 4LWSB 2Y4UA 2E75B 1K4CC 5JVDB 3M8AA 1NR7A
chains in the Genus database with same CATH topology
1K34A 3JCZA 4MVMA 3ML0A 5B1BC 3SPIA 3ABLB 2C2AA 2DWDC 4PDVA 1JX9A 3FYEB 4FMTA 4JAVA 1VQ7V 3FB5C 1FXHA 4EKWA 3JD3A 3AG1B 1AJPA 5CN0A 1KQSU 4PDRA 4QE7A 5DM6V 3IC7A 2UXXA 4JPRA 4GT1A 3G71V 3K08A 4FJCC 4R8CA 3OFNG 2WLLA 4MVOA 3E2EA 2OTJV 1VQ9V 3RBZA 4TSFG 2EZPA 3W7WA 1NVPD 2NNUA 1JPXA 3F7YC 1MOFA 3K0GA 4QE9A 3TK1A 3X2QC 2OTLV 4TT3G 1Q7YW 3ZRXA 3I55V 1GMGA 4Z1MG 2F43G 2X7RB 1V55B 4PA7A 5KUMA 3P30A 5C93A 3CCUV 1RM1C 3LUTB 2MK3A 2FTKA 4MW8A 4UV9A 2XNDG 3CPWU 3T1CA 1P4RA 1KKDA 2JJ1G 5CBGA 3FB7C 4ZKIA 2WLHA 4R50A 4MT8A 2JDIG 1P7BA 4JYBA 5EK0A 1RPRA 5B3SC 4F4LA 1SZTA 1VQNV 3JD4A 1YJNV 4XDLA 1VQKV 3SYPA 1B6QA 4DO2A 4E2LA 5L3BA 2XAFA 3OUSA 2QTOA 3DTUB 3VBBA 1OHHG 1QLEC 1BHBA 3G6EV 2PI4A 4R6ZA 1CEZA 1AI4A 4U7OA 1W0KG 3OE7G 3AEIA 1SETA 3OUFA 3QO5A 3K9AA 1FXKC 1VQ5V 1I5XA 2OCCB 1GTOA 4WFHA 4GX0A 1PL0A 5IYCO 4QPKA 3W7XA 3OW2U 3CP1A 1F51A 1OCCB 2WWWA 4BIZA 2ZR3A 3CCQV 4P30A 1GM9A 2B1IA 3M99B 1EBOA 1FXKA 4JAUA 5CBFA 5IYBO 1YJ9V 2IJIA 3ABMB 3B8MA 1GK9A 2EBOA 3B8NA 4HYOA 3ZIAG 3LSQA 4PDLA 2GHYA 4WFAV 2WLKA 3F7VC 1BMFG 2WLIA 2XASA 4FK5C 3K79A 3AG4B 3OR7C 1VQ6V 3MD0A 3ZN1A 4KUMA 1HWYA 2HKOA 4QPJA 2XAQA 3IFXA 4DXWA 2DYRC 1K73W 1R3LC 1QCEA 1S76D 3HPLC 4MTGA 1AI7A 3H01A 4TWKA 4OXSA 4QIWF 2Y69B 1R3IC 3JD1A 1FXKB 1JQ0A 5H6QA 3ZMVA 5LHHA 4QNHB 3FYIB 5IDJA 2EILC 3QNEA 4CZZA 4PA6A 1W2BU 1KD1W 1F4MA 2X6BA 3W7SA 3LNMB 1YITV 1AROP 4RO2A 1F23A 2ZDIC 1SRYA 2YEVB 2BOCC 4GCZA 3T4ZA 1MG1A 3CXCU 5LBQA 4UVAA 1JOYA 3CMAV 3CYOA 3FB6C 1Q86W 5LGNA 2ZDIA 3ZMUA 5HFMA 1FXVA 4UVBA 3ETDA 4XDKA 1K5QA 3JYCA 2P67A 3DGEA 4RUFA 3OM3B 4G2KA 1MSWD 2R9RB 4G28B 1XL4A 2Y48A 4Q20A 3IGAC 4RUEA 2EZOA 5HFLA 3E8BA 1G8MA 1S72V 2A9HA 2K1EA 5L3EA 3UKMA 1DTOA 2XAGA 3F5WC 1AJQA 2IU3A 5L3FA 2P90A 2JIZG 4H33A 4RQFA 4WFGA 3CCRV 2OT5A 1G4YB 2LFSA 4PA4A 3E8FA 5EC1C 1EZJA 4JF3A 1NBMG 2EIMB 5KA6A 1R6KA 4RQEA 1KP2A 3OMNB 1KC8W 1QVGU 4GX1A 1R6NA 2AHZA 3K06A 1VQ8V 2HG5C 3ETEA 1SERA 3AG2C 1E1RG 3STZC 4UV8A 3UM7A 4MVZA 5L3CA 3WG7B 3FKSG 1JVMA 4UXNA 3LDDA 1OCCC 3QO7A 3R65A 4JTCB 2XOKG 1Y66A 3TCUA 2PI5A 1K97A 1MABG 1LNQA 1NR1A 2BOBC 2JEXA 2WLIB 5LHIA 2EIJC 1YSCA 1V55C 2X0LA 2UXNA 1NVPB 3SYQA 4PA9A 5B3SB 1BL8A 2HJFC 3MHHC 3ZRWB 2Q68A 2HVKC 4YXWG 1YTFB 1S0VA 2AHYA 3AG1C 3LSSA 2EIMC 4XBFA 2R9IA 1N8RW 4RAIA 3W7UA 1R3KC 5L3DA 2ZXWB 2EINB 3OMIB 3ASOB 1L1FA 1PNMA 2IW5A 1OCOC 3E89A 3D3IA 4JYCA 3K0DA 3SPJA 2YSUB 3T4DA 2YEVA 1YTFD 4N23A 3EHBB 3ZMSA 4PELA 1BHAA 3PJSK 1OCZC 4KFMA 3SYCA 2DYSB 2QM7A 2V1DA 3CMEV 3ZMTA 2ZD9A 3GWOA 4PA3A 4ASUG 1VQLV 1M1KW 3CC2V 4H37A 4WCEV 1ENVA 3ASNC 3AG2B 5GW7A 4MTFA 2B1GA 5EBMC 1M56C 4LC1A 3I56V 1H38A 1WLEA 2WLMA 3RW0A 4LCUC 3A0RA 1OCRB 4R7CA 3K04A 3SYOA 2EIKB 2Z3YA 2DQ3A 4LP8A 1E1QG 3RVYA 1M56B 3B77A 1FS0G 4BW5A 5L3GA 3CCJV 3AG4C 4J9YB 5FL7G 3SPGA 3CC4V 4FIPC 5B1NA 3OMAB 4MS2A 4PDMA 2EIKC 4MW3A 2HR3A 5LHGA 2M7WA 1COWG 2XAJA 3WFVA 3LDCA 5H6RA 1KECA 1OCOB 1WPXA 1DLBA 3RVZA 2A79B 4CBCA 3CD6V 4U7NA 3ZMZA 5J9PC 3ETGA 1JJ2U 5EBLC 1VQOV 5KA5A 1PKXA 3ZJZA 2Q6AA 3WG7C 1S3JA 1THZA 2A0LA 3ABUA 1M57C 3MHSC 1K8AW 2DWEC 1PD3A 2ITCC 5B1OA 2QKSA 1K7DA 3E8GA 4JASA 3CCLV 1DF4A 1YIJV 2EJRA 4GX5A 1QLEB 2P6JA 3VOUA 3JD2A 3W7TA 3E83A 1E79G 2Q67A 1I5YA 3BEHA 2Z5UA 4J9ZB 4JTAB 3ZN0A 3CCVV 2EINC 3D36A 4WFFA 1W0JG 1R3JC 2WLJA 3EFFK 1Y4MA 3K3WA 1XL6A 3ABTA 1OZ0A 2JJ2G 1CPYA 1FFTB 3SYAA 1YHQV 3CCEV 1NQTA 2LFRA 2LP7A 3OGCC 3E35A 2DW4A 2DYRB 2W0FC 1H2GA 3ABMC 3OAAG 4JTDB 3ZRVA 4MVSA 1VQMV 1H8HG 1Q82W 2H8PC 1K33A 3AG3B 4P9PA 4MTXA 2X6CA 2DYSC 2ZQMA 1UJWB 1ROPA 2IJKA 5BZBA 2IU0A 3AG3C 1GM8A 5KUKA 3OR6C 4P2ZA 3LDEA 1AI5A 1NJIW 4ZBMA 1JCHA 3ASNB 1TUEB 2JEUA 4FPPA 1QBZA 1J95A 2QE7G 3OEHG 2WSSG 2D3OW 3FB8C 4N21A 1S77D 4X88A 2WAMA 4X8AA 1V54B 1H8EG 2Y69C 5CA3A 2H94A 1K3EA 2HLDG 2GSMB 5B1AB 2ITDC 2NLJC 1F4NA 1NH2B 5IY5C 1YJWV 3ZRSA 3NXSA 4WFEA 3ABKC 3ASOC 2IJJA 3OEEG 1AJNA 4XDJA 2XAHA 1AR1B 1M90W 2OCCC 2EIJB 4MSWC 1AI6A 2WLNA 5LGTA 3STLC 4JGSA 2IH3C 3ZRWA 2WPDG 3ZCCA 5LGUA 2Q69A 5EBWC 1VQPV 1OCZB 4I9WA 1GO3F 2KB1A 1M9NA 1QR9A 4UVCA 2ATKC 4MVUA 1S5HC 4MVQA 5DN6G 1RPOA 2B5UA 4LBEC 1GM7A 1QR8A 4GX2A 4G27B 1QVFU 2IJHA 1K9MW 2HVJC 1NKDA 1PNLA 1K92A 4L87A 1VQ4V 1RM1B 4BAYA 1EFRG 4WF9V 2QA4V 2W6JG 1YI2V 1GKFA 2W6IG 2P7TC 1R73A 4UUJC 3X2QB 1IXMA 2ZR2A 4BIUA 2X6AA 3SPCA 5CMUA 4MVRA 3E86A 5B1AC 4P9OA 1M57B 5CBHA 3P32A 3TETA 3CC7V 4HZ3A 1QLNA 3SJQC 3KG2A 5E1AC 4X89A 2V7QG 1Q81W 1NH2D 1K4DC 1KP3A 2EILB 2ZXWC 3GB7C 2IH1C 5IYDO 3JD0A 5EC2C 3HB3B 1ORQC 5IY5B 3SPHA 2QEXV 1SESA 4MTOA 2CK3G 3ABKB 3E8HA 1CP9A 3CCSV 3QO8A 1ZWIC 1K5SA 4KP4A 3G4SV 4WFBV 4I5SA 3T2MA 2JK5C 1OCRC 2HFEC 2QM8A 3ABLC 3CCMV 5B1BB 3BY6A 3K03A 5H9CA 1V54C 1PNKA 4QJFB 2DQ0A 2WLLB 1K4CC 4HAMA 1DF5A 1NR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W7T A;  3W7W A;  2WAM A;  3D3I A;  1NVP B;  3BY6 A;  3W7U A;  1RM1 C;  5GW7 A;  5CA3 A;  3IC7 A;  2P90 A;  4HAM A;  1S3J A;  3W7S A;  1NH2 B;  2HR3 A;  1YTF B;  3W7X A;  3E35 A; 
#chains in the Genus database with same CATH topology
 2LW1 A;  3JCZ A;  4FVM A;  4MVM A;  1MNG A;  3PN1 A;  4K3A A;  4FFK A;  4DV5 B;  2PGG A;  2CAZ C;  3CS5 A;  1I94 O;  1FXH A;  2UXD O;  3RYH A;  1XNR B;  2GV9 A;  4QE7 A;  5EZY A;  2CTW A;  4X1I A;  4PJ0 Z;  4GT1 A;  3K08 A;  5IYZ A;  2QWN B;  1EN4 A;  3QG5 A;  4JI8 O;  1VQ9 V;  4TSF G;  1G6U A;  4AIL C;  1JPX A;  3F7Y C;  4PV1 B;  3K0G A;  1R1B A;  3S3X A;  2PYJ A;  4Z1M G;  2X7R B;  3CCU V;  4DUY B;  2UU9 B;  4UV9 A;  2XND G;  3OTF A;  4X62 B;  4ICG A;  1N33 B;  1SA0 B;  1VP7 A;  5CBG A;  1HP8 A;  4KL1 A;  2UUB B;  4F4L A;  4CH6 A;  1B6Q A;  1XOU A;  5C8Y A;  3CWB H;  2XAF A;  4JI3 O;  1L0N H;  5LMU B;  2UXD B;  2AW9 A;  3F5T A;  3RYI B;  1W0K G;  1IXB A;  5LXT A;  1TA8 A;  3AEI A;  5FPR A;  3JAL B;  3OUF A;  1IZ3 A;  1Q6H A;  5LYJ A;  4GX0 A;  4ZIB A;  4YJ2 B;  3OW2 U;  1F51 A;  2GDS A;  1GM9 A;  2B1I A;  2JS5 A;  2UXB B;  1PV0 A;  5LA6 B;  5ITZ A;  4PDL A;  1QQC A;  3SJB C;  1XMO O;  2Y0P A;  4O4L B;  4WFA V;  5JQG B;  2QM4 A;  1FJG B;  1XIL A;  1VQ6 V;  3ZN1 A;  1HWY A;  4B3M B;  2A3Q A;  4ZOL B;  4JI2 O;  3H01 A;  1WN7 A;  4DR1 B;  2LW7 A;  1FXK B;  2OYQ A;  4FFB A;  5IDJ A;  3QNE A;  3E22 B;  1F4M A;  4DV1 O;  3LNM B;  1YIT V;  5J2T A;  4EB6 B;  3JSL A;  4NVP A;  4DV0 O;  1H2N A;  3RFR A;  4J41 A;  5LBQ A;  1Y76 B;  3K5M A;  1NTM H;  1Q86 W;  5LGN A;  1Z5W A;  3ZMU A;  1IBM O;  3BCC H;  3ETD A;  4RUF A;  2E74 B;  2YS8 A;  2AXT Z;  3OM3 B;  4O2B A;  4AQY B;  4G28 B;  5JJE B;  1S72 V;  2K1E A;  5L3E A;  3UKM A;  2LO1 A;  2YIC A;  3C3S A;  3N2K B;  2JIZ G;  2BTO A;  1J5E O;  1G4Y B;  5KMG B;  4PA4 A;  1EZJ A;  3DXR A;  4JF3 A;  1NBM G;  1Q43 A;  1R6K A;  1XQ8 A;  3B09 A;  3HKE B;  1KU9 A;  1QVG U;  1GH6 A;  3OD4 A;  4D6T H;  1SER A;  3AG2 C;  2OWO A;  4TQF A;  3MDS A;  4MVZ A;  5L3C A;  2RNB A;  3WG7 B;  4DR7 B;  3LDD A;  1XMQ O;  5K1X A;  1XMQ B;  1K97 A;  1NR1 A;  4EEQ A;  4DV6 B;  1UPG A;  1VMG A;  2EIJ C;  1V55 C;  4O4L A;  3JAR B;  3SYQ A;  4PA9 A;  1WPB A;  4DV6 O;  3KKY A;  4DW0 A;  4YY3 O;  4J42 A;  1ZTE A;  4DV7 B;  2R9I A;  3CJH A;  4NXM O;  5L3D A;  1EZV H;  4W4L A;  3OMI B;  5J2U A;  1IX9 A;  1OCO C;  3K0D A;  3SPJ A;  2HHH O;  1TUB B;  5EIB C;  1OJH A;  4PEL A;  1SC5 B;  1IUR A;  1Y67 A;  4IHJ B;  4GKK O;  1AR5 A;  2VQF B;  3JAT A;  2UXB O;  3CC2 V;  1GAX A;  2WLM A;  1NI8 A;  1URF A;  4R7C A;  2EIK B;  5LMN O;  2DQ3 A;  3P3P A;  2G38 A;  3RVY A;  2F66 C;  5L3G A;  4BW5 A;  3L75 H;  2KG7 A;  3JAT B;  4FIP C;  4IIJ A;  1WAZ A;  3ZHU A;  3U10 A;  3WFV A;  5H6R A;  5ITZ B;  1KEC A;  1DLB A;  2A79 B;  2CH7 A;  4B3T B;  5A9G A;  3K5L A;  3CE2 A;  3ETG A;  5EBL C;  3G67 A;  1PKX A;  2Q6A A;  1ZSP A;  1S3J A;  1M57 C;  4TV9 B;  2ITC C;  2QKS A;  2JVD A;  3A0H Z;  4JAS A;  4DV4 O;  1DF4 A;  1A32 A;  3BEH A;  2GUZ A;  2Z5U A;  3ZN0 A;  5K1P A;  4NR1 A;  2YIB D;  3EFF K;  1ZUQ A;  4YJ3 A;  3FD9 A;  1WB7 A;  2AZ2 A;  2FKX A;  3K59 A;  5D5Q A;  2PYL A;  3E35 A;  3OAA G;  4JTD B;  5FPO A;  3CRM A;  3ZRV A;  3L74 H;  2H8P C;  4P9P A;  4WBN A;  2NR5 A;  3QF7 A;  2ZQM A;  4DK1 A;  2PTM A;  1I0H A;  1GN6 A;  4B3S O;  3LDE A;  3ASN B;  4YIO A;  5IE9 A;  4FPP A;  1J95 A;  4TQD A;  2WSS G;  1S77 D;  5KMG A;  4X88 A;  1H8E G;  2ZKO A;  4KHP O;  5D5P A;  1F7Y A;  1MZE A;  5IY5 C;  1P49 A;  5DEC A;  3ZRS A;  5IJ0 A;  2PZS A;  1GRJ A;  5CA1 B;  1AR1 B;  2Y4T A;  2EIJ B;  4MSW C;  5EIB D;  2WLN A;  1RFY A;  2IH3 C;  2W0X A;  4TV8 B;  5LGU A;  5EBW C;  3TXS A;  5LXT B;  4A5U B;  1EN5 A;  3S3W A;  2V4D A;  1GM7 A;  4LBE C;  4GX2 A;  1QVF U;  5H2F Z;  2IJH A;  4EB6 A;  1IDS A;  5JVD A;  2FYU H;  3UO3 A;  4BAY A;  2R72 A;  5LP6 B;  5JCO A;  1YI2 V;  2W6I G;  3X2Q B;  3BA8 A;  1XRE A;  5B1A C;  2QTS A;  4P9O A;  5CBH A;  3L73 H;  1Q81 W;  1NH2 D;  2RMK B;  4J11 A;  1KP3 A;  2IH1 C;  2AZ0 A;  2ARH A;  1YCI A;  3RYF B;  3ABK B;  5CB4 A;  1CP9 A;  3N27 A;  3J7A U;  2Q7G A;  4X1Y A;  1OCR C;  2JK5 C;  2QM8 A;  2QWR B;  3ABL C;  4YJ2 A;  5B1B B;  1V54 C;  1D5A A;  1PNK A;  1M5I A;  2ETN A;  4CC6 A;  4X64 B;  4U3F H;  2QA4 V;  1XNQ O;  3J81 N;  3JAR A;  2CDY A;  5B1B C;  2C2A A;  4PI0 A;  3FYE B;  3JAM N;  1T5E A;  4FMT A;  1ZL8 B;  1IBK B;  2EJ7 A;  4B08 A;  4WBN B;  4DV4 B;  1KQS U;  4PDR A;  4NXM B;  4LFA O;  5DM6 V;  1NS1 A;  2UXX A;  3IC7 A;  4DR4 B;  2YDE A;  1XHX A;  4FJC C;  1KB9 F;  5F2V O;  3OFN G;  3E2E A;  2OTJ V;  1VF5 B;  2JGU A;  3RBZ A;  2EZP A;  3GVM A;  2E76 B;  1MOF A;  2OTL V;  3TK1 A;  4TT3 G;  2QR4 A;  2H3O A;  2ZE8 A;  1Q6I A;  2MK3 A;  2QWO B;  4IL6 Z;  2XHB A;  5EYP B;  1WP8 A;  3T1C A;  1P4R A;  4O4J B;  4LF4 B;  2WLH A;  3GWK C;  4I4T A;  5LMN B;  4DR6 B;  4MT8 A;  1QU7 A;  2JDI G;  5EK0 A;  2YXL A;  1DK1 A;  1YJN V;  2CGN A;  4DR5 O;  5KHH A;  3SYP A;  2EX3 A;  5L3B A;  2M6Y A;  4FLU A;  4DR5 B;  4R6Z A;  5KX5 A;  5KAI Z;  1VF7 A;  1SET A;  2XT9 A;  5J2T B;  3CEI A;  3K9A A;  1FXK C;  2FL4 A;  1I5X A;  2OCC B;  1GTO A;  4IIJ B;  1Q6U A;  1PL0 A;  2Q0O C;  4BIZ A;  4P30 A;  3M99 B;  1FXK A;  4JAU A;  5CBF A;  3LNN A;  2IJI A;  1M4U A;  3B8N A;  2DMX A;  2L35 A;  2RN9 A;  2F1M A;  2GHY A;  1XDC A;  1BS3 A;  3J80 N;  3SR2 C;  2WLI A;  2ZNJ A;  4FK5 C;  4LNU A;  3OR7 C;  2VQE B;  1N34 O;  4IYH A;  2P06 A;  4HNA B;  4KUM A;  3IFX A;  4DR1 O;  4OXS A;  3K5N A;  1JQ0 A;  2BTQ A;  4DUZ B;  1W59 A;  3B40 A;  3C90 A;  5LHH A;  1LUV A;  2CE4 A;  1W2B U;  4NXN O;  1ARO P;  2B9Z A;  1SQV H;  4GCZ A;  2BOC C;  1SS3 A;  5EYP A;  3DC6 A;  4CS3 A;  1MG1 A;  3CXC U;  4B3R O;  1JOY A;  3FB6 C;  4X64 O;  3JYC A;  2P67 A;  4G2K A;  4I55 A;  5IJ9 B;  1MSW D;  1XL4 A;  4Q20 A;  1G8M A;  2A9H A;  2R9A A;  3WB0 A;  1HW7 A;  4IHJ A;  2IU3 A;  3U0Z A;  4WFG A;  4LFC O;  2OT5 A;  3T1Y B;  2LFS A;  1HNW B;  1N34 B;  3SGI A;  4B7K A;  3BAB A;  4RQE A;  3RT3 C;  2GUZ B;  1BGY H;  3K06 A;  3ZHS A;  1VQ8 V;  3ETE A;  2R70 A;  4PHZ A;  3HR0 A;  3UM7 A;  4FZ0 A;  1SKV A;  1SQP H;  3H1I H;  4CH4 A;  3FKS G;  1SQF A;  4JTC B;  2XOK G;  1N33 O;  4B3R B;  2PI5 A;  3QVN A;  5E79 Z;  1MAB G;  2WLI B;  2JEX A;  5LHI A;  1YSC A;  1PP9 H;  1BL8 A;  1Q3E A;  2KG7 B;  2EIM C;  2P22 C;  1SQG A;  1SQB H;  3WB2 A;  1XNR O;  1N8R W;  3W7U A;  4UCO A;  4JI6 O;  3EXA A;  1L1F A;  3T1Y O;  3VQW A;  5IWA O;  5JJJ B;  2YSU B;  3D8C A;  3ZMS A;  2CTQ A;  1X59 A;  3SYC A;  2ZIN A;  4GUN A;  3CME V;  5J2U B;  2ZD9 A;  1ZX3 A;  1YVW A;  1VQL V;  1M1K W;  5FLX N;  4LF5 B;  2RJZ A;  4GKK B;  2B1G A;  5EBM C;  4X1Y B;  2VQF O;  1N36 O;  2YIA A;  1WLE A;  4LCU C;  3A0R A;  1OCR B;  3SYO A;  3ZHT A;  1Y76 A;  2IBZ H;  3B77 A;  4J9Y B;  5FL7 G;  3SPG A;  3CC4 V;  5B1N A;  2EIK C;  3H9V A;  1US6 A;  1Z5V A;  5LHG A;  1COW G;  2XAJ A;  3H1H H;  3TGU H;  1ZAU A;  3CD6 V;  1UFI A;  4J10 A;  5J9P C;  3RWR D;  4DUZ O;  4U3J B;  1BE3 H;  2DWE C;  5B1O A;  4JZ2 A;  3E8G A;  4KHP B;  5IJ9 A;  4IYI A;  5CA0 B;  4FM1 A;  1YIJ V;  4GX5 A;  4UCU A;  5KHI A;  1QLE B;  3HKC A;  2P6J A;  2HHH B;  3N2G B;  3JD2 A;  4JV5 B;  3E83 A;  1I5Y A;  3L9D A;  3BVO A;  4WFF A;  2FB5 A;  1N32 B;  1XL6 A;  3B4S A;  3ABT A;  4LFB O;  2PUS A;  1OZ0 A;  2JJ2 G;  1FFT B;  5H5N A;  4O2A B;  5DED A;  2LFR A;  3L70 H;  5CA1 A;  3DC5 A;  2LP7 A;  3CJH B;  3ZHQ A;  2DW4 A;  2DYR B;  1H2G A;  5BY1 A;  2OIE A;  1H8H G;  1Q82 W;  4BWA A;  4UB8 Z;  2X6C A;  4Z1V A;  2DYS C;  3CX5 F;  2IJK A;  4JI7 B;  1N0J A;  1XEQ A;  1PPJ H;  1GM8 A;  3OR6 C;  1AI5 A;  1NJI W;  3D3Q A;  4ZBM A;  1JCH A;  1QBZ A;  1EM1 A;  2QE7 G;  2ZE6 A;  2ODM A;  4X8A A;  3VQV A;  2Y69 C;  1L0L H;  5B1A B;  2ITD C;  2NLJ C;  1NH2 B;  1IBL B;  3QTC A;  1YJW V;  1HNZ B;  4JAA A;  2OIG A;  2IJJ A;  1XI1 A;  3T1H O;  2OCC C;  1Y6X A;  2Y0I A;  4GKJ O;  4K0K B;  1FD9 A;  2ADQ B;  3R66 A;  3A8T A;  4LFB B;  2Q69 A;  1VQP V;  1OCZ B;  1GO3 F;  4UVC A;  2ATK C;  1KYO F;  2CUG A;  4YY3 B;  4DRX B;  1QR8 A;  4DV5 O;  3UCS C;  1HNX B;  2DN9 A;  1EFR G;  3BRC A;  2P7T C;  1R73 A;  4BW9 A;  4UUJ C;  3CB2 A;  4BIU A;  4I0X B;  2PY5 A;  2X6A A;  3SPC A;  1J5E B;  4HZ3 A;  3SJQ C;  5E1A C;  2ZXW C;  2L6L A;  4FZ1 A;  3GB7 C;  3JAK A;  4UFZ A;  4IGG A;  3JD0 A;  3HB3 B;  3IJ4 A;  1Q8I A;  2QEX V;  2CTP A;  3BHP A;  3E8H A;  3QO8 A;  1ZWI C;  1K5S A;  2DE0 X;  4KP4 A;  3G4S V;  1AP6 A;  5GON A;  1SQQ H;  1R6T A;  3T2M A;  1WA8 A;  1MA1 A;  1AVM A;  3K03 A;  2DQ0 A;  4HAM A;  2VWK A;  1IBM B;  4U7O A;  3ML0 A;  3SPI A;  1PM9 A;  4FLW A;  3M7M X;  1I94 B;  4AQY O;  1SA0 A;  4X1K B;  1VQ7 V;  1WJZ A;  4EKW A;  1DGS A;  2KSD A;  5CN0 A;  4CH3 A;  3HKD A;  4JPR A;  2ZT9 B;  3THO A;  3G71 V;  4R8C A;  2WLL A;  4MVO A;  1OV9 A;  3W7W A;  4JI0 O;  4NB5 A;  4QE9 A;  5B66 Z;  3FX7 A;  4I9Q A;  1GMG A;  2F43 G;  5KUM A;  1V55 B;  4PA7 A;  1RM1 C;  4X62 O;  4BIO A;  1MMM A;  2F93 B;  2FTK A;  2F4V B;  2LJ2 A;  1RP3 B;  2JJ1 G;  3FB7 C;  4IT5 A;  4DK0 A;  4R50 A;  2F23 A;  2ZCE A;  1P7B A;  4JYB A;  2Z0A A;  1RPR A;  4I55 B;  1SZT A;  3JD4 A;  2JGD A;  5JCO C;  5LMU O;  4XDL A;  4DO2 A;  4E2L A;  4DV3 O;  2A06 H;  3VBB A;  4B3T O;  1OHH G;  1BHB A;  1V9P A;  2PI4 A;  1CEZ A;  2LGW A;  1NTZ H;  1NZ6 A;  3QO5 A;  3G80 A;  2Q4P A;  3JAK B;  5IYC O;  2VWJ A;  2ZM6 O;  2WWW A;  1GN3 A;  1L8D A;  3CCQ V;  4I50 A;  5IYB O;  3ABM B;  3B8M A;  2UUC B;  2EBO A;  4GLX A;  2Q9L A;  5JH7 B;  3DSQ A;  3LSQ A;  5GTH Z;  4TUY B;  1HR0 B;  2YXY A;  3F7V C;  4B3M O;  1BMF G;  2XAS A;  3K79 A;  3TXQ A;  3ETQ A;  3AG4 B;  3MD0 A;  4QPJ A;  2HKO A;  2XAQ A;  4O4H B;  1K73 W;  4J7J A;  5C8Y B;  1QCE A;  1S76 D;  3HPL C;  1AI7 A;  2Y69 B;  1R3I C;  4F6R A;  3JD1 A;  2K9P A;  1MSD A;  3NR7 A;  5H6Q A;  4CZZ A;  4PA6 A;  1KD1 W;  1TAE A;  5TIS Z;  2X6B A;  4DV0 B;  2ZDI C;  4O4I A;  1TUB A;  2YEV B;  1ZL8 A;  4LF9 B;  4CS4 A;  1IBL O;  1VF6 A;  3T4Z A;  4X20 A;  4UVA A;  3SJC C;  3CMA V;  5LL6 Y;  2Q0A A;  3CYO A;  2ZDI A;  5HFM A;  1FXV A;  4XDK A;  2BSK A;  3DGE A;  1Z2G A;  1Q90 D;  4YIP A;  1JFF A;  2R9R B;  4CS2 A;  1JFF B;  2Y48 A;  4RUE A;  2EZO A;  3E8B A;  5IJ0 B;  2RCV A;  4CH5 A;  1XMO B;  2XAG A;  5L3F A;  1AJQ A;  2BCC H;  2ZIO A;  4H33 A;  4RQF A;  4FLV A;  3RYH B;  3ZX6 A;  3E8F A;  2D2C B;  3UQ8 A;  1YZB A;  2EIM B;  4DR2 O;  1I08 A;  1KP2 A;  3OMN B;  3G6B A;  1NTK H;  4JI0 B;  4ZI7 A;  2QKC A;  3Q4H A;  3A2F A;  1E1R G;  4UV8 A;  2GBO A;  5BMV A;  4LH6 A;  4UCR A;  4ZOL A;  5JJN B;  3OTO B;  1OCC C;  3QO7 A;  3R65 A;  3I5D A;  4BR6 A;  3K9S A;  2YUA A;  1Y66 A;  3TCU A;  4JYA B;  3ZHV A;  1N0N A;  3L71 H;  5B3S B;  4TUY A;  3ZRW B;  5JWP A;  2Q68 A;  2HVK C;  4YXW G;  4LF7 B;  1YTF B;  4DR3 B;  1S0V A;  3ZED A;  2HP8 A;  4XBF A;  2MW2 B;  4TV9 A;  4TOI A;  1R3K C;  3VQY A;  2Q7H A;  2ZXW B;  5KHG A;  2EIN B;  4DYL A;  1JMK C;  1O9H A;  3ASO B;  4LNU B;  3JCU Z;  4JYC A;  2CH7 B;  4JI6 B;  2YEV A;  2DJV A;  4N23 A;  3EHB B;  4DR2 B;  1OCZ C;  4KFM A;  2QM7 A;  2V1D A;  4JZG A;  3ZMT A;  1BQ0 A;  2UU9 O;  4FM2 A;  4E4E A;  4WCE V;  3ASN C;  5BMV B;  5FNV A;  3AG2 B;  4MTF A;  1WA8 B;  4LC1 A;  3CRA A;  3I56 V;  3RW0 A;  2WA3 A;  3AK2 A;  2Z3Y A;  4RWU A;  1N36 B;  3CCJ V;  5LP6 A;  3AG4 C;  3HKE A;  1JJO A;  4UB6 Z;  3BA9 A;  3OMA B;  4MS2 A;  4C7U A;  4X66 B;  2VS0 A;  3UT5 B;  3LDC A;  3DXR B;  4JI5 O;  1OCO B;  1WPX A;  4YJ3 B;  3HKB B;  4U7N A;  3ZMZ A;  4DV3 B;  1G1X B;  4JI3 B;  2YC0 A;  4H13 B;  2GTA A;  1JJ2 U;  1VQO V;  5KA5 A;  3ZJZ A;  4TV8 A;  1THZ A;  2A0L A;  1IBK O;  1K8A W;  3CCL V;  4JV5 O;  2KKW A;  4DV1 B;  2EJR A;  4OPA A;  2RDC A;  3VOU A;  3W7T A;  1E79 G;  3RGB A;  1H2K A;  3T1H B;  4O4J A;  3FAV A;  1R3J C;  4YHH O;  2UUC O;  1P84 F;  1FYJ A;  4O4I B;  4YHH B;  4LR3 A;  2QSA A;  1SQX H;  3ZBH A;  1RSO A;  4ZHQ B;  4ZI7 B;  3K57 A;  4L8J A;  2W0F C;  4ZHQ A;  4LF6 B;  4MVS A;  3BFR A;  3AG3 B;  3SJA C;  2UXC O;  4B3S B;  4DR6 O;  1ROP A;  5LOV B;  5BZB A;  2IU0 A;  2VQE O;  4UCT A;  1AR4 A;  4P2Z A;  4GYC B;  1NT2 B;  1Y74 A;  1CXZ B;  2DOS A;  1TUE B;  3OEH G;  2EUL A;  2D3O W;  2JRI A;  3FB8 C;  1EN6 A;  2F95 B;  1QHT A;  1Q5O A;  1V54 B;  2H94 A;  1K3E A;  4J7K A;  2BE3 A;  2PF4 E;  1F4N A;  3N2K A;  5IYZ B;  4FLX A;  4J7Z A;  4FLZ A;  4K35 A;  2YI8 A;  4WFE A;  3ABK C;  3ASO C;  1YXB A;  3FFQ A;  3OEE G;  1HNZ O;  4JI4 B;  2OCH A;  2XAH A;  1AI6 A;  4J80 A;  4X20 B;  5LGT A;  4JGS A;  4PD4 F;  3ZRW A;  5BXZ A;  2Q5Z A;  2WPD G;  3ZCC A;  4HNA A;  4I9W A;  3O65 A;  2KB1 A;  1M9N A;  4MVU A;  1RPO A;  2B5U A;  3RYI A;  5KLV H;  2Q7E A;  2UUA O;  4G27 B;  1K9M W;  1KUQ A;  2A7W A;  2HJD A;  4L87 A;  2ZNI A;  1VQ4 V;  5CA0 A;  3C3T A;  2ZIM A;  3MAQ A;  3E22 A;  2W6J G;  1P7G A;  3WU2 Z;  1IXM A;  4NYK A;  4W4K A;  2ZR2 A;  1YDX A;  5CMU A;  1HDJ A;  4AHC A;  1B3Q A;  2QWP B;  4OX9 O;  1QLN A;  2QDO A;  3APO A;  4X89 A;  2V7Q G;  3JAW A;  2EIL B;  1B04 A;  4KXR A;  4JYY A;  1WNS A;  1ORQ C;  5LA6 A;  3OTO O;  1SES A;  4MTO A;  5KX5 B;  2CK3 G;  1M93 A;  1NU1 H;  3CSX A;  3CCS V;  4HBN A;  4DR7 O;  4WFB V;  4I5S A;  2HFE C;  3CCM V;  1ZLZ A;  3BY6 A;  5H9C A;  1AP5 A;  1YEW A;  4QJF B;  2WLL B;  1DF5 A;  4X66 O;  3W7X A;  1K34 A;  3L72 H;  3ABL B;  4I4T B;  1IVS A;  2AGA A;  1VEW A;  2DWD C;  3RYC B;  4JI1 O;  4PDV A;  1JX9 A;  2UUA B;  1LR1 A;  4JAV A;  5LOV A;  3JAL A;  1QNM A;  3FB5 C;  4JI1 B;  3JD3 A;  3AG1 B;  2JGD B;  1AJP A;  1FPO A;  1YF2 A;  1TVK A;  4NKG B;  3O9O A;  2YID A;  1NVP D;  2NNU A;  4LF5 O;  4U3J A;  3X2Q C;  4JI8 B;  2ZE5 A;  1Q7Y W;  3ZRX A;  1FFX B;  3I55 V;  3FAV B;  2FML A;  5C93 A;  3P30 A;  3RYC A;  3LUT B;  3LSU A;  1MZF A;  4MW8 A;  4Z2W A;  3CPW U;  5JQG A;  4LF4 O;  3APQ A;  3A0B Z;  2LQT A;  1O9G A;  4FLT A;  1KKD A;  4ZKI A;  3JAS A;  2UUB O;  1U97 A;  2XUM A;  1H2M A;  2BSK B;  4I50 B;  1SF9 A;  4X1I B;  1KBH A;  5B3S C;  5CB4 B;  1D5N A;  4JI2 B;  1VQN V;  1WB8 A;  2E5L B;  1VQK V;  2CTR A;  3OUS A;  1VIB A;  2QTO A;  3DTU B;  2ADP A;  3RN4 A;  1QLE C;  3G6E V;  1S5J A;  1AI4 A;  4OGQ B;  5B5E Z;  4LF8 O;  3OE7 G;  4LFA B;  1VQ5 V;  1H2L A;  2QKA A;  4WFH A;  1FKA O;  3JAW B;  2JS3 A;  4QPK A;  3ZS8 C;  3CP1 A;  1OCC B;  5GON B;  2ZR3 A;  4LH7 A;  1AB3 A;  4O4H A;  1EBO A;  2GTS A;  1YJ9 V;  2WA4 A;  1TGO A;  1GK9 A;  1D2D A;  4DV2 O;  4HYO A;  3ZIA G;  1HNX O;  3KCY A;  2WLK A;  4NTX A;  4LFC B;  3JSN A;  4LF6 O;  4DXW A;  1VF6 C;  2DYR C;  1R3L C;  4JI5 B;  3BPZ A;  4I7Z B;  4MTG A;  4TWK A;  4QIW F;  1GN2 A;  1KKC A;  4DW1 A;  5LYJ B;  2O57 A;  3ZMV A;  3IAY A;  4QNH B;  3FYI B;  2EIL C;  3HKD B;  1H2S B;  3H1J H;  3HKB A;  3KZI Z;  4LF8 B;  2YI9 A;  3W7S A;  4FM0 A;  2Q73 A;  1N4C A;  4RO2 A;  1F23 A;  1SRY A;  3CXH F;  1SZX A;  2N04 A;  4UVB A;  1K5Q A;  1S5L Z;  5FNV B;  3IGA C;  5HFL A;  1HR0 O;  4OPH A;  3SDL A;  2P4V A;  1DTO A;  1RSO B;  3TJT A;  3F5W C;  1X4T A;  2P90 A;  1FAF A;  3CCR V;  2QJ1 A;  2ZE7 A;  2IM9 A;  4OX9 B;  5IWA B;  5EC1 C;  3CRQ A;  3UO2 A;  3H1K H;  5KA6 A;  1HNW O;  3ZHR A;  1KC8 W;  3CRC A;  1XHZ A;  4GX1 A;  1R6N A;  2AHZ A;  2HG5 C;  2YXH A;  4I0X A;  3STZ C;  3BAA A;  4O2A A;  4D7S A;  1PL4 A;  4UXN A;  1JVM A;  4GZR B;  3B2E E;  3AK1 A;  2P4K A;  2KQX A;  4JI4 O;  1LNQ A;  2BOB C;  1FFX A;  1GN4 A;  1NVP B;  2UXN A;  2X0L A;  3N2G A;  1WP7 A;  2HJF C;  3MHH C;  4K8Z A;  4AI8 A;  1XNQ B;  2AHY A;  3AG1 C;  3LSS A;  4X9Q A;  4FLY A;  4LF7 O;  1JR9 A;  4DR3 O;  2LGQ A;  4RAI A;  3AK3 A;  4F6R B;  4X65 O;  4DV7 O;  1PNM A;  3OGI B;  2IW5 A;  4EFE A;  3E89 A;  1JA8 A;  3D3I A;  5KHK A;  3T4D A;  1YTF D;  1BHA A;  2QWQ B;  3H1L H;  3PJS K;  4NTY A;  2DYS B;  1VAR A;  2Q8V A;  1XBL A;  1BT8 A;  3GWO A;  4PA3 A;  4ASU G;  3KCX A;  4H37 A;  4EFB A;  1ENV A;  3EVK A;  4O2B B;  5GW7 A;  1M56 C;  4QGP A;  1H38 A;  3K5O A;  3K04 A;  5KAF Z;  4LP8 A;  1E1Q G;  1M56 B;  1FS0 G;  3AG7 A;  2F4V O;  3CHX A;  1FJG O;  4PDM A;  2NN4 A;  4MW3 A;  3VQX A;  2HR3 A;  2M7W A;  2N05 A;  4H44 B;  2E5L O;  1I7F A;  3RVZ A;  4CBC A;  4F6E A;  2N74 A;  2VRZ A;  3WB1 A;  4ABM A;  2ILM A;  3Q4H B;  4PI2 A;  3WG7 C;  2E3C A;  4FFB B;  3ABU A;  3MHS C;  3ICX A;  1PD3 A;  1K7D A;  3D36 C;  3K58 A;  4LF9 O;  1TVK B;  2ZM6 B;  2Q67 A;  4J9Z B;  4JTA B;  3CCV V;  1BSM A;  5BR8 O;  2EIN C;  3D36 A;  1W0J G;  4K0K O;  2WLJ A;  3K3W A;  1Y4M A;  5BR8 B;  1CPY A;  3IC9 A;  3SYA A;  1N32 O;  1YHQ V;  3CCE V;  1NQT A;  2CGO A;  1B06 A;  3OGC C;  1LUW A;  4DV2 B;  3ABM C;  1VQM V;  3JAS B;  1K33 A;  4MTX A;  1UJW B;  3P3N A;  5EZY B;  4UCV A;  3AG3 C;  5KUK A;  4JI7 O;  4K8X A;  2JEU A;  3UT5 A;  4N21 A;  4NXN B;  4X1K A;  3HKC B;  2WAM A;  5CA3 A;  4UCS A;  2HLD G;  2GSM B;  5GTI Z;  2RQ6 A;  5IT9 N;  3NXS A;  1BQZ A;  1AJN A;  4XDJ A;  1M90 W;  4LWS A;  4JYA O;  3STL C;  1U96 A;  4GKJ B;  1QR9 A;  2P5O A;  1S5H C;  4MVQ A;  5JH7 A;  5DN6 G;  5LP6 C;  1XUQ A;  2HVJ C;  1NKD A;  1PNL A;  2BTQ B;  1K92 A;  1RM1 B;  4CC5 A;  2YIB A;  4X65 B;  1AIL A;  4WF9 V;  3U11 A;  5AG2 A;  1GKF A;  3OT7 A;  2UXC B;  4Q6G A;  4DR4 O;  4MVR A;  3E86 A;  1M57 B;  3TET A;  3P32 A;  3CC7 V;  3RYF A;  3KG2 A;  4DRX A;  4H0L B;  3CRR A;  1K4D C;  5KHJ A;  1BCC H;  5A2Q N;  2QGN A;  5IYD O;  4D7T A;  5EC2 C;  1KMI Z;  5IY5 B;  3SPH A;  2XTA A;  1BZK A;  1Y74 B;  4DUY O;  4NTW A;  2HEP A;  4B7E A;  4LWS B;  2Y4U A;  2E75 B;  1K4C C;  5JVD B;  3M8A A;  1NR7 A; 
#chains in the Genus database with same CATH homology
 1K34 A;  3JCZ A;  4MVM A;  3ML0 A;  5B1B C;  3SPI A;  3ABL B;  2C2A A;  2DWD C;  4PDV A;  1JX9 A;  3FYE B;  4FMT A;  4JAV A;  1VQ7 V;  3FB5 C;  1FXH A;  4EKW A;  3JD3 A;  3AG1 B;  1AJP A;  5CN0 A;  1KQS U;  4PDR A;  4QE7 A;  5DM6 V;  3IC7 A;  2UXX A;  4JPR A;  4GT1 A;  3G71 V;  3K08 A;  4FJC C;  4R8C A;  3OFN G;  2WLL A;  4MVO A;  3E2E A;  2OTJ V;  1VQ9 V;  3RBZ A;  4TSF G;  2EZP A;  3W7W A;  1NVP D;  2NNU A;  1JPX A;  3F7Y C;  1MOF A;  3K0G A;  4QE9 A;  3TK1 A;  3X2Q C;  2OTL V;  4TT3 G;  1Q7Y W;  3ZRX A;  3I55 V;  1GMG A;  4Z1M G;  2F43 G;  2X7R B;  1V55 B;  4PA7 A;  5KUM A;  3P30 A;  5C93 A;  3CCU V;  1RM1 C;  3LUT B;  2MK3 A;  2FTK A;  4MW8 A;  4UV9 A;  2XND G;  3CPW U;  3T1C A;  1P4R A;  1KKD A;  2JJ1 G;  5CBG A;  3FB7 C;  4ZKI A;  2WLH A;  4R50 A;  4MT8 A;  2JDI G;  1P7B A;  4JYB A;  5EK0 A;  1RPR A;  5B3S C;  4F4L A;  1SZT A;  1VQN V;  3JD4 A;  1YJN V;  4XDL A;  1VQK V;  3SYP A;  1B6Q A;  4DO2 A;  4E2L A;  5L3B A;  2XAF A;  3OUS A;  2QTO A;  3DTU B;  3VBB A;  1OHH G;  1QLE C;  1BHB A;  3G6E V;  2PI4 A;  4R6Z A;  1CEZ A;  1AI4 A;  4U7O A;  1W0K G;  3OE7 G;  3AEI A;  1SET A;  3OUF A;  3QO5 A;  3K9A A;  1FXK C;  1VQ5 V;  1I5X A;  2OCC B;  1GTO A;  4WFH A;  4GX0 A;  1PL0 A;  5IYC O;  4QPK A;  3W7X A;  3OW2 U;  3CP1 A;  1F51 A;  1OCC B;  2WWW A;  4BIZ A;  2ZR3 A;  3CCQ V;  4P30 A;  1GM9 A;  2B1I A;  3M99 B;  1EBO A;  1FXK A;  4JAU A;  5CBF A;  5IYB O;  1YJ9 V;  2IJI A;  3ABM B;  3B8M A;  1GK9 A;  2EBO A;  3B8N A;  4HYO A;  3ZIA G;  3LSQ A;  4PDL A;  2GHY A;  4WFA V;  2WLK A;  3F7V C;  1BMF G;  2WLI A;  2XAS A;  4FK5 C;  3K79 A;  3AG4 B;  3OR7 C;  1VQ6 V;  3MD0 A;  3ZN1 A;  4KUM A;  1HWY A;  2HKO A;  4QPJ A;  2XAQ A;  3IFX A;  4DXW A;  2DYR C;  1K73 W;  1R3L C;  1QCE A;  1S76 D;  3HPL C;  4MTG A;  1AI7 A;  3H01 A;  4TWK A;  4OXS A;  4QIW F;  2Y69 B;  1R3I C;  3JD1 A;  1FXK B;  1JQ0 A;  5H6Q A;  3ZMV A;  5LHH A;  4QNH B;  3FYI B;  5IDJ A;  2EIL C;  3QNE A;  4CZZ A;  4PA6 A;  1W2B U;  1KD1 W;  1F4M A;  2X6B A;  3W7S A;  3LNM B;  1YIT V;  1ARO P;  4RO2 A;  1F23 A;  2ZDI C;  1SRY A;  2YEV B;  2BOC C;  4GCZ A;  3T4Z A;  1MG1 A;  3CXC U;  5LBQ A;  4UVA A;  1JOY A;  3CMA V;  3CYO A;  3FB6 C;  1Q86 W;  5LGN A;  2ZDI A;  3ZMU A;  5HFM A;  1FXV A;  4UVB A;  3ETD A;  4XDK A;  1K5Q A;  3JYC A;  2P67 A;  3DGE A;  4RUF A;  3OM3 B;  4G2K A;  1MSW D;  2R9R B;  4G28 B;  1XL4 A;  2Y48 A;  4Q20 A;  3IGA C;  4RUE A;  2EZO A;  5HFL A;  3E8B A;  1G8M A;  1S72 V;  2A9H A;  2K1E A;  5L3E A;  3UKM A;  1DTO A;  2XAG A;  3F5W C;  1AJQ A;  2IU3 A;  5L3F A;  2P90 A;  2JIZ G;  4H33 A;  4RQF A;  4WFG A;  3CCR V;  2OT5 A;  1G4Y B;  2LFS A;  4PA4 A;  3E8F A;  5EC1 C;  1EZJ A;  4JF3 A;  1NBM G;  2EIM B;  5KA6 A;  1R6K A;  4RQE A;  1KP2 A;  3OMN B;  1KC8 W;  1QVG U;  4GX1 A;  1R6N A;  2AHZ A;  3K06 A;  1VQ8 V;  2HG5 C;  3ETE A;  1SER A;  3AG2 C;  1E1R G;  3STZ C;  4UV8 A;  3UM7 A;  4MVZ A;  5L3C A;  3WG7 B;  3FKS G;  1JVM A;  4UXN A;  3LDD A;  1OCC C;  3QO7 A;  3R65 A;  4JTC B;  2XOK G;  1Y66 A;  3TCU A;  2PI5 A;  1K97 A;  1MAB G;  1LNQ A;  1NR1 A;  2BOB C;  2JEX A;  2WLI B;  5LHI A;  2EIJ C;  1YSC A;  1V55 C;  2X0L A;  2UXN A;  1NVP B;  3SYQ A;  4PA9 A;  5B3S B;  1BL8 A;  2HJF C;  3MHH C;  3ZRW B;  2Q68 A;  2HVK C;  4YXW G;  1YTF B;  1S0V A;  2AHY A;  3AG1 C;  3LSS A;  2EIM C;  4XBF A;  2R9I A;  1N8R W;  4RAI A;  3W7U A;  1R3K C;  5L3D A;  2ZXW B;  2EIN B;  3OMI B;  3ASO B;  1L1F A;  1PNM A;  2IW5 A;  1OCO C;  3E89 A;  3D3I A;  4JYC A;  3K0D A;  3SPJ A;  2YSU B;  3T4D A;  2YEV A;  1YTF D;  4N23 A;  3EHB B;  3ZMS A;  4PEL A;  1BHA A;  3PJS K;  1OCZ C;  4KFM A;  3SYC A;  2DYS B;  2QM7 A;  2V1D A;  3CME V;  3ZMT A;  2ZD9 A;  3GWO A;  4PA3 A;  4ASU G;  1VQL V;  1M1K W;  3CC2 V;  4H37 A;  4WCE V;  1ENV A;  3ASN C;  3AG2 B;  5GW7 A;  4MTF A;  2B1G A;  5EBM C;  1M56 C;  4LC1 A;  3I56 V;  1H38 A;  1WLE A;  2WLM A;  3RW0 A;  4LCU C;  3A0R A;  1OCR B;  4R7C A;  3K04 A;  3SYO A;  2EIK B;  2Z3Y A;  2DQ3 A;  4LP8 A;  1E1Q G;  3RVY A;  1M56 B;  3B77 A;  1FS0 G;  4BW5 A;  5L3G A;  3CCJ V;  3AG4 C;  4J9Y B;  5FL7 G;  3SPG A;  3CC4 V;  4FIP C;  5B1N A;  3OMA B;  4MS2 A;  4PDM A;  2EIK C;  4MW3 A;  2HR3 A;  5LHG A;  2M7W A;  1COW G;  2XAJ A;  3WFV A;  3LDC A;  5H6R A;  1KEC A;  1OCO B;  1WPX A;  1DLB A;  3RVZ A;  2A79 B;  4CBC A;  3CD6 V;  4U7N A;  3ZMZ A;  5J9P C;  3ETG A;  1JJ2 U;  5EBL C;  1VQO V;  5KA5 A;  1PKX A;  3ZJZ A;  2Q6A A;  3WG7 C;  1S3J A;  1THZ A;  2A0L A;  3ABU A;  1M57 C;  3MHS C;  1K8A W;  2DWE C;  1PD3 A;  2ITC C;  5B1O A;  2QKS A;  1K7D A;  3E8G A;  4JAS A;  3CCL V;  1DF4 A;  1YIJ V;  2EJR A;  4GX5 A;  1QLE B;  2P6J A;  3VOU A;  3JD2 A;  3W7T A;  3E83 A;  1E79 G;  2Q67 A;  1I5Y A;  3BEH A;  2Z5U A;  4J9Z B;  4JTA B;  3ZN0 A;  3CCV V;  2EIN C;  3D36 A;  4WFF A;  1W0J G;  1R3J C;  2WLJ A;  3EFF K;  1Y4M A;  3K3W A;  1XL6 A;  3ABT A;  1OZ0 A;  2JJ2 G;  1CPY A;  1FFT B;  3SYA A;  1YHQ V;  3CCE V;  1NQT A;  2LFR A;  2LP7 A;  3OGC C;  3E35 A;  2DW4 A;  2DYR B;  2W0F C;  1H2G A;  3ABM C;  3OAA G;  4JTD B;  3ZRV A;  4MVS A;  1VQM V;  1H8H G;  1Q82 W;  2H8P C;  1K33 A;  3AG3 B;  4P9P A;  4MTX A;  2X6C A;  2DYS C;  2ZQM A;  1UJW B;  1ROP A;  2IJK A;  5BZB A;  2IU0 A;  3AG3 C;  1GM8 A;  5KUK A;  3OR6 C;  4P2Z A;  3LDE A;  1AI5 A;  1NJI W;  4ZBM A;  1JCH A;  3ASN B;  1TUE B;  2JEU A;  4FPP A;  1QBZ A;  1J95 A;  2QE7 G;  3OEH G;  2WSS G;  2D3O W;  3FB8 C;  4N21 A;  1S77 D;  4X88 A;  2WAM A;  4X8A A;  1V54 B;  1H8E G;  2Y69 C;  5CA3 A;  2H94 A;  1K3E A;  2HLD G;  2GSM B;  5B1A B;  2ITD C;  2NLJ C;  1F4N A;  1NH2 B;  5IY5 C;  1YJW V;  3ZRS A;  3NXS A;  4WFE A;  3ABK C;  3ASO C;  2IJJ A;  3OEE G;  1AJN A;  4XDJ A;  2XAH A;  1AR1 B;  1M90 W;  2OCC C;  2EIJ B;  4MSW C;  1AI6 A;  2WLN A;  5LGT A;  3STL C;  4JGS A;  2IH3 C;  3ZRW A;  2WPD G;  3ZCC A;  5LGU A;  2Q69 A;  5EBW C;  1VQP V;  1OCZ B;  4I9W A;  1GO3 F;  2KB1 A;  1M9N A;  1QR9 A;  4UVC A;  2ATK C;  4MVU A;  1S5H C;  4MVQ A;  5DN6 G;  1RPO A;  2B5U A;  4LBE C;  1GM7 A;  1QR8 A;  4GX2 A;  4G27 B;  1QVF U;  2IJH A;  1K9M W;  2HVJ C;  1NKD A;  1PNL A;  1K92 A;  4L87 A;  1VQ4 V;  1RM1 B;  4BAY A;  1EFR G;  4WF9 V;  2QA4 V;  2W6J G;  1YI2 V;  1GKF A;  2W6I G;  2P7T C;  1R73 A;  4UUJ C;  3X2Q B;  1IXM A;  2ZR2 A;  4BIU A;  2X6A A;  3SPC A;  5CMU A;  4MVR A;  3E86 A;  5B1A C;  4P9O A;  1M57 B;  5CBH A;  3P32 A;  3TET A;  3CC7 V;  4HZ3 A;  1QLN A;  3SJQ C;  3KG2 A;  5E1A C;  4X89 A;  2V7Q G;  1Q81 W;  1NH2 D;  1K4D C;  1KP3 A;  2EIL B;  2ZXW C;  3GB7 C;  2IH1 C;  5IYD O;  3JD0 A;  5EC2 C;  3HB3 B;  1ORQ C;  5IY5 B;  3SPH A;  2QEX V;  1SES A;  4MTO A;  2CK3 G;  3ABK B;  3E8H A;  1CP9 A;  3CCS V;  3QO8 A;  1ZWI C;  1K5S A;  4KP4 A;  3G4S V;  4WFB V;  4I5S A;  3T2M A;  2JK5 C;  1OCR C;  2HFE C;  2QM8 A;  3ABL C;  3CCM V;  5B1B B;  3BY6 A;  3K03 A;  5H9C A;  1V54 C;  1PNK A;  4QJF B;  2DQ0 A;  2WLL B;  1K4C C;  4HAM A;  1DF5 A;  1NR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...