1NVPD

Human tfiia/tbp/dna complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
97
structure length
97
Chain Sequence
YQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*GP*GP*GP*GP*GP*GP*CP*TP*AP*TP*AP*AP*AP*AP*GP*G)-3'
publication title Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 25
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02268 TFIIA_gamma_N Transcription initiation factor IIA, gamma subunit, helical domain
D PF02751 TFIIA_gamma_C Transcription initiation factor IIA, gamma subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.190 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1nvpD01
2.30.18.10 Mainly Beta Roll TATA box binding Protein, subunit D; domain 2 Transcription factor IIA (TFIIA), beta-barrel domain 1nvpD02
1NH2C 5IYBO 5IYCO 1NH2D 1NVPD 1YTFC 1RM1C 5IYDO 1RM1B 1NVPC 1YTFD
chains in the Genus database with same CATH superfamily
4O2BB 2LW7A 1NTMH 4JTDB 3CRMA 1AVMA 4DV2O 1TA8A 1NVPB 2Y4TA 3ABKB 2NR5A 3OTOB 4GUNA 5IY5B 4LF4B 2ZNJA 3VBBA 1ZSPA 3JD1A 1YJNV 3JATA 3HKCB 3A0RA 1J5EO 3CRQA 2PZSA 5EBMC 2L35A 1YDXA 3ICXA 1RPOA 3FX7A 2X6AA 3HB3B 3AG2C 5H2FZ 1HR0B 2DN9A 5FPRA 2Q73A 2B9ZA 4PA3A 2VWKA 4D7SA 5LHGA 2HJDA 3E89A 4ZKIA 2OIGA 4KHPO 1BS3A 5LP6A 1K33A 4MW3A 5BMVB 2CK3G 4UXNA 3T4DA 2GDSA 3ZRVA 1XQ8A 3F5TA 1BL8A 1YTFB 2DYSC 3FKSG 2BE3A 2JIZG 4JI2B 1ZWIC 4DR3O 5BZBA 1S5LZ 3CC4V 2PYJA 3DC5A 4FZ1A 4UVAA 1NU1H 1VQ6V 4KP4A 1FAFA 1A32A 5LXTA 4X62O 4RQEA 1ZL8A 4P9PA 4RUEA 4DR7B 1VP7A 4ZIBA 4N23A 1SC5B 1LUVA 1N33O 4R50A 3K9SA 2KG7A 3H01A 2WSSG 1LR1A 1U97A 2QGNA 3G71V 2BTQA 1I7FA 3OAAG 2EIMB 4JYAO 3JD0A 3RVZA 3ZS8C 2AGAA 3E8HA 2EZPA 5KMGB 1OCCC 3FYIB 2JEXA 4NTXA 4RUFA 4HAMA 4NXNB 2Q69A 4FLUA 1VQPV 2ADQB 3NR7A 2CAZC 4DR1O 3UKMA 2UXDB 4IHJB 3J80N 1L0LH 3J7AU 1AILA 5C8YB 2QWRB 4B3SO 3H1IH 1EN6A 1P4RA 1Z2GA 1H2GA 3RGBA 2B1IA 1WB8A 4J80A 4MTOA 5JCOC 2Q0AA 2R70A 5EZYA 1QCEA 2IH1C 3VQVA 2NNUA 1I08A 1RPRA 5L3DA 1I94B 3BY6A 1IBLB 3OE7G 2WA3A 1P49A 2AHZA 4GKKB 4O2AB 4MVQA 4UB6Z 4I7ZB 3BABA 4FIPC 3SPJA 1VF6C 1Q5OA 4RWUA 2CUGA 1D5AA 5LP6B 2HR3A 1OHHG 3UO2A 2EBOA 1XNQB 4OX9O 3MHSC 1YXBA 2ILMA 2Q67A 1MG1A 5KA5A 1H38A 5EC2C 2XHBA 1R3KC 1NZ6A 2K1EA 3OMAB 2ODMA 1AI4A 4TV9A 2UXCB 3UCSC 3HR0A 1RM1C 2XUMA 2AZ2A 1RFYA 3UT5B 3RYHA 2YSUB 3P32A 4UV8A 2GHYA 2UUBB 2XAJA 3CB2A 3EXAA 4UCUA 1FXKA 2KG7B 3X2QC 1XUQA 5IWAB 1F23A 3GVMA 2EIKC 2BTQB 1M4UA 2CTRA 4U7NA 1NH2B 5BR8B 1KP3A 4DYLA 2BSKA 4YHHB 2EULA 4HNAA 3Q4HB 3ETGA 3AEIA 3WG7B 3OTOO 2ITCC 4FLTA 1K73W 3B09A 4LF4O 1UPGA 4DV6B 4YIOA 1D2DA 5D5QA 3RYFB 5H9CA 3CX5F 1V55B 4ZOLA 4BW9A 4MVRA 2ZE7A 2A79B 4TUYB 1Y66A 2GUZB 1YJWV 1DF4A 1S72V 5FPOA 3E8FA 1TUBB 1OCZB 4N21A 3ZMUA 5HFLA 4LH6A 1BMFG 4R8CA 2UXBO 4O4HA 1SERA 3K9AA 2HP8A 1UJWB 2RDCA 1CEZA 3RYIB 4X1YA 1K5QA 2OWOA 4X89A 4J7KA 3ZN1A 1AI6A 3JCUZ 4IIJB 2LW1A 5L3FA 1XHZA 3CSXA 5B1NA 1AP5A 4CS4A 4B08A 2ZNIA 4BAYA 2OCHA 3M99B 3JYCA 4O4IA 4F6RA 1E1RG 4IGGA 1E79G 3BAAA 4H33A 2Y0IA 5JQGB 4XDKA 1IBMO 1OCRC 2IW5A 4Z1VA 3CRRA 2X6BA 4UVBA 3JD4A 1S5JA 4RO2A 3D36C 1VF7A 1N32B 3HKDB 4JPRA 2R9AA 4DR6O 5KHGA 3CCJV 1KYOF 4UFZA 1WNSA 2F1MA 2OCCC 4GYCB 2JRIA 1MSDA 2X0LA 3BA8A 3ASOB 1F51A 3RYHB 3OW2U 3ABLB 4JI4O 1H2MA 3JAWB 4UUJC 2P67A 4LF5B 1IXMA 3T1CA 3CCUV 2QKAA 1EBOA 2V4DA 3K0GA 4CH5A 1XREA 5ITZB 1L8DA 2UXDO 5B1AC 3CJHB 2E74B 2Q5ZA 4YIPA 2JDIG 1YF2A 4HNAB 1HDJA 1D5NA 1GN2A 1AI7A 4LNUA 3UQ8A 3ASNC 2Q4PA 5E1AC 2ZR2A 3RT3C 3C3TA 4DV5B 2YIBD 5IDJA 2HHHB 5LMNB 1TAEA 1VQKV 4YJ2B 1KP2A 3OFNG 4I4TA 5A2QN 4JI1B 5JWPA 4ZOLB 3OUFA 3B40A 2HKOA 4PA4A 1F4NA 5KAFZ 1IDSA 1I94O 3K5MA 4NB5A 1M93A 1G1XB 2YI8A 4FFKA 4GKKO 3DGEA 4CH4A 2HLDG 4DR4B 5F2VO 4UCSA 5CBFA 2D3OW 4WBNA 5IYDO 1NJIW 3CEIA 2D2CB 1IXBA 2C2AA 1XNQO 4RQFA 2LO1A 1Y67A 1GN4A 3CCRV 4DV3B 4LWSA 1BSMA 3SGIA 2IJHA 1H2KA 2N04A 1B6QA 2ZD9A 3ABMB 2DWDC 5J9PC 1Z5VA 4MVZA 3QO8A 4F6RB 4B3MB 4DV4O 3AK1A 3H9VA 1NR7A 3G4SV 1SA0A 2JGDA 2K9PA 4O2BA 4LFAB 5IWAO 3CC2V 1Z5WA 5DEDA 4AHCA 1AROP 4WFAV 2CTPA 1Q7YW 1F4MA 3M7MX 4PA9A 4ABMA 3BPZA 1FS0G 1I5XA 4X66B 2VQFB 1AR1B 3AK3A 4DV6O 2YXLA 4DXWA 4TT3G 3W7XA 2P5OA 4JV5B 4U7OA 1L0NH 1DK1A 3FB6C 4CC5A 4LF8B 3CRCA 1VQOV 1CXZB 3WB0A 1OV9A 2DYRC 3I55V 3T4ZA 4LNUB 3GB7C 3LNMB 4JI0O 4BIUA 4EB6B 1PNMA 4WFBV 3K59A 4TWKA 3SYOA 4B3RB 1EFRG 2V1DA 3ZJZA 3ZMSA 2OYQA 3B4SA 3G6EV 1NH2D 4I9QA 1PL4A 1XI1A 1PPJH 5LL6Y 1W59A 2RN9A 4LFCB 2Y0PA 1R6NA 5JH7B 1IURA 2F66C 2IJIA 3ABTA 5IJ9B 2IJJA 3B8NA 3MDSA 1Q86W 1R3LC 2DQ0A 5L3EA 1RP3B 1F7YA 1EZVH 3CE2A 4Z1MG 1NBMG 3ETDA 1Q6HA 4D7TA 2YIBA 1W0KG 1VF6A 3HPLC 4AILC 3A8TA 2IH3C 2X7RB 4FMTA 5BY1A 4TOIA 3C90A 5LYJB 1JOYA 2DYSB 2EIJC 4X64B 5KMGA 1XOUA 4DUZO 3EFFK 4JI7O 1N32O 1M90W 3LDEA 3QG5A 2YICA 4FJCC 2UXNA 1OCOC 3MD0A 3ETQA 1TVKB 2P6JA 4WFGA 4G2KA 1M57B 1SQPH 1IBKB 2Z3YA 4TQFA 3K5NA 4X1KB 3AG1C 1IZ3A 4IHJA 1NT2B 4I55A 3QF7A 4LC1A 5C8YA 3CHXA 3ZHSA 4H0LB 1HWYA 3L74H 4GKJB 5L3GA 3H1KH 1Y74A 3BFRA 4J10A 4QE7A 4UCTA 2IU0A 3F5WC 1MSWD 2R9IA 3STZC 1G8MA 2UUAO 1OCCB 4W4KA 1JQ0A 4LCUC 3H1LH 4DV5O 3T2MA 4D6TH 4L87A 5LMNO 1I0HA 5B3SC 3OGCC 2H3OA 2A0LA 4U3JB 3CCQV 4NXMB 2HJFC 1M56C 5EIBD 4QNHB 4DV0B 1O9HA 3FB8C 4O2AA 1N34O 3E35A 1N36B 3JD2A 4DK1A 1SQFA 5EC1C 5KHIA 3HKEB 4FPPA 1WB7A 4O4LB 3THOA 1GM9A 2ZM6B 1CP9A 2B5UA 4JI8B 1ZX3A 4DR4O 1K4CC 4E4EA 4PA7A 4LF6B 4DV7O 3OM3B 1R3JC 1VQNV 3CMEV 2A3QA 3LUTB 5KAIZ 4PD4F 3OMIB 2LQTA 2ZXWB 4DUYB 3P3NA 4O4JA 2FB5A 1YCIA 4JZ2A 5EK0A 3UT5A 1FYJA 3G80A 2PY5A 1HNWB 1XBLA 2QM7A 2KB1A 4WCEV 1QLEC 4GLXA 4PJ0Z 2RNBA 1M9NA 1YI2V 4B3MO 4QJFB 4JAUA 5CA3A 2LP7A 5KLVH 4LFAO 3J81N 4DRXA 3QTCA 1BE3H 5DM6V 2AZ0A 1PV0A 2KSDA 3Q4HA 1XMOB 3IJ4A 1NVPC 1WJZA 4OPAA 1QVGU 4FZ0A 2ZCEA 3RYFA 2Q7EA 3PN1A 2JS5A 4X66O 3FAVB 1R6KA 1PNKA 2VQFO 2DE0X 4GT1A 4I55B 4TUYA 3X2QB 2EINC 2GUZA 2HEPA 3LSSA 4FLXA 5LOVB 2EIKB 4J42A 4B3TB 4B7KA 4MTGA 2YIAA 1KB9F 1ROPA 2DJVA 1UFIA 1TUBA 4MVSA 2W0XA 1R73A 1Y74B 1WP8A 4UB8Z 5J2TB 3ZMVA 1VQ4V 3RVYA 3LDCA 3CCLV 2PTMA 3NXSA 5LA6B 4DO2A 4ICGA 3RYIA 4K35A 2VRZA 1YJ9V 2WLKA 3T1YB 1K3EA 4UCRA 3SYQA 3N2GB 4TSFG 5CB4B 4IIJA 3W7TA 3TJTA 4JI5B 3RYCB 2NLJC 3KCXA 5H5NA 5L3BA 5GONA 4LFCO 2XTAA 2WA4A 3R66A 3ZHQA 1H2SB 1YHQV 1OZ0A 2XOKG 5K1PA 5JQGA 1T5EA 1S77D 3GWOA 3ZEDA 1S5HC 1DGSA 1SQXH 3APQA 4CS2A 2UUCB 1K34A 3BRCA 3HKDA 1IX9A 1AP6A 4C7UA 3CMAV 2GBOA 4A5UB 4GX1A 2VQEO 1VIBA 4O4JB 4CH3A 5TISZ 4NKGB 4J41A 1EZJA 1Y76A 1BHAA 4MS2A 2IM9A 3JAWA 4DR2O 1S3JA 1HW7A 4Q20A 3BA9A 4LP8A 1IBKO 3LDDA 5LMUO 3JCZA 2EX3A 5ITZA 4QIWF 1EN4A 4KL1A 4DRXB 1OCRB 4JASA 3CJHA 3ZRXA 3E2EA 1V54C 1ZAUA 1ZTEA 3SPGA 1SESA 1US6A 2OTJV 5E79Z 3CXHF 5EBWC 4GKJO 1R6TA 2R72A 4JI6B 1B06A 2OCCB 2YXHA 4YJ2A 2Z5UA 3WFVA 1O9GA 1TUEB 4DW0A 1WPBA 2XAQA 3F7YC 3OT7A 2JGUA 4WFEA 5KHJA 3OEHG 1XNRB 2FYUH 4MTFA 2LGWA 5GTHZ 1Q43A 1GM8A 2PGGA 1IVSA 4NXMO 4JGSA 1FXHA 4DV0O 1HR0O 3LSUA 1W0JG 2ZE6A 5B1AB 1QBZA 3P3PA 2ZM6O 4JI8O 5LP6C 5EYPA 1QNMA 2WLMA 4JYCA 4LF6O 4JI2O 2Q9LA 3LSQA 2PYLA 4ZI7B 5GONB 3ZX6A 3SDLA 5IYCO 4DR7O 2RCVA 2ZDIA 3ML0A 1HNWO 1AI5A 1JJOA 1SQGA 2UU9B 4WF9V 3AG7A 4LR3A 4MVMA 2FL4A 2ZIMA 1KKCA 4KFMA 1R3IC 1XL4A 4HBNA 1VQLV 3E83A 3L9DA 3BVOA 1XMOO 1Y76B 1QVFU 5CMUA 3N27A 4NXNO 4LH7A 2JVDA 1N0JA 4ZHQA 4LF9B 2XAFA 2CTWA 5L3CA 1M5IA 1PNLA 3AG3C 1FFXA 5FL7G 3JASA 1Y6XA 1QLNA 4H13B 2W0FC 2WLJA 5CN0A 2QTSA 2BCCH 5J2UA 4MVUA 5IT9N 3G67A 4B3TO 4E2LA 4X88A 4EB6A 2OIEA 4PDRA 4DV2B 5IE9A 3JSNA 1FJGB 4GX0A 2ITDC 2GSMB 3IC7A 4CZZA 2GTAA 4X9QA 3T1YO 4QE9A 2ZIOA 4X20B 5JH7A 1IBLO 2JS3A 4WFHA 5IJ9A 1GH6A 1SQQH 1YEWA 1VQ8V 1BCCH 4MTXA 1J5EB 4UCOA 2YXYA 3PJSK 1FKAO 2M7WA 2GTSA 1PM9A 5LBQA 2N74A 4TQDA 4B7EA 1G6UA 1J95A 2IU3A 3L70H 3CP1A 1KECA 2KQXA 3IC9A 3JARB 1KMIZ 1NR1A 1BHBA 5EYPB 3CC7V 2CE4A 4KHPB 1SQBH 2ZINA 4LBEC 5LYJA 3DTUB 2Y69B 2YC0A 4JAVA 3K0DA 2P4VA 2UXCO 3RWRD 2FTKA 5HFMA 4XDJA 1NTKH 4CBCA 1K92A 3IAYA 2QWNB 4FLWA 1TVKA 1WP7A 1M1KW 2UUBO 4X65B 3AG4C 3TXSA 3ASOC 4J9ZB 2Y4UA 4X1KA 1QR8A 3H1JH 3CXCU 2LGQA 3WU2Z 4PI0A 1FXKC 4YY3B 4PA6A 5BR8O 4Q6GA 3JALB 2ZE5A 3L72H 3W7SA 4YHHO 3WB2A 1JFFA 3FB7C 4L8JA 1THZA 4JYAB 2OT5A 1B3QA 4K8ZA 3RN4A 3DC6A 4JI6O 3A0HZ 4ZHQB 3ZN0A 3VOUA 1GK9A 1Q81W 3DSQA 3OGIB 4U3JA 2PI5A 3SPCA 3QVNA 1FFXB 2EILC 2F23A 3JASB 1SQVH 4F6EA 3SYCA 3AG1B 4EFEA 1XNRO 4DR1B 5J2UB 2B1GA 3CCSV 3HKEA 4PDVA 4MVOA 4O4LA 4HYOA 3B2EE 1Q8IA 5KX5A 1KQSU 3QO7A 1GTOA 4PV1B 1RSOA 3APOA 3C3SA 4KXRA 5BXZA 2EJRA 5JCOA 2E5LB 4NVPA 5CA0B 2YIDA 5DN6G 4I0XB 5B3SB 5KHKA 1W2BU 1WAZA 3K5LA 1M56B 3KCYA 2H8PC 2HFEC 3AG2B 4FLZA 1K4DC 3ETEA 1WN7A 1H2NA 2ZT9B 4F4LA 4MW8A 1VEWA 3MAQA 1XEQA 1ZUQA 4OX9B 4PDMA 3BEHA 1GKFA 5B1BC 2A9HA 3FB5C 1SRYA 2P4KA 5C93A 2HVJC 2N05A 3CPWU 4FVMA 1X4TA 3DXRB 2YEVA 1X59A 1KKDA 3F7VC 3FAVA 1HNZB 3T1HB 2ATKC 3LNNA 4LF5O 1NS1A 3JD3A 3G6BA 5DECA 4BR6A 4LF9O 1QLEB 1Q6IA 2RQ6A 5LOVA 3L73H 2IJKA 2WLLB 1LNQA 3CS5A 2JJ1G 1JFFB 2VS0A 4JAAA 5J2TA 1K8AW 3FFQA 1DLBA 4BIZA 4R6ZA 5LA6A 5IYZB 4LF7B 1ZLZA 2HHHO 5JVDA 5B66Z 4WFFA 1FJGO 4YJ3B 1PL0A 3N2GA 4JI1O 5CB4A 2BOBC 2ZE8A 3OTFA 3A0BZ 3ZHTA 4BWAA 1BT8A 3RYCA 2CDYA 3N2KA 2PUSA 2JJ2G 2ZQMA 3B8MA 3BCCH 1YVWA 3KZIZ 1VMGA 2QEXV 2EINB 5GW7A 3R65A 3SR2C 5IJ0B 5KX5B 5JJJB 4I50A 2DWEC 1RSOB 4UV9A 4PI2A 5CA1A 2LFSA 3ZRWA 2LJ2A 1JPXA 2E76B 4ZBMA 1KU9A 1VARA 1PKXA 4FM1A 4P2ZA 4DV3O 2UXBB 2XT9A 2CGNA 1JCHA 2WLNA 2AHYA 3WB1A 3FD9A 4FK5C 3KKYA 2VWJA 4X65O 1AJPA 2WAMA 2P7TC 4TV8B 1M57C 2XNDG 3BHPA 1IBMB 1XILA 2QM4A 4YY3O 3D36A 2UXXA 4K3AA 5FNVB 3B77A 3TK1A 1WLEA 4NTYA 3ABKC 1AR4A 4MT8A 3SJCC 3I5DA 3TXQA 4EKWA 4QGPA 3L75H 1AJQA 1RM1B 4Z2WA 4DR6B 3O9OA 5IY5C 2YDEA 2YEVB 1K5SA 5IYBO 3CD6V 2KKWA 1WA8A 3D3QA 3K3WA 2AW9A 4QPKA 2CGOA 4JI4B 2PF4E 1CPYA 2Q68A 4NR1A 5H6QA 2CH7B 4DR5B 4JV5O 4GX5A 1YITV 4LF8O 1LUWA 2P06A 4GX2A 3KG2A 3D8CA 2ZR3A 3P30A 1ORQC 1V54B 3HKBA 4G27B 4J9YB 2DQ3A 3M8AA 4B3RO 3A2FA 3E22A 5JVDB 5B5EZ 4BW5A 1JJ2U 1VQMV 1YTFC 4JZGA 3CCMV 4ASUG 3OD4A 3SYPA 2WLIA 1XHXA 4ZI7A 3K04A 3N2KB 2E5LO 4JYYA 3MHHC 3JATB 4DK0A 2OTLV 4PDLA 2F93B 2ZXWC 3SJQC 1SETA 4I50B 3JAMN 5CA1B 2QWPB 5LGUA 2FMLA 3OR7C 3ZRWB 2EJ7A 2QJ1A 2CTQA 2G38A 1E1QG 1COWG 3ZCCA 3U11A 3ZMTA 2EIMC 4X64O 2L6LA 3JSLA 4IYIA 1AR5A 1GO3F 1HNXB 5LGTA 1QQCA 1BQZA 4AQYB 1K7DA 5LXTB 4XBFA 1ZL8B 5AG2A 1KD1W 1HNZO 3T1HO 2P90A 1FD9A 4I9WA 2E75B 4DV4B 1GAXA 4BIOA 3IGAC 2PI4A 2ZKOA 3ABUA 4EFBA 2Q7HA 3L71H 3VQXA 4PELA 3K79A 1BGYH 4GCZA 4X1IA 4K0KB 1MOFA 2BOCC 3EVKA 4FM2A 4FLVA 4JI3B 3SPHA 3STLC 2F4VB 1EM1A 2YUAA 4LF7O 1WA8B 1VQ9V 4X20A 2Q6AA 4LFBB 5KUMA 3K06A 1L1FA 3VQYA 2M6YA 3ZBHA 3AG3B 2W6JG 2EZOA 3IFXA 3OUSA 4UVCA 3S3XA 1N36O 4P30A 1KUQA 2HG5C 5FLXN 3CYOA 3HKBB 3JARA 3ASNB 5H6RA 4NTWA 1R1BA 3E22B 4JI0B 1JR9A 3QNEA 2Y48A 3UM7A 3SYAA 3ZIAG 2WLIB 3JAKA 4QPJA 1P7GA 1GN6A 4DUYO 5EZYB 2DOSA 1XDCA 2V7QG 1QU7A 1I5YA 1P7BA 2MW2B 2Q7GA 3ZHVA 1Y4MA 1GN3A 5A9GA 1NVPD 2E3CA 3CCEV 1JX9A 1FXVA 1YSCA 4FFBA 5KUKA 1NI8A 3U0ZA 2O57A 1ENVA 5JJEB 5KA6A 4DV1B 2ETNA 3JALA 1MMMA 3EHBB 3K5OA 3U10A 1BZKA 1NH2C 3RFRA 2QSAA 3AK2A 3TCUA 1SS3A 1KBHA 4HZ3A 3K03A 5LHHA 3OMNB 1Q90D 4EEQA 2YI9A 2QKSA 3CRAA 3K58A 4DUZB 4JI7B 1WPXA 3E8BA 1U96A 4TV9B 4I5SA 3WG7C 2RMKB 1XMQB 3AG4B 4FLYA 1URFA 1FFTB 1V55C 3K08A 1DF5A 2MK3A 1YTFD 1K97A 1FXKB 2HVKC 2QWOB 3S3WA 5EBLC 4DR5O 2XAGA 3CWBH 4X1IB 2BSKB 1OCZC 4K8XA 1H8EG 2XAHA 5KHHA 5CA0A 1V9PA 2UUAB 1MZFA 3I56V 2Q0OC 2WWWA 1VF5B 4I0XA 4JI5O 5CBGA 2EILB 1NTZH 3ZRSA 1SF9A 4J7ZA 2FKXA 1N34B 1N8RW 2DYRB 1MA1A 2ARHA 2WLHA 1Q6UA 4W4LA 1YIJV 2F95B 4J11A 1P84F 1GMGA 3RW0A 3CCVV 4X8AA 1NQTA 2UUCO 3TETA 4JYBA 2YS8A 3W7UA 4G28B 3JAKB 4RAIA 4DV7B 4DR3B 2WPDG 1N0NA 2JEUA 3QO5A 2Z0AA 4XDLA 1B04A 4O4HB 3OEEG 2QM8A 5EIBC 1AJNA 2IBZH 4X1YB 4X62B 3DXRA 1JMKC 3ZMZA 4AI8A 4R7CA 3SJBC 1HNXO 2NN4A 3ABLC 4CC6A 4FFBB 3FYEB 4PHZA 3E8GA 1N33B 5K1XA 2QR4A 4AQYO 1GM7A 1Q3EA 2WLLA 1BQ0A 2QDOA 4O4IB 2RJZA 4IYHA 1XL6A 3O65A 2F43G 1OJHA 1Q82W 3ZHRA 3SJAC 2EIJB 5B1OA 2QWQB 1SZTA 5B1BB 5IYZA 2QA4V 1MZEA 1TGOA 2Q8VA 4K0KO 1OCOB 1JVMA 4YJ3A 1SZXA 1VQ7V 1FPOA 2GV9A 4U3FH 4JI3O 2LFRA 2F4VO 4GZRB 4UCVA 1KC8W 4JF3A 1S0VA 4J7JA 3OR6C 4IT5A 4MSWC 4LFBO 3HKCA 5IJ0A 1GRJA 1QHTA 3H1HH 4JTAB 5JJNB 3TGUH 4IL6Z 1AB3A 1JA8A 1H2LA 2BTOA 5LHIA 4CH6A 5D5PA 4B3SB 1EN5A 3SPIA 2P22C 5BMVA 4DW1A 1QR9A 4H37A 2JK5C 2H94A 2Y69C 4I4TB 1HP8A 4P9OA 4CS3A 3ABMC 3D3IA 5GTIZ 5LGNA 4OXSA 2QTOA 1PP9H 3K57A 4TV8A 2ZDIC 2UU9O 1H8HG 2QKCA 2X6CA 4OGQB 4KUMA 1NKDA 2A7WA 1MABG 1YZBA 3E86A 4DV1O 2DW4A 1K9MW 2W6IG 1MNGA 3GWKC 4WBNB 5FNVA 2XASA 4NYKA 3UO3A 4FM0A 1S76D 5CBHA 2VQEB 4LWSB 1SKVA 1DTOA 1VQ5V 2R9RB 4DR2B 2CH7A 3VQWA 1XMQO 2AXTZ 2A06H 2QE7G 1N4CA 1PD3A 4OPHA 2DMXA 3ZHUA 3W7WA 4JTCB 3RBZA 5LMUB 1SA0B 2JGDB 1G4YB 4H44B 4YXWG 2ADPA
chains in the Genus database with same CATH topology
4BW5A 4JTDB 1VQMV 1YTFC 3CCMV 1NR7A 3G4SV 4ASUG 3SYPA 1NVPB 3ABKB 5IYCO 2WLIA 3K04A 3CC2V 2ZDIA 3ML0A 1AI5A 3MHHC 5IY5B 1AROP 4PDLA 2OTLV 4WFAV 2ZXWC 3VBBA 4WF9V 1Q7YW 3SJQC 1F4MA 4PA9A 3JD1A 4MVMA 1YJNV 1SETA 5LGUA 3A0RA 4KFMA 1FS0G 3OR7C 3ZRWB 5EBMC 1I5XA 1R3IC 1XL4A 1RPOA 1E1QG 1COWG 1AR1B 2X6AA 1VQLV 3E83A 3HB3B 3ZCCA 3AG2C 3ZMTA 2EIMC 4DXWA 4TT3G 1QVFU 3W7XA 4PA3A 5LHGA 5CMUA 3E89A 4ZKIA 4U7OA 1K33A 4MW3A 2CK3G 1GO3F 3FB6C 4UXNA 3T4DA 2XAFA 1VQOV 5L3CA 5LGTA 3ZRVA 1PNLA 3AG3C 1BL8A 2DYRC 2DYSC 3I55V 5FL7G 3FKSG 3T4ZA 1YTFB 3GB7C 3LNMB 2JIZG 4BIUA 1K7DA 1ZWIC 1QLNA 2W0FC 4XBFA 2WLJA 5CN0A 1PNMA 5BZBA 4WFBV 3CC4V 4TWKA 3SYOA 1KD1W 4UVAA 1EFRG 2V1DA 2P90A 4KP4A 4MVUA 3ZJZA 3ZMSA 1VQ6V 4I9WA 3G6EV 4E2LA 1NH2D 4X88A 3IGAC 4RQEA 2PI4A 4P9PA 4PDRA 3ABUA 4RUEA 4GX0A 4N23A 4PELA 3K79A 2ITDC 1R6NA 2GSMB 4R50A 2IJIA 3ABTA 2IJJA 3B8NA 4GCZA 3IC7A 1Q86W 1R3LC 4CZZA 1MOFA 3H01A 2WSSG 2BOCC 2DQ0A 4QE9A 5L3EA 3G71V 3SPHA 3STLC 4WFHA 4Z1MG 3OAAG 2EIMB 1NBMG 3ETDA 1VQ9V 1VQ8V 4MTXA 3HPLC 1W0KG 3JD0A 2Q6AA 3RVZA 3PJSK 5KUMA 2IH3C 3E8HA 3K06A 2EZPA 2X7RB 2M7WA 1L1FA 5LBQA 4FMTA 1OCCC 3FYIB 2JEXA 1J95A 2IU3A 3AG3B 2W6JG 4RUFA 2EZOA 3CP1A 3IFXA 1KECA 2DYSB 3OUSA 4HAMA 4UVCA 1JOYA 2EIJC 4P30A 1NR1A 1BHBA 3EFFK 3CC7V 1M90W 2HG5C 2Q69A 3LDEA 4LBEC 1VQPV 3DTUB 4FJCC 3CYOA 3ASNB 2UXNA 1OCOC 2Y69B 5H6RA 3MD0A 4JAVA 3UKMA 3K0DA 2P6JA 2FTKA 3QNEA 4G2KA 1M57B 4WFGA 4XDJA 5HFMA 2Z3YA 2Y48A 3UM7A 4CBCA 1K92A 3SYAA 3AG1C 3ZIAG 2WLIB 1M1KW 4QPJA 3AG4C 3ASOC 4J9ZB 4LC1A 2V7QG 1P4RA 1QR8A 1I5YA 1P7BA 3CXCU 1H2GA 1HWYA 1Y4MA 2B1IA 4MTOA 1FXKC 1NVPD 3CCEV 5L3GA 1QCEA 1JX9A 1FXVA 4PA6A 2IH1C 1YSCA 4QE7A 2IU0A 2NNUA 3F5WC 5KUKA 1MSWD 2R9IA 1RPRA 5L3DA 3STZC 3BY6A 3W7SA 1G8MA 1ENVA 1OCCB 1JQ0A 3OE7G 5KA6A 3FB7C 4LCUC 3T2MA 3EHBB 1THZA 4L87A 2AHZA 2OT5A 1NH2C 4MVQA 5B3SC 3OGCC 3SPJA 4FIPC 2A0LA 3TCUA 3CCQV 2HJFC 1M56C 4QNHB 3FB8C 3K03A 2HR3A 4HZ3A 5LHHA 1OHHG 3OMNB 3ZN0A 2EBOA 3VOUA 1GK9A 3E35A 1Q81W 2QKSA 3JD2A 3MHSC 2PI5A 3SPCA 5EC1C 2Q67A 2EILC 1MG1A 5KA5A 1WPXA 3E8BA 5EC2C 1H38A 4FPPA 1R3KC 4I5SA 3SYCA 3WG7C 1GM9A 2K1EA 1CP9A 2B5UA 3AG1B 3OMAB 1K4CC 4PA7A 2B1GA 3CCSV 1AI4A 3AG4B 3OM3B 4PDVA 1FFTB 1R3JC 1V55C 3K08A 4HYOA 4MVOA 1VQNV 1DF5A 2MK3A 1RM1C 3CMEV 1KQSU 1YTFD 1K97A 3QO7A 3LUTB 1GTOA 1FXKB 2HVKC 3OMIB 5EBLC 2XAGA 2YSUB 3P32A 4UV8A 2GHYA 2XAJA 2ZXWB 2EJRA 5EK0A 1FXKA 3X2QC 1OCZC 1F23A 2EIKC 2QM7A 2KB1A 1H8EG 4U7NA 2XAHA 1NH2B 5DN6G 1KP3A 5B3SB 4WCEV 1W2BU 1QLEC 1M9NA 1YI2V 1M56B 4QJFB 4JAUA 3I56V 2H8PC 2HFEC 2WWWA 3AG2B 5CA3A 2LP7A 1K4DC 3ETEA 5CBGA 3ETGA 3AEIA 5DM6V 4F4LA 2EILB 4MW8A 3ZRSA 3WG7B 1K73W 2ITCC 1N8RW 2DYRB 5H9CA 1NVPC 2WLHA 4PDMA 3BEHA 1V55B 1YIJV 1GKFA 5B1BC 2A9HA 3FB5C 1SRYA 1QVGU 4MVRA 5C93A 1GMGA 2HVJC 2A79B 3RW0A 3CCVV 3CPWU 1Y66A 4X8AA 1NQTA 3TETA 1YJWV 1DF4A 1R6KA 4JYBA 1PNKA 3W7UA 4G28B 4RAIA 1S72V 2WPDG 2JEUA 3QO5A 3E8FA 4GT1A 4XDLA 3X2QB 2EINC 2YEVA 1KKDA 3F7VC 1OCZB 3OEEG 2QM8A 3LSSA 4N21A 2EIKB 2ATKC 3ZMUA 4MTGA 3JD3A 1AJNA 5HFLA 3ZMZA 1ROPA 1BMFG 4R8CA 4MVSA 1SERA 1QLEB 3K9AA 1UJWB 1R73A 4R7CA 3ABLC 1CEZA 2IJKA 2WLLB 3FYEB 3E8GA 1LNQA 1VQ4V 3ZMVA 2JJ1G 1K5QA 3RVYA 3LDCA 3CCLV 3NXSA 4X89A 1GM7A 4DO2A 3ZN1A 1AI6A 2WLLA 5L3FA 1YJ9V 2WLKA 1K8AW 1K3EA 5B1NA 3SYQA 1DLBA 1XL6A 4BIZA 4R6ZA 4TSFG 2F43G 1Q82W 3W7TA 4BAYA 3M99B 2NLJC 3JYCA 1E1RG 2EIJB 1E79G 4WFFA 5L3BA 5B1OA 1PL0A 1SZTA 4H33A 5B1BB 2BOBC 4XDKA 2QA4V 1OCRC 2IW5A 1YHQV 2X6BA 1OCOB 4UVBA 3JD4A 1JVMA 1OZ0A 2XOKG 2JJ2G 2ZQMA 3B8MA 4RO2A 1VQ7V 1S77D 2LFRA 2QEXV 3GWOA 2EINB 5GW7A 3R65A 4JPRA 1KC8W 1S5HC 4JF3A 1S0VA 3CCJV 3OR6C 4MSWC 2OCCC 2X0LA 1K34A 2DWEC 4UV9A 3ASOB 1F51A 2LFSA 3ZRWA 3OW2U 3CMAV 3ABLB 4JTAB 4GX1A 1JPXA 4ZBMA 5LHIA 4UUJC 2P67A 1IXMA 3T1CA 3CCUV 1PKXA 1EBOA 1EZJA 4P2ZA 1BHAA 4MS2A 3K0GA 3SPIA 1S3JA 4Q20A 4LP8A 1JCHA 1QR9A 5B1AC 3LDDA 4H37A 2JK5C 2WLNA 3JCZA 2JDIG 4QIWF 2AHYA 1AI7A 2H94A 3ASNC 5E1AC 1OCRB 2Y69C 4FK5C 4JASA 2ZR2A 4P9OA 1AJPA 2WAMA 3ABMC 3ZRXA 3E2EA 3D3IA 1V54C 2P7TC 5LGNA 5IDJA 1M57C 3SPGA 1SESA 1VQKV 1KP2A 2XNDG 3OFNG 2OTJV 4OXSA 5EBWC 2QTOA 3OUFA 2ZDIC 2HKOA 3D36A 1H8HG 2OCCB 2UXXA 2X6CA 4PA4A 1F4NA 3B77A 4KUMA 1NKDA 2Z5UA 3TK1A 1WLEA 3WFVA 3ABKC 4MT8A 1MABG 4EKWA 3E86A 1TUEB 2DW4A 1K9MW 1AJQA 1RM1B 2W6IG 2XAQA 3F7YC 2XASA 5IY5C 4WFEA 3OEHG 3DGEA 2YEVB 2HLDG 4MTFA 5CBFA 2D3OW 1K5SA 5IYBO 3CD6V 1GM8A 1S76D 4JGSA 5IYDO 1FXHA 1NJIW 5CBHA 3K3WA 2C2AA 4QPKA 4RQFA 1DTOA 1CPYA 2Q68A 1W0JG 5H6QA 5B1AB 4GX5A 1YITV 3CCRV 1QBZA 4GX2A 1VQ5V 3KG2A 2R9RB 2IJHA 2ZR3A 3P30A 2WLMA 2QE7G 1B6QA 1ORQC 2ZD9A 3ABMB 1PD3A 4JYCA 1V54B 3W7WA 4JTCB 3RBZA 2DWDC 5J9PC 4G27B 3QO8A 4J9YB 2DQ3A 4MVZA 1G4YB 4YXWG 3LSQA 1JJ2U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NH2 C;  5IYB O;  5IYC O;  1NH2 D;  1NVP D;  1YTF C;  1RM1 C;  5IYD O;  1RM1 B;  1NVP C;  1YTF D; 
#chains in the Genus database with same CATH topology
 4O2B B;  2LW7 A;  1NTM H;  4JTD B;  3CRM A;  1AVM A;  4DV2 O;  1TA8 A;  1NVP B;  2Y4T A;  3ABK B;  2NR5 A;  3OTO B;  4GUN A;  5IY5 B;  4LF4 B;  2ZNJ A;  3VBB A;  1ZSP A;  3JD1 A;  1YJN V;  3JAT A;  3HKC B;  3A0R A;  1J5E O;  3CRQ A;  2PZS A;  5EBM C;  2L35 A;  1YDX A;  3ICX A;  1RPO A;  3FX7 A;  2X6A A;  3HB3 B;  3AG2 C;  5H2F Z;  1HR0 B;  2DN9 A;  5FPR A;  2Q73 A;  2B9Z A;  4PA3 A;  2VWK A;  4D7S A;  5LHG A;  2HJD A;  3E89 A;  4ZKI A;  2OIG A;  4KHP O;  1BS3 A;  5LP6 A;  1K33 A;  4MW3 A;  5BMV B;  2CK3 G;  4UXN A;  3T4D A;  2GDS A;  3ZRV A;  1XQ8 A;  3F5T A;  1BL8 A;  1YTF B;  2DYS C;  3FKS G;  2BE3 A;  2JIZ G;  4JI2 B;  1ZWI C;  4DR3 O;  5BZB A;  1S5L Z;  3CC4 V;  2PYJ A;  3DC5 A;  4FZ1 A;  4UVA A;  1NU1 H;  1VQ6 V;  4KP4 A;  1FAF A;  1A32 A;  5LXT A;  4X62 O;  4RQE A;  1ZL8 A;  4P9P A;  4RUE A;  4DR7 B;  1VP7 A;  4ZIB A;  4N23 A;  1SC5 B;  1LUV A;  1N33 O;  4R50 A;  3K9S A;  2KG7 A;  3H01 A;  2WSS G;  1LR1 A;  1U97 A;  2QGN A;  3G71 V;  2BTQ A;  1I7F A;  3OAA G;  2EIM B;  4JYA O;  3JD0 A;  3RVZ A;  3ZS8 C;  2AGA A;  3E8H A;  2EZP A;  5KMG B;  1OCC C;  3FYI B;  2JEX A;  4NTX A;  4RUF A;  4HAM A;  4NXN B;  2Q69 A;  4FLU A;  1VQP V;  2ADQ B;  3NR7 A;  2CAZ C;  4DR1 O;  3UKM A;  2UXD B;  4IHJ B;  3J80 N;  1L0L H;  3J7A U;  1AIL A;  5C8Y B;  2QWR B;  4B3S O;  3H1I H;  1EN6 A;  1P4R A;  1Z2G A;  1H2G A;  3RGB A;  2B1I A;  1WB8 A;  4J80 A;  4MTO A;  5JCO C;  2Q0A A;  2R70 A;  5EZY A;  1QCE A;  2IH1 C;  3VQV A;  2NNU A;  1I08 A;  1RPR A;  5L3D A;  1I94 B;  3BY6 A;  1IBL B;  3OE7 G;  2WA3 A;  1P49 A;  2AHZ A;  4GKK B;  4O2A B;  4MVQ A;  4UB6 Z;  4I7Z B;  3BAB A;  4FIP C;  3SPJ A;  1VF6 C;  1Q5O A;  4RWU A;  2CUG A;  1D5A A;  5LP6 B;  2HR3 A;  1OHH G;  3UO2 A;  2EBO A;  1XNQ B;  4OX9 O;  3MHS C;  1YXB A;  2ILM A;  2Q67 A;  1MG1 A;  5KA5 A;  1H38 A;  5EC2 C;  2XHB A;  1R3K C;  1NZ6 A;  2K1E A;  3OMA B;  2ODM A;  1AI4 A;  4TV9 A;  2UXC B;  3UCS C;  3HR0 A;  1RM1 C;  2XUM A;  2AZ2 A;  1RFY A;  3UT5 B;  3RYH A;  2YSU B;  3P32 A;  4UV8 A;  2GHY A;  2UUB B;  2XAJ A;  3CB2 A;  3EXA A;  4UCU A;  1FXK A;  2KG7 B;  3X2Q C;  1XUQ A;  5IWA B;  1F23 A;  3GVM A;  2EIK C;  2BTQ B;  1M4U A;  2CTR A;  4U7N A;  1NH2 B;  5BR8 B;  1KP3 A;  4DYL A;  2BSK A;  4YHH B;  2EUL A;  4HNA A;  3Q4H B;  3ETG A;  3AEI A;  3WG7 B;  3OTO O;  2ITC C;  4FLT A;  1K73 W;  3B09 A;  4LF4 O;  1UPG A;  4DV6 B;  4YIO A;  1D2D A;  5D5Q A;  3RYF B;  5H9C A;  3CX5 F;  1V55 B;  4ZOL A;  4BW9 A;  4MVR A;  2ZE7 A;  2A79 B;  4TUY B;  1Y66 A;  2GUZ B;  1YJW V;  1DF4 A;  1S72 V;  5FPO A;  3E8F A;  1TUB B;  1OCZ B;  4N21 A;  3ZMU A;  5HFL A;  4LH6 A;  1BMF G;  4R8C A;  2UXB O;  4O4H A;  1SER A;  3K9A A;  2HP8 A;  1UJW B;  2RDC A;  1CEZ A;  3RYI B;  4X1Y A;  1K5Q A;  2OWO A;  4X89 A;  4J7K A;  3ZN1 A;  1AI6 A;  3JCU Z;  4IIJ B;  2LW1 A;  5L3F A;  1XHZ A;  3CSX A;  5B1N A;  1AP5 A;  4CS4 A;  4B08 A;  2ZNI A;  4BAY A;  2OCH A;  3M99 B;  3JYC A;  4O4I A;  4F6R A;  1E1R G;  4IGG A;  1E79 G;  3BAA A;  4H33 A;  2Y0I A;  5JQG B;  4XDK A;  1IBM O;  1OCR C;  2IW5 A;  4Z1V A;  3CRR A;  2X6B A;  4UVB A;  3JD4 A;  1S5J A;  4RO2 A;  3D36 C;  1VF7 A;  1N32 B;  3HKD B;  4JPR A;  2R9A A;  4DR6 O;  5KHG A;  3CCJ V;  1KYO F;  4UFZ A;  1WNS A;  2F1M A;  2OCC C;  4GYC B;  2JRI A;  1MSD A;  2X0L A;  3BA8 A;  3ASO B;  1F51 A;  3RYH B;  3OW2 U;  3ABL B;  4JI4 O;  1H2M A;  3JAW B;  4UUJ C;  2P67 A;  4LF5 B;  1IXM A;  3T1C A;  3CCU V;  2QKA A;  1EBO A;  2V4D A;  3K0G A;  4CH5 A;  1XRE A;  5ITZ B;  1L8D A;  2UXD O;  5B1A C;  3CJH B;  2E74 B;  2Q5Z A;  4YIP A;  2JDI G;  1YF2 A;  4HNA B;  1HDJ A;  1D5N A;  1GN2 A;  1AI7 A;  4LNU A;  3UQ8 A;  3ASN C;  2Q4P A;  5E1A C;  2ZR2 A;  3RT3 C;  3C3T A;  4DV5 B;  2YIB D;  5IDJ A;  2HHH B;  5LMN B;  1TAE A;  1VQK V;  4YJ2 B;  1KP2 A;  3OFN G;  4I4T A;  5A2Q N;  4JI1 B;  5JWP A;  4ZOL B;  3OUF A;  3B40 A;  2HKO A;  4PA4 A;  1F4N A;  5KAF Z;  1IDS A;  1I94 O;  3K5M A;  4NB5 A;  1M93 A;  1G1X B;  2YI8 A;  4FFK A;  4GKK O;  3DGE A;  4CH4 A;  2HLD G;  4DR4 B;  5F2V O;  4UCS A;  5CBF A;  2D3O W;  4WBN A;  5IYD O;  1NJI W;  3CEI A;  2D2C B;  1IXB A;  2C2A A;  1XNQ O;  4RQF A;  2LO1 A;  1Y67 A;  1GN4 A;  3CCR V;  4DV3 B;  4LWS A;  1BSM A;  3SGI A;  2IJH A;  1H2K A;  2N04 A;  1B6Q A;  2ZD9 A;  3ABM B;  2DWD C;  5J9P C;  1Z5V A;  4MVZ A;  3QO8 A;  4F6R B;  4B3M B;  4DV4 O;  3AK1 A;  3H9V A;  1NR7 A;  3G4S V;  1SA0 A;  2JGD A;  2K9P A;  4O2B A;  4LFA B;  5IWA O;  3CC2 V;  1Z5W A;  5DED A;  4AHC A;  1ARO P;  4WFA V;  2CTP A;  1Q7Y W;  1F4M A;  3M7M X;  4PA9 A;  4ABM A;  3BPZ A;  1FS0 G;  1I5X A;  4X66 B;  2VQF B;  1AR1 B;  3AK3 A;  4DV6 O;  2YXL A;  4DXW A;  4TT3 G;  3W7X A;  2P5O A;  4JV5 B;  4U7O A;  1L0N H;  1DK1 A;  3FB6 C;  4CC5 A;  4LF8 B;  3CRC A;  1VQO V;  1CXZ B;  3WB0 A;  1OV9 A;  2DYR C;  3I55 V;  3T4Z A;  4LNU B;  3GB7 C;  3LNM B;  4JI0 O;  4BIU A;  4EB6 B;  1PNM A;  4WFB V;  3K59 A;  4TWK A;  3SYO A;  4B3R B;  1EFR G;  2V1D A;  3ZJZ A;  3ZMS A;  2OYQ A;  3B4S A;  3G6E V;  1NH2 D;  4I9Q A;  1PL4 A;  1XI1 A;  1PPJ H;  5LL6 Y;  1W59 A;  2RN9 A;  4LFC B;  2Y0P A;  1R6N A;  5JH7 B;  1IUR A;  2F66 C;  2IJI A;  3ABT A;  5IJ9 B;  2IJJ A;  3B8N A;  3MDS A;  1Q86 W;  1R3L C;  2DQ0 A;  5L3E A;  1RP3 B;  1F7Y A;  1EZV H;  3CE2 A;  4Z1M G;  1NBM G;  3ETD A;  1Q6H A;  4D7T A;  2YIB A;  1W0K G;  1VF6 A;  3HPL C;  4AIL C;  3A8T A;  2IH3 C;  2X7R B;  4FMT A;  5BY1 A;  4TOI A;  3C90 A;  5LYJ B;  1JOY A;  2DYS B;  2EIJ C;  4X64 B;  5KMG A;  1XOU A;  4DUZ O;  3EFF K;  4JI7 O;  1N32 O;  1M90 W;  3LDE A;  3QG5 A;  2YIC A;  4FJC C;  2UXN A;  1OCO C;  3MD0 A;  3ETQ A;  1TVK B;  2P6J A;  4WFG A;  4G2K A;  1M57 B;  1SQP H;  1IBK B;  2Z3Y A;  4TQF A;  3K5N A;  4X1K B;  3AG1 C;  1IZ3 A;  4IHJ A;  1NT2 B;  4I55 A;  3QF7 A;  4LC1 A;  5C8Y A;  3CHX A;  3ZHS A;  4H0L B;  1HWY A;  3L74 H;  4GKJ B;  5L3G A;  3H1K H;  1Y74 A;  3BFR A;  4J10 A;  4QE7 A;  4UCT A;  2IU0 A;  3F5W C;  1MSW D;  2R9I A;  3STZ C;  1G8M A;  2UUA O;  1OCC B;  4W4K A;  1JQ0 A;  4LCU C;  3H1L H;  4DV5 O;  3T2M A;  4D6T H;  4L87 A;  5LMN O;  1I0H A;  5B3S C;  3OGC C;  2H3O A;  2A0L A;  4U3J B;  3CCQ V;  4NXM B;  2HJF C;  1M56 C;  5EIB D;  4QNH B;  4DV0 B;  1O9H A;  3FB8 C;  4O2A A;  1N34 O;  3E35 A;  1N36 B;  3JD2 A;  4DK1 A;  1SQF A;  5EC1 C;  5KHI A;  3HKE B;  4FPP A;  1WB7 A;  4O4L B;  3THO A;  1GM9 A;  2ZM6 B;  1CP9 A;  2B5U A;  4JI8 B;  1ZX3 A;  4DR4 O;  1K4C C;  4E4E A;  4PA7 A;  4LF6 B;  4DV7 O;  3OM3 B;  1R3J C;  1VQN V;  3CME V;  2A3Q A;  3LUT B;  5KAI Z;  4PD4 F;  3OMI B;  2LQT A;  2ZXW B;  4DUY B;  3P3N A;  4O4J A;  2FB5 A;  1YCI A;  4JZ2 A;  5EK0 A;  3UT5 A;  1FYJ A;  3G80 A;  2PY5 A;  1HNW B;  1XBL A;  2QM7 A;  2KB1 A;  4WCE V;  1QLE C;  4GLX A;  4PJ0 Z;  2RNB A;  1M9N A;  1YI2 V;  4B3M O;  4QJF B;  4JAU A;  5CA3 A;  2LP7 A;  5KLV H;  4LFA O;  3J81 N;  4DRX A;  3QTC A;  1BE3 H;  5DM6 V;  2AZ0 A;  1PV0 A;  2KSD A;  3Q4H A;  1XMO B;  3IJ4 A;  1NVP C;  1WJZ A;  4OPA A;  1QVG U;  4FZ0 A;  2ZCE A;  3RYF A;  2Q7E A;  3PN1 A;  2JS5 A;  4X66 O;  3FAV B;  1R6K A;  1PNK A;  2VQF O;  2DE0 X;  4GT1 A;  4I55 B;  4TUY A;  3X2Q B;  2EIN C;  2GUZ A;  2HEP A;  3LSS A;  4FLX A;  5LOV B;  2EIK B;  4J42 A;  4B3T B;  4B7K A;  4MTG A;  2YIA A;  1KB9 F;  1ROP A;  2DJV A;  1UFI A;  1TUB A;  4MVS A;  2W0X A;  1R73 A;  1Y74 B;  1WP8 A;  4UB8 Z;  5J2T B;  3ZMV A;  1VQ4 V;  3RVY A;  3LDC A;  3CCL V;  2PTM A;  3NXS A;  5LA6 B;  4DO2 A;  4ICG A;  3RYI A;  4K35 A;  2VRZ A;  1YJ9 V;  2WLK A;  3T1Y B;  1K3E A;  4UCR A;  3SYQ A;  3N2G B;  4TSF G;  5CB4 B;  4IIJ A;  3W7T A;  3TJT A;  4JI5 B;  3RYC B;  2NLJ C;  3KCX A;  5H5N A;  5L3B A;  5GON A;  4LFC O;  2XTA A;  2WA4 A;  3R66 A;  3ZHQ A;  1H2S B;  1YHQ V;  1OZ0 A;  2XOK G;  5K1P A;  5JQG A;  1T5E A;  1S77 D;  3GWO A;  3ZED A;  1S5H C;  1DGS A;  1SQX H;  3APQ A;  4CS2 A;  2UUC B;  1K34 A;  3BRC A;  3HKD A;  1IX9 A;  1AP6 A;  4C7U A;  3CMA V;  2GBO A;  4A5U B;  4GX1 A;  2VQE O;  1VIB A;  4O4J B;  4CH3 A;  5TIS Z;  4NKG B;  4J41 A;  1EZJ A;  1Y76 A;  1BHA A;  4MS2 A;  2IM9 A;  3JAW A;  4DR2 O;  1S3J A;  1HW7 A;  4Q20 A;  3BA9 A;  4LP8 A;  1IBK O;  3LDD A;  5LMU O;  3JCZ A;  2EX3 A;  5ITZ A;  4QIW F;  1EN4 A;  4KL1 A;  4DRX B;  1OCR B;  4JAS A;  3CJH A;  3ZRX A;  3E2E A;  1V54 C;  1ZAU A;  1ZTE A;  3SPG A;  1SES A;  1US6 A;  2OTJ V;  5E79 Z;  3CXH F;  5EBW C;  4GKJ O;  1R6T A;  2R72 A;  4JI6 B;  1B06 A;  2OCC B;  2YXH A;  4YJ2 A;  2Z5U A;  3WFV A;  1O9G A;  1TUE B;  4DW0 A;  1WPB A;  2XAQ A;  3F7Y C;  3OT7 A;  2JGU A;  4WFE A;  5KHJ A;  3OEH G;  1XNR B;  2FYU H;  4MTF A;  2LGW A;  5GTH Z;  1Q43 A;  1GM8 A;  2PGG A;  1IVS A;  4NXM O;  4JGS A;  1FXH A;  4DV0 O;  1HR0 O;  3LSU A;  1W0J G;  2ZE6 A;  5B1A B;  1QBZ A;  3P3P A;  2ZM6 O;  4JI8 O;  5LP6 C;  5EYP A;  1QNM A;  2WLM A;  4JYC A;  4LF6 O;  4JI2 O;  2Q9L A;  3LSQ A;  2PYL A;  4ZI7 B;  5GON B;  3ZX6 A;  3SDL A;  5IYC O;  4DR7 O;  2RCV A;  2ZDI A;  3ML0 A;  1HNW O;  1AI5 A;  1JJO A;  1SQG A;  2UU9 B;  4WF9 V;  3AG7 A;  4LR3 A;  4MVM A;  2FL4 A;  2ZIM A;  1KKC A;  4KFM A;  1R3I C;  1XL4 A;  4HBN A;  1VQL V;  3E83 A;  3L9D A;  3BVO A;  1XMO O;  1Y76 B;  1QVF U;  5CMU A;  3N27 A;  4NXN O;  4LH7 A;  2JVD A;  1N0J A;  4ZHQ A;  4LF9 B;  2XAF A;  2CTW A;  5L3C A;  1M5I A;  1PNL A;  3AG3 C;  1FFX A;  5FL7 G;  3JAS A;  1Y6X A;  1QLN A;  4H13 B;  2W0F C;  2WLJ A;  5CN0 A;  2QTS A;  2BCC H;  5J2U A;  4MVU A;  5IT9 N;  3G67 A;  4B3T O;  4E2L A;  4X88 A;  4EB6 A;  2OIE A;  4PDR A;  4DV2 B;  5IE9 A;  3JSN A;  1FJG B;  4GX0 A;  2ITD C;  2GSM B;  3IC7 A;  4CZZ A;  2GTA A;  4X9Q A;  3T1Y O;  4QE9 A;  2ZIO A;  4X20 B;  5JH7 A;  1IBL O;  2JS3 A;  4WFH A;  5IJ9 A;  1GH6 A;  1SQQ H;  1YEW A;  1VQ8 V;  1BCC H;  4MTX A;  1J5E B;  4UCO A;  2YXY A;  3PJS K;  1FKA O;  2M7W A;  2GTS A;  1PM9 A;  5LBQ A;  2N74 A;  4TQD A;  4B7E A;  1G6U A;  1J95 A;  2IU3 A;  3L70 H;  3CP1 A;  1KEC A;  2KQX A;  3IC9 A;  3JAR B;  1KMI Z;  1NR1 A;  1BHB A;  5EYP B;  3CC7 V;  2CE4 A;  4KHP B;  1SQB H;  2ZIN A;  4LBE C;  5LYJ A;  3DTU B;  2Y69 B;  2YC0 A;  4JAV A;  3K0D A;  2P4V A;  2UXC O;  3RWR D;  2FTK A;  5HFM A;  4XDJ A;  1NTK H;  4CBC A;  1K92 A;  3IAY A;  2QWN B;  4FLW A;  1TVK A;  1WP7 A;  1M1K W;  2UUB O;  4X65 B;  3AG4 C;  3TXS A;  3ASO C;  4J9Z B;  2Y4U A;  4X1K A;  1QR8 A;  3H1J H;  3CXC U;  2LGQ A;  3WU2 Z;  4PI0 A;  1FXK C;  4YY3 B;  4PA6 A;  5BR8 O;  4Q6G A;  3JAL B;  2ZE5 A;  3L72 H;  3W7S A;  4YHH O;  3WB2 A;  1JFF A;  3FB7 C;  4L8J A;  1THZ A;  4JYA B;  2OT5 A;  1B3Q A;  4K8Z A;  3RN4 A;  3DC6 A;  4JI6 O;  3A0H Z;  4ZHQ B;  3ZN0 A;  3VOU A;  1GK9 A;  1Q81 W;  3DSQ A;  3OGI B;  4U3J A;  2PI5 A;  3SPC A;  3QVN A;  1FFX B;  2EIL C;  2F23 A;  3JAS B;  1SQV H;  4F6E A;  3SYC A;  3AG1 B;  4EFE A;  1XNR O;  4DR1 B;  5J2U B;  2B1G A;  3CCS V;  3HKE A;  4PDV A;  4MVO A;  4O4L A;  4HYO A;  3B2E E;  1Q8I A;  5KX5 A;  1KQS U;  3QO7 A;  1GTO A;  4PV1 B;  1RSO A;  3APO A;  3C3S A;  4KXR A;  5BXZ A;  2EJR A;  5JCO A;  2E5L B;  4NVP A;  5CA0 B;  2YID A;  5DN6 G;  4I0X B;  5B3S B;  5KHK A;  1W2B U;  1WAZ A;  3K5L A;  1M56 B;  3KCY A;  2H8P C;  2HFE C;  3AG2 B;  4FLZ A;  1K4D C;  3ETE A;  1WN7 A;  1H2N A;  2ZT9 B;  4F4L A;  4MW8 A;  1VEW A;  3MAQ A;  1XEQ A;  1ZUQ A;  4OX9 B;  4PDM A;  3BEH A;  1GKF A;  5B1B C;  2A9H A;  3FB5 C;  1SRY A;  2P4K A;  5C93 A;  2HVJ C;  2N05 A;  3CPW U;  4FVM A;  1X4T A;  3DXR B;  2YEV A;  1X59 A;  1KKD A;  3F7V C;  3FAV A;  1HNZ B;  3T1H B;  2ATK C;  3LNN A;  4LF5 O;  1NS1 A;  3JD3 A;  3G6B A;  5DEC A;  4BR6 A;  4LF9 O;  1QLE B;  1Q6I A;  2RQ6 A;  5LOV A;  3L73 H;  2IJK A;  2WLL B;  1LNQ A;  3CS5 A;  2JJ1 G;  1JFF B;  2VS0 A;  4JAA A;  5J2T A;  1K8A W;  3FFQ A;  1DLB A;  4BIZ A;  4R6Z A;  5LA6 A;  5IYZ B;  4LF7 B;  1ZLZ A;  2HHH O;  5JVD A;  5B66 Z;  4WFF A;  1FJG O;  4YJ3 B;  1PL0 A;  3N2G A;  4JI1 O;  5CB4 A;  2BOB C;  2ZE8 A;  3OTF A;  3A0B Z;  3ZHT A;  4BWA A;  1BT8 A;  3RYC A;  2CDY A;  3N2K A;  2PUS A;  2JJ2 G;  2ZQM A;  3B8M A;  3BCC H;  1YVW A;  3KZI Z;  1VMG A;  2QEX V;  2EIN B;  5GW7 A;  3R65 A;  3SR2 C;  5IJ0 B;  5KX5 B;  5JJJ B;  4I50 A;  2DWE C;  1RSO B;  4UV9 A;  4PI2 A;  5CA1 A;  2LFS A;  3ZRW A;  2LJ2 A;  1JPX A;  2E76 B;  4ZBM A;  1KU9 A;  1VAR A;  1PKX A;  4FM1 A;  4P2Z A;  4DV3 O;  2UXB B;  2XT9 A;  2CGN A;  1JCH A;  2WLN A;  2AHY A;  3WB1 A;  3FD9 A;  4FK5 C;  3KKY A;  2VWJ A;  4X65 O;  1AJP A;  2WAM A;  2P7T C;  4TV8 B;  1M57 C;  2XND G;  3BHP A;  1IBM B;  1XIL A;  2QM4 A;  4YY3 O;  3D36 A;  2UXX A;  4K3A A;  5FNV B;  3B77 A;  3TK1 A;  1WLE A;  4NTY A;  3ABK C;  1AR4 A;  4MT8 A;  3SJC C;  3I5D A;  3TXQ A;  4EKW A;  4QGP A;  3L75 H;  1AJQ A;  1RM1 B;  4Z2W A;  4DR6 B;  3O9O A;  5IY5 C;  2YDE A;  2YEV B;  1K5S A;  5IYB O;  3CD6 V;  2KKW A;  1WA8 A;  3D3Q A;  3K3W A;  2AW9 A;  4QPK A;  2CGO A;  4JI4 B;  2PF4 E;  1CPY A;  2Q68 A;  4NR1 A;  5H6Q A;  2CH7 B;  4DR5 B;  4JV5 O;  4GX5 A;  1YIT V;  4LF8 O;  1LUW A;  2P06 A;  4GX2 A;  3KG2 A;  3D8C A;  2ZR3 A;  3P30 A;  1ORQ C;  1V54 B;  3HKB A;  4G27 B;  4J9Y B;  2DQ3 A;  3M8A A;  4B3R O;  3A2F A;  3E22 A;  5JVD B;  5B5E Z;  4BW5 A;  1JJ2 U;  1VQM V;  1YTF C;  4JZG A;  3CCM V;  4ASU G;  3OD4 A;  3SYP A;  2WLI A;  1XHX A;  4ZI7 A;  3K04 A;  3N2K B;  2E5L O;  4JYY A;  3MHH C;  3JAT B;  4DK0 A;  2OTL V;  4PDL A;  2F93 B;  2ZXW C;  3SJQ C;  1SET A;  4I50 B;  3JAM N;  5CA1 B;  2QWP B;  5LGU A;  2FML A;  3OR7 C;  3ZRW B;  2EJ7 A;  2QJ1 A;  2CTQ A;  2G38 A;  1E1Q G;  1COW G;  3ZCC A;  3U11 A;  3ZMT A;  2EIM C;  4X64 O;  2L6L A;  3JSL A;  4IYI A;  1AR5 A;  1GO3 F;  1HNX B;  5LGT A;  1QQC A;  1BQZ A;  4AQY B;  1K7D A;  5LXT B;  4XBF A;  1ZL8 B;  5AG2 A;  1KD1 W;  1HNZ O;  3T1H O;  2P90 A;  1FD9 A;  4I9W A;  2E75 B;  4DV4 B;  1GAX A;  4BIO A;  3IGA C;  2PI4 A;  2ZKO A;  3ABU A;  4EFB A;  2Q7H A;  3L71 H;  3VQX A;  4PEL A;  3K79 A;  1BGY H;  4GCZ A;  4X1I A;  4K0K B;  1MOF A;  2BOC C;  3EVK A;  4FM2 A;  4FLV A;  4JI3 B;  3SPH A;  3STL C;  2F4V B;  1EM1 A;  2YUA A;  4LF7 O;  1WA8 B;  1VQ9 V;  4X20 A;  2Q6A A;  4LFB B;  5KUM A;  3K06 A;  1L1F A;  3VQY A;  2M6Y A;  3ZBH A;  3AG3 B;  2W6J G;  2EZO A;  3IFX A;  3OUS A;  4UVC A;  3S3X A;  1N36 O;  4P30 A;  1KUQ A;  2HG5 C;  5FLX N;  3CYO A;  3HKB B;  3JAR A;  3ASN B;  5H6R A;  4NTW A;  1R1B A;  3E22 B;  4JI0 B;  1JR9 A;  3QNE A;  2Y48 A;  3UM7 A;  3SYA A;  3ZIA G;  2WLI B;  3JAK A;  4QPJ A;  1P7G A;  1GN6 A;  4DUY O;  5EZY B;  2DOS A;  1XDC A;  2V7Q G;  1QU7 A;  1I5Y A;  1P7B A;  2MW2 B;  2Q7G A;  3ZHV A;  1Y4M A;  1GN3 A;  5A9G A;  1NVP D;  2E3C A;  3CCE V;  1JX9 A;  1FXV A;  1YSC A;  4FFB A;  5KUK A;  1NI8 A;  3U0Z A;  2O57 A;  1ENV A;  5JJE B;  5KA6 A;  4DV1 B;  2ETN A;  3JAL A;  1MMM A;  3EHB B;  3K5O A;  3U10 A;  1BZK A;  1NH2 C;  3RFR A;  2QSA A;  3AK2 A;  3TCU A;  1SS3 A;  1KBH A;  4HZ3 A;  3K03 A;  5LHH A;  3OMN B;  1Q90 D;  4EEQ A;  2YI9 A;  2QKS A;  3CRA A;  3K58 A;  4DUZ B;  4JI7 B;  1WPX A;  3E8B A;  1U96 A;  4TV9 B;  4I5S A;  3WG7 C;  2RMK B;  1XMQ B;  3AG4 B;  4FLY A;  1URF A;  1FFT B;  1V55 C;  3K08 A;  1DF5 A;  2MK3 A;  1YTF D;  1K97 A;  1FXK B;  2HVK C;  2QWO B;  3S3W A;  5EBL C;  4DR5 O;  2XAG A;  3CWB H;  4X1I B;  2BSK B;  1OCZ C;  4K8X A;  1H8E G;  2XAH A;  5KHH A;  5CA0 A;  1V9P A;  2UUA B;  1MZF A;  3I56 V;  2Q0O C;  2WWW A;  1VF5 B;  4I0X A;  4JI5 O;  5CBG A;  2EIL B;  1NTZ H;  3ZRS A;  1SF9 A;  4J7Z A;  2FKX A;  1N34 B;  1N8R W;  2DYR B;  1MA1 A;  2ARH A;  2WLH A;  1Q6U A;  4W4L A;  1YIJ V;  2F95 B;  4J11 A;  1P84 F;  1GMG A;  3RW0 A;  3CCV V;  4X8A A;  1NQT A;  2UUC O;  3TET A;  4JYB A;  2YS8 A;  3W7U A;  4G28 B;  3JAK B;  4RAI A;  4DV7 B;  4DR3 B;  2WPD G;  1N0N A;  2JEU A;  3QO5 A;  2Z0A A;  4XDL A;  1B04 A;  4O4H B;  3OEE G;  2QM8 A;  5EIB C;  1AJN A;  2IBZ H;  4X1Y B;  4X62 B;  3DXR A;  1JMK C;  3ZMZ A;  4AI8 A;  4R7C A;  3SJB C;  1HNX O;  2NN4 A;  3ABL C;  4CC6 A;  4FFB B;  3FYE B;  4PHZ A;  3E8G A;  1N33 B;  5K1X A;  2QR4 A;  4AQY O;  1GM7 A;  1Q3E A;  2WLL A;  1BQ0 A;  2QDO A;  4O4I B;  2RJZ A;  4IYH A;  1XL6 A;  3O65 A;  2F43 G;  1OJH A;  1Q82 W;  3ZHR A;  3SJA C;  2EIJ B;  5B1O A;  2QWQ B;  1SZT A;  5B1B B;  5IYZ A;  2QA4 V;  1MZE A;  1TGO A;  2Q8V A;  4K0K O;  1OCO B;  1JVM A;  4YJ3 A;  1SZX A;  1VQ7 V;  1FPO A;  2GV9 A;  4U3F H;  4JI3 O;  2LFR A;  2F4V O;  4GZR B;  4UCV A;  1KC8 W;  4JF3 A;  1S0V A;  4J7J A;  3OR6 C;  4IT5 A;  4MSW C;  4LFB O;  3HKC A;  5IJ0 A;  1GRJ A;  1QHT A;  3H1H H;  4JTA B;  5JJN B;  3TGU H;  4IL6 Z;  1AB3 A;  1JA8 A;  1H2L A;  2BTO A;  5LHI A;  4CH6 A;  5D5P A;  4B3S B;  1EN5 A;  3SPI A;  2P22 C;  5BMV A;  4DW1 A;  1QR9 A;  4H37 A;  2JK5 C;  2H94 A;  2Y69 C;  4I4T B;  1HP8 A;  4P9O A;  4CS3 A;  3ABM C;  3D3I A;  5GTI Z;  5LGN A;  4OXS A;  2QTO A;  1PP9 H;  3K57 A;  4TV8 A;  2ZDI C;  2UU9 O;  1H8H G;  2QKC A;  2X6C A;  4OGQ B;  4KUM A;  1NKD A;  2A7W A;  1MAB G;  1YZB A;  3E86 A;  4DV1 O;  2DW4 A;  1K9M W;  2W6I G;  1MNG A;  3GWK C;  4WBN B;  5FNV A;  2XAS A;  4NYK A;  3UO3 A;  4FM0 A;  1S76 D;  5CBH A;  2VQE B;  4LWS B;  1SKV A;  1DTO A;  1VQ5 V;  2R9R B;  4DR2 B;  2CH7 A;  3VQW A;  1XMQ O;  2AXT Z;  2A06 H;  2QE7 G;  1N4C A;  1PD3 A;  4OPH A;  2DMX A;  3ZHU A;  3W7W A;  4JTC B;  3RBZ A;  5LMU B;  1SA0 B;  2JGD B;  1G4Y B;  4H44 B;  4YXW G;  2ADP A; 
#chains in the Genus database with same CATH homology
 4BW5 A;  4JTD B;  1VQM V;  1YTF C;  3CCM V;  1NR7 A;  3G4S V;  4ASU G;  3SYP A;  1NVP B;  3ABK B;  5IYC O;  2WLI A;  3K04 A;  3CC2 V;  2ZDI A;  3ML0 A;  1AI5 A;  3MHH C;  5IY5 B;  1ARO P;  4PDL A;  2OTL V;  4WFA V;  2ZXW C;  3VBB A;  4WF9 V;  1Q7Y W;  3SJQ C;  1F4M A;  4PA9 A;  3JD1 A;  4MVM A;  1YJN V;  1SET A;  5LGU A;  3A0R A;  4KFM A;  1FS0 G;  3OR7 C;  3ZRW B;  5EBM C;  1I5X A;  1R3I C;  1XL4 A;  1RPO A;  1E1Q G;  1COW G;  1AR1 B;  2X6A A;  1VQL V;  3E83 A;  3HB3 B;  3ZCC A;  3AG2 C;  3ZMT A;  2EIM C;  4DXW A;  4TT3 G;  1QVF U;  3W7X A;  4PA3 A;  5LHG A;  5CMU A;  3E89 A;  4ZKI A;  4U7O A;  1K33 A;  4MW3 A;  2CK3 G;  1GO3 F;  3FB6 C;  4UXN A;  3T4D A;  2XAF A;  1VQO V;  5L3C A;  5LGT A;  3ZRV A;  1PNL A;  3AG3 C;  1BL8 A;  2DYR C;  2DYS C;  3I55 V;  5FL7 G;  3FKS G;  3T4Z A;  1YTF B;  3GB7 C;  3LNM B;  2JIZ G;  4BIU A;  1K7D A;  1ZWI C;  1QLN A;  2W0F C;  4XBF A;  2WLJ A;  5CN0 A;  1PNM A;  5BZB A;  4WFB V;  3CC4 V;  4TWK A;  3SYO A;  1KD1 W;  4UVA A;  1EFR G;  2V1D A;  2P90 A;  4KP4 A;  4MVU A;  3ZJZ A;  3ZMS A;  1VQ6 V;  4I9W A;  3G6E V;  4E2L A;  1NH2 D;  4X88 A;  3IGA C;  4RQE A;  2PI4 A;  4P9P A;  4PDR A;  3ABU A;  4RUE A;  4GX0 A;  4N23 A;  4PEL A;  3K79 A;  2ITD C;  1R6N A;  2GSM B;  4R50 A;  2IJI A;  3ABT A;  2IJJ A;  3B8N A;  4GCZ A;  3IC7 A;  1Q86 W;  1R3L C;  4CZZ A;  1MOF A;  3H01 A;  2WSS G;  2BOC C;  2DQ0 A;  4QE9 A;  5L3E A;  3G71 V;  3SPH A;  3STL C;  4WFH A;  4Z1M G;  3OAA G;  2EIM B;  1NBM G;  3ETD A;  1VQ9 V;  1VQ8 V;  4MTX A;  3HPL C;  1W0K G;  3JD0 A;  2Q6A A;  3RVZ A;  3PJS K;  5KUM A;  2IH3 C;  3E8H A;  3K06 A;  2EZP A;  2X7R B;  2M7W A;  1L1F A;  5LBQ A;  4FMT A;  1OCC C;  3FYI B;  2JEX A;  1J95 A;  2IU3 A;  3AG3 B;  2W6J G;  4RUF A;  2EZO A;  3CP1 A;  3IFX A;  1KEC A;  2DYS B;  3OUS A;  4HAM A;  4UVC A;  1JOY A;  2EIJ C;  4P30 A;  1NR1 A;  1BHB A;  3EFF K;  3CC7 V;  1M90 W;  2HG5 C;  2Q69 A;  3LDE A;  4LBE C;  1VQP V;  3DTU B;  4FJC C;  3CYO A;  3ASN B;  2UXN A;  1OCO C;  2Y69 B;  5H6R A;  3MD0 A;  4JAV A;  3UKM A;  3K0D A;  2P6J A;  2FTK A;  3QNE A;  4G2K A;  1M57 B;  4WFG A;  4XDJ A;  5HFM A;  2Z3Y A;  2Y48 A;  3UM7 A;  4CBC A;  1K92 A;  3SYA A;  3AG1 C;  3ZIA G;  2WLI B;  1M1K W;  4QPJ A;  3AG4 C;  3ASO C;  4J9Z B;  4LC1 A;  2V7Q G;  1P4R A;  1QR8 A;  1I5Y A;  1P7B A;  3CXC U;  1H2G A;  1HWY A;  1Y4M A;  2B1I A;  4MTO A;  1FXK C;  1NVP D;  3CCE V;  5L3G A;  1QCE A;  1JX9 A;  1FXV A;  4PA6 A;  2IH1 C;  1YSC A;  4QE7 A;  2IU0 A;  2NNU A;  3F5W C;  5KUK A;  1MSW D;  2R9I A;  1RPR A;  5L3D A;  3STZ C;  3BY6 A;  3W7S A;  1G8M A;  1ENV A;  1OCC B;  1JQ0 A;  3OE7 G;  5KA6 A;  3FB7 C;  4LCU C;  3T2M A;  3EHB B;  1THZ A;  4L87 A;  2AHZ A;  2OT5 A;  1NH2 C;  4MVQ A;  5B3S C;  3OGC C;  3SPJ A;  4FIP C;  2A0L A;  3TCU A;  3CCQ V;  2HJF C;  1M56 C;  4QNH B;  3FB8 C;  3K03 A;  2HR3 A;  4HZ3 A;  5LHH A;  1OHH G;  3OMN B;  3ZN0 A;  2EBO A;  3VOU A;  1GK9 A;  3E35 A;  1Q81 W;  2QKS A;  3JD2 A;  3MHS C;  2PI5 A;  3SPC A;  5EC1 C;  2Q67 A;  2EIL C;  1MG1 A;  5KA5 A;  1WPX A;  3E8B A;  5EC2 C;  1H38 A;  4FPP A;  1R3K C;  4I5S A;  3SYC A;  3WG7 C;  1GM9 A;  2K1E A;  1CP9 A;  2B5U A;  3AG1 B;  3OMA B;  1K4C C;  4PA7 A;  2B1G A;  3CCS V;  1AI4 A;  3AG4 B;  3OM3 B;  4PDV A;  1FFT B;  1R3J C;  1V55 C;  3K08 A;  4HYO A;  4MVO A;  1VQN V;  1DF5 A;  2MK3 A;  1RM1 C;  3CME V;  1KQS U;  1YTF D;  1K97 A;  3QO7 A;  3LUT B;  1GTO A;  1FXK B;  2HVK C;  3OMI B;  5EBL C;  2XAG A;  2YSU B;  3P32 A;  4UV8 A;  2GHY A;  2XAJ A;  2ZXW B;  2EJR A;  5EK0 A;  1FXK A;  3X2Q C;  1OCZ C;  1F23 A;  2EIK C;  2QM7 A;  2KB1 A;  1H8E G;  4U7N A;  2XAH A;  1NH2 B;  5DN6 G;  1KP3 A;  5B3S B;  4WCE V;  1W2B U;  1QLE C;  1M9N A;  1YI2 V;  1M56 B;  4QJF B;  4JAU A;  3I56 V;  2H8P C;  2HFE C;  2WWW A;  3AG2 B;  5CA3 A;  2LP7 A;  1K4D C;  3ETE A;  5CBG A;  3ETG A;  3AEI A;  5DM6 V;  4F4L A;  2EIL B;  4MW8 A;  3ZRS A;  3WG7 B;  1K73 W;  2ITC C;  1N8R W;  2DYR B;  5H9C A;  1NVP C;  2WLH A;  4PDM A;  3BEH A;  1V55 B;  1YIJ V;  1GKF A;  5B1B C;  2A9H A;  3FB5 C;  1SRY A;  1QVG U;  4MVR A;  5C93 A;  1GMG A;  2HVJ C;  2A79 B;  3RW0 A;  3CCV V;  3CPW U;  1Y66 A;  4X8A A;  1NQT A;  3TET A;  1YJW V;  1DF4 A;  1R6K A;  4JYB A;  1PNK A;  3W7U A;  4G28 B;  4RAI A;  1S72 V;  2WPD G;  2JEU A;  3QO5 A;  3E8F A;  4GT1 A;  4XDL A;  3X2Q B;  2EIN C;  2YEV A;  1KKD A;  3F7V C;  1OCZ B;  3OEE G;  2QM8 A;  3LSS A;  4N21 A;  2EIK B;  2ATK C;  3ZMU A;  4MTG A;  3JD3 A;  1AJN A;  5HFL A;  3ZMZ A;  1ROP A;  1BMF G;  4R8C A;  4MVS A;  1SER A;  1QLE B;  3K9A A;  1UJW B;  1R73 A;  4R7C A;  3ABL C;  1CEZ A;  2IJK A;  2WLL B;  3FYE B;  3E8G A;  1LNQ A;  1VQ4 V;  3ZMV A;  2JJ1 G;  1K5Q A;  3RVY A;  3LDC A;  3CCL V;  3NXS A;  4X89 A;  1GM7 A;  4DO2 A;  3ZN1 A;  1AI6 A;  2WLL A;  5L3F A;  1YJ9 V;  2WLK A;  1K8A W;  1K3E A;  5B1N A;  3SYQ A;  1DLB A;  1XL6 A;  4BIZ A;  4R6Z A;  4TSF G;  2F43 G;  1Q82 W;  3W7T A;  4BAY A;  3M99 B;  2NLJ C;  3JYC A;  1E1R G;  2EIJ B;  1E79 G;  4WFF A;  5L3B A;  5B1O A;  1PL0 A;  1SZT A;  4H33 A;  5B1B B;  2BOB C;  4XDK A;  2QA4 V;  1OCR C;  2IW5 A;  1YHQ V;  2X6B A;  1OCO B;  4UVB A;  3JD4 A;  1JVM A;  1OZ0 A;  2XOK G;  2JJ2 G;  2ZQM A;  3B8M A;  4RO2 A;  1VQ7 V;  1S77 D;  2LFR A;  2QEX V;  3GWO A;  2EIN B;  5GW7 A;  3R65 A;  4JPR A;  1KC8 W;  1S5H C;  4JF3 A;  1S0V A;  3CCJ V;  3OR6 C;  4MSW C;  2OCC C;  2X0L A;  1K34 A;  2DWE C;  4UV9 A;  3ASO B;  1F51 A;  2LFS A;  3ZRW A;  3OW2 U;  3CMA V;  3ABL B;  4JTA B;  4GX1 A;  1JPX A;  4ZBM A;  5LHI A;  4UUJ C;  2P67 A;  1IXM A;  3T1C A;  3CCU V;  1PKX A;  1EBO A;  1EZJ A;  4P2Z A;  1BHA A;  4MS2 A;  3K0G A;  3SPI A;  1S3J A;  4Q20 A;  4LP8 A;  1JCH A;  1QR9 A;  5B1A C;  3LDD A;  4H37 A;  2JK5 C;  2WLN A;  3JCZ A;  2JDI G;  4QIW F;  2AHY A;  1AI7 A;  2H94 A;  3ASN C;  5E1A C;  1OCR B;  2Y69 C;  4FK5 C;  4JAS A;  2ZR2 A;  4P9O A;  1AJP A;  2WAM A;  3ABM C;  3ZRX A;  3E2E A;  3D3I A;  1V54 C;  2P7T C;  5LGN A;  5IDJ A;  1M57 C;  3SPG A;  1SES A;  1VQK V;  1KP2 A;  2XND G;  3OFN G;  2OTJ V;  4OXS A;  5EBW C;  2QTO A;  3OUF A;  2ZDI C;  2HKO A;  3D36 A;  1H8H G;  2OCC B;  2UXX A;  2X6C A;  4PA4 A;  1F4N A;  3B77 A;  4KUM A;  1NKD A;  2Z5U A;  3TK1 A;  1WLE A;  3WFV A;  3ABK C;  4MT8 A;  1MAB G;  4EKW A;  3E86 A;  1TUE B;  2DW4 A;  1K9M W;  1AJQ A;  1RM1 B;  2W6I G;  2XAQ A;  3F7Y C;  2XAS A;  5IY5 C;  4WFE A;  3OEH G;  3DGE A;  2YEV B;  2HLD G;  4MTF A;  5CBF A;  2D3O W;  1K5S A;  5IYB O;  3CD6 V;  1GM8 A;  1S76 D;  4JGS A;  5IYD O;  1FXH A;  1NJI W;  5CBH A;  3K3W A;  2C2A A;  4QPK A;  4RQF A;  1DTO A;  1CPY A;  2Q68 A;  1W0J G;  5H6Q A;  5B1A B;  4GX5 A;  1YIT V;  3CCR V;  1QBZ A;  4GX2 A;  1VQ5 V;  3KG2 A;  2R9R B;  2IJH A;  2ZR3 A;  3P30 A;  2WLM A;  2QE7 G;  1B6Q A;  1ORQ C;  2ZD9 A;  3ABM B;  1PD3 A;  4JYC A;  1V54 B;  3W7W A;  4JTC B;  3RBZ A;  2DWD C;  5J9P C;  4G27 B;  3QO8 A;  4J9Y B;  2DQ3 A;  4MVZ A;  1G4Y B;  4YXW G;  3LSQ A;  1JJ2 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...