1NVUQ

Structural evidence for feedback activation by rasgtp of the ras-specific nucleotide exchange factor sos
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTGGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for feedback activation by RasGTP of the Ras-specific nucleotide exchange factor SOS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Transforming protein p21/H-RAS-1
total genus 60
structure length 166
sequence length 166
chains with identical sequence R
ec nomenclature
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nvuQ00
4CDGA 4XWKA 2XTZA 2YV5A 3ZS9A 2YC2C 4BLQA 2XJ4A 2BKUA 2BMJA 3LXRA 4RY2A 3H4MA 2GZDA 1SQ5A 1SZPA 3D7MA 4BFTA 1KNQA 2B8TA 1JBKA 3BK7A 5KO2A 2C03A 4HDQB 3G0HA 2PEZA 1LVGA 1JXOA 3N2EA 1P6XA 3FB4A 3P26A 4JLBA 4LYHA 4ESHA 2YNMA 3TSZA 4AYTA 1R7RA 2NTYC 1ZNWA 1BOFA 2QQ0A 4CW7A 2ZJ8A 4EPTA 3IQWA 4JKIA 1MT0A 4XIGS 5EE0A 5EZ5A 1E9RA 2GEDA 1GRNA 1Q1EA 1Z0IA 4TL9A 1TMKA 1CP2A 3WHKA 1A2KC 2JAQA 3L8ZA 5BYKA 2GBLA 1MV5A 4LWZA 1E2NA 5G53C 4A8JA 4A8JB 2WKPA 3K0AA 1G5TA 1GL6A 2RGGA 2IUTA 3PEVA 4FN5A 4NYJQ 2Q9AA 5KDOA 5HZKA 1XJ0A 2J59A 4O0MA 4BFZA 3IO5A 2XNDA 3MAAC 3V4FA 5DYIA 1JR3E 2F1JA 1SVKA 1BIFA 1XFAA 4OK6A 2OG2A 1KZGB 3J81k 3Q72A 4JJKA 4YQFA 1OH5A 3AB3A 2N42A 4Q1CA 4HAZA 4V0ME 3EIQA 1OHHD 4XTCS 1U0HC 4BFVA 1DELA 1TF5A 4NCHA 2QMOA 2G3YA 1J7KA 4PFSA 3QXXA 1N6KA 5LB2A 1N0WA 2ZI4A 4JL8A 2ZYVX 1VG8A 1W0JD 3PUWA 1Z22A 4GPTA 2H1LA 2EFGA 4B75A 1G291 3UWKA 4IEEA 1QHGA 2PCLA 1GKIA 4DC9A 2GCPA 3KTAB 1AN0A 4F7WA 1MO4A 2GXQA 2PMKA 2QT0A 2PH1A 1OW3B 1JXMA 4ZCMA 1NMZA 3U7GA 4GL2A 3NDBB 2HV8A 1LNZA 2CK3D 1RRPA 2LCFA 3KJIA 2VSFA 3AQ4A 3VU9B 5C18A 2ZITA 3IIJA 2FEOA 2J5XA 4KHZA 1EFHA 2A5FA 3A1VA 1E79A 3DOFA 1P9WA 4M1SA 1KAOA 4DIEA 3WMEA 1KAGA 2QEQA 4LHWA 2Z5FA 1OH8A 1L8QA 2YWEA 2ZVQX 1TL7C 3FKQA 3PXGA 2NO9A 3SE0A 3CNLA 8OHMA 4M1TA 4GFDA 1G18A 3GLIA 1E0AA 3F3YA 2X8AA 2I4IA 2OAQ1 2DWPA 4LJYA 3VR4A 2FFAA 4BWYA 1NLYA 1JAIA 1R10A 3A1SA 4IEIA 4Q4HB 3T35A 4AKHA 5CLQA 3B82A 1MO6A 4G5SA 4JYCA 4KLNA 2GAAA 1G1MA 1E2QA 4FINA 5TY0A 3P1JA 3ICEA 2ZM5A 1P5ZB 2JLSA 3KQUA 1E4VA 4LCBA 3AF4A 4MDEA 4ILEA 4EQ6B 1ZP6A 3TUZC 3W8NA 3NBFA 3KQLA 3R20A 2FU5C 2XZLA 2J41A 1J99A 4E07A 5DSZA 3NVAA 5EUQB 1A4RA 2IYYA 1EFUA 1N6RA 4FCTA 4P32A 1XEWY 4DLXA 3SU8A 4US1R 1XD2A 2YYZA 1E4YA 1QVAA 2QAGB 3RS2A 4XVUA 1TF7A 1FMLA 4BEBA 1NN3A 1KJWA 1SXJD 4S2EA 2P2LA 4DZZA 1KI3A 2F1HA 4FCVA 2EU8A 3NBYC 1R5NA 2RGNA 3LW7A 4IVQA 4WVFA 4OHWA 2IYRA 4OQFA 1N6HA 2Z4SA 4ESVA 1QHSA 1CJVC 3DHWC 5KUTA 2FSGA 4XTRA 2IYUA 3JVUA 4Q02A 2JJ1A 3UPUA 2WSSD 2HUPA 3C5HA 2R2AA 3A6PC 1QHHB 2HYIC 2W6JD 2WHXA 3RS3A 3IBYA 1KO1A 3FFBA 2MSDB 4LSGA 1BMFD 1IBRA 2KJQA 1XJQA 2WMOB 1YE8A 2IF0A 4UNRA 3GPLA 4G0NA 4N0EA 2H5EA 4L5BA 4KBGA 3VU9A 4NH0A 2FJUA 4PHFA 4C0BA 4CVNA 1TQ4A 2TMKA 3VFDA 1JEDA 1UADA 1P60A 2ZIAA 5AJYA 4IFBA 1U0JA 2GEVA 2HF8A 3U3OA 1AGPA 1Z3IX 4MITA 4TYQA 1I2DA 1JR3D 3WBKA 3CRVA 3FOZA 4OI0A 1ZD9A 3OFND 1C9KA 1N6NA 1GSIA 2EFDB 1VHLA 5FH9A 3U6KA 1S1CA 4D0NA 3IHLA 2RKOA 3TNFA 1BYUA 2QE7D 2QL6A 4BZXA 4D4MA 3LVQE 3ZVLA 3SR0A 3C14C 2CE7A 4C3ZA 1E2DA 1IAQA 2XSZD 3B9QA 5TMPA 4O2RA 1F2UB 4R7ZA 5AJVB 1G16A 1NSTA 4KAXA 5KPDA 2O8EB 3RRYA 2IYWA 1IXSB 4PC1A 2RGBA 3FWYA 2X19A 3MSXA 4CYMA 1GRRA 3VR3A 3VR5A 1N0VC 2ZSFA 521PA 5FR2A 2EYUA 4TN1A 1PLJA 3CRW1 2W6JA 4IOMA 5AUQA 1WP9A 2NZ8A 3EZ7A 2JIZD 2JLXA 2Q3MA 1QHHA 3OEHA 4QBFA 1G17A 2W58A 2OEPA 1J2JA 2PEYA 2ZE5A 3QF7A 4L9WA 5AUNB 1Z07A 4Q1FA 1A2BA 1LV7A 1XEFA 5E4FA 4A0FA 1WQ1R 2G0TA 1G8YA 3RS7A 2UZIR 4IVPA 4H1VA 4Q47A 1IM2A 4YLGA 2VTKA 2ZJBA 1S1MA 1KY2A 1SVSA 3GFTA 5K8LA 3M6AA 5EP2A 2OZEA 2MMGA 1B0UA 4B74A 3PITA 1E2KA 3AGPA 1ELOA 3PR1A 4A0RA 2QENA 1GM5A 3U2QA 4H1UA 3LW8A 2YHSA 1DO0A 3QKSA 2VHQA 2QE7A 1HH4A 1U99A 3UG6A 4DCVA 2GWHA 1JPJA 2QSZA 3FHCB 1XTSA 5EXXA 4DB2A 4M9SA 3VQTA 4PC3A 4KFRA 3QY0A 2C78A 1T3HA 2JASA 3WBJA 4D4LA 3E5HA 3T1TA 4O3MA 3IKJA 2F3TA 4LC0A 4V0OA 1CJUC 3HR7A 4WAUA 4GOJA 3LLMA 2QTFA 3RABA 1OPXA 1KK1A 1LS1A 2G1JA 4A0HA 3GLIB 2QAJA 1U94A 2GHIA 1S3GA 5FTMA 3TLXA 1QHXA 4NTZA 2I3BA 4RJLA 3KFXA 1CR4A 1NBMA 1TNDA 2ZJOA 1JPNA 4GZMA 4PC6A 2QMEA 4LJ4A 4Q01A 5CLLA 4TT3A 4F38A 3WNBA 1FOEB 1GG2A 4I1SA 5FTKA 4A6PA 1WF3A 2VO1A 1ZINA 2W6IA 3AVPA 3ECCA 1NVXQ 1S9HA 2GXSA 4OI2A 4WXPA 5H70A 2C77A 5E7IA 1NN5A 4Q4JA 3PEWA 5J4KA 2HT1A 2QORA 2ZRCA 4IRUB 4AKGA 3KKPA 3FKSA 2EVWX 4HAVA 3THYA 2CHQA 4BLSA 1U9IA 4P4SA 4Q03A 4CEJB 3AUYA 1W47A 1AGRA 2VA8A 3NBXX 2FF7A 3CW2A 2WJJA 4RCYA 4LDJA 1S2MA 1VDZA 5KHOC 4LHXA 1E2HA 2KB0A 2NO6A 1NLFA 2GJ9A 2LWIA 1KI1A 2GZAA 3IGFA 5DLQC 1MKYA 4RZ3A 1YR7A 3X1YA 2QPTA 2NOAA 3QXHA 621PA 3KQNA 5JJIA 1GZSA 4URYR 3ZZ0A 3FKSD 2WAYA 3GLHB 5HPYB 4UQOA 3L8YA 3GD7A 3CR7A 5FI1B 3RS5A 4EPRA 4RSGA 2ZJ5A 1M34E 1FUKA 2ZJZA 3DDCA 4ZCIA 4URXR 4JKYA 1NJGA 5FUXA 4EFLA 1HTWA 1Z0JA 3B1VA 1KI2A 1Q44A 2CLSA 2QBYA 3ZJYA 2PBRA 3ETLA 821PA 1NVUQ 4EPVA 3I32A 4LJAA 1E1RD 1E69A 3UANA 2D7CA 1P73A 2QZ4A 5CB6A 1E0JA 4DT1A 1D2NA 2BKEA 2ZRHA 5FUVA 4OK3A 2Z83A 3U3KA 1UKEA 3ND9A 3UMFA 1JQJC 2VSXA 2IXGA 4RD3A 2O8DB 2RGAA 3THWA 2V54A 1T5LA 1GKYA 3WMGA 4A2WA 4Z54A 3LBIA 2HF9A 2HXYA 4DEXA 2O5VA 2YOFA 1MO5A 1Z08A 3O8CA 1KDTA 2YVUA 2BM0A 3LH5A 3L0OA 4Q9JA 5FTLA 1QVRA 3GEHA 3AF1A 3W6NA 3IHWA 3AP1A 3BOSA 2FSHA 4AC9A 1GP2A 3R9IA 1DPFA 4C0JA 4US0R 5BQ5A 1UKZA 1OKKD 3GFPA 2XXAB 1T91A 2D2FA 5JEEA 2ZRNA 4LYJA 5GJVC 2CXXA 1KY3A 2ODWA 2WSMA 4NYMQ 1HYQA 1XJCA 2CLDX 2WJVA 3GJ0A 1UDXA 2GXUA 3HP1A 3TK1A 5IHPA 4BZPA 3FHOA 4TSFD 2C2HA 2V4ZA 4II7A 1UBEA 2QGZA 1L2TA 3LQQA 4GMXA 1OH6A 3Q9LA 2EYQA 5DN6A 2AKAB 3P4XA 2GJKA 4PSKA 4Z8XA 4C2UA 2IWRA 3HPRA 1OKKA 1E1QA 2QPOA 1D2EA 4NHOA 1E1RA 4QHYA 1G19A 3MWLA 4WXRA 2WICA 1TADA 4DLUA 2FSFA 3NIBA 1VCIA 2VP9A 4MGIR 2IF2A 3GJ8A 5CK5A 4TSFA 3SS8A 2AKYA 4UXJA 1AZSC 1JAHA 1JB1A 4MYTA 1ZD8A 3NXSA 2J7KA 3X2SA 3ZH9B 4D2IA 5F3WB 1G9XA 4BEJA 4P4UA 4XWAA 1NIJA 3QPVA 2A5GA 4D80A 3ADBA 2QP4A 3CONA 2JLVA 4TLBA 3ADCA 221PA 2OAP1 4XSGA 3QKSB 4YMWA 4L4UA 4PHTA 3LO5A 1GNPA 2AX4A 3NEYA 1EFCA 1QBKC 1HE8B 1EGAA 5SZIA 1WRBA 2VH5R 3GLHE 4OQXA 3CF6R 1FZQA 4QKQA 4M2LA 3H0KA 5HCIA 4F92B 4Q66C 4G5OA 1W36C 1Z6AA 2OCPA 5EE9A 4EJSC 1SXJB 2FZLA 2G1KA 2ZJAA 1CU1A 4ZI3A 4WZBE 1NKTA 4R98A 1P9RA 3P32A 2PX3A 2VEDA 4HLUA 1WCV1 2H16A 5JS8A 1TU3A 4XOIA 5CIWA 3GLGA 5E3HA 1DBSA 3MJRA 2Q9BA 5M04A 1XPRA 4D25A 5JJKA 3K53A 4FMDF 4P31A 4RD2A 3UMRA 1R4AA 4B3FX 1UKYA 1T5IA 3E70C 4CF7A 2RH5A 1XTQA 3RC3A 1W46A 4TLDA 2WV9A 5KPJA 2D74A 2AD1A 2XX3A 5FPYA 3FGNA 4PZYA 2WKRA 3QJYA 2ZRKA 2JLYA 3GJXC 4Q21A 2OT3B 3I5YA 1LW7A 4CGZA 3U4QA 3W90A 2NQ2C 4MRVA 3OAAD 5EXSA 1ZU5A 4DCNA 1KSJA 4HUQA 1EK0A 4UXIA 4DSOA 2AHOA 4ZKDA 3OE7A 2J46A 3PEYA 4JJZA 4LI0A 3FFAA 1U98A 5A0FA 4PPNA 1BMFA 3OIWA 4EPWA 2GXAA 3KDSE 5B2ZA 3BIFA 4HSEA 1G3QA 1XXHB 4IOLA 4NE2A 4HAWA 1UAAA 5SZJA 3SBDA 4DSTA 1TU4A 1UFQA 1XEWX 1J8MF 1NLZA 4BFSA 1Z0FA 3V4RA 5CJ2A 3HDTA 2VBCA 2F43B 2VLIA 3AKCA 1UPTA 3DKPA 3OFNA 2WPDD 4A15A 3N70A 1R2QA 1HT2E 1VYUA 3AVOA 1CR1A 4ZV4A 1II8B 4CRWB 1XTJA 3U4QB 3CBQA 1S8FA 4GBMA 2OESA 5D3QA 4QHTA 4B33A 2H92A 2EFCB 3NDPA 3B1WA 1ZCBA 4Z1MA 5HKKD 2ORVA 4LY6A 3ZD7A 4P3YA 2XB4A 3N5CA 2CHGA 5K8UA 1JEEA 3SN6A 2VHCA 3FPAA 3NBZC 4V0KA 2GESA 2FN4A 2Q6TA 3KKMA 4I1UA 4B48A 1Z28A 5G41A 2ZU0C 1OF1A 1TQ6A 3THWB 2PLFA 4Q4LA 4KITB 4NP6A 1RRCA 1NIPA 1V43A 3JZMA 4W5WA 5CDFA 3H86A 2F9LA 3B1YA 2WBLC 1SGWA 4V03A 1XCPA 4QBHA 4S35A 5KSYA 5L3SA 3AVWA 1SXJA 3AVXA 2EWVA 4Q1BA 3ZZTA 5K8TA 1OHHA 1ANKA 4P4SB 4JLMA 1IJFA 3AVQA 1IOZA 1N25A 1G8HA 2BEJA 3BH7A 2JEOA 2P6NA 3L0PA 4PZLA 3THXB 2CMKA 4DEYA 1P61B 4KVGA 1HE1C 5C46F 5DHAA 4WIAA 1PLLA 4HB3A 1W49A 421PA 3LBNA 4M1KA 1CBUA 3EZFA 4BECA 2A5JA 4M8NE 5EUMA 5G40A 1Q12A 4K81B 1X1SA 1SULA 3RLFA 1U8YA 5SZHB 1E9CA 2ZI5A 5DIFA 1XEXA 2CK3A 2P5TB 3AUXA 4DB4A 5FOSA 1ZD1A 3NEJA 4AIIA 4QM6A 2HCBA 2IYSA 1N5IA 4C0AC 1KKLA 1XTKA 4URVR 4Z51A 4C0LA 1OH7A 2ANCA 3LWNA 2CNWA 2W0SA 1SVLA 4JBYA 3TKLA 4B6EA 5JSZA 2KBFA 3ASZA 2QM7A 1JR3A 5P21A 4ZCLA 4URZR 1H8EA 1P2TA 1ZRHA 4M9XA 3AGQA 1KO8A 2IL1A 3QXJA 3CPEA 3SYNA 2BBWA 3BC1A 5J4VA 3EC2A 4BQSA 4UNNA 1LB1B 2WZQA 1ZVQA 4U7DA 2ZRDA 4HB0A 2MSCB 3WRXC 1E2PA 2ZREA 1FL9A 2B8WA 1QDEA 4FMDB 4JL6A 3A1UA 3FMPB 3W3ZB 4B2LA 2IT1A 2K5UA 3LRPA 4DSUA 1XPOA 1P72A 3T5DA 4JLJA 1FNNA 5EJEA 1YZQA 1XEXB 2Q0HA 4PAQA 4R9UC 2XNDD 3BGWA 2HCJB 2AR7A 4DCTA 3GJ7A 1ESNA 1Y63A 2WWHA 5FI0B 5J4LA 4N0DA 2JA1A 3EA5A 2PT7A 4JT4A 3OIYA 3ZLJA 1TEVA 3CNOA 3K09A 3B85A 5JWOA 2H18A 3TE6A 1HV8A 1HQYE 3JZAA 5D3MB 4ZDIA 4Q5IA 1KJYA 3B5JA 4NL4H 2RGDA 1CRQA 4C4PA 5ANRB 2WOOA 3LQRA 1R5OA 2I1VB 1W0JA 5HZHA 1RZ3A 3L0IB 4DLYA 2Y8EA 3REGA 4FMCB 4FXPA 1F6BA 2QRZA 5KYKA 4TTPA 3LDAA 3N2IA 5CK4A 4BFUA 1FW6A 2EW1A 5JEDA 3VMFA 4DDUA 2GAOA 3G5UA 4IW3B 3BRWD 1RYHA 3SFVA 1ZM4A 2I1QA 2MMCA 2ONJA 4AI6A 1TX4B 3LXXA 1NNEA 4UKDA 1YR8A 2AFHE 3S1AA 4LHZA 4Q4AA 2IK8A 2R44A 1PZNA 3X1ZA 1G64A 2O0KA 2OLJA 2AFIE 3PQCA 1Q0UA 2FWRA 3QKTA 4D6PA 1WXQA 3U7FB 3KZ1E 1YZNA 1GILA 5GVRA 3EZ6A 2FE4A 1GTVA 4MGZR 2CL7X 1OFUX 5LD2C 3RWOA 1QRAA 5E7JA 1KK2A 1O87A 3QVVA 1I4LD 1GRQA 1ZYUA 2J7PD 2XNSA 1SXJE 4AKIA 2IHYA 2OFXA 2YKGA 2ZSBA 4QGHA 1H8HA 2R8RA 2P0EA 3IIMA 4UNQA 5FOVA 2BJWA 3LAWA 4JS0A 4NDZA 1D5CA 5G3YA 4LPKA 4HUQB 5HE9A 2JLRA 3VX4A 2ZAOA 2ZPTX 1K5GA 4HEJA 3BS4A 1XNJA 4FW9A 3KKOA 4PSAA 5AK0A 2REXB 4X8LA 4TTQA 2JCSA 1GOTA 3CB4A 4EPXA 5FBWB 1Z63A 2JGNA 3BORA 5CYPA 3SEAA 2D2EA 4JIMA 2GCOA 5B57C 2WWYA 3B1XA 2DCUA 1XXHA 2C9CA 3FE2A 1Q3HA 2P67A 4HYYA 4KODA 1ZCAA 4O25A 3W6PA 4KO8A 1II8A 2FA9A 3T34A 5J4YA 3I92A 1RC8A 1AJEA 2OCBA 2BVNA 3AF2A 3ZVNA 3X1DA 5KNBA 3CLVA 4O2LA 3QKRB 2GK6A 3DEFA 4MA4A 1G7CA 4KSCA 1UKVY 2IS4A 2O8EA 3EIHA 1W0KD 3U44A 4Q7JB 2IS6A 2HDNB 1TQDA 2GZHA 5FBQB 1EX6A 3ZIAA 4B34A 4B76A 5LD2B 1XD8A 2CCJA 4M1WA 4MKHA 3K70C 5HR5A 1KIMA 2DWOA 2B21A 2DWQA 3T15A 3W6OA 1Z29A 1MRNA 2CJWB 1SKQA 4LJ6A 2YOGA 4DSNA 4US2R 5BWMA 5FL3A 3ZS8A 1Q57A 4GDFA 4HB2A 3I72A 2FEMA 2FFBA 4LK2A 1T6NA 3K8YA 1OV4A 4E03A 2VHUA 1VYTA 1EX7A 2OBMA 3KUCA 3NC1C 4HZUA 4KJZA 3QPUA 5DI9A 1T9HA 3EASA 2O0HA 5DH9A 3A1TA 5TARA 1ZUIA 4X8MA 1N6OA 4EFNA 2ORIA 4YXWD 4YDHB 4PO9A 3CF0A 2OILA 3I4LA 4NBSA 3GLFB 4F91B 1RW4A 1TQ2A 2FG5A 3WXMA 1E2GA 1K6MA 5D3MA 4ARZB 4NCNA 5BN4A 4D0GA 3QXCA 3MUFA 1Z6YA 3CRQA 1KSFX 4A2QA 2XOKD 2QGNA 1L7VC 3EZ9A 2AD5A 2YJTD 4I81A 3CX6A 3X1XA 1W0KA 1NVWQ 1DE0A 3K0FB 5JWHA 1MOZA 1Z83A 2IUSA 1M7BA 2WWWA 1CRPA 4NU0A 4PANA 4DLZA 4Q9KA 3CH5A 1W36D 4TZ6A 1W4BA 5EP3A 1IY1A 4C0QC 2XZOA 1VHTA 2J45A 1US8B 3B7GA 1COWD 2JIZA 1WMSA 1FTSA 3C41J 2P3SA 4CT5A 3SHFA 3QE0A 4PTLA 1I2MA 3Q5EA 4JMPA 3O8BA 3OE7D 4XSHA 2X1VA 4D82A 1F5NA 2GILA 3B60A 2QG6A 4RCZA 3NTUA 3P27A 3SI7A 4A36A 3R8CA 3I3SR 2FOLA 3BWDD 4GNKA 2FSIA 1PUJA 5FUYA 2WWIA 1SVOA 3RANA 2WKQA 1CLUA 3TAUA 4B3BA 2DY1A 3I73A 4Q48A 1EFTA 2ASEA 3KB2A 2ZJYA 1HT1E 1KI6A 4IXNA 4LV6A 3B8HA 2IYLD 3BB1A 2FPLA 2VP4A 2GCNA 5DE3A 4OQMA 1N6LA 3AKYA 3RHFA 4Q9IA 3ND8A 1N2CE 5LBIA 5JCPA 1N3BA 4D0LB 3NKVA 3RVBA 2J0SA 1QHYA 1KO4A 2GEUA 4WW0A 4DLRA 1DAKA 4NKRA 2HJGA 4FI3C 5BN5A 1U90A 1XXHE 3F5FA 3GLFE 5FPHA 3CO5A 4LV5B 2LKCA 4OJKA 4DKXA 1W5SA 4BLRA 3KXLA 1VPLA 3FDIA 2QTVB 1NL3A 2W2VA 4EUNA 3F8TA 4F4CA 3D6TB 1Z06A 4QBIA 2V9PA 1XTIA 4RZXA 2XTNA 3RWMB 3ZD6A 1NBMD 4W9MC 2O8FB 1ZU4A 3SQXA 3EWAA 2AK2A 4B3XA 4B43A 5IT5A 1G7TA 4WZAE 4A6XA 3KJGA 2QBYB 3WP0A 4B44A 1XU4A 2BMDA 4C7OB 4F4IA 5FL7D 4M1YA 1XX6A 1SVIA 1BO6A 2OFOA 3B78A 2F7SA 3CWQA 5A4JA 5JBQA 4ON9A 2P65A 3GLHA 4AKEA 3TQFA 4ZDKA 5H8WA 1X8LA 3VAAA 4PPFA 3AKEA 2FFQA 4IKEA 4WOPA 2O8BB 3GJ5A 3BJIC 4JLAA 3HYTA 1BYIA 1NG9A 1W48A 4HI0E 3EPKA 1KGDA 1FTNA 3CZPA 1KK3A 1U2RA 1Z2CA 2Z4RA 1P2VA 3CRRA 4NYJR 1GL9B 3W3AA 1IN8A 5J5CA 1HURA 1XCGB 3VHLB 4LGMA 4M4SA 3FMOB 2CL0X 1N6PA 2ZRLA 2GRJA 3VR1A 1IY2A 3CH4B 4ZIRB 1Q22A 3CX8A 2IUUA 2JJ2D 1V5WA 2PCJA 2ZE7A 4BRWA 3LVRE 1P2SA 1WE2A 1BKDR 3I62A 3V00A 1YZKA 2F9MA 4PO8A 5TVKA 1LS6A 3KJEA 4DWJA 4YMUA 3QI2A 5KSPA 1IXRC 4W5HA 3BERA 1ZMXA 2R6AA 3IBGA 1E2JA 3AVUA 2O8CB 1XMSA 2C95A 5FPKA 1G5RA 3TQCA 3KXIA 3I8XA 3PENA 1XTRA 2DFKB 2OCAA 2RGEA 4W5JA 1OJLA 2PLRA 2ZRJA 4TYYA 4TMVA 1Z6TA 2BWJA 4PQYA 5DI3A 2HJVA 5GJCA 1QF9A 1IN5A 4NONA 1S4QA 3IIKA 3IDQA 2H17A 2O0JA 3DO6A 1SHKA 3PUYA 1E2LA 1UBGA 3CWZA 4EDHA 2NO0A 4AD8A 1ZNYA 1E9BA 3K9NA 3EZ2A 4LBZA 4ZIRA 4BZQA 5GJWC 2DHRA 2QP3A 3K9LA 2NO7A 3M0EA 4LYFA 3O8RA 3SJBA 4FMCF 3TW4A 4MUBA 4KSBA 4DRZA 1JR6A 3PUZA 4EQ6A 5CIQA 2V7QD 3QBTA 2QAGC 2IXFA 3EIEA 4ACBA 1ZNZA 2WJIA 5FBRB 1GNRA 1UM8A 1OB5A 3GQBA 4D4JA 2IBMA 4WBSA 1F2UA 5LB4A 1CR2A 1DOAA 2ZI6A 3D8BA 1FX0B 4LJ8A 4JLPA 4V0NA 1AS2A 3W34A 2N1BA 4QL3A 5CJPA 2J1LA 1UBCA 3IILA 5C4GB 1VMAA 4RZUA 4TL6A 3R8FA 1DAMA 3GEIA 3GLFA 5FOXA 3CUEF 3T61A 4CT4B 2B92A 3RRMA 3WMFA 1NMYA 4X8OA 1XD9A 4KV9A 4N1AA 4NZYA 3QVUA 2VP0A 4NYIR 1I4DD 5FOWA 2FFHA 2ZRGA 1KDOA 2YWFA 1E2FA 3THOA 1TF2A 4CEHB 3K0EA 3EWSA 2G83A 4QHSA 3WY9A 3WYGA 1G20E 5KDDA 2RMKA 4PO1A 3PV0A 5B30A 5K8IA 5L3SB 1J70A 4IDNA 2ZAMA 1XBTA 1KDRA 4MQBA 4UNPA 5EP4A 1G3MA 4LYAA 4TQAA 3QUSA 3TR0A 4XH9B 1TTTA 1BS1A 3QPWA 3KKNA 1KHTA 4J0QA 4BE7B 4B3GA 3EA0A 4KLZA 1DG3A 3MWJA 1NI3A 4PPQA 4V0MA 1P62B 2UKDA 3BXZA 2A30A 1A5TA 2A9KA 5AJXA 4A82A 4B71A 2XB2A 1AZTA 2ONKA 3W9YA 2CVFA 1RRFA 3U7HB 4LRWA 3WNDA 2V1XA 4Q19A 1TEXA 1E9SA 1AS0A 3OZXA 4TL8A 4DDVA 4MKIA 3TH5A 3TSWA 3Q85A 2VQSA 4C0KA 5E7MA 4BPBA 1FQJA 3ICQB 3LNCA 1C1YA 1KI6B 1QG2A 1ZM2A 4MRRA 3EW9A 1M6NA 3HYRA 4NMMA 2WSSA 1F2TA 1OFHA 4TMTA 1GITA 1KMQA 2E9SA 1XD2B 1VIYA 1M8PA 3IEUA 4QGGA 4BFXA 1AS3A 1S3SA 3QF4B 3RAPR 3DPUA 1G7RA 4JLNA 4DUGD 5L3QB 2VRWA 1US8A 4CIDA 1E9FA 2REOA 2QY9A 5JRZA 5ELXA 1E3MA 3W8RA 1Q3TA 3NG1A 4TWZA 4JLOA 5CYOA 2EWWA 4G5QA 4MGKR 4ZDWA 5G3ZA 4GZLA 4HATA 2REBA 2NZJA 3A58B 3VKWA 3QSYA 5JRJA 5JZVA 2JDID 1E96A 2BJVA 2H7VA 4JVSB 1XMVA 2CL6X 2QAGA 2R6DA 3OEHD 3VTKA 2ZYUX 4PHHA 1IY0A 1G6HA 2BMEA 3CPJB 2YZ2A 4B3DA 2ZE6A 5JCZA 4EPYA 1I4TD 3WHLA 1N5LA 5IF9A 2ZRMA 1Z0AA 1K5DA 1MRSA 2WJHA 2DPXA 1D9ZA 5TXGA 3ONWA 3TJZA 3QKRA 4BLOA 2CNWD 4IFEA 2J87A 2IYZA 2H8KA 2ZS9A 1XZQA 3K0CC 1G4UR 2PZFA 1SVMA 1R6BX 1EWQA 1ZM9A 4PR0A 4GOKA 5H1YA 3UATA 1H8HD 1EFRD 2F6RA 4EJSB 1ZC4A 4A0GA 3U3MA 2J0UB 4H9GA 4PC2A 3H2YA 1KSGA 3C8UA 4P33A 1Q1BA 1XDBA 1HQCA 5J40A 2ZI9A 1DARA 1YRAA 4MYCA 3R7WA 4OK5A 2QA5A 3LBHA 5KDLA 1YZTA 2QMUA 2A5DA 4LJ9A 4LZZA 1M1YE 4JBWA 1NY5A 2W2TA 4MKFA 2QN6A 4MRPA 4ZO4A 4YMSA 1E6CA 1Q1ZA 1KO7A 1EWRA 4PZZA 3MLEA 1ZJ6A 3QG1A 2OFWA 2NG1A 2YINC 1RPZA 4HAYA 3DVLA 3KXKA 4JLDA 1B23P 2YWHA 3LX5A 4F4JA 2WIAA 2ZR0A 2FMXA 3TRFA 3LLUA 4RKEA 2P6RA 3HR8A 1J90A 1O3YA 2VP2A 3NH6A 1G8GA 4M22A 2XSZA 1CTQA 1OLOA 3NH9A 4L9SA 5KSZA 3C4JA 2FH5B 2Q3FA 2VP6A 4IVRA 2F1IA 3KFVA 1T3LA 3EPJA 1G8FA 2ZYTX 3A1WA 4IOJA 4EFMA 1PJRA 3RRZA 2WJYA 5A5GA 1XRJA 2D06A 4MYUA 1CXZA 4JVLA 2J9RA 1J8YF 1LY1A 4QJ3A 1N6IA 4I1VA 2XGJA 4XJXA 1OXVA 4K8OA 3QF4A 3WRYC 4A1FA 2B7CA 2R6CA 2ZE8A 1TUIA 3BE4A 2DBYA 2J0VA 3OESA 2O8DA 3TSOA 3BB4A 3KJHA 4DXAA 1EFRA 1AKEA 4QM7A 1GAJA 4B6FA 1S9DA 1Z2AA 3GFOA 3K0AB 2ZUCA 4ASUD 1ZBDA 1KMHA 1P9NA 2ZRAA 1X6VA 4RD0A 4LUCA 4HAXA 1OIXA 1SKYB 2PL3A 4A9AA 3THYB 2GJ8A 2VL7A 2ZS7A 1GWNA 3I5XA 1A7JA 1GUAA 4GI7A 3SJZA 2KWIA 2W6ID 1KI7A 4GSYA 2W00A 1X1RA 2BBTA 2ATVA 2OO7A 3EPHA 3NHBA 4B73A 4OHXA 4D26A 1Z8FA 2CEAA 1IN4A 2IEZA 2C9OA 1E2MA 4JLKA 4QNRA 2YC4C 2W83A 4UNSA 1OFTA 3RNLA 4DLWA 3KL4A 4PQRA 1U9IC 2JLQA 3DZ8A 1IHUA 4KCGA 4Q1EA 4LHYA 5EXPA 1W5TA 2A5YB 3EAQA 2IS1A 1KYIA 3T1VA 2FDCA 3HPQA 4MYHA 2ZSAA 1E9EA 1G41A 1YQTA 2B6HA 2AXNA 3D3QA 3PUXA 1SXJC 3FHTA 1LF0A 3LV8A 3FMIA 4AG6A 4BFYA 2GVZC 2RHDA 5KOYA 1XZPA 2A7QA 2V6JA 2BOVA 4ZI2A 3TVDA 4POAA 4K46A 5CM9C 5FPTA 2L0XA 2Z43A 2IS2A 3UK6A 2XJ9A 1XPUA 4YONB 2VPPA 1IQPA 3CF2A 1DADA 1E0KA 1OE0A 4JBXA 4UXHA 1H65A 4Q7MB 2BC9A 4P4TA 1ZIPA 2GJAA 2YWGA 3AV0B 4YMTA 2WWFA 3A4MA 4Q4HA 1DAEA 2XTMA 3QG5A 1WBDA 3PCRB 2R9VA 2KSQA 4BUJA 5UKDA 4PSVA 4U02A 1VG0B 3U7EB 3CNNA 1KDPA 3TUJC 2NO1A 5JECA 4QGFA 5FPSA 3TVTA 2X2FA 2FNAA 3O8DA 2R6GA 3VR6A 4E22A 721PA 3ZZUA 4EJSA 4AK9A 5DHFA 1E99A 1DEKA 1Z5ZA 4P0TA 3RS0A 5SZKB 2PZGA 3T1QA 3TBKA 3ZGXA 1NN0A 1II0A 2ZVPX 5DN6D 4C2TA 2IXEA 2C98A 2ZRPA 5L8VA 4OHYA 3LX8A 4JSTA 2V55B 3TR5A 2P5SA 2ANBA 2GA8A 1N5JA 1FFHA 2RCNA 5CDFE 2VF8A 4GP7A 1A1VA 2IC5A 3CR8A 4UJ3A 2RGCA 1L4YA 2VF7A 3R9XA 3RRNA 1WBBA 5EZ6B 5TDHA 3QOFA 2QM8A 1R0XA 4G1UC 5AWFC 4HZIA 1NY6A 2DR3A 3K9GA 5HE8A 2ZS8A 5F9HA 4RVCA 4XD7A 4Q7LA 4U5XA 5KTYA 1U81A 2DFTA 2Z6VA 3W5IA 4OKSA 1E0SA 2WM9B 2AWNA 5B64A 3KQKA 2RGNC 4F93B 3U61B 1GL7A 2MSEB 3SOPA 3VX3A 4RZ2A 5JI2E 2H57A 5EE1A 3B1ZA 1GNQA 5L3QA 5IDVA 4KI0A 2XITA 1N0UA 4FWIB 3RSOA 2BBSA 1AQYA 5J4HA 2QPAA 1KI4A 2OCYC 4C9BA 2ZUDA 3GEEA 1C4OA 3V9PA 1AKYA 1X8KA 4URUR 4XD7D 4LV8B 2UZ3A 3VKGA 3DL0A 2F3RA 5FFMA 4KVAA 5FR1A 4R2HA 2ZRIA 2HLDD 3QKUA 1YR9A 2O8CA 3GLGE 1BH2A 5AUOB 5JS7A 2JLWA 3JVVA 1OIVA 3KB1A 4TQUS 1UBFA 4L15A 2BIFA 1P4SA 3K9HA 2JJ2A 5C1BA 1DAHA 4AWXA 1CR0A 2LKDA 4MGYR 4LPSA 3T1OA 1N5KA 1D6JA 1YZLA 4C7OA 3UMSA 1FPMA 1E32A 3LD9A 4QC2A 3CRMA 2IWHA 3I61A 1HY3A 2QP9X 3SBEA 2GKSA 1G4AE 2ZETA 4C0HA 4LC1A 3K0SA 2QROA 4M9ZA 4CEIB 3R9WA 4XWOA 1D8TA 3IPYA 1KZ7B 2OHFA 4NYIQ 1E1QD 2QTHA 3OEEA 5HCNA 5JHGB 1W1WA 1EXMA 4CEHA 3SC3A 3EPLA 1VYVA 5CB8A 1E94E 2C96A 1TUEA 1Q1QA 3K0CA 3QQ5A 4QNMA 2N46A 3U3RA 3U6BA 2CCKA 2ECKA 1EESA 3DMDA 5CM8B 4KFSA 5JFGA 2A78A 2WTUA 4IXMA 1LFDB 2YOHA 1Z0KA 4LOAA 2J0QA 1IN7A 1FUUA 1K8RA 3HWSA 2DYKA 4AYXA 5FOTA 3MWYW 1NMXA 1P3JA 4TMWA 4YMVA 4AG5A 4TMKA 2GK7A 2IHBA 4A92A 1FX0A 5F98A 1GFIA 1AQUA 1W4RA 1P2UA 3ZQ6A 2HLDA 1XMIA 2GNOA 3QEOA 4FCWA 4XVQA 1VCOA 2EQBA 4MKGA 1LTQA 3EG5A 3OHMA 4B2PA 1T8UA 2E1RA 2R6FA 2WMNB 3E1SA 4RD1A 4A4DA 4AY2A 2A2ZA 3GLIE 4G5GA 2HXSA 4D81A 1XWIA 4CEIA 2VYFA 4Q9LA 2XZPA 4IDPA 3IUYA 3SHWA 1NG1A 2QRNA 2GETA 1PUIA 5FOUA 5DYGA 4E09A 1G7SA 1G6OA 3R7WB 3OIVA 1YHNA 2ERXA 3L82B 2FX3A 5BW8A 4FWTA 4XVRA 5EE3A 2WPDA 1XB2A 5GVSA 3BB3A 2X77A 3KTAA 2ZYWX 5L3RA 1KSHA 3ZQJA 3P4YA 3DM5A 4M0LA 1GVNB 5DO9A 2PT5A 3CZQA 4JT2A 4QXAA 4ERNA 4Q7KA 3S1AB 3WYAA 4JVMA 4M21A 1AK2A 1HUQA 1RJ9A 1F48A 2X2EA 2P6UA 1NBME 3PG5A 1CEEA 3TMKA 1OXXK 3OAAA 3AVYA 2IYQA 1E79D 1VTKA 3MRSA 4FD2A 3AVVA 3A4NA 3U60B 1OYWA 1WA5A 1TPZA 5E95A 3QNUA 1P75A 4TYNA 3ZDQA 1EG7A 4BRUA 4CEJA 3I8SA 5H68A 4NCKA 2DB3A 4C30A 4D4KA 1G21E 3L2OB 1IXZA 4MH0R 4HAUA 4TYWA 4JVNA 5IK2D 1NKSA 2RAPA 6Q21A 2GDJA 4TTRA 4TYPA 1UF9A 3TIFA 3G82C 1W2HA 3GJ3A 4DBLC 1D2MA 2ODBA 2FPKA 1OFIA 2BV3A 5DNYB 4I1OA 4GMDA 4DJTA 3TAHA 2C5LA 3LFUA 2ORWA 3T06B 3SYLA 4ZDJA 2V8OA 2O8BA 2ZANA 2JJ8A 2CCGA 3BFKA 1R5BA 1YZUA 4Q00A 1W7AA 3FYHA 2KE5A 3C5CA 2GF9A 3KUDA 1F2TB 5HKKA 2OXCA 4BASA 4QFMA 1UDWA 2ZROA 4TLEA 4DDTA 1ETUA 3VHXA 4Q1DA 1DG1G 4KYUA 1SHZA 3AH8A 1KKMA 4HZUB 1CS4C 2VIIA 4B47A 3EXAA 1F60A 4I4LA 3THXA 1CJTC 1RVDA 2IEYA 1W2GA 3HU3A 2NIPA 1X3SA 3RSLA 3HJNA 4QGAA 1ZC3A 2BMFA 2R62A 2VHTA 3GP8A 1FNMA 3MCAA 1W4CA 3KQHA 1OB2A 2ODNA 3MJHA 5KU1A 1U0LA 2ATXA 1FP7A 3QXSA 4KBFA 2JDIA 4WZ6A 2CJWA 2OUKA 2B7BA 4OHVA 3U3JA 2AXPA 3H1TA 1NN1A 2HT6A 2G0NA 4JL5A 2ODEA 1M7HA 2D4HA 3AP3A 1Z0DA 3B6EA 1ODFA 5IK2A 2EFHB 4ASUA 4RD4A 4M1MA 3NHAA 2F43A 2Q9CA 3AKDA 3BH0A 4Z1MD 5JI3E 1DO2A 2GF0A 2UVQA 1R0ZA 5FBVB 4OQLA 3K09C 5EQTA 1ZW6A 3SYKA 4Q18A 1ZUNB 3BFXA 4HDCA 4X8HA 4LX0A 5BN3A 4RKFA 5GJBA 3K70B 2CDNA 3T5GA 4BFWA 1M74A 3IO3A 1U8AA 1VCNA 1OYYA 3ASYA 3UXMA 4MRNA 3M1IA 3C15C 1NJFA 2OBLA 1G3UA 5F2EA 2ZSEA 4MUAA 3MGCA 3OF5A 1WB9A 4TT3D 3M4YA 2V6IA 1G3IA 3PUVA 5LPNA 3BH6A 2GVDC 2ZR9A 1NVVR 4PQFA 4V02A 1R0YA 4PPGA 1HEIA 1CULC 1RKBA 2JATA 3CM0A 3P20A 2V1UA 1AIPA 4BLPA 2FZ4A 3BFVA 2F55A 2G77B 4ZPXA 4QG7A 5EXTA 3DMNA 2FPMA 5F9FA 4RFSB 4ACAA 4WA7A 1G5PA 1W44A 4AURA 1PVOA 3HU1A 2IYXA 4DUGA 1DS6A 3L0SA 1YU9A 3FMFA 2G6BA 5JJLA 3GMTA 4OBEA 1T4GA 3TW8B 1KI9A 2BHRA 2BCGY 2D62A 3C7KA 2ZU6A 1CJMA 3Q7PA 1KO5A 3MFYA 1L4UA 1W4AA 2WJGA 4LHVA 4OYHA 1FMJA 1KTVA 1VIAA 4KU4A 5JLJA 1X8JA 1PV4A 1H8ED 4KFUA 1OSNA 2GTPA 2J7PA 2ZUBA 4YDSA 3IPXA 1II9A 5AUPB 2OSBA 2O52A 1ZUHA 4OQNA 1FP6A 2OBNA 4Y0AA 2ZRFA 2J3EA 3Q8XB 4DIDA 1MR3F 1CIPA 1G8PA 2IA5A 3T12A 2XAUA 1JJVA 1Z6XA 2A3RA 2RGXA 3PVSA 2Q21A 1MABB 1KOFA 2AWOA 2FGJA 4RFVA 4HUTA 3PJRA 3X1WA 3BBPA 1T0HB 3PEUA 3SDZA 4JYBA 3EARA 3RDPA 3ZIAD 1OXUA 4TLAA 3ZYCA 4CZ2A 3VR2A 2DFNA 4ZKEA 3VNUA 4ARZA 2FGKA 2W2XA 4L16A 1YKSA 4Q4JB 1OIWA 3MD0A 3WYFA 3WNCA 1MH1A 2PZEA 5KNCA 1MO3A 1QZXA 1DTSA 2PX0A 1ZM3A 1W36B 4Q1AA 4TZ0A 2BBOA 3ADKA 4ITRC 3TGPA 1NP6A 4IOKA 4QJ4A 1RIFA 2QNRA 3DKVA 3Q3JB 1YZGA 1Q20A 4L8GA 3U44B 1Y3AA 4TMZA 1UEIA 2D3WA 4RFSA 4JLVA 3CKLA 4DLSA 4HLDA 1CJKC 4GP6A 1RJ9B 4OHZA 5LDDC 5AJZA 3B2EA 1AM4D 3VNVA 1R8SA 1NF3A 4IJMA 4QBGB 1RFLA 4B2IA 4MDFA 3O47A 3AVTA 4I99A 3SJCA 3WP1B 5KNDA 5IRCD 4QRHA 5DI3B 1ZAKA 4LJ5A 2ZEJA 4PHGA 5FTJA 4Q9HA 4DLTA 2OXRA 2SHKA 4PAOA 3AF3A 1QHIA 3EC1A 4NCIA 2ZXUA 2WVJA 5TB5A 4PC7A 5GADl 2O8FA 1G3RA 4R71A 4G5RA 2NGRA 4V0LA 5C4MA 4QOSA 5JSZB 2ZI3A 1KI8A 3IQXA 1GKUB 3A8TA 1T3SA 1YJ5A 4JSYA 1KNXA 5JMTA 3CIOA 2JJ1D 4UJ5A 2ZJ2A 3MG9A 2CHVA 2R65A 3DOEA 4ABYA 3PIRA 4GRAA 1E9AA 1QHNA 4FIDA 2WWGA 1OT3A 2NMVA 2QU8A 2ZR7A 4U00A 5B58C 4IDQA 5CITA 4RD6A 1XF9A 4PXAA 1NVVQ 4R2IA 4B3CA 3A4LA 3UKDA 2GCOB 1IJEA 1RRGA 1CF4A 2WOJA 2PMDA 5DISB 2E87A 2C9YA 1S96A 5BYJA 4OI4A 3CX7A 5FBLB 1NRJB 4OL0A 2BM1A 4TL7A 4HLCA 2WWXA 4DT1B 2G88A 2Q3HA 3FVQA 2NPIA 2DFLA 3F0TA 1R8QA 1OXSC 4AYWA 4LBWA 2VHJA 3QIAA 2HEIA 3LY5A 2QQEA 3Q5DA 4B32A 3ADDA 1COWA 1AA9A 1PLKA 3IEVA 1JECA 3AP2A 3DM9B 4NPHA 2NPFA 3B13B 2BDTA 3GJ6A 2GJSA 3TUIC 2XEXA 5DGXA 3REFA 2QMHA 1KJZA 4IHQA 3UG7A 4KXFB 1OXTA 1NSFA 2KBEA 3FTQA 4G01B 3AF0A 2D7DA 2AN9A 3K0FA 2OLKA 3W5JA 2WAXA 2WIBA 1JALA 1VKJA 2QSYA 3RYTC 1FQKA 4HB4A 3L43A 4FMBB 2QI9C 2ZI7A 4TQ9A 1VG9B 2PJZA 1E9DA 1GIAA 4M53A 4EAQA 1ZM7A 4DDWA 2HYDA 1E2EA 1Q21A 2ZTSA 3SZRA 4E5UA 2KI5A 1JI0A 3C16C 2CVHA 3KX2A 4G3XA 2FV8A 1XCMA 4PAMA 2BEKA 5FL7A 1T8TA 2XOKA 2ERYA 3OIUA 1ONBA 1TAGA 4BGDA 3RC8A 3BD9A 4EKDA 2JLUA 2IYVA 3PFIA 4KFTA 4DHEA 3RS4A 3UWOA 2AL7A 1KMHB 3QBVA 1X86B 3A37A 1ZNXA 4M9QA 4M1OA 2OE2A 5AR1A 5KSOA 3UIEA 1YVDA 121PA 3SQWA 3VKHA 1ZIOA 2IW3A 5HTKA 1VCMA 1M2OB 1VG1A 2RHMA 2Z0MA 4YXWA 1LF5A 1HA3A 4QJ5A 2C99A 3H84A 4HLUC 5TV2A 4A8JC 1DAGA 2ZRBA 1U8ZA 1YRBA 3D31A 4Q4AB 1A82A 1E2IA 2AK3A 4LBYA 1KK0A 1DAFA 3E2IA 1SKYE 3AM1A 3OEED 3GCGA 4HDOB 4OJQA 2C04A 1RE0A 2IYTA 1CKEA 2PJRA 2OM2A 3SNHA 2F1RA 3SFZA 3EX7C 3NC0C 2JLZA 4PX9A 3GJ4A 2RB4A 3HU2A 3B9PA 4OI1A 2IX3A 3MWKA 1Z47A 1JJ7A 2W0MA 2ZQ5A 1P7CA 5EE5B 2CE2X 5L3VA 1R0WA 4A2PA 1UJ2A 1JNYA 2CBZA 2G9NA 1IN6A 4Z8YA 1SVWA 4BLTA 1IONA 4GOXA 1S0UA 1Z6GA 4GT1A 3MMPA 1DAIA 2VSOA 5JWRA 2V3CC 4URWR 3QEJA 1F3OA 4DCUA 5JHHB 1XP8A 2ZSDA 4JZKA 2XXAA 1D9XA 2VP5A 4KYIB 5EP1A 3GLGB 1M7GA 4TLCA 4IDOA 3U5ZB 3KKQA 4B35A 4LBVA 2CLCX 5FUWA 4DCSA 1T0JB 1MABA 2BCJQ 4TMXA 1JQLB 4DVGA 1GDDA 1ESMA 1VECA 4IDHA 3QENA 5AJWA 3Q7QA 1RYFA 2J0UA 2QT1A 3A36A 4Y0VA 3AEZA 1UEJA 3SJAA 1E98A 5FTNA 4NYMR 2EFEB 5BXQC 2QUZA 1WDTA 4MRSA 4C0SA 2OV2A 3ZVMA 3BAFA 1QG4A 3DZDA 4NCJA 5C2JB 3K1JA 2GBLC 4N3NA 1XMJA 5J47A 3K70D 3LA6A 3ZVRA 4YC7A 1DVRA 2C8VA 4W7SA 4EIWA 3NWJA 4HLQB 2V7QA 3I1FA 4DLVA 4LJ7A 3CPHA 1YR6A
chains in the Genus database with same CATH superfamily
4L7VA 1HPLA 1YQQA 3PLRA 3HDQA 3JXEA 2QTNA 5DEIA 2FRDC 2YV5A 1NNUA 4P4NA 4Q39A 5IT9A 3ZS9A 4BLQA 2XT0A 1KL7A 2XA1A 4IY1A 2NM0A 1EX1A 2BH9A 3GGCA 3W4JA 4ND8A 5FTWA 4BFTA 3IVGA 1N1DA 3LDFA 4W1RA 3BK7A 1GSOA 2PSDA 1EM8B 3HZHA 1JXOA 1P6XA 4JLBA 2I7TA 4LVCA 3EGXB 5ENVA 3U80A 3UB3A 3WRYA 3IMEA 4HFJA 4DIFA 1UMDA 1EFPB 1H2EA 2I03A 3HMQA 3NIDB 1OJ7A 1Z7BA 3OICA 3TSZA 2GM4A 4Q3EA 4EF4A 1Z4LA 1ZI9A 1PU2A 2EIHA 4NG4A 1GO2A 4EPTA 3DUFA 1N2OA 1S5PA 2A9JA 4IYRA 2VH1A 4JKIA 5EZ5A 5K6AA 1D2CA 5ADVA 1GRNA 2G8NA 1SQ0A 2V5VA 3RYIA 4YRBA 1UC8A 4D8XA 1T4CB 3VPBA 4RZIA 2PL9A 1O97D 2B1QA 2E49A 2JAQA 3L8ZA 5HYVA 2C8JA 3W7VA 4UVIA 1PQPA 1M2EA 2Z09A 3DPSA 5KJFA 2VDMB 3ZE9A 2H1RA 1VC2A 1VHQA 1GL6A 3PEVA 2IV7A 4ZN6A 3Q1KA 4AJIA 1NVMB 2HA7A 4UCQA 1TLFA 2Z5GA 1HL7A 2XNDA 3FCAA 2D1QA 1WTAA 5DYIA 1SVKA 4HMOA 2E1PA 4W4TA 1KZGB 3GUHA 4JJKA 1TCAA 4MUXA 1NRXA 2HJHA 2N42A 5JXGA 1H1DA 1EUDA 1UC9A 2JGJA 2M2IA 4HAZA 2XNHA 1TMOA 2XKBA 3EIQA 4MCAA 5EKUA 4KWTA 3AI3A 4L6CA 4BGUA 2GCEA 3SQDA 2DT8A 4CKCA 3N28A 1F1JA 1XL0A 4PFSA 1CUIA 4Q37A 3OU2A 2ZYVX 1JG1A 3KB6A 1Z22A 5JRDS 2D4AA 3ON5A 1FF9A 3I04A 4B75A 1G291 1GRVA 1V2HE 2FOXA 3R7SA 5AW6A 1D5WA 2OHHA 3HA2A 3UWKA 5B3JC 1XYVA 5K6TA 4ENVA 1AMOA 1GUZA 1JBEA 1W35A 1T0BA 2Q5JA 1Y7PA 2OHOA 3DTVD 4IDEA 1JWBB 1W19A 4FFMA 1MO4A 2P2SA 1ZCJA 2PMKA 1A8SA 3BYZA 1PFKA 4ZCMA 1B8OA 3EVFA 3B6ZA 3PC3A 4QGSA 3U7GA 4GL2A 1NXTA 2HIAA 1E4EB 1ZG3A 5CNJA 4WY2A 1FU7A 1Z9BA 4MQ5A 3SE7A 1PF7E 2AE1A 1VYHA 1KEVA 3AQ4A 4XX0B 4EGFA 3IDFA 2KW5A 1RHMA 1ZXLA 2B98A 2C0PA 2IEIA 4HGOA 3A1VA 3R7LA 3TL6A 3UKJA 5KNCH 5CAEA 1JFTA 3LQ2A 2X8JA 4M1SA 1KAOA 1VDMA 3GP5A 3WMEA 2C7RA 4Z4GA 3NXKA 1X15A 1U8EA 2QEQA 2PYIA 4KH1A 4LHWA 1JEOA 5E8RA 3CNLA 3QVXA 4O59O 2AG1A 3O0TA 1FSSA 3DEHA 4M1TA 4QOFA 2A92A 2CBXA 3MCUA 2DWPA 1QPBA 1L7RA 4Q4HB 3T35A 5EWLB 4YAOA 1MO6A 2VDJA 5TY0A 2GAAA 3N3AC 3D2LA 8ABPA 1NU6A 1P5ZB 1QFSA 3R6TA 1U31A 4BO2A 3DD1A 3ASVA 3LBFA 1MN6A 4FGJA 3V97A 3W8NA 3R20A 3KQLA 4OHKA 1YI0A 3WZ2A 4CPDA 2RC6A 3DONA 3NWBA 3PLNA 4Q9NA 3KOUA 4NZOA 5EUQB 3E58A 1EWYA 3WGTA 5DNUA 5DM2A 1TT5B 4J0EA 1B26A 1O96A 2FN7A 2B83A 1E1CB 3AOEA 1WW2A 3FUWA 1YDMA 1XEWY 3GO4A 4FCTA 4P32A 5LCXA 1ZGGA 4US1R 3BDVA 1RJGA 3E82A 3EOBI 1VE6A 2GPAA 3RS2A 3C7AA 2BZSA 3KG2A 4F5EA 5GONF 1FMLA 2HHCA 4C29A 1DOZA 1NN3A 1SXJD 2JC3A 1RXUA 5K45A 3FOAA 2P2LA 2A1IA 2F1HA 3IH5A 3O83A 4KVFA 1VCHA 3K2EA 3IALA 2RGNA 4IVQA 4WD3A 4WVFA 2IE8A 1V7QA 1ZD4A 3EGOA 1CS0B 3DHWC 3WLHA 2ZRQA 1TIBA 1ZJJA 3VYWA 3DCIA 3WLKX 4LZLA 3KELA 1M2GA 4YJ2F 2PO7A 3C5HA 1FRNA 3UJPA 2FUNB 2W6JD 2FPSA 2FETA 3FHJA 3KQVA 1LW6E 5FULA 2MSDB 2Z30A 3COZA 3D4NA 3NAGA 1U80A 4LSGA 3H6GA 1BMFD 1IBRA 1Y80A 2HHLA 2D6FA 3DGFC 2XUIA 1XJQA 1REQA 2RARA 4N0EA 2RKWA 1QH0A 4KBGA 3AY3A 4YK7A 3OA0A 2IZ6A 1DBWA 1RQ7A 2EFJA 4LMPA 4FC6A 1U7OA 1D4ZA 3L4BC 1YZVA 2H85A 3JATB 4NDAA 3QWAA 1XZNA 3R5SA 4MB0A 5D7NA 1B93A 4CVNA 5CDYA 1P60A 3KWFA 1K8QA 4M86A 3ER8A 4L9AA 4MUHA 2V0NA 2WRZA 2PMBA 5KHLB 3DQPA 2Q5EA 3F3MA 3WV5A 1UT5A 2VJLA 2UYQA 3EB9A 2C8LA 3V7FA 2EFDB 1GXSB 2Q62A 5DSTA 3TQRA 1KYZA 3A6ZA 3HEAA 3Q3VA 3F3SA 1JHUA 2VZEA 2V8BA 1X7XB 4FEEA 4LXHA 4PBRA 1KEKA 2QL6A 3RLIA 2HHJA 4Z3DA 3ZVLA 1JMKC 3ZNNA 2H31A 3NONA 5FUQA 1Q2XA 4PBTA 2CE7A 2AOUA 3O82A 4C6SA 4HVCA 4HBZA 1V37A 3C74A 3MUEA 2I65A 3V55A 3ZGLA 3CUKA 4YFYA 1ENZA 1YBAA 5AVTA 1JFFB 1UBHS 3NVDA 5KOJA 1QXSA 2IYWA 3HO6A 4Y1RB 1KEEB 5EJ2A 3FWYA 4CYMA 2CSXA 1XTBA 3B5EA 3H5TA 2LIVA 1Z17A 3OMWA 4MINA 4X90A 3D4IA 2AI2A 3J7TA 3PA6A 4AM8A 2EYUA 1C8KA 1PLJA 2FMKA 4NV0A 1IBLB 2FY8A 4IOMA 3C3YA 1DIOB 1JQEA 1Q91A 2Q4TA 3KQPA 1WP9A 2NZ8A 3P0FA 2JIZD 2ZUWA 3RT7A 3TLZA 3VYTB 5ERGB 3VU3A 1QHHA 2XNCA 5BMVF 1NQAO 2VHXA 4DARA 4IBOA 3CRZA 4M37A 3HKBB 1EM6A 1YRHA 2ZE5A 2FDXA 3KPYA 1Z07A 4RGYA 1XEFA 3W4KA 2C2GA 4QDOA 1G8YA 3ANSA 1X0VA 4Q47A 3TZ6A 1IM2A 4CLRB 1KEPA 1LPNA 5EJ7A 5L6MB 3EISA 3KS9A 3K2IA 3D3JA 2C7GA 2ZQZA 4MA5A 1CUJA 3OLYA 3RAGA 4QVIA 1S1MA 5CLHA 2QVXX 1SVSA 3JQ8B 3D6FA 4DMFA 4ZJYA 3LZCA 2DM6A 3GZNB 5ICSA 1J33A 1PWZA 2CYBA 1J5EB 4P36A 1VI2A 4KE7A 3AGPA 1ELOA 1ST2A 3NV9A 3Q0EA 5ENZA 3T3IA 4A0RA 2V6GA 5CVEA 3LW8A 3A4YA 5K3FA 4GBGA 2XCUA 1TM3E 3VV3A 2QE7A 3UAWA 4FB5A 5JADA 1HH4A 1XTZA 1VA4A 4W9RA 4DCVA 1RYYA 3NBAA 3REQB 1NJ5A 1Z4MA 4LOJA 5TEVA 5KAMA 4PC3A 3VQTA 2IXDA 2XUAA 1WETA 2P75A 3QY0A 1QTRA 1Y1QA 3UMBA 2XMQA 4B6PA 3ICOA 1W25A 1XZFA 5HF8A 4D4LA 5L4LA 2V9ZA 5AOAA 4O3MA 3PWSA 4Z9AA 4J75A 2Z8ZA 4K05A 1PFUA 1SCKA 3DTNA 1ATZA 4P3XA 1H9AA 1MVOA 5AK3A 3PJEA 3RABA 3VZDA 1GYPA 1SR8A 2WYHA 4HYTA 3VPGA 4C07A 2V74B 1PJAA 1BU8A 4ITVA 4JNCA 1UMCB 4DSAA 1F6DA 1QHXA 3C3KA 1BQEA 1OA0A 3P9QA 4RJLA 2D13A 3KFXA 2XUDA 3NHPA 3RIEA 4DREA 1Z4KA 2ZJOA 2VUSA 4GDMA 4O5OA 3F9CA 1HOXA 1NZJA 5AKJA 5DRTA 4ZAYA 3ZI7A 3WJAA 3JD3A 4F38A 1PN3A 4QDUA 4RTMA 4M1QA 3KHUA 2HRBA 4JD5A 3JS5A 2R8BA 3FPKA 1V41E 4Z9YA 1FRQA 1GG2A 5FTKA 2VP3A 4QARA 2L18A 2JW5A 2W6IA 5H70A 1NVXQ 1S9HA 4OI2A 4WXPA 5LLTA 3RKRA 3QX7A 1A9PA 1O95A 3PEWA 2MSWA 1I14A 4AKGA 1GPMA 3KKPA 1RQLA 3FKSA 4FFBA 3RRFA 1DWOA 2NADA 5T67A 3TZCA 4BLSA 3UFBA 1D1QA 4Q03A 1R64A 2XTJA 4WZBA 1RZVA 3W3AH 3AUYA 4J43A 1X1AA 2AXEA 2FF7A 4TPKA 1P2GA 4B6RA 3S2UA 2UUAB 1VDZA 4LHXA 3IVCA 1E77A 2NO6A 4C4SA 1KZ1A 1DJLA 2LWIA 1IWOA 4G9EA 2GZAA 4NI5A 1BFKA 4QLAA 2HV9A 1XZIA 2HDHA 4EB8A 4Y18A 4GC5A 5JJIA 1YR7A 4H27A 3WYEA 3LZDA 4E2YA 4RE5A 1GZSA 4G0PA 3ZZ0A 3UBTA 4ZPJA 4X9XA 2C5FA 3GLHB 4Q24A 5A05A 5C1IA 2QXYA 3EYAA 1VLHA 2DPHA 3GD7A 2JA2A 3CR7A 2QV7A 4GI1A 5FI1B 3V1LA 2CUZA 2XKJE 4JC5A 2XLBA 2YMPA 1H22A 5DT9A 4EBBA 5HXAA 5LU8A 4RA9B 3WE7A 5JDIC 5FUXA 4MJLA 2CLSA 2QBYA 4GD3Q 4IV0A 2EEPA 3WA7A 3ETLA 1NVUQ 1Y42X 1Q6YA 4OLAA 3KYDB 2DSNA 4LJAA 5EYPA 1ETHA 1ORHA 3VM6A 5BOSB 4G25A 4O33A 1HRDA 2XYGA 3KB8A 1NW7A 5BRNA 2EKLA 1AQIA 3FROA 4NABA 4BBZA 2G28A 3T7EA 4DNFA 5L7TA 4R16A 2FWBA 1P3DA 10MHA 2XUKA 3ILHA 4KMOA 4RW0A 4OK3A 1C9YA 2Z83A 4EHFA 1JQJC 2C3YA 2WU3A 4FYVA 4RD3A 5CEJA 5LN1A 1AN9A 3RASA 3THWA 1N1GA 2V54A 1T5LA 5C5CA 3GOQA 4UUPA 3JQAA 4YH1A 4Z54A 1M5TA 5IF3A 2HF9A 5K7SA 2HXYA 4QUDA 5EMNA 4MO2A 2A3NA 1MO5A 2X7XA 3O8CA 3TEJA 4P5EA 3L0OA 1N9ZA 1M1ZA 4E5VA 5FTLA 2FQQA 3IHWA 5TEWA 1R74A 2OQ2A 1Q3KA 3OG9A 1U8UA 2CD7A 4US0R 4DCCA 4RBNA 4I6EA 5JXJA 2QTBA 1OKKD 3EA4A 2XXAB 1T91A 2D2FA 4Z9XA 2ZRNA 2YL2A 3OVMA 1PR5A 3K8QA 4YREA 3W0LB 4AMVA 2WJVA 4EF5A 3LGXA 4UASA 3VOSA 2XF2A 3HP1A 2LVBA 4YQYA 5IHPA 2B4YA 4WLFA 1QYIA 3U19A 1PWEA 3NIGB 4E32A 1M83A 1WQ3A 1VIVA 2KHZA 3TCXB 1X7HA 4BVEA 1OT5A 1UBEA 1NBHA 3G5LA 2A0KA 3T4UA 1K06A 2D2XA 4D3FA 1W8IA 2EOAA 1U7DA 1M1YB 3FSJX 3T6KA 1RCFA 2AKAB 4BLWA 4PSKA 4Z8XA 1XVTA 2IWRA 1DWUA 1OKKA 1AKUA 2EKBA 4LF4B 2YJZA 2NUPB 4MW2A 3B9BA 1CQIA 2CV1A 3WADA 2HIMA 1C0IA 3L77A 4DV1B 5A0VA 1F8YA 1TADA 5KKAA 2CXOA 3ZW7A 2VRNA 4KQ6A 3GJ8A 4HJRA 2OO5A 4TSFA 2X58A 5CK5A 3U4CA 2HPAA 3TIGA 3ZXIA 1SQFA 3TPCA 5JTTA 1JAHA 1YO6A 1JB1A 1XZKA 3CW8X 2Q7DA 1ZD8A 3NXSA 5E1MA 3X2SA 2HA0A 4YHHB 2VYND 1BJKA 2FX2A 2NVUA 4QRIA 2QQ5A 5DTQA 4EHJA 1QRTA 4KTVE 2QP4A 2YDYA 4NE7A 4NSNA 4QUJA 2A7XA 3ZHSA 1KU6A 3DHYA 221PA 4HXEB 5JSKA 1YQ9A 1QAOA 2YWCA 4KOAA 3AERB 4DMCA 3BF7A 3OFSA 5JAQA 5EVJA 4CMCA 2PPVA 1EFCA 4KN9S 1UBUS 4TTJA 4QU9A 3CF6R 4G9GA 1TQ8A 3EXG2 3JRNA 2W43A 1DEXA 1QFJA 2AZ4A 4BO0A 4F92B 1E2BA 3NHZA 1W36C 5F1OA 3MGAA 1FDOA 1WHSA 2G1KA 4RF3A 4WZBE 3GH1A 3CXRA 1D2RA 4MWTA 4O8CA 3TDKA 4A16A 4F2GA 2VEDA 2ZSKA 4RIEA 1HEYA 2BFNA 2H16A 4A6DA 5EJ4A 4DV4B 3BE6A 1JIVA 3VV2A 5JS8A 3BQMB 1R9JA 5JSYA 4XOIA 3SF8A 4KR2A 4PLYA 1DBSA 3S2SA 2BM9A 4Y2YA 4D99A 3MJRA 3T4PA 2MR5A 1XPRA 4D25A 4ZT3A 5JJKA 1HT0A 4M7PA 4BNTA 1LH0A 2PANA 3ZHBA 4MLPA 1J8FA 4YHBA 3E70C 2RH5A 4HEHA 5IUNC 1KQOA 5EWMB 4O2AB 3LX6A 1A69A 1FXUA 3FGNA 3IQGX 3MJ4A 4CV0A 3KLBA 1FJXA 3DOHA 1A8PA 3AB8A 3MTEA 4UHHA 2P5YA 2Q50A 4Q21A 3KFLA 4ZEXA 2OV3A 1IDOA 1LW7A 2JHPA 4C3UA 3HRKA 1FFXA 3GT4A 3W90A 2QQGA 4E4TA 2EJCA 1WAMA 3OAAD 4YV0A 5EXSA 5LNK6 2ZDQA 2GK4A 2VUUA 4AY6A 3M1YA 2ID8A 2YJ4A 3SXUA 5IAEA 4DYHA 2I4OA 1EXNA 4ZKDA 3EIOA 3R74A 4WXMA 4BE9A 2H7YA 3FMVA 3W3AD 3PEYA 2QX6A 1XRRA 3SF8B 5K3FB 3FFAA 2IZ0A 3L8HA 3PFCA 1SEVA 1Y3BE 1R9MA 2DX7A 2YV3A 5A0FA 4YCDA 1KWGA 5EMHA 4DNQA 2X3UA 5CDHA 1Z45A 8GPBA 2YTZA 3VU8A 4HSEA 4YUWA 2BGWA 1G3QA 1XXHB 1UAAA 1QE5A 3ZBUA 4DSTA 4R0VA 1K7YA 3DL2A 4AUEA 4BFSA 1Z0FA 3L8GA 2P68A 1X38A 4ND1A 2I34A 2QIPA 2R47A 3K2QA 3MFQA 3HNPA 2VLIA 2A0YA 3NYQA 5AM0A 5EQFA 2ZTLA 4ND5A 1ZJYA 5NULA 3FOFC 2P69A 5I7SA 1KPHA 1KY5A 4MEBA 3KSRA 2WQ7A 3OFNA 4CF4A 3NHSA 4LGVA 1WCIA 1Z6PA 4Z99A 2XCRB 2B30A 1R2QA 1R15A 1HT2E 2AN4A 1ZMBA 1P0FA 5J59A 3KVOA 5B4VA 3N2GB 1TYAE 4XIJA 5DCWA 2FXIA 2OESA 5D3QA 2FEKA 5KTNA 1B2RA 5CA0A 4P5PA 2J6BA 1MQ8B 2EFCB 5ALHA 3DKIA 1J1IA 4P3YA 3W6ZA 2CHGA 2WWRA 3ROFA 4QUEA 1JEEA 2WDZA 3FPAA 5K0GA 4E1AA 1KYYA 1M1XB 2AYZA 2I55A 4RJJA 1Y8ZA 3JQAB 3FYDA 2A9QA 3SQNA 1CY8A 5IBPA 3VC2A 2PLFA 1YQUA 4CF6A 3N8IA 1SU6A 1X1QA 3EUEA 3JZMA 1B8NA 2AHRA 2F59A 3GLKA 1V39A 5CDFA 3V8VA 1PSDA 3TXAA 3SJUA 1GZ5A 2CYAA 2WF7A 1XCPA 2NZUG 4M60A 3VDXA 4EGCB 1VHDA 4ZHQA 5IN4A 2GBCA 3CO0S 4BJHB 1O03A 3AVWA 3O7MA 4G8DA 1RVV1 1GU1A 1AUXA 3BAZA 4N40A 2C2YA 2Z2YA 5F3DA 2EWVA 2YVKA 3ZZ1A 5G1PA 4Q1BA 1OHHA 3DDUA 1QFXA 4P4SB 4RYDA 4M0DA 1JA0A 2X42A 3GBSA 3EQ7A 2M32A 4LQLA 4O0LA 4QATA 3D6UA 1EMDA 1U4NA 1I6WA 2BEJA 1DJQA 2P6NA 3L0PA 3PQ4A 4ZC1A 4KRFA 2QD4A 2DUWA 2H4JA 3EMDA 3O90A 1HE1C 4DV0B 1D4FA 4UU8A 1GTG1 2PY6A 2XB8A 3TOCA 4WIAA 1NQ5A 2IYEA 3LBNA 3OT1B 4A8PA 1IZ8A 1ZH6A 3PT5A 2H9AA 3OFJA 3G2LA 1LBEA 5AW1A 3HXTA 2ZWIA 3LCVB 3GGOA 3U7JA 3PP8A 5EXDA 1Z12A 2JEYA 3FLEA 4HAOA 5DT2A 4FQ7A 2IYPA 5LNK1 5DIFA 2CK3A 2IBSA 1SCJA 2HRQA 4E4YA 1Z0SA 4QM6A 4ZT7A 1X39A 1E5VA 1L7NA 4URVR 3P9KA 4YMHA 1I5OA 1OH7A 3HTXA 4B6EA 1SVLA 1Q0QA 1LPOA 2JCBA 2D1RA 1ZOOA 2FWAA 3BA6A 1DKMA 4KE6A 4KWEA 4AT1A 3E3LA 3G9QA 4TKVB 4WZZA 3D59A 4QTXA 1AHIA 5CFPA 3KSUA 1ZSVA 2PIDA 1MAWA 4DW8A 4N8EA 4M9XA 1JHVA 1XZDA 2DH6A 2G07A 3CLRC 1C8VB 3E8XA 4HEA1 4JYAB 1FNSA 2IL1A 4TSKA 3FNQA 3S5UA 4BAGA 3ED1A 3EC2A 5KINB 1J09A 2X86A 3BZBA 3QV1A 2WG2A 4BQSA 3K20A 1MZVA 1RXEA 1QQ6A 1FXWF 1ZVQA 2AGVA 3JZIA 4K6MA 4F3NA 3AIIA 2BSQA 1AV6A 2MSCB 2GAJA 1P1RA 2XPCA 2VJPA 1FL9A 4D6XA 5A6SB 4J4TA 1H0RA 1WMEA 1XZCA 4JITA 3A1UA 1PR9A 4PLWA 3W3ZB 4BNFA 2IT1A 3LRPA 4FN4A 1PNOA 3RUAA 3VZPA 1MB3A 5ICEA 3Q2IA 4JLJA 3RYIB 2J5QA 1FQOA 1Y3FE 1FNNA 2WYOA 1V8ZA 5EHGA 4DPLA 1IZZA 1YZQA 4CDRA 1XEXB 4TKUB 5CT6A 2NN3C 1DQNA 4R9UC 3IL2A 4X00A 5LOVF 5DM0A 5KHAA 4ZAZA 3GJ7A 1Y63A 1DKOA 3DCJA 2O3TA 2ZUUA 2QU7A 5FI0B 1JAYA 3HUEA 4GAEA 3VTFA 4D5EA 3H42B 5AESA 1J2EA 2PT7A 2VFAA 5DTMA 1MEJA 3OIYA 3ZLJA 4PCUA 2E4AA 1C3LA 5JWOA 1YAHA 1QZTA 2PQ2A 4M0MA 1D0IA 2YHIB 5D3MB 1T4BA 1KJYA 1MF7A 3B5JA 3TFWA 3VH3A 1LQUA 1T9AA 1TTHA 4X7PA 2FUKA 1R6TA 3K1AB 4BWFB 4PBSA 3USCS 2WOOA 3PNSA 4M0CA 5DGHA 1EHIA 1W0JA 3GPDG 3VO1A 4DLPA 4ZOLF 5F51A 4WVLA 3E7PA 4FNMA 4LYYA 4P2GA 5CUQA 4RTLA 4B3IA 3LDAA 4FYWA 1FW6A 3RC9A 1IEQA 4I9UA 3L8EA 4YIKA 4YV1A 1MB9A 1SURA 1M66A 1Q7RA 1RYHA 1ZM4A 2DRIA 2HTEA 2ODTX 2I1QA 1W9MA 2RK4A 2ZWPA 3OZVA 3UWPA 2XXBA 1LK7A 4NEQA 4ZU3A 1P5RA 3P2OA 4UKDA 3KM0A 3MS2A 3C8DA 2PX4A 1OFVA 1PZNA 5K3EA 1PNTA 5AOVA 2O0KA 3VOTA 2P78A 4D42A 2H1OA 3F6SA 2FWRA 1FFAA 3SKXA 3B3AA 3UAGA 3U7FB 3KZ1E 5GVRA 3EZ6A 4TV8F 3SKYA 1GTVA 4OXQA 4V3BA 3HY6A 4FFVA 1KK2A 1O87A 2AJDA 4WBNA 4QYWA 4JCCA 4V0QA 6GPBA 4NG5A 4AKIA 2OFXA 3BE5A 1UM9B 3RI3A 1H8HA 4WCDA 2NV6A 4H0CA 2SICE 4ZOEA 4ZYYA 2BJWA 3NDJA 5KOJB 3LAWA 1EH5A 1NXPA 3SXUB 5HE9A 2WPNA 3DAOA 4QJBA 2ZAOA 4I1RA 1QP7A 1HNXB 1ZGHA 2CDCA 3QA9A 4HEJA 4WMLA 2JH3A 2C5HA 4AWAA 4Z6KA 2ZDHA 2P91A 1CNFA 5LXTA 1EJBA 4KP7A 5DNVA 1CUBA 3CB4A 1WCYA 3C1AA 4EPXA 3V1KA 4W5NA 3WX0A 2AJ8A 2VYVA 4QUGA 3O2NA 3RUHA 2D2EA 2I5PO 1MEOA 3AL2A 1SQSA 3FPLA 2AMVA 2C9CA 4I4TB 2PGXA 1EVJA 3VDMA 3WZLA 2P67A 2Q5FA 4RAQA 5DXAA 1ZCAA 3P0JA 3ZW9A 1G6Q1 2JZNA 2WKSA 3W6PA 3BRCA 1EFPA 1II8A 2CZGA 2FA9A 4KO8A 5J4YA 1RC8A 2YICA 5HS4A 3EFEA 3WZMA 4DCPA 1MP0A 2JF0A 2HGZA 2BVNA 3ZVNA 3CPSA 3Q41A 3FAZA 1PX2A 1REQB 4MWDA 2VPWA 2D0IA 4MA4A 4ZVQA 4M83A 2PSJA 2OD9A 2IS4A 2H1WA 4EEXA 1KAEA 2HDNB 2VYCA 3MA0A 3NNSA 3L7NA 4R8LA 3ZIAA 4L4YA 3U62A 4WJKB 3WWEA 4B76A 5LD2B 3U3XA 2FCRA 1RYZA 2V7PA 5EY5B 1TZKA 1BAPA 3FSGD 4FHDA 2PGAA 3A27A 1YONA 2DWQA 5KVCA 1FFYA 4LJ6A 5FIUA 2YOGA 1R1DA 2HMSA 1GXSA 2SKEA 1S02A 5AOBA 5FL3A 1GUBA 2YASA 1JAZA 3BQNB 4MRMB 1OMOA 3FGPA 2E21A 3I72A 2RAVA 4KC0A 3RU9A 1E3LA 5KYTA 2Y67A 1I3CA 2ZJ6A 1WP4A 4JB8A 1VYTA 1C29B 4Y2TA 1ESDA 3G5MA 3LUAA 3GQBB 4C6HA 4X20A 3OPNA 4KJZA 4UHJA 1NA5A 3QPUA 4X3PA 2QF7A 1M8JA 5DH9A 4FR2A 3TD9A 5F7XA 5YASA 2FW0A 3A1TA 3N59A 4JC8A 4EP1A 1ZUIA 3QX3A 2YJNA 4B2YA 3GXBA 1J5XA 2ORIA 3A7EA 5FI5A 4EQZA 2WW8A 5JO9A 2GZ1A 3GLFB 3CEAA 3JQ7A 4B7AA 1HDZA 4MQMA 3WXMA 3EEYA 5I47A 4NCNA 2OSVA 2Q3LA 5DOZA 2WKWA 4D0GA 4L28A 1OWNA 2VWQA 2XMBA 3LSTA 1Z6YA 1NVGA 1PVDA 4PGAA 2V6FA 2BTEA 2QGNA 5KJEA 4R0NA 2G70A 3EZ9A 5CLJA 3MCTA 2YWJA 3BJEA 2FJ0A 1RM0A 4I81A 4WN3A 5C34B 1W0KA 1X94A 4X3CA 1NVWQ 4RPCA 5DM1A 1QF7A 5JWHA 3GN2A 4BDSA 2R8XA 2WYUA 5I7UA 1YGYA 1CQIB 4P3KA 3HA5A 3LOUA 3CZRA 2WWWA 2P9GA 3VSDA 3CINA 3VU1A 5FOQA 2B20A 2W70A 1C9NA 1QOPB 1X9IA 3CH5A 3DZJA 4H7IA 4IHJA 4Q9KA 1IY1A 5AO9A 5EP3A 4C0QC 1Z2EA 4CMBA 1COWD 1XDUA 2D1YA 4MPRA 1I2MA 4OAOA 3ZTTA 4J3JA 3R5XA 2VA9A 1F5NA 3B60A 2TECE 1U28A 2QG6A 5JMPA 4RCZA 5U9CA 1DTWA 3GVHA 4AJHA 2QTLA 3I3SR 3ETGA 3BWDD 1WW8A 2KQUA 2VUHB 1T5SA 1IY9A 2OCDA 3JVIA 5FUYA 1SVOA 1LRLA 1QQBA 1XYGA 1U04A 2WKQA 1QONA 2Q27A 3TAUA 2VRBA 2XGSA 4Q48A 3ZLUA 3FTCA 1X19A 4X1IB 1G42A 4Z4CA 3E9CA 4IXNA 3B8HA 2WUWE 2CMDA 1HC7A 3ENQA 5BQPA 2MOKA 4ZICA 2B8JA 3KYDA 5EI5A 4F97A 4EVRA 1BXRA 2PD4A 3RHFA 3WKCA 3PDHA 5F5NA 3UWDA 2ZM6B 1OWMA 1PJLA 3TAXA 3ND8A 1PQWA 4GOLD 1NT2A 1Q2UA 4EHLA 1PS0A 2NP7A 5LBIA 4X84A 3M9LA 5JCPA 3KWMA 4MUYA 4N12A 5DULA 4D0LB 1AHPA 1KO4A 2J0SA 3P5SA 1UBKS 2QM0A 3DE4X 4DLRA 3U48A 1EB9A 3LYAA 1VL5A 4Q05A 1C2YA 1EEHA 2ID4A 2C3UA 2PUDA 1M6EX 3F5FA 3ZJ4A 1GPWB 3LKDA 3LY7A 5E9JA 1CUDA 2HSGA 4R2MA 5AVQA 5BWCA 1E0DA 1Y4AE 2DHCA 2RAFA 3G13A 4IG9A 4BLRA 1T6XA 2GAFA 3CB2A 2QT9A 3JQ9A 4WV3A 2X0RA 5AKLA 5DWVA 1D1PA 3SOZA 4J03A 2CB0A 4BV3A 2W4IA 4M9UA 4QBIA 1XA4A 2XTNA 4ND2A 3RWMB 3ZD6A 1NBMD 4RH1A 5C0OE 3I2KA 5CEEA 4W9MC 1T4CA 1JNXX 1W88B 2OD2A 3G0CA 3IV6A 3ROEA 2VAWA 1KMCA 1W75A 3CHYA 1JHQA 1T9CA 2RH4A 3EZLA 3KJGA 3KHKA 4FHGA 5EIAA 4JI7B 4OA5A 1UINA 2GZRA 1IWBB 2BMDA 4CKXA 3NGMA 4F4IA 5BT9A 3T7CA 4M1YA 4I1IA 1XX6A 4D4IA 3DXYA 1BO6A 2F7SA 3L5KA 3QEKA 4I46A 1VMEA 2QN2A 1U3FA 2P65A 2WD7B 4G0XA 5HMMA 5KVQA 5IKPA 3VI3B 4CT0A 1AE1A 2B78A 4E0BA 3ELUA 2Q28A 4DS3A 5M2QA 3VAAA 3C3AA 3AKEA 2O8BB 3R5FA 2G67A 3GJ5A 4JLAA 3OQPA 3K4PA 1RZRD 3N7UA 1RWXA 1OD6A 1FTNA 1KGDA 4MMXB 1ARZA 3W1EA 3ZCPA 1S2OA 4N3AA 1ZLXA 4OSEA 4DV5B 2P4EA 3OJCA 1N3LA 3QE2A 4QAJA 2PJUA 2SNIE 3M5CA 2GJ4A 1WUHS 2FWPA 2WIFA 1PEYA 1SD1A 3IUPA 3NNDA 4FEYA 2C97A 5U1PA 3D6MA 2EDCA 1K8ZB 3NT2A 4BNGA 2ZB7A 2PGJA 4RESA 5DWQA 3IAUA 1SOVA 4ZAVA 3Q10A 5FJIA 1MC1A 3PUIA 4RHUA 3CH4B 1G8KA 2IUUA 5DK4A 1O94A 3PFWO 1EP9A 2VJQA 1C7EA 2CVPA 3LVRE 3QUQA 1C0LA 1OTXA 1K86A 2J30A 2Y92A 2F9MA 4PO8A 2H7CA 3GRUA 3KJEA 4YO8A 3H97A 4YMUA 5KSPA 3WK4A 1NWHA 1ZMXA 3BERA 2R6AA 4TX1A 4KPFC 4YRMA 1Z8HA 3A3NA 4TQGA 3QOYA 5J43A 1G5RA 4YJKA 4H6PA 3TQCA 3QIVA 5E2BA 1QU3A 3I8XA 1SKMA 1KJ9A 4W5JA 4U4AA 4HN9A 1OJLA 1YIOA 2ZRJA 4TYYA 2PA0A 3ZD8A 4RQUA 2BWJA 2R25B 4BTVA 5DI3A 5GJCA 2PWPA 1DFIA 1PP4A 4YFVA 4NONA 3JQ8A 3UWMA 3H2SA 1Q15A 4HNTA 1NOKA 3TLEA 3S0JA 4KN5A 1L8OA 1YS1X 3ANMA 3DO6A 3MTJA 3VYUB 4HNVA 4W7HA 4R41A 4AMGA 5K0BA 2V7XA 4BV2A 4WGFA 1XLTA 1ZK1A 4H16A 1GZUA 1ZNYA 4OMFG 3K9NA 4GSLA 3I53A 5F1PA 5CBPA 4UPEA 2HH9A 2V9CA 1BXKA 2I66A 1YCFA 2D5IA 2YNMD 1A8QA 2QP3A 2ZTUA 5EZYF 1OLUB 2NO7A 1XVVA 3QKWA 1J1UA 4BMCA 4QD3A 4MUBA 3AHDA 4QUHA 1IHDA 4KSBA 1ZEMA 3IMCA 2JGEA 2WWVD 1JR6A 3R77A 3M6XA 4EQ6A 4F4HA 4DRYA 1M2JA 2X5JO 1GTSA 2NUTA 2QYSA 1D0VA 5CA1B 4ACBA 1PCXA 1J0XO 2BISA 1FB5A 1N2HA 1GNRA 5SYNA 1KARA 2ZJ4A 3EG9A 1Z5VA 4NBUA 3L4BA 3RKUA 4WBSA 4L5CA 4BNWA 2AQHA 3ZG6A 1E18A 1DOAA 3H4VA 1NXWA 3B5IA 4Z2AA 1U9JA 1FX0B 2XYHA 3W34A 2N1BA 1D3AA 2WD7A 5IAKA 4EHAA 3H9GA 3OY7A 5I9NA 1J6UA 3A7DA 1XLTC 3IILA 4FZJA 3PXEA 4WFQA 4F45A 3CUEF 4ZYWA 4CT4B 2VJMB 4HVLA 2B92A 2F1OA 2YS6A 1F51E 2B4KA 4PLVA 4Q4DA 2Y6VA 3I9NA 4EHDA 8AT1A 2IHTA 2DBVO 4RPGA 2VP0A 1GDTA 1DJOA 1GEEA 4GL4A 4F60A 3E7XA 3QVTA 3AI2A 5KYXA 1O1YA 3R2JA 4JSRA 1Z5UA 2JBHA 2JK0A 4RA9A 4CL2A 1U0EA 2QPLA 5BNFA 1G20E 3KKZA 4PO1A 5G2OA 5B30A 3ZWQA 1TO6A 3MCZA 4UNPA 1XAIA 3A6KA 4ZT2A 2DE0X 1BGXT 3TZKA 3M49A 4LI3X 1TTTA 3GL9A 3S1SA 1HNWB 4GMFA 1UCFA 3EA0A 3A11A 1DG3A 1DSSG 3B9RA 3MWJA 2IGTA 1PSWA 4UBIA 2QN1A 2CJPA 4V0MA 5JY1A 2Q3DA 1P62B 2V7UA 3DE3X 1NBEA 2PMCA 2EP5A 3PNPA 1U7TA 4CG3A 3D4OA 4IGFA 1UDRA 3AR6A 3ZYZA 3U7HB 3C4VA 2BF7A 3ZZNA 3M1LA 1FDWA 3STXA 4NBNA 3OZXA 5K09A 1JSRA 2WABA 1E3QA 2GTHA 4JOCA 5LQSA 3KZVA 4YT4A 1NZFA 3CURA 3ICQB 4NV3A 3FCUB 2ZBRA 1MEEA 3MTDA 3LO8A 3FYUA 1EBBA 3LDGA 3W05A 3WQSB 3H1AA 3TWOA 4NMMA 3MJVA 1IXYA 1V71A 1G8JA 2GPJA 1OFHA 4MB6A 5DGDA 4CFYA 5FHQA 4CM9A 2GK3A 2FP3A 1KMQA 3LUGA 3U7QB 1RP1A 4R69A 3HXLA 4RGQA 3SC2B 3FD8A 2VCYA 4BFXA 1W87A 3FNFA 1CE8A 4IIHA 1PQUA 4LSWA 2CKMA 3P19A 1TU0A 4JLNA 3IESA 4DUGD 5L3QB 2FW6A 1VGRA 4CHGA 1L8LA 2HMWA 1K5HA 2I62A 2X0FA 1A5SB 4RXTA 4CIDA 4FC7A 1Z33A 2QY9A 4KR0A 5FFFA 2L42A 4MVJM 4NBVA 4CV1A 4EHHA 1NAIA 2X9VA 1SIBE 2CFIA 1FE8A 3ZC3A 1X1TA 2B5VA 3W8RA 1E1DA 1JHZA 2WAOA 2XXAA 4MVJG 2B1JA 1GG5A 4FEGA 3IEXA 4ZDWA 5G3ZA 4ENUA 2W8ZA 3VH4A 4PLGA 4DCOA 5LC1A 3W8EA 4LJLA 5CB4A 4QG3A 4DR6B 2JDID 4RTRA 2BJVA 4WECA 2RC5A 2Z2IA 1E1CA 2R6DA 3LUBA 3T7RA 2AOTA 2G17A 1IY0A 1G6HA 1XAGA 2BMEA 2BLLA 5IKOA 2YZ7A 2OM6A 3A3YA 5HMLA 3ORQA 5B4TA 1GADO 3WHLA 1T8PA 1N5LA 2JGDA 3IP6A 3P9PA 2ZRMA 2IU4A 2WJHA 2YXEA 5TXGA 3W8DA 3S4YA 4IS2A 3ONWA 4ETMA 1IC6A 3TBFA 4K26A 3UUFA 4IFEA 4O4JA 4F3TA 2I29A 3F5MA 2IYZA 1OBVA 2ZS9A 3UW1A 1EK5A 1KQFA