1NVXQ

Structural evidence for feedback activation by rasgtp of the ras-specific nucleotide exchange factor sos
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTGGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for feedback activation by RasGTP of the Ras-specific nucleotide exchange factor SOS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Transforming protein p21/H-RAS-1
total genus 60
structure length 166
sequence length 166
chains with identical sequence R
ec nomenclature
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nvxQ00
5KYKA 3NHBA 4LHYA 2JATA 3NBXX 3TR5A 5DISB 2GJSA 3SJAA 2FV8A 1IXRC 5CDFE 3CKLA 4Q1BA 2XNSA 4URZR 5C2JB 4TT3D 3NXSA 5J4VA 3K0SA 1UF9A 1M7BA 2J5XA 2YWFA 5KSYA 2G77B 1AGRA 4B47A 4CGZA 2VO1A 1Z0IA 1CU1A 2V6JA 1E1RA 2OAQ1 2ZRPA 2KI5A 2GDJA 4R71A 1F5NA 821PA 4HAYA 3DMNA 3NC0C 2O8EA 1D5CA 2HLDD 2ORIA 2ZUDA 1U8AA 3R7WA 4CEJB 1Y3AA 3WYAA 5FUVA 5JWRA 4W5WA 1M1YE 3IEVA 3U7FB 4Q1CA 1TX4B 1W2GA 1NNEA 3REFA 1NVUQ 2F43B 4U5XA 3AM1A 3FDIA 3VQTA 3O8BA 4BLRA 2H8KA 1E0KA 3K09C 3DMDA 4NYJR 1ZIPA 4GBMA 5L3RA 3WXMA 4AURA 1XEXB 4PHTA 3B7GA 2CLDX 2WBLC 2WVJA 3QXHA 3GCGA 3PENA 1IY1A 4ON9A 4EFMA 1ZUHA 4V0NA 4AG5A 5K8UA 5L3SB 3VR2A 3AUXA 4Q4LA 4M1SA 4OHWA 3UMSA 4ZDIA 1RC8A 1CXZA 1UDXA 3CRMA 2RGNC 1U98A 4EPRA 2C9YA 3U60B 2ODNA 2ECKA 5KUTA 1Q1BA 1M6NA 2GILA 2GAOA 3FMIA 1ZD9A 2JDID 3NDPA 4PAMA 3BRWD 1WB9A 4KBFA 4NH0A 2JLVA 1VECA 1TQDA 3GFTA 2ZRJA 3P26A 4PZYA 4Q18A 1U8ZA 1KHTA 4ARZA 4B73A 3AQ4A 1U0HC 1G21E 1FZQA 1AS3A 4D6PA 5EE3A 5BN4A 1N0VC 5HZHA 1FNNA 3LBIA 4K8OA 4IFEA 4UXIA 1IXZA 1N6PA 3EWSA 3ZJYA 1F2UA 4TMKA 2ODEA 2WWGA 1WF3A 4GOJA 5CJ2A 5B57C 1IQPA 4A0FA 4RKEA 1LF0A 5GJCA 5G41A 1VCOA 4NCJA 3E70C 1MT0A 1PLKA 2PLRA 2ZRBA 4JJZA 4POAA 1KOFA 1XJQA 2E87A 5LPNA 1T8UA 4OHYA 4IXMA 5A5GA 4B3DA 4LBVA 1TEXA 5EUQB 4E07A 3R8CA 1L7VC 2VSOA 2HCJB 3SYKA 2V8OA 1H65A 4YDSA 3SNHA 2AK2A 1ONBA 1XCGB 1SKYE 2N46A 3W8RA 1YZQA 2DFKB 1S9DA 3MCAA 4Q9IA 3DKVA 2PZFA 3MUFA 4LJAA 5KNDA 4Q4JA 1CR2A 1N6LA 1DEKA 1Q1EA 3UK6A 3K70B 3ZS8A 2O0HA 2FZ4A 3CIOA 4ZDJA 1YR8A 3A6PC 3PUXA 3EIQA 2EQBA 3LDAA 3P27A 1XX6A 1G9XA 1EGAA 1HH4A 1BMFD 4LYJA 1GTVA 5FTMA 1T3LA 4PXAA 4DB2A 2IEZA 1E2KA 1TQ4A 2FPLA 2XAUA 1EXMA 1SHZA 1MV5A 2JGNA 2PCJA 3K0CC 1YQTA 4JJKA 1HV8A 1XPOA 3A4LA 2XGJA 3DO6A 1ZNXA 3BOSA 4OK6A 1SGWA 2MSDB 2I1VB 2XJ4A 2YWEA 3MJHA 2KWIA 1A4RA 3FYHA 2V54A 4Q1EA 3REGA 5EZ5A 2YOHA 4DUGD 4RD4A 3VX4A 1HQCA 4G1UC 4KO8A 4QHSA 2O8FB 3NVAA 4IDOA 4B6EA 2HV8A 3FFAA 2W2VA 5JECA 4HLUC 1G3UA 2C98A 3LQRA 4LV6A 3BB1A 5DI9A 4DLRA 4PX9A 1PVOA 1TL7C 1UKYA 2JAQA 2ZRLA 3BFXA 3MSXA 4BFYA 1NSTA 1FUUA 3RRYA 5A4JA 2R8RA 1JEDA 3AKDA 1ZM2A 4Q9JA 4Q7LA 5AJYA 3ASYA 1RRFA 3QF7A 2FMXA 2VP2A 1KTVA 3PIRA 3ADKA 1W1WA 4HDQB 4LGMA 1KO4A 2R44A 3PUZA 4TL8A 4AYTA 1J8YF 4HUQB 4DKXA 4GL2A 3I5XA 1AKEA 1HE8B 3QJYA 4NCKA 4RFSA 3PEWA 1XEWY 2ZR7A 3KJEA 4FMBB 4JLKA 4U00A 1KK3A 2A5FA 4DHEA 1UADA 2ZR0A 1VCMA 1R8SA 5TMPA 1R5BA 2QQ0A 2V1UA 2A5DA 3B1YA 1UEIA 3ZIAD 2PEYA 2EWWA 4MRNA 4BGDA 3MWJA 3MWKA 1E9AA 4A4DA 3UIEA 2GBLC 4NCIA 4ZDWA 1Z22A 1G7SA 4BZPA 3ECCA 3QKTA 3C4JA 5JHHB 521PA 3EZFA 3THWB 2A3RA 4OJQA 2WJYA 1R5OA 1Q22A 1OFUX 1KIMA 1W4CA 4B71A 2KSQA 1XTKA 1ZM4A 3S1AB 4ZV4A 4YONB 1T5LA 1R0XA 2G0TA 5KSOA 1E3MA 1VKJA 4AKEA 1KI2A 1KZGB 1M2OB 3I32A 3GLHA 1AQYA 5EXSA 4Z54A 3HU1A 2DYKA 3ZZ0A 4JL5A 2QAGC 4C7OB 1YHNA 1R4AA 3AVTA 1FX0A 2IYUA 2FSFA 3SJZA 4QJ4A 2PCLA 4NKRA 3KFXA 1NVXQ 4DEXA 2AR7A 2IYXA 4DWJA 4KU4A 3FE2A 3TVTA 3SR0A 4QGFA 4ITRC 2XOKD 2VL7A 2ZRGA 4QRHA 4MRSA 5L3QA 1Y63A 1PZNA 4G5GA 3K9NA 5CK5A 4ZIRB 3SE0A 5HR5A 4ERNA 5BWMA 4M22A 3IPYA 5JJKA 2OM2A 3U44A 1X1RA 2ZE8A 3JZAA 4HLDA 3SBEA 2BJWA 3T06B 1CIPA 1ZU5A 4G3XA 3K9HA 4DT1B 5LD2B 4JKIA 1QRAA 3D7MA 3VR1A 4OYHA 1W5SA 1P9NA 4MYUA 3TIFA 1SKYB 4G0NA 4KBGA 1CRQA 4QJ5A 4MYCA 2BWJA 2J45A 5J4HA 1XZPA 4C0BA 1Z06A 4EAQA 2GF9A 3IKJA 5ANRB 3E2IA 2ZYUX 5L3QB 2F3RA 4A8JC 5FFMA 2YWHA 4HUQA 3G5UA 1EFCA 4OBEA 5FOWA 2GTPA 4C4PA 1OH5A 4NTZA 3BH7A 1YVDA 4AD8A 1XZQA 2ZI5A 4HB0A 5JZVA 2BMFA 4MKFA 3WHLA 4JLDA 3K0EA 5EP3A 4EPTA 5JWOA 2WOJA 2EFDB 4MRVA 1MRSA 1JXOA 2QE7D 5JSZA 5E7JA 3UKDA 2V3CC 1XDBA 2IS6A 2QT1A 3BGWA 1JAHA 3NDBB 3KQKA 3RSOA 2NO6A 3KQLA 1XXHE 1Q21A 2KE5A 2SHKA 4LJ5A 4LRWA 4OI2A 3O8DA 3RAPR 5JBQA 1KI6A 4ZI3A 2ZYVX 5DHAA 4QHYA 2CL7X 5KSZA 1N3BA 1KI9A 3RDPA 4PC7A 4D82A 4O0MA 4RY2A 4ZPXA 5F9FA 4DEYA 3M1IA 3CWZA 1A1VA 1TADA 2IL1A 5DYGA 4LSGA 3MGCA 4OQNA 3LVQE 4QBFA 3L0PA 1CJKC 1JNYA 2BKUA 2QSYA 2ZJ5A 4IFBA 3TKLA 1MABA 4F7WA 4TN1A 2OAP1 1EFHA 2EFCB 2ZJOA 4DJTA 3ZDQA 3ND9A 1FUKA 3A1TA 2O8EB 4PHGA 3WNDA 1OB2A 2ANBA 5EXPA 3JVVA 4L4UA 2ZS8A 3PUYA 2V7QA 3IGFA 2AD1A 2LKCA 2ERYA 4LOAA 4LV8B 1R7RA 4IOMA 3KQNA 4A6XA 5FOSA 2LCFA 1XXHA 1EFUA 3MRSA 2CDNA 1DAMA 2XZPA 4G5SA 4RKFA 1U8YA 2ZI7A 3QXJA 2CJWA 3IQWA 3LVRE 4LC0A 4HAZA 4TYYA 3MMPA 1X8LA 5GVRA 5CK4A 1OSNA 5TV2A 1AGPA 4JBWA 1OYWA 3D31A 2ZRFA 1TEVA 3IIJA 2P6UA 4LJ8A 4ZCIA 3OIVA 3TNFA 2GJ9A 1UBCA 1ZM7A 5TVKA 4V0ME 1DARA 1KNXA 2BBSA 4FN5A 2FA9A 1JQJC 3IQXA 2C9CA 1Q3TA 3VU9A 3EPLA 5EQTA 2ZE6A 2QAGB 6Q21A 3KQUA 5C4MA 1XPUA 4AKHA 1DAEA 1IY2A 2W6JD 4MGKR 3FOZA 2FZLA 2F9MA 4JLJA 3GLFA 1SVLA 2VLIA 4RVCA 1Z6YA 4BFVA 4FWTA 4NBSA 3QKUA 2QGNA 4A36A 4LZZA 4AC9A 1OH6A 2PLFA 4BE7B 3K9GA 2OCPA 4TL6A 5J5CA 1WP9A 4KYUA 4G5RA 3BK7A 2RGGA 3BERA 4PTLA 5HE9A 3W90A 2L0XA 4LHXA 4B34A 4KXFB 1DAGA 4TSFD 1Z2AA 3KFVA 4NDZA 3K9LA 3AKYA 2YOGA 1P6XA 4GMXA 2W6IA 1OFHA 1W0KA 4B3GA 4NCHA 2C5LA 4Y0AA 2YKGA 3SFZA 2VP6A 4MKIA 4MKHA 3DOEA 2O8CB 1IJEA 4B3CA 5JJIA 2FFQA 3X1YA 1VTKA 5E4FA 1CBUA 3G82C 1E0SA 4URVR 2QN6A 3PXGA 2X2EA 1QDEA 1NJGA 1GIAA 4MKGA 4EDHA 2IUTA 2WV9A 3KUCA 4AWXA 3MD0A 2FFBA 2KBFA 2W0MA 4R2IA 5TDHA 1COWA 2BKEA 4A8JA 3MAAC 3THYA 3AP3A 4OQXA 1U94A 3H1TA 1W47A 3RVBA 3RS2A 4JKYA 1Z63A 3PV0A 4PZLA 2R6AA 4DSUA 4AY2A 2XEXA 3A1VA 2UZ3A 3QENA 5DHFA 4OI4A 4L15A 5FOXA 2ASEA 4A8JB 721PA 3THYB 2IF2A 4EUNA 3QPVA 4C30A 5CJPA 4F91B 1ZCAA 5FI1B 1FFHA 2HT6A 3BJIC 1RYFA 2P2LA 4X8OA 3ZZTA 2HXYA 3FGNA 3AF2A 1G3IA 3QG5A 2ZR9A 4NE2A 2VHCA 2AD5A 2QMOA 1Z0FA 2IWHA 1AQUA 1XD2A 2FNAA 3E1SA 1KMQA 3BB3A 1N5IA 2QZ4A 4KSCA 4NL4H 3VR6A 2WJHA 2YC4C 1UBGA 4E03A 3OEHD 2CEAA 3GJ7A 5CM8B 1ZU4A 2QRZA 2GJ8A 1CS4C 1I2DA 2PBRA 3U3OA 3RS0A 2IXFA 2CHVA 1PUJA 5L3VA 1W4AA 4OKSA 5CLLA 1H8HD 1RVDA 1WRBA 2JJ2D 5BQ5A 2O8BB 2QP3A 2AN9A 3CZQA 1VYUA 3UMRA 4YMSA 3NG1A 4BEBA 3I62A 3ICQB 3DHWC 3UWKA 5IT5A 4FD2A 4LBZA 1QBKC 2IYLD 2ZRNA 3U3MA 4M1KA 2LWIA 1W5TA 2J87A 2G1KA 5AK0A 1N25A 1HY3A 4GPTA 1VG0B 4V0MA 2ZEJA 3D3QA 4RZUA 3TW8B 2O8CA 1R2QA 1IONA 4BASA 2MMCA 4BEJA 1G8PA 4P4SA 2UKDA 2BC9A 3KKOA 4LY6A 3WP1B 2V4ZA 3T34A 3GLHE 4MRPA 1HYQA 3TUZC 4B2LA 4AKIA 3AGQA 5CB8A 4HAXA 1NMZA 3T1TA 3HPQA 4YC7A 4Q19A 1C4OA 5LB4A 3P1JA 3PFIA 3GLHB 4TYQA 5CITA 4CW7A 3OIWA 3LQQA 5DLQC 1IN6A 3F8TA 3KB1A 1XCMA 2IYVA 1TF5A 5KDOA 1LW7A 3CRW1 4B48A 3L43A 4RZ2A 4ZDKA 4F4CA 1JR6A 2HF8A 1PLLA 2XTZA 3LA6A 2ZI4A 4D0NA 3FMPB 4BZQA 3WRYC 2CCJA 3I3SR 2K5UA 4ACBA 2JLXA 3NH6A 3ZVMA 2D7DA 3SEAA 1NI3A 4DXAA 3IPXA 4IVRA 2PX0A 1D6JA 3QVUA 1OXXK 1CJTC 2QU8A 4KCGA 2FOLA 3W34A 1GILA 1GNPA 1YZUA 2ZYWX 3LBHA 1Z0JA 4GZMA 4OHXA 4TYWA 2WMNB 2FJUA 3SC3A 2DFLA 1R10A 3OIYA 3P4YA 4M53A 4V0OA 3ZVRA 4ABYA 1MH1A 1GNQA 1II0A 3THXB 4D4MA 4I81A 4Z1MD 4PSAA 1H8EA 2Y8EA 1KAGA 2QBYB 4DDVA 5FR1A 2XB2A 1JR3D 2IXEA 4IXNA 1E1RD 1CR0A 1CULC 1YZTA 3U2QA 4TZ0A 1NSFA 2OBMA 5FOUA 4L16A 1E0AA 1UKEA 2Q3FA 5AJXA 2OLKA 3B1VA 4KLNA 4TMWA 4UKDA 1T3HA 4OI1A 1N0UA 3U44B 4IOLA 2OXCA 2VHUA 3I72A 3K8YA 3EARA 3O8RA 3NEJA 2I4IA 4FI3C 1BYUA 1LTQA 3TSZA 4ARZB 1RFLA 3GLGE 1E6CA 2EVWX 2W00A 4LHZA 4WVFA 5F2EA 3CF0A 2RCNA 4A0RA 2G9NA 5C18A 3THOA 2OFOA 3TGPA 1BKDR 5D3QA 1WDTA 2QAJA 2HEIA 4HYYA 2D62A 1RPZA 1NLZA 1NVWQ 4EJSC 4MYTA 4EFLA 4DBLC 3GLGB 1JR3A 3LXRA 2OCBA 2GCNA 5IRCD 1FTSA 1U90A 2IHBA 2WKQA 2ZM5A 2H7VA 4LYFA 2EFGA 4JYCA 2PX3A 5EP4A 2OFXA 3QVVA 1F2UB 5GADl 2D4HA 1QHHA 4GZLA 4JL8A 4GP7A 1V5WA 5IK2A 1M34E 1Z0DA 3HYTA 3S1AA 2J41A 3KJHA 4ZO4A 1MR3F 5CYOA 1E9SA 4L8GA 3T15A 121PA 2JJ1D 3T35A 5JEEA 4UXJA 1T9HA 3B85A 4H1VA 4JLVA 5FUYA 1S4QA 1OYYA 1WQ1R 5UKDA 3SHWA 3ZVNA 2WAYA 4LCBA 4PAOA 4L9SA 3VMFA 1YR9A 3OHMA 1KO7A 2G0NA 3FB4A 1G8FA 2G83A 1FQKA 3PVSA 1CJMA 2C03A 4QBHA 4MDFA 4L5BA 3CLVA 3X1XA 1BS1A 1L4UA 1W0JA 4OHVA 1OT3A 2WJIA 4JVSB 1E0JA 4M1WA 2REXB 1RKBA 1F6BA 1DG1G 1DTSA 3A4NA 4CEJA 1XCPA 2ZRHA 1Q1ZA 4P0TA 4Y0VA 3T1QA 3R8FA 4URUR 3RWOA 3W3AA 4A2QA 2PJRA 3KL4A 3CM0A 4AG6A 1RRPA 4JLBA 3NTUA 2WWWA 1IN4A 2BBTA 4XWOA 2ZRKA 1KI3A 1P2TA 3TQFA 3VTKA 1KJWA 2F3TA 2PZGA 4GOKA 2ONKA 3GEHA 2V6IA 4JLNA 2GEVA 2ZREA 3CH4B 5EE9A 1K8RA 2HF9A 2OEPA 4V0KA 3VNVA 4LUCA 3WP0A 2CBZA 1AA9A 4P33A 4P3YA 1RJ9B 3PUWA 4C9BA 4RD2A 1Q1QA 4WAUA 4DB4A 2B7CA 2ZRCA 3BFVA 1JECA 1VHTA 1WMSA 3GJ4A 1TNDA 1JB1A 1MO3A 2NTYC 5FPYA 5FTKA 4V03A 2J9RA 1XJ0A 4M9XA 2BEJA 5AJZA 5EP2A 1G7TA 1MOZA 4BRWA 1OF1A 2CHGA 4Q9KA 3MFYA 1NY6A 2FWRA 1E2NA 2OCYC 2P65A 2O8FA 1KSFX 4CEHA 4NCNA 2QP4A 3RNLA 4NONA 2VQSA 1L8QA 2IYTA 2ZI9A 4HLUA 4DSNA 3MJRA 1C1YA 1OIVA 2GWHA 1KSGA 2AKAB 2AX4A 4GI7A 3L2OB 1FW6A 4C0SA 4WOPA 3RS4A 3ONWA 3SOPA 4C2TA 3QBTA 2BCGY 1P3JA 4HB3A 1ESNA 1P60A 1FP7A 1ZW6A 4XWKA 5K8LA 3GLGA 4JL6A 2XXAB 2W0SA 1OLOA 3Q85A 1O87A 5EJEA 1E2FA 2CK3D 3M6AA 1HTWA 3DPUA 4N1AA 3LBNA 1VCIA 2IEYA 1KDTA 4FIDA 2BBOA 2ZI6A 4BLPA 1T5IA 2BVNA 3QPWA 1DBSA 4FMDB 4JLOA 4LJ7A 5CB6A 2OSBA 2IYSA 1E2EA 2ODBA 1EFTA 4PC1A 2PT5A 1LNZA 2EW1A 4HB4A 2BMEA 2GEUA 2VEDA 1XNJA 3X1ZA 3EPJA 4FMCF 2WICA 5FUXA 3R9XA 1GL6A 3GJ0A 3OESA 3RS7A 4US2R 4O2RA 4RSGA 2RKOA 3GLIA 5EUMA 1XEFA 3BORA 1XP8A 5TARA 2WIBA 4XD7A 2QP9X 2X1VA 2H57A 1KO1A 5DI3B 3KXIA 2XXAA 4II7A 3SJBA 4IDPA 3KJGA 3V00A 4PO9A 3KKNA 1Z07A 1A2KC 1TQ2A 4Z8XA 3EZ6A 2CE7A 2ZAOA 4M0LA 2ZJ8A 3IUYA 4ACAA 2WAXA 4M8NE 4P31A 1E79D 3PEVA 1HT1E 2C8VA 2NIPA 3PR1A 5EZ6B 1Q20A 2RGAA 4O2LA 1EFRD 4DSTA 2QM8A 4A2WA 3EASA 2VSXA 4JBYA 3AEZA 1KKLA 4JBXA 4JIMA 4QFMA 1YZLA 2CL6X 2VRWA 1KSHA 4GFDA 1E2IA 4R7ZA 1GRRA 4CYMA 3W6PA 1P62B 3IO5A 4TYPA 4D81A 5FL3A 4QG7A 4PPFA 4BLOA 2GETA 3IHWA 4FMDF 3QNUA 1SZPA 1YKSA 1M7HA 2CLCX 3VX3A 4DCVA 4C0KA 4YMVA 1LB1B 5A0FA 1P7CA 1IM2A 4QKQA 4BWYA 3LAWA 4Q4AB 4WXRA 1NJFA 5CM9C 4D4JA 4EQ6A 5IF9A 2GXSA 4HI0E 4KLZA 1DAHA 5AJWA 4YXWD 1W46A 2P67A 1Z29A 4WXPA 3BH6A 1NIPA 3OE7D 1P2SA 2AFIE 4LJ4A 5EXTA 4S35A 1KAOA 3GFPA 1C9KA 3HR8A 5KHOC 3H84A 2BM0A 5LDDC 3HPRA 1W4RA 5BXQC 3KQHA 2YZ2A 1T4GA 2G6BA 4TLEA 1YRAA 1IOZA 2VHQA 4TTRA 4US0R 1E4YA 3LW7A 2VP9A 4JVLA 5B2ZA 4CVNA 3QEOA 1HT2E 5ELXA 3CNLA 3HU2A 3UPUA 5FOVA 4DDWA 1US8B 2WKRA 3GLIB 4MQBA 4PO1A 1E79A 3CRRA 5JCPA 1E2JA 3QG1A 2Z43A 4UJ3A 3LY5A 1RRCA 2OT3B 1GOTA 1GL9B 3KJIA 4IW3B 1S1MA 5CYPA 2GHIA 2ZSBA 2VF7A 5KTYA 3BD9A 3EAQA 4BFZA 1F2TA 5KPJA 4M9SA 5FPHA 5JHGB 2TMKA 4V02A 3RC3A 1UJ2A 3VAAA 1PUIA 2OE2A 1ZNYA 1N5LA 2DR3A 4IDQA 2A7QA 2DFNA 2JLQA 4B6FA 4C0QC 2IUUA 4PC3A 1Q44A 1ZNZA 1TMKA 2VP0A 4Q9HA 1SVWA 3U61B 1Z6TA 1IXSB 1ZYUA 3FHCB 5FBQB 2NMVA 2NPIA 3AF0A 3R7WB 3EX7C 4G5QA 1DVRA 1UM8A 4B3BA 3DKPA 2ZRIA 5K8IA 2IX3A 2ZVQX 3U4QA 4TT3A 1IN7A 2J0VA 1YJ5A 4HUTA 3X1DA 1JJ7A 1QG4A 4HDOB 5SZKB 2JLSA 3CNOA 5BYKA 3GLFE 4PR0A 1OFIA 3RRNA 4DT1A 5G40A 4IOJA 1GM5A 4RCZA 4LPKA 4NYIQ 4RD0A 4HAVA 4MYHA 3RLFA 1HQYE 3SQWA 4HB2A 3PITA 1QVRA 4QL3A 2C04A 4L9WA 2REBA 1G3RA 3DVLA 1A7JA 1U9IC 3KDSE 1OIXA 1QVAA 1X8JA 2WPDD 4JSYA 4TL7A 1W48A 4NHOA 2XSZA 4YQFA 1SQ5A 1AN0A 2OV2A 2J0SA 3VKHA 3QUSA 5E7MA 4W5JA 4BLSA 3LD9A 4XTRA 2GEDA 2FPKA 1D2EA 3PEUA 2VIIA 2VF8A 5BYJA 1OIWA 2RGCA 1T0JB 3KKQA 3EIHA 4A0GA 3U7HB 4QM6A 3IO3A 2DY1A 2GXAA 5JRZA 1E2MA 1WXQA 3ZD7A 3SDZA 2Q9BA 2QT0A 4IRUB 2OHFA 1ZVQA 2OZEA 1JI0A 3OF5A 1XFAA 1UBEA 5BN3A 2IS1A 1P72A 2AWOA 4LPSA 5DYIA 5JEDA 3ND8A 4TWZA 4TMZA 2WWYA 1X3SA 2BMJA 4DDTA 2Q9CA 2R6FA 2C78A 1Q57A 2J7PD 2W83A 2WM9B 2PL3A 1NKSA 3NBYC 4HDCA 3GD7A 3T61A 1JQLB 1G6OA 4XTCS 4Q7JB 2J0UA 3B13B 3OEED 1LY1A 2WSSD 3OAAA 5J47A 3J81k 2WWHA 2ZRAA 2JJ8A 3AVQA 5GJWC 2CLSA 2H18A 1T0HB 1TUIA 1CLUA 5DN6D 2ATXA 2VHTA 4W5HA 1K5DA 4JYBA 1MABB 4F4JA 2A9KA 2EU8A 4XJXA 4X8MA 2DWQA 2JJ1A 3GP8A 3CRVA 2A5JA 3THXA 5DGXA 1NL3A 4A9AA 2JCSA 1U81A 5DO9A 4FCVA 4WBSA 4K46A 3N70A 5KU1A 1OJLA 2JEOA 3RSLA 2O5VA 4KFUA 4QBGB 1IN5A 1SKQA 4TMTA 5EE5B 2A2ZA 3B8HA 4RD1A 3TVDA 1XMIA 3RS5A 2G88A 4XSGA 3E5HA 5FBWB 3WNBA 3O47A 1S1CA 1GFIA 2ZE5A 2BJVA 2P3SA 1R0WA 4D4LA 2N42A 3L8YA 2NO7A 1ZD8A 3FHTA 3NH9A 2I3BA 4HEJA 4ZI2A 3KXLA 4A92A 3F5FA 3FFBA 3TUIC 2QBYA 3EXAA 3TAHA 4Q66C 2QTFA 4PSVA 4XH9B 1YR7A 1WA5A 2GXUA 5L3SA 2H92A 4CF7A 3KTAB 2YINC 1XF9A 2QMHA 1R5NA 5HCIA 4A0HA 1XB2A 2NQ2C 2GA8A 2ZI3A 4DLTA 1I4TD 2VH5R 4JZKA 3AH8A 3U7GA 3KKPA 5D3MA 2VP5A 2CVHA 2BOVA 1EX6A 2IYYA 1E2DA 2A5GA 2O52A 4MUAA 1G3MA 3NIBA 5FUWA 2WKPA 3DM9B 1Z3IX 3TR0A 4AK9A 3GJ3A 3CPEA 4Q7KA 2RGEA 2OLJA 2P5SA 2JLYA 1A5TA 5JLJA 1N6HA 2VA8A 5G3ZA 3IHLA 3TLXA 1OXTA 1Z8FA 3O8CA 1JR3E 3VFDA 3K0AB 4TMVA 2Q6TA 3VHLB 1JPNA 3Q72A 1NMXA 2VSFA 3WNCA 4JVMA 1FPMA 1OHHA 1ZCBA 5B30A 2Z4SA 1L4YA 4GP6A 1TQ6A 2QQEA 1QHGA 2XNDD 1DG3A 1AS0A 2OO7A 3AKEA 4H1UA 2IYQA 4DSOA 1H8ED 2QRNA 2KJQA 2WJVA 5FTNA 8OHMA 2HYIC 4KVAA 5JJLA 1KYIA 1GKYA 1UKZA 3I73A 4QM7A 4F4IA 3W9YA 5FPSA 2YC2C 2PEZA 4F38A 2ZS7A 1SULA 4B76A 1KMHB 2D74A 4PPGA 4TLCA 3SJCA 421PA 2FDCA 1J70A 1Q12A 5SZJA 3TW4A 1E2GA 1E2LA 1JEEA 1KY3A 1NN1A 4EJSB 2BMDA 2ZE7A 3N2EA 3AVVA 1H8HA 3OE7A 4Q4JB 2ZSFA 4WZ6A 5AWFC 1G4UR 3L82B 5B58C 2ANCA 1VG9B 3UANA 1CP2A 2FSGA 2QL6A 2V7QD 5FH9A 4U7DA 2F43A 3EWAA 2P5TB 2GJKA 4Q1DA 3I1FA 5TB5A 1JJVA 4YDHB 4QOSA 1QF9A 4Q1AA 4C3ZA 2PMDA 5HZKA 1U0JA 3L8ZA 1RW4A 4FMCB 2IW3A 1FNMA 4UJ5A 1G41A 4DIEA 4A82A 4LI0A 2O8BA 1SXJE 1GNRA 4FWIB 2BIFA 2Z83A 4IJMA 5FI0B 1G8YA 4QBIA 3B1ZA 1XPRA 2R65A 3ASZA 3GJ5A 2GVDC 1ZRHA 1Z28A 2NO9A 3GJ6A 4I4LA 4KITB 3EPKA 4LYAA 2OXRA 2YWGA 1G18A 2ZU6A 4H9GA 2P6RA 3VR4A 4ZIRA 1NP6A 1XEXA 3ZS9A 2FSIA 2D7CA 4NU0A 2EFEB 4UXHA 1KDRA 4DLSA 3CONA 3K09A 4EPWA 2F55A 3EZ2A 2IWRA 1XJCA 5HTKA 4D26A 3GJXC 2J3EA 4I1OA 2DWOA 3CPJB 2XTNA 3VR5A 1RZ3A 4AYXA 1KNQA 1E9BA 2ATVA 1P9RA 1GITA 4JSTA 1E4VA 2HJGA 5JSZB 1E98A 3CR7A 1DAIA 1GL7A 2FGJA 3AF1A 4HAWA 3BS4A 1ZAKA 3V9PA 2QY9A 4DLVA 3ZQJA 4B74A 1ELOA 2ZSDA 1XMSA 4HZUA 1KK1A 4ZKEA 4PPQA 5AUNB 1ZIOA 2IBMA 4IVQA 1Z47A 221PA 4EQ6B 4I99A 4WZBE 3U6BA 1E94E 1W44A 3F3YA 2ZXUA 5JMTA 3BFKA 3B78A 3GPLA 2AXPA 3QSYA 5C4GB 1ZC3A 2ZJ2A 4BFXA 3BC1A 4B33A 1NVVR 4URXR 1CTQA 3A1UA 4BZXA 1SXJA 4MDEA 4PQYA 4DCUA 2ZROA 2H17A 4TL9A 3OEHA 4N0EA 2OBLA 2VPPA 3GJ8A 3W6OA 4CIDA 2DB3A 3MG9A 3T1VA 3T1OA 1N5JA 2QROA 3CWQA 1N6KA 2C99A 3QKSA 1IBRA 2GRJA 4B2IA 3K70C 1J90A 1SVMA 2DFTA 3U3JA 1S96A 2Z4RA 4UNQA 4CT5A 3V4FA 4HZIA 3AUYA 3C7KA 4LBYA 2ONJA 2OFWA 2ZJZA 1UBFA 4JLMA 3SYNA 3A8TA 3BAFA 2FGKA 2Q3MA 1X1SA 4LX0A 4FINA 4DCSA 2XNDA 3EC1A 5HKKA 2O8DB 1G291 1KK2A 2CJWB 3A1SA 3NC1C 4PO8A 1ZMXA 2V1XA 4MH0R 3SQXA 4AI6A 1GSIA 5SZHB 3D6TB 5LBIA 2B7BA 2EFHB 1T8TA 1OXSC 5M04A 4Q48A 1OKKA 2QAGA 2ZS9A 2DWPA 1E69A 4M21A 1VYTA 4B75A 2GCOB 3KTAA 4IEEA 2HJVA 1P61B 2QTVB 3L0IB 1U0LA 1E9DA 4C0HA 4KFRA 3IILA 4G01B 3AF4A 2A30A 2RH5A 2YHSA 4RCYA 4UNNA 4X8HA 3WRXC 2IS2A 2EWVA 3K0AA 3H0KA 4O3MA 1E32A 2H5EA 4BUJA 1L2TA 5D3MB 2BBWA 2W6JA 3WYGA 4DVGA 4F93B 3UATA 2JDIA 3CO5A 2ZVPX 4Q21A 2EYUA 1M7GA 1TPZA 2MSEB 3EIEA 4A2PA 3U7EB 3HR7A 5J40A 1G64A 3QKRA 4B32A 1W0JD 4TTPA 3G0HA 1UAAA 1E1QD 1E1QA 4U02A 4IKEA 3ZQ6A 4DUGA 2XSZD 4EIWA 3CW2A 2WIAA 2WPDA 4NPHA 1RRGA 1XWIA 5CLQA 1UEJA 1KO5A 4ASUA 4WZAE 4D80A 2R2AA 3LX8A 1II8B 3GQBA 3C5CA 3OZXA 2GKSA 2JJ2A 2JA1A 3PG5A 3W3ZB 2Q21A 4KVGA 1E99A 1HE1C 3RANA 1GUAA 1GKUB 2WSMA 5CIWA 1J8MF 4K81B 5P21A 3K70D 1GKIA 1DAKA 4DLZA 3QKSB 5E95A 1CR4A 4P4SB 3U3KA 4JMPA 3EA0A 1CKEA 1VIAA 4G5OA 2WTUA 1WBBA 2D2EA 2Q9AA 2G3YA 1ESMA 5KDLA 2IK8A 2ZANA 1PLJA 3AV0B 2B21A 3BB4A 4PQFA 4A6PA 5TY0A 1JXMA 2XZLA 4IVPA 4IHQA 2ZUBA 4M9QA 1G8HA 4P4TA 1G7CA 4S2EA 3K0FA 4JLAA 4MGZR 4URYR 4XOIA 2WWXA 3QEJA 4PC6A 3FKQA 4DLYA 1GDDA 3JVUA 1G7RA 5G53C 4D0GA 3ETLA 2RHMA 3WHKA 3OEEA 1VCNA 2FEMA 2QGZA 3VHXA 1X8KA 2ZAMA 1BYIA 4HATA 3B60A 1MO4A 3AVPA 4I1SA 1ZINA 5IDVA 2GXQA 1Z83A 1W7AA 5J4LA 2CXXA 3TQCA 4BQSA 2C96A 3AVYA 3WYFA 3SI7A 1Q3HA 3CX7A 3DOFA 1HA3A 1YE8A 1GRQA 1ETUA 4KI0A 3K0CA 1LFDB 2QPAA 1K6MA 1RJ9A 1TAGA 4IOKA 4MGIR 4P32A 1ZJ6A 4TLBA 3KKMA 2IUSA 3TE6A 1GP2A 1OE0A 4Q4HA 2GF0A 2Z0MA 2XX3A 5DNYB 5DH9A 2IS4A 2ZJYA 2MSCB 4OK3A 4NP6A 2PT7A 4N0DA 5KNBA 1GRNA 1NN0A 4Z8YA 3QQ5A 1QHHB 4M1OA 1N6IA 3ZH9B 3AF3A 2E9SA 4PHFA 2FF7A 5JWHA 2JLWA 4C0LA 1G5TA 2I1QA 2X77A 4NYIR 3A1WA 2GK6A 1WE2A 2Q0HA 2WOOA 3LXXA 5KDDA 4Q5IA 4IEIA 1XXHB 4Q4AA 1K5GA 1TUEA 2OG2A 1Z6GA 1XMJA 1J99A 3TMKA 4XD7D 3QKRB 1D9XA 3B5JA 2F9LA 3AP2A 5J4KA 4JLPA 5H70A 3TJZA 4W7SA 3WMFA 3SHFA 3ZVLA 5C46F 4TYNA 4BPBA 3WY9A 2V55B 3GFOA 3R20A 2FX3A 2RGXA 3LV8A 3V4RA 1OH7A 2XITA 5EE0A 4N3NA 1KI6B 3NEYA 3QIAA 3WMEA 3R9WA 5FR2A 3P4XA 4A15A 3EPHA 1KKMA 5C1BA 2C95A 4DDUA 1G5PA 4LDJA 4QGGA 4WA7A 2FE4A 3DDCA 3TSOA 1S3SA 5JFGA 5F3WB 2J7KA 1XBTA 4LWZA 1CF4A 4QJ3A 1G6HA 2QMEA 2ZQ5A 2CMKA 1US8A 1F48A 1EK0A 3L0SA 2GZAA 1KI8A 3Q7PA 4PANA 2RHDA 1KI1A 3U6KA 4QGHA 4RFVA 4RFSB 3EC2A 4CEIA 1RE0A 4ZCLA 5FPKA 4W9MC 3Q8XB 4P4UA 5JS7A 1KY2A 1LF5A 4LBWA 3CX8A 3ICEA 2AFHE 1II9A 1R0YA 4PPNA 5DI3A 3PJRA 1N6OA 3FHOA 3IIMA 5AUOB 2IF0A 3SYLA 4QHTA 2CE2X 5GJVC 3M4YA 1W36B 1G1MA 4CT4B 5FL7D 1FMJA 3C41J 2C77A 4DLWA 1XD9A 2ZUCA 3FMOB 3LWNA 1BO6A 5CDFA 1UKVY 2CHQA 3R9IA 1DADA 3QXCA 3VR3A 4ESHA 4TQAA 2GESA 1JALA 1KMHA 2FFHA 3BE4A 4TQUS 2YYZA 4RD6A 4R2HA 1OB5A 1I4DD 1Z0KA 4MRRA 3C14C 3NBFA 4Q4HB 1OFTA 2HCBA 1NBME 3GLIE 1B23P 2QSZA 3QI2A 1GZSA 2QORA 4B35A 3EZ7A 3U5ZB 4C2UA 1E2PA 2AHOA 2J0QA 3CB4A 5FL7A 3BBPA 1KJZA 1IN8A 4NYJQ 3GEEA 3B9PA 3Q5EA 1S9HA 1VHLA 2Q3HA 4LHVA 1G17A 4OHZA 2F1IA 4ASUD 3Q7QA 5AUQA 1RIFA 2AK3A 3I61A 2FG5A 2FEOA 1QHNA 5DIFA 5EXXA 3W5IA 2FFAA 3AGPA 1A82A 621PA 1OXUA 1NMYA 2C2HA 2R9VA 1ZP6A 4ESVA 3A37A 2X19A 3N2IA 3NBZC 1UDWA 3OIUA 1T91A 3AVWA 2JIZA 2B92A 5KNCA 1COWD 1V43A 1VG8A 5SZIA 3RC8A 3RHFA 4B3XA 1ZUIA 2CNWD 2F1RA 3H86A 1IJFA 5H68A 1QHIA 1MKYA 3HDTA 1DO2A 1CRPA 3GEIA 5H1YA 2ZIAA 3IDQA 3JZMA 4WIAA 4XSHA 1G5RA 3MWLA 4MUBA 1MRNA 1B0UA 1YRBA 2ZTSA 2WHXA 1Z6XA 3B1XA 2QMUA 4B44A 1GG2A 2W6ID 2KBEA 3RS3A 4CEHB 4M1TA 2IYWA 1SVSA 4OK5A 1EWRA 1CJVC 5JI2E 2CL0X 4Q00A 1P9WA 1N6RA 3SS8A 2AXNA 3B6EA 4EFNA 1HURA 1SVIA 3L0OA 4GOXA 4CZ2A 1IHUA 3THWA 2BM1A 2QI9C 4GSYA 2JLRA 1AJEA 1P2UA 1NG1A 3NWJA 3A4MA 1KDOA 2ZRDA 1J7KA 1AKYA 1OV4A 2HYDA 3M0EA 5K8TA 4MA4A 1G4AE 1ZNWA 3VKWA 1W49A 1W2HA 3IEUA 4OQLA 3FVQA 2CCKA 5HE8A 1KZ7B 1ZD1A 2CNWA 2RMKA 1BH2A 5E7IA 2ORWA 3OFND 4C7OA 4TZ6A 2O8DA 2R6GA 2V9PA 3ZYCA 3UWOA 1DAFA 1FQJA 3TSWA 2Z6VA 3NHAA 4WW0A 5DN6A 2PJZA 5KSPA 2CVFA 5CIQA 4TMXA 1R8QA 5LD2C 5IK2D 5FPTA 3Q5DA 4DLXA 1GVNB 1A2BA 1QZXA 3FTQA 2X8AA 1BOFA 3UG6A 5E3HA 1EWQA 2J59A 3QXXA 3U4QB 3I4LA 2NGRA 2O0JA 3H2YA 5JRJA 2H16A 2O0KA 4DCTA 2B8TA 1KK0A 1WCV1 2GK7A 1LVGA 1Q0UA 2OBNA 1XMVA 4PAQA 3KUDA 4C0AC 2BDTA 1S0UA 3QY0A 4R98A 5FOTA 2AKYA 4AIIA 4RZ3A 4R9UC 4UNSA 2WZQA 3ZZUA 4BLQA 5F9HA 3AKCA 3ZGXA 3KX2A 1E96A 1T3SA 3BIFA 1M74A 2MMGA 3QF4B 4YMTA 5DE3A 2J46A 1P75A 5KPDA 1OW3B 3TUJC 5FTLA 1BIFA 3QXSA 3X1WA 1N5KA 4OJKA 2NPFA 4J0QA 1XU4A 2RAPA 1T6NA 1KI7A 3NKVA 4LHWA 1W0KD 2NG1A 4Q47A 1P2VA 3LW8A 4IDNA 2JASA 2JIZD 4LYHA 1SXJB 5BW8A 1G8GA 3DEFA 4JT4A 3DZDA 1N0WA 2GVZC 2QPOA 4JS0A 2RB4A 2OILA 3WMGA 2NZ8A 4Z1MA 3ADDA 4QNMA 2DHRA 3EW9A 4I1VA 2CK3A 2B8WA 3RABA 3PCRB 4ZCMA 2J1LA 2FSHA 4DRZA 4V0LA 2XZOA 2GAAA 4DIDA 4EPXA 4OL0A 1AM4D 4CRWB 2QPTA 3I8SA 2IT1A 3B1WA 4E22A 1FX0B 5IHPA 3CX6A 1E2HA 4MITA 3ADCA 5J4YA 1NF3A 3Q3JB 2W58A 1DPFA 4FW9A 4E5UA 2BEKA 4PQRA 4YLGA 2P0EA 4FCWA 1BMFA 2PZEA 3C8UA 5HPYB 3C15C 1YR6A 4KV9A 4KSBA 1GWNA 3T5GA 4D0LB 3CNNA 1RYHA 1DELA 3AVOA 3PQCA 1NG9A 2D3WA 1IY0A 4KJZA 5GVSA 3SU8A 4LJ6A 2OCAA 2YJTD 4ZKDA 3CZPA 1NN3A 3UG7A 2R6DA 4KHZA 1KO8A 1ZM3A 2ZSAA 4NZYA 1NVVQ 5AJVB 3P32A 3QBVA 3OFNA 1OH8A 1YZKA 2EYQA 3F0TA 1XD8A 2ERXA 3HJNA 4PZZA 1VIYA 1XRJA 4GMDA 4LV5B 3AB3A 3DM5A 2REOA 1S2MA 1YU9A 4M1YA 2F6RA 2Z5FA 4D4KA 3I92A 5EE1A 1W36C 1Z5ZA 3IBYA 1VYVA 1G16A 1R6BX 2GCPA 2KB0A 2R6CA 3RWMB 4BFSA 4Q7MB 4CDGA 1F2TB 1WBDA 3IBGA 1QHYA 2C9OA 2HLDA 4TLDA 1U99A 3BXZA 3QE0A 3AP1A 5GJBA 2A5YB 2ORVA 2P6NA 3BH0A 4TLAA 5TXGA 5BN5A 1OHHD 1E9RA 3LFUA 1CJUC 1MO5A 2ZJBA 3CUEF 5DSZA 1JPJA 1PJRA 2QENA 4BLTA 3LLMA 3FWYA 2XOKA 2ODWA 1XTRA 1R0ZA 3CH5A 1AS2A 1E9EA 2YV5A 1Z2CA 3TAUA 1VG1A 2N1BA 1IAQA 3K53A 3GMTA 2R62A 3MLEA 1XTJA 4RD3A 4AYWA 5AUPB 1S8FA 4PC2A 2XJ9A 4HSEA 3SFVA 4BFUA 2QTHA 5L8VA 4D2IA 3HP1A 2DCUA 4JVNA 4B2PA 2X2FA 1P4SA 2HT1A 1NBMA 1FTNA 2IHYA 1ODFA 4LJ9A 2ZSEA 4PSKA 3C5HA 2YVUA 2HUPA 3X2SA 2FPMA 1SXJD 1NLFA 3DZ8A 2GBLA 4OI0A 1W36D 4M9ZA 4GDFA 1Z0AA 2NZJA 4D25A 3CBQA 3K0FB 4LK2A 1KDPA 3UMFA 1AZTA 1LS1A 1OXVA 2WJJA 3BWDD 1E2QA 3CRQA 1XEWX 1VPLA 4UNRA 4QGAA 5EP1A 5FBRB 3AVUA 4US1R 4M2LA 1J2JA 2D06A 3TRFA 5FBLB 1F60A 4YMUA 3ZD6A 1P73A 1AIPA 2BHRA 2D2FA 3P20A 3VNUA 1ZC4A 2UZIR 5KOYA 2FU5C 4O25A 4YXWA 1GAJA 1FP6A 1KGDA 1DO0A 1Z08A 3KXKA 3N5CA 2QNRA 3FPAA 2A78A 1KSJA 4AKGA 4NYMR 3FKSD 1DS6A 1NN5A 1ZM9A 4XWAA 3ZLJA 2GZHA 2WWFA 3TBKA 2ZRMA 4HLQB 1Z6AA 4DLUA 1VMAA 4CEIB 3UXMA 1OPXA 3B82A 2F1HA 3HYRA 4KFTA 4KODA 1E9FA 2XTMA 4PHHA 4NYMQ 1X86B 4QNRA 4URWR 4Q1FA 3RYTC 4NMMA 5FBVB 3PEYA 1NKTA 3MWYW 1DE0A 2ZJAA 3AVXA 2QA5A 4EJSA 4TTQA 2JLZA 2IA5A 1SXJC 1NY5A 4OQMA 1ZBDA 4BRUA 1UPTA 2E1RA 4B43A 4BFTA 4XVQA 5LB2A 1CEEA 1FL9A 3TH5A 2J0UB 1AZSC 3ZIAA 4XVRA 2PH1A 3EA5A 3WBKA 5F98A 2ZU0C 3K1JA 1NRJB 2UVQA 3FMFA 1TF7A 3IIKA 1D9ZA 1XD2B 1XTIA 3B9QA 1P5ZB 2AL7A 5G3YA 4F92B 4PFSA 2GCOA 4M4SA 4BECA 1MO6A 2GNOA 1G3QA 1QHXA 2DBYA 4QC2A 3LLUA 1NLYA 1OKKD 4BFWA 1U2RA 4X8LA 3GLFB 2VHJA 4DC9A 4EPVA 2QE7A 3CR8A 3LH5A 1JBKA 2HXSA 2FH5B 3EZ9A 3HWSA 4Q9LA 4HZUB 1D2MA 3LRPA 4YMWA 2OUKA 2OESA 2IYZA 2VBCA 5JCZA 5HCNA 2WJGA 1TU4A 1XTQA 4DCNA 4GRAA 1I2MA 2W2XA 2B6HA 2IC5A 1ANKA 1W4BA 4OQFA 3WBJA 2CCGA 3A36A 4LJYA 2F1JA 3KZ1E 3A58B 1VDZA 3W5JA 3H4MA 1LV7A 2F7SA 2WSSA 1QHSA 3CF6R 3OAAD 4Q02A 2ZITA 4UNPA 1G20E 1EG7A 3HU3A 3QOFA 4FXPA 3SBDA 5H8WA 2AWNA 3VKGA 1JAIA 1PV4A 4RZXA 1AK2A 1NBMD 3CPHA 3QPUA 1O3YA 4QXAA 1II8A 1DOAA 3DL0A 4Q03A 4ILEA 1YZGA 2ZYTX 5HKKD 1EX7A 2ZETA 4KAXA 1HEIA 1TTTA 1KI4A 2BCJQ 2JLUA 2RGNA 3B2EA 4Q01A 2GJAA 2WWIA 3T12A 2RGBA 1QG2A 1D8TA 1SHKA 3EG5A 1F3OA 2H1LA 4TQ9A 2G1JA 2QG6A 5AR1A 1X6VA 4DZZA 1ZUNB 1S3GA 2QEQA 4M1MA 1TF2A 4I1UA 1FOEB 2GZDA 2J7PA 2WMOB 2NO1A 2YNMA 3Q9LA 4KFSA 4Z51A 1FMLA 4GNKA 5B64A 3C16C 1YZNA 3LO5A 3KB2A 4TSFA 3U3RA 3W8NA 4RJLA 2VTKA 4XVUA 2FN4A 1CR1A 4B3FX 3SZRA 5JS8A 2XB4A 2VYFA 3FKSA 1HUQA 1TU3A 4A1FA 3I5YA 1NIJA 4FCTA 1M8PA 1SVOA 3CF2A 4EPYA 1G19A 2HDNB 1UFQA 3RRZA 2BV3A 2RGDA 1N6NA 5FTJA 2QM7A 4LC1A 1U9IA 3LX5A 4UQOA 3VU9B 4E09A 1SVKA 4MGYR 3I8XA 2W2TA 3LNCA 5JI3E 1XTSA 4IDHA 3ADBA 4C0JA 1N2CE 4HLCA 1EFRA 3QF4A 4EKDA 1KJYA 4KYIB 4GT1A 3W6NA 2PMKA 1LS6A 3T5DA 2LKDA 2NOAA 3PUVA 1E9CA 1I4LD 2NO0A 2QUZA 4JT2A 3RRMA 1D2NA 2YOFA 3SN6A 2IXGA 1EESA 2DPXA 4HAUA 2IYRA 3D8BA 2VP4A 5KO2A 4XIGS 3TK1A 2ZPTX
chains in the Genus database with same CATH superfamily
4BMOB 1Z15A 4D9IA 1IBMB 3P2EA 4LHYA 4QX6A 3TR5A 5DISB 3T7CA 2KHZA 1HNXB 4DR4B 4RZIA 4RVFA 2IBTA 5JTTA 4I8XA 2RHGB 1JX6A 4M0EA 4PVDA 4Q1BA 5COQA 5BN3B 4URZR 4Y3UA 3NXSA 3VC7A 1QH8B 2VEOA 3D59A 4HDRA 1SZJG 4Y1FA 2J5XA 3ZHBA 2VJQA 2Q4EA 3WIVA 2GN9A 1Z0IA 4ER3A 2WTAA 4TV8A 1FJ2A 2C94A 2ZRPA 5LLSA 2KI5A 3RQIA 1RXWA 1F5NA 2AOUB 2O8EA 1V4NA 5DTQA 1U8AA 5E1DA 5JVDA 4R9VA 4E2FA 4CEJB 3WYAA 3A6LA 4IF4A 4Q9AA 5FPPA 3K5IA 4HJRA 4MW4A 5HZGA 5LN1A 2VZ8A 1PF7E 4LF9B 1W2GA 3FOCA 3REFA 4UOZA 4RGQA 2WINI 4U5XA 5KBYA 5ALOA 1VSVA 1UPFA 1ZKMA 4KMOA 5ILGA 2FHPA 4L5CA 4LVCA 3VPXA 4JDPA 1JG7A 2R7LA 2NX2A 3O8BA 5DX0A 4BLRA 4RELA 4RKRA 3TW6A 2RIRA 5JOQA 3R24A 1U1CA 2KM1A 4HH0A 5L3RA 4FZ5A 4ME6A 3WXMA 3B7GA 2CLDX 5AVWA 5AICA 3DTYA 3QXHA 5ALGA 2PMWB 2XAAA 2XMSA 4ON9A 1T1RA 4KQJA 4DUPA 5K8UA 1CQZA 1H2YA 1CXZA 3ME5A 1I6LA 1HLPA 1LDGA 1UP6A 1VE3A 2RGNC 3AHCA 3GRKA 3B1KA 4FEYA 1LQ2A 1U98A 1XMXA 4WFKA 4X90A 5ALRA 5A05A 5LOVF 1WS6A 1P5FA 4LDAA 1L5LA 4JELA 1Q1BA 2GILA 2NACA 4D44A 2JDID 4LYEA 5GWXA 3MBKA 4P54A 3JQGA 3O93A 2DBQA 1SNYA 2ZRJA 3V9AA 2C59A 1K8XB 3EQ2A 3D8UA 1V1RA 3JQBA 1Q3KA 3TX2A 4OB8A 3UAYA 2AW5A 1NULA 3ZYZA 2PKCA 3FW1A 1S2IA 4B73A 3F4BA 1J97A 4U6QA 2NT3A 1U0HC 4K26A 3OQIB 3N39C 4GOLD 3F47A 4M89A 4WT7A 5HIMA 4QICA 2RH4A 1FNNA 1FCJA 5K0EA 1R5JA 1RWBA 1N6PA 2SICE 4G25A 3GRPA 2PXHA 1QJCA 4INOA 1W30A 3EWSA 4YCDA 4LAFA 4TMKA 2DTDA 2WWGA 4C0WA 1L7DA 2PZJA 4GOJA 5CJ2A 1XMOB 1MPXA 3JQAD 4YP5A 4CQJA 4NDAA 2MIIA 4E4RA 2W37A 1A9SA 1G5IA 4R9SA 4UE6A 5JYEA 5GJCA 3N2NA 4R2LA 1Q14A 1MT0A 2WJ3A 4POAA 1XJQA 3Q7RA 3F6CA 3FWKA 5LPNA 1T8UA 1JVNA 4K9RA 5I47A 2OGTA 1CRZA 1O94C 4OM7A 1I7SB 2A57A 5H0IA 1KEEB 2Z8YA 2G76A 1FNCA 1L7VC 2VSOA 4P93A 3SYKA 1DFIA 4WLOA 5EKUA 2O2DA 1Z37A 3K1AB 2RJ3A 1SKYE 1UIMA 1Z5WA 3A3YA 3VHRA 5F52A 5KNDA 2H3EA 4YPVA 3L01A 3KPWA 3IS3A 1DJPA 1A69A 5LQRA 3DBIA 3CIOA 1PT8A 4NE9A 1YR8A 4OPMA 1NJ6A 3VR6H 3QVGB 3MOGA 1ZK0A 4CQMB 4QA9A 4R6XA 2FX5A 1EGAA 3GJRA 1NW8A 3KHKA 3Q8WA 1BMFD 2Z1DA 3OA0A 3L0YA 4GE0A 4NBRA 4L51A 5I7AA 3ZR4B 2WHEA 5J2UA 1SURA 4B31A 2C5BA 4BMXA 3ZNNA 2KMLA 3OQBA 3E3NA 1QUEA 1TQ4A 1Y6QA 2CBGA 1U8TA 1EXMA 5F5LA 1KQ3A 4JI3B 1K2VN 3K35A 2EHJA 4IVNA 1XPOA 3NHFA 5CA0F 1PWXA 1YDFA 5KI6A 3E9YA 3VTAA 3CNHA 5L95A 3SXUB 1QSGA 3UWMA 4QSHA 3EDRA 1L5MA 1AOXA 5CX1A 2KWIA 2CLHB 3BZBA 3FYHA 3JQAB 1MEEA 3NHSA 3WK5A 1E5VA 1GY8A 2YOHA 3RUIA 4C08A 4DIOA 2EJWA 3FPFA 1HQCA 5BSWA 5I9LA 2B5WA 5AVTA 4QHSA 1T1IA 3BWEA 3NVAA 4IDOA 3RR2A 4HV4A 2EDCA 1CX9B 2HV8A 3SSAA 4HLUC 2VAMA 4JOQA 5JECA 1OT5A 3DAPA 1NQVA 2C98A 2QLLA 3BB1A 4HS9A 1QDUA 3ZTWA 1PVOA 1UKYA 4BVLA 1Y8ZA 1V2GA 3TR6A 3B5EA 3VVCA 2P8JA 2XGOA 3DXZA 4D8WA 3QVWA 3ILYA 4BNWA 3KQMA 4X54A 2IW1A 5T4HA 1ZM2A 3AW9A 5IJXA 3T7SA 1JLRA 3HBLA 3TLBA 5BW4A 4EHHA 3IVRA 4FONA 3GMSA 3RYHA 2FMXA 3ICWA 3PIRA 1JFVA 4OAPA 3UJ8A 1EZ1A 4Z2YA 5F2NA 4AYTA 4E31A 1J8YF 4DKXA 1MU0A 4X7MA 1QM5A 1TVMA 3BJEA 2QVZX 3ZX5A 5E1BA 3QX7A 1FDVA 1XEWY 3BFPA 4X0EA 5KYNA 3WISA 1N4DA 5CEJA 3CNQS 3ZHZA 1FQWA 2VDLB 1E64A 1FC0A 1OZFA 1FRQA 1OXMA 1R8SA 2VSYA 1M3SA 3PD1A 4O4LB 5TMPA 2JJQA 2JHGA 1HLFA 4INZA 4UBOA 5TQJA 4ENTA 2A5DA 2OFPA 1GZ7A 5LCXA 4BGDA 3HG7A 3MWJA 3T3GA 2XUFA 2EOAA 3FUTA 1O2DA 3MWKA 4ZALA 1QH0A 4A4DA 3L4BC 2N75A 4RVHA 3MCUA 1F3LA 4ZDWA 3RRBA 4RO0A 2OMEA 3TGLA 1WY7A 1XN4A 1E1CA 4BZPA 2BFWA 3TTVA 4R2JA 1WPXA 3CUTA 1NXSA 1RTTA 3VVBA 1CJSA 5BSGA 5JHHB 2IHNA 3QM1A 3F6SA 1GZHB 3LA8A 4G8BA 4ITUA 1KKUA 1GQOA 1A5BB 3H3FA 4RS4A 4Y2HA 1M0EA 3C70A 5A5FA 4QUEA 1NUQA 1OFUX 1OTYA 3A2NA 3IRUA 2KSQA 3OLYA 3T41A 3O7WA 3DF9A 4Y2QA 3S1AB 4BB5A 4DQLA 1IUPA 3K8OE 4KO2S 2OVBA 3VPBA 1RHRA 1INLA 10MHA 1DUSA 3A2LA 3NHWA 2IEIA 1AQYA 4BVFA 5ES4B 5KYWA 1NUAA 3SKXA 3JQCA 4Z54A 3HU1A 2I4OA 2VRNA 2HU2A 4JL5A 4WTOA 3RODA 4DMLA 4DQDA 2AV6A 4EGFA 5E2AA 3IERA 4QGBA 4G67A 1HG1A 4O08A 4MO2A 1YHNA 3HCPA 4MVWA 4Y18A 5CMLA 1OZAA 1OWLA 4ECAA 2AYZA 4MS3B 3MYRA 3ZLVA 2PCLA 2UV8A 1W581 1ENPA 1HEUA 1YU6A 1L7BA 2EGUA 2WJWA 4MB6A 2RHLA 2QS9A 4BNTA 4K1LA 4QGFA 1QZ3A 1OWPA 1Z33A 2VL7A 4Y98A 2XB6A 2ZRGA 3AOEC 3EEBA 1PZNA 4M76B 2RI6A 1ZOLA 2Y6UA 2R1UA 4MQMA 4UATA 2X5OA 2MYPA 3JQRA 1O6FA 1U8FO 1PT5A 4FNMA 4P84A 2GD6A 1KIAA 3GPIA 4M22A 1YB7A 3K9CA 1KE1A 2OM2A 3TZKA 1MVLA 4ZGBA 5IKMA 3U44A 1X1RA 3CW8X 2J6IA 5C32A 3EGCA 4HLDA 1RBYA 4CLOA 3T06B 4KQ9A 1DC7A 2ZGVA 1ZU5A 5H16A 1GGVA 2K2WA 3ZKWB 4WINA 2QRKA 5JVDB 3FNIA 4K6KA 1GKLA 3D7MA 4OYHA 3WDMA 4EENA 1RZVA 1PJSA 4AQDA 4QJ5A 2DBVO 1CRQA 4TS4A 3WLHA 1CY4A 4DF3A 5IAGA 4GZ5A 2B1JA 1YOBA 1FFBA 1B8UA 3IKJA 3LJKA 4TWIA 1DX4A 1PVDA 4LKOA 5D1HA 4A7PA 4E2XA 3EVCA 5CVCA 1ZCJA 3RPEA 3QFHA 2RC5A 1FP1D 2A4KA 4OBEA 4YFYA 1KJNA 3COPA 5FOWA 1NJ1A 2I54A 4XDZA 4PYRA 1FRNA 3DO5A 1KDYA 4C4PA 2XQJA 2RHJA 3IT1A 1JPUA 2PH3A 1XZQA 2WD8A 3IAM6 3WS7A 1THGA 1H0KA 3P0EA 1YNSA 2IZOA 3FYSA 3HA3A 4KI7A 3WWDA 1PW5A 2VCYA 3I34X 3BL6A 4WLUA 4LF4B 3UY4A 4JLDA 1V96A 3K0EA 5EP3A 2AC4A 4XJVA 1CUFA 1VBNA 2WOJA 1X2EA 4KGVA 1MRSA 2QE7D 3ZGZA 1G98A 2A3NA 2IS6A 1XDBA 5K8VA 2QT1A 2XHEA 5JD4A 5EJ4A 4QGSA 3NDBB 4D1YA 3AR2A 2QTBA 2FEXA 5DP2A 1YUNA 3KQLA 4LJ5A 2LV8A 2VYCA 3O8DA 4H3VA 4BJHB 4ARIA 3PFGA 3L1IA 1V8OA 4CODB 1LJ8A 4LY9A 4B40A 3ZDEA 1D2CA 2VYQA 3JAWB 2BFBA 5H02A 5I7OA 3ZDZB 4QYTA 3CKKA 4ZPXA 3LMKA 2H2IA 2HN9A 3GNTA 2ZIFA 4KPUB 3M1IA 2DTXA 4PRKA 1SUDA 3CWZA 2WZCA 4CIVA 3PTAA 1TADA 3L41A 3W5CA 4LSGA 2I55A 4B6OA 5JAPA 4LHEA 3L0PA 4QBFA 4RQTA 5EKDA 3NWPA 1UCFA 2BKUA 4PLCA 3O3MB 1BJRE 3M1YA 3R7LA 1MABA 4RL4A 4TN1A 1T8RA 1EFHA 2EFCB 2Z30A 4DJTA 1EFAA 3ZDQA 5CM2Z 2VPXA 3ND9A 5ARCA 1GZ6A 3BMOA 3RS9A 1M1UA 1YJQA 3NC4A 5FJIA 1OB2A 1CDEA 3WNDA 2FLKA 5D01A 5KOHA 4M8SA 4L4UA 3UMCA 1DEAA 3PUYA 3IGFA 2CVPA 3HVRA 2ZIEA 3U13A 2FDRA 4LOAA 3SDBA 3LF2A 1L7EA 4IOMA 5AM2A 1BC5A 3KQNA 1CNFA 3JS5A 1FU7A 4TSRA 1MJNA 1M0SA 1EFUA 4L2IB 1B6GA 2XZPA 1QE5A 1F8FA 3Q6NA 2JVIA 3A4YA 3R09A 2DFDA 3KE9A 1LTHR 5ALZA 4TYYA 4NS4A 2X15A 3RADC 4I9GA 1EUYA 2HDWA 3DMTA 1XIVA 3SYTA 1OSNA 1CY0A 1AGPA 2VPYA 4JBWA 1OYWA 3Q3CA 3ZTYA 1X92A 2PS3A 2YJ4A 3KHTA 3Q7IA 1RM4A 4MMXB 5G0TA 4MV7A 1JIJA 3IIJA 4LJ8A 4YRRA 1UPBA 2CZQA 2Q6LA 3L9XA 4H15A 4EYQA 1UBCA 3NANA 1ADBA 2J4DA 4MV1A 1NW6A 4GPIB 1KNXA 4MI6A 4BO7A 1KRWA 4JX8A 4FN5A 3HJAA 5ALDA 1JQJC 4DABA 3IQXA 3O4HA 4EG1A 5K0ZA 5LKAA 1JEYA 3EPLA 1L8OA 5AXAA 7MHTA 2Y0EA 4OL9A 2GNAA 3SXJA 3KKEA 4AKHA 3KJQA 1DAEA 3OZCA 3UUEA 1IY2A 2W6JD 1YASA 1PNOA 3C85A 2NU8B 4CQMD 2VLIA 4FFMA 2NWQA 5IC5A 4GQAA 2ZUUA 4XARA 4YO7A 2PLFA 3ZHTA 4CM8A 4PRYA 4R7GA 3VZPA 2JIMA 5IDYA 1IULA 1HTTA 3BERA 3FJ1A 3T4UA 5ECYA 1L1EA 3B1JA 3W90A 3VJKA 2P2NA 4IIGA 4LHXA 3F2VA 3V55A 4B34A 5IW8A 1DAGA 2TSYB 2RI0A 1NURA 1UBJS 3ICCA 2VS1A 1OLSB 3NDIA 3AKYA 3WB9A 2XVYA 1P6XA 2YOGA 2W6IA 4ZEOA 7REQB 4W7HA 1R00A 4HH1A 4P7GA 4DIMA 1EE1A 3JQEA 3ZU4A 4IIYA 1I3NA 3LUGA 5KNBD 4Y0AA 3PJFA 5D7NA 1GGJA 1YJ8A 1U1FA 4MKIA 4BEWA 3OPYB 4S1WA 2CNDA 1IJEA 2JJMA 3NR2A 4G8CA 4NMWA 4XOUA 1VJDA 2FFQA 3VGJA 3W2HA 1N32B 2OHJA 2VUUA 3ESAA 3L8HA 1QDEA 2RHWA 3SSMA 3ON5A 1EUQA 1P2DA 2IUTA 2J30A 2QVBA 3GA7A 3IHTA 2FFBA 2KBFA 3PFHA 5BN5B 3WSWA 3WOVA 4P0PB 2RE8A 2J3DA 5TDHA 1M2FA 4I8DA 1U80A 4ZFNA 2J48A 3U09A 2JCGA 3E7WA 3THYA 4HP8A 2CUTA 1EZ4A 3KDPA 4ID3A 2GJ4A 5D84A 4JB3A 2WTMA 4ZCTA 1CUGA 1EE2A 2DKOA 3PPIA 4QU0A 5KYWB 1OX4A 1PK7A 4IX1A 3A1VA 4AJNA 2UZ3A 3LCJA 5DHFA 3I9V6 5FOXA 3B7PA 1AV7A 2JGDA 2W8BB 4IWXA 5LXTA 1BX3A 2IF2A 3C74A 2NSHA 3K5PA 2FHSA 3QPVA 4ZCPA 4EUNA 4C30A 4C4TA 2ZT6A 3PTLA 4F91B 4CQMA 2D1YA 1SQSA 1GZ4A 2H2DA 3BL8A 3KEQA 4X8OA 2PR2A 4XDHA 3AF2A 3NDJA 3QG5A 2J08A 3X43A 1Z0FA 4GXNA 1G8MA 3WGQA 2IWHA 1XD2A 2FNAA 1QB7A 4FHGA 3RV3A 1YL6A 5B6IA 1VMKA 1KMQA 1VJRA 2QLBA 1R64A 2HU7A 2QZ4A 4R31A 2WJHA 3VR6A 2X13A 4E03A 3PWKA 2VJCA 4RDXA 4G0WA 5B55A 1GSAA 5CM8B 3RVNA 3KQYA 1ZU4A 4AZ3B 4L07A 1J5XA 4ZAZA 1CS4C 3CH7A 4HOYA 2P9TA 3ONFA 2IXFA 4JJEA 4LWOA 4UZFA 3S2EA 3IQGX 2NXEA 4ZYZA 3HJFA 4KTTE 3ZQKA 2XXBA 2YY5A 1NPTO 3H2HA 3OKAA 2AN9A 4AUMA 3P94A 4HJXA 1DBVO 1DBIA 2COKA 4WBXC 5BO5A 3UMRA 3DFUA 2GN0A 3NG1A 4ER5A 3ICQB 3DHWC 3S99A 4BO1A 1HT3A 4FD2A 4AUNA 3DQZA 1W19A 2IYLD 3DBHB 3KXPA 3NUQA 3AFOA 4MJ3A 4N39A 3QQPA 3K71B 4M1KA 2XEDA 2G7ZA 1SJ9A 2PYIA 3UJCA 4G8DA 4EF5A 4JI0B 3LX6A 4JD5A 2J87A 1X14A 2G4VA 4YIHA 3IEVA 1VOTA 1M66A 5LYJB 1WPRA 1DZ3A 3RYHB 2RHTA 5CLJA 2MJLA 3A6DA 4QLAA 4V0MA 3D3QA 3TW8B 2HGSA 3C8ZA 4JCOA 4BASA 4K0KB 4P4SA 2W98A 2WIFA 3KKOA 5DEOA 4LY6A 3WP1B 2P4EA 3P9ZA 1RZUA 1W52X 2C82A 2BHNA 2FI1A 3CLTC 3DDSA 3LS2A 4KQCA 2QRQA 3LDUA 2X4IA 4GSKA 1BQ3A 4UFNA 1H3FA 3T1TA 4R7TA 4YC7A 4Q19A 1IZ0A 5BP7A 3TIGA 5AVYA 1NMSA 3P1JA 1HFEL 2VF5X 2JGFA 4YRMA 4TYQA 3AM3A 4BYMA 4CW7A 2AG8A 4BC0A 4B6PA 4BPBA 2OCLA 3SGLA 3RK4A 2OZLA 4J0GA 2AFIB 3TPFA 3JZDA 4QXQA 4K5QA 3A1EA 4D56A 3NX4A 4EX6A 3CRW1 3HDJA 1OLUA 3KD3A 3L43A 2PGDA 1CY2A 4J0KA 2BLNA 4X44A 3ORYA 3HC7A 1JLSA 1PLLA 1O96B 3KZCA 3VPFA 4D0NA 1DIHA 3CX3A 4KLAA 4N5MA 4MUJA 4TLMB 4A6DA 4EFKA 1DKRA 2CLOB 3AHJA 2G71A 2MYUA 4B17A 4CCSA 4NEHB 1EQUA 3TLAA 4DPKA 4I3GA 3L6CA 2JLXA 6YASA 3HRKA 1Y3DE 3PICA 3ZVMA 2D7DA 5LBUA 1QK5A 4R83A 4NAHA 3W5SA 4DXAA 5IDXA 3IPXA 3H16A 2PAAA 5AM3A 3GVHA 4QRIA 1GPNA 3OEWA 4HEHA 4TXHA 1K5HA 3HUUA 5EHXA 3KUUA 1TLTA 1P77A 3WGZA 4EW6A 3LBHA 1IXKA 1IK6A 1SUFA 1HNNA 1PTJC 2FJUA 2DFLA 3IUPA 1OILA 3NHUA 3HDVA 4X1YA 4B6QA 4EHIA 5ISMA 3L8FA 3HXOA 4BAGA 4GRIA 1II0A 2BR5A 1CY8A 1XAGA 3GQVA 3LKZA 4D4MA 2ZQZA 3CBGA 4PSAA 1H8EA 1V8ZA 2VR1A 5E6SB 1PAUA 3ROZA 2QBYB 1QOZA 1TQ8A 1PJ8A 3TRDA 4AIRA 2IXEA 2XCUA 3CTMA 3AETB 3ZWQA 1LDMA 4DIUA 4EF4A 1QP4A 3TFOA 1M83A 2AI1A 3QV1A 4TZ0A 2O7NA 4IINA 1NSFA 4C0XA 2PTGA 1UKEA 2Q3FA 4RH3A 3TBFA 4CMEC 3ZGNA 3P2JA 4ZREA 1NBOA 4OI1A 3U44B 2FPIB 4CPDA 3KYJB 6ADHA 2EBHX 3I72A 3SDSA 4CGYA 1OLXB 3O8RA 5BSMA 4FI3C 4DLLA 3TSZA 3GLGE 2ZZNA 3AI3A 1E6CA 1X0XA 2W00A 3NHYA 3IDAA 2HQOA 3UF0A 1PD1A 3CF0A 4FFSA 4A0RA 3G23A 1BKDR 3I2FA 5D3QA 3ZQUA 3G8AA 1NLZA 3JASB 3UM9A 2XUIA 4ZQHA 5LP6C 4EJSC 3SFTA 4JOCA 4UM5A 3ZHRA 5BR7A 3DEKA 4BB0A 1JR3A 1VMIA 1MB4A 3N75A 3ACDA 3CO0S 5IRCD 1TZJA 3QVGA 1FTSA 3GDHA 4GX5A 4HMOA 2QMZA 4M87A 2IXAA 2WKQA 1UMBA 2X2PA 3UT6A 5LM3A 3WJAA 2ZM5A 4KN9S 2EFGA 1IMJA 2BGNA 4YCBA 1F2UB 2AFHB 1NU6A 1KR5A 2N3ZA 2JGMA 2ZBGA 1QHHA 4FLMA 4CKEB 4GP7A 5DYWA 2A1IA 3KKLA 3EC7A 3NZEA 2DR2A 1M34E 1Z0DA 4HXFB 1QK3A 3SZMA 2R8EA 4RUKA 2OCXA 3PQDA 3KZVA 2P78A 4P92A 4UUAA 3T15A 1Y81A 4L8GA 4L8FA 4AJJA 4PLHA 4WNAA 5T64A 4NULA 3DE3X 2G5TA 1T9HA 4NENB 1UK7A 4JQZA 4UXJA 4EVIA 2P30A 2H9YA 2Q5LA 1WQ1R 1NBHA 3A3KA 2CNBA 4BRZA 5FOQA 4PAOA 1TCCA 4CM4B 4L9SA 2IOQA 1J20A 3DNMA 3CS3A 3P9XA 9GPBA 1PZEA 4QAQA 3NPMA 3X2FA 3CUUA 1A0OA 1J0CA 4TXMA 4A91A 3LLSA 3IA2A 4YJ2A 1X38A 5CFQA 1CHNA 1MIOB 1BS1A 4OHRA 4JWTA 1GUDA 4JC4A 2X86A 2YN2A 4BVKA 3W5AA 2DPGA 3GFVA 1DG1G 4JUCA 2J9YB 1XEAA 4YMLA 3NVKI 1RLIA 3OZIA 4DCJA 3T1QA 3S28A 3UJHA 1OGIA 1EWKA 4URUR 4PFJA 4A2QA 3BPSA 2C54A 5H3HA 1IC6A 2F3UA 2ZDGA 3CM0A 3PGXA 5CLIA 5I01A 3NTUA 4U39A 1UBTS 2FX2A 3HZRA 1ARZA 3OOEA 2BFPA 3RFVA 3R0IA 4ALIA 5C35A 1U0BB 1P2TA 5HK9A 1AHPA 4PYKA 3BE5A 3VTKA 2F3TA 1PJBA 4GOKA 4DLNA 2BTQA 2HF9A 3UFXA 2OEPA 3VNVA 4LUCA 2M2IA 3WP0A 4UD6A 4EA9A 4UU8A 1MB2A 5I9BA 3DB1A 4P3YA 3RFFA 1RJ9B 3G59A 1Q1QA 3N53A 4QUBA 2AMVA 1V6AA 1Z7WA 2HA3A 4MVXA 5JE8A 3GJ4A 2QTCA 1DBRA 3N59A 3T0GA 4OSOA 2O54A 1N8NA 1RQ2A 3GGOA 1AB5A 2IIBA 1DO8A 3IOMA 4NI5A 5FTKA 3E5NA 1AG9A 1XJ0A 4MS4B 4EITA 4KR6A 3HVUA 5JDIC 3EPRA 4CLHA 1SRRA 1E5DA 1YO6A 1MOZA 4V0SA 5IF3A 5AW5A 1MOSA 3ELBA 3MFYA 1DRVA 2FWRA 2YWDA 1E2NA 3VR2D 1KSFX 2Q50A 4TKUB 2QP4A 1YBHA 4MWBA 5D51S 4C5AA 5B37A 1PNQA 1L8QA 3ENVA 3BYZA 1MA3A 1W5EA 1OIVA 2EW2A 2GWHA 1KSGA 3NLLA 1EM8A 2WRZA 1NC3A 3L2OB 1EHCA 3TIIA 2PE5A 3KTDA 5HFJA 2Q41A 2W93A 4IGEA 3LQ1A 8GPBA 1FP7A 2WV7A 4L5YA 3HY3A 2UZ0A 4XWKA 1Y4ZA 2CEKA 3V4OA 4BZWA 5IEBA 3RBVA 3CLTD 4F71A 4D97A 1OLOA 3Q85A 2BTOA 4H7EA 3CYFA 5EJEA 3NOXA 4AS3A 3DMPA 3WL7A 5EZYB 4KPYA 1HTWA 2XUDA 3NM4A 4N1AA 5LL6P 2JFWA 1ZPDA 2PIDA 4FIDA 4V24A 2BBOA 2TRSB 1PJQA 4JOSA 4BLPA 2BVNA 4JLOA 4Q9DA 3AIIA 3I6MA 4MHTA 2FUG1 2IYSA 5FI5A 1MEJA 3U31A 4DLKA 2YVAA 1EFTA 4CDGA 1SK9A 1FP4A 3E3MA 3PJEA 2QN9A 3PJDA 2F90A 4U7JA 3HP7A 1GDHA 3U48A 2WICA 3MRTA 4AECA 1GL6A 4HCJA 1UZUA 1B0PA 2EQAA 2H4WA 3H2BA 4DJEC 1Y7LA 1H05A 5E6UA 3S29A 5HJEA 2ZFUA 3QPBA 2Z6UA 5EUMA 3MTDA 2HA0A 3DT9A 1RYBA 1XP8A 1R18A 4XVHA 5DULA 1ZJJA 2QP9X 2HCRA 3Q3IA 3DC7A 1L1FA 5IFKA 1O6GA 5DI3B 2ACEA 3HLYA 5F78A 5KWVA 5EWMB 3EBPA 3V8BA 1OBCA 4X00A 2BCEA 5LP6F 1DMRA 4IHAA 3T3MB 1GXSB 2C9BA 2I9KA 3CLRD 2MDTA 3EZ6A 2XD4A 2ZJ6A 4HG2A 4M0LA 3EVTA 1X1QA 5JCOC 1VMDA 4ACAA 4M8NE 1KAQA 1IY9A 1J1UA 1BNCA 3HM2A 1J5EB 1C7RA 1XV5A 5F1KA 3FOBA 4O2LA 3ZHYA 1EFRD 1M0WA 2FPRA 4WDRA 3RTBA 4DSTA 3GO4A 4MX8A 2VSXA 1H2AS 1WHTB 3GVCA 4JBYA 3RW9A 3CT6A 4NOKA 3FGZA 3KFLA 3DZHA 2X1MA 4X20A 4FZ3A 1Z5GA 3QMPA 3JYLA 3GK3A 1KSHA 2H52A 1BN7A 3K30A 1CD5A 2XMBA 2V5AA 1ID1A 2XA2A 4G1FA 3W6PA 4TYPA 4OAOA 4CCYB 3I9MA 5EJ5A 2YZMA 3RROA 1M6WA 1K08A 4QG7A 1SM4A 4OM8A 5FL3A 4BLOA 5DCWA 5JCJA 3D4BA 3ZGOA 3CN9A 1SZPA 3LHIA 4REQA 5FLYA 4QJBA 3WLKX 4JP8A 5ECGC 3S2FA 2AA3A 5IPFA 1LB1B 2FPUA 3JARA 4R40A 1YI0A 5DBHX 5C5DA 1U4SA 2P9BA 4QKQA 1UJNA 4RGYA 3DBHA 4IIVA 2VHVA 3N6RA 2YL2A 4Q4AB 4WXRA 1X80B 3SEQA 3U26A 4D4JA 1WZEA 2V96A 2Y1LA 5BYBA 2GXSA 4HI0E 3VAYA 5AJWA 1XDDA 4IXWA 1Z29A 3E9DA 3OE7D 1XR3A 2I8LA 3BCUA 3QNWA 4I5EA 2IPLA 1SVUA 4N5LA 4I8IA 4S35A 5FT9A 3T7EA 4FFVA 3FUVA 1C9KA 5JDCA 3H84A 5TR9A 1TMYA 3GCZA 3HPRA 2C5SA 5AI6A 1AURA 1CJCA 2E7ZA 2Q5OA 3OF3A 4TLEA 2W6CX 3GI1A 5DB4A 3JAKB 4QWMA 4TPKA 4ZVTA 3ROKA 1IOZA 3M6MD 4RU1A 2VP9A 5FCDA 1LBQA 3TNYA 3QYAA 4Y2JA 5B2ZA 3NTOA 3QU7A 8ATCA 5I6DA 5JIBA 3SC2B 4AZ0A 3ZXIA 4KYTA 1WMBA 1US8B 2DFVA 2WKRA 4XPIA 3GLIB 2JLCA 1OAKA 4OH1A 4PO1A 5I7RA 5BSRA 2Z43A 4NENA 4UJ3A 1UMCA 4LS3A 1ST2A 2OT3B 1U9YA 3AEYA 1T9DA 3KJIA 3MPUA 4Y2TA 5GAJA 5CYPA 3GFGA 1Y7TA 3B6MA 1BN6A 1LSUA 1TZMA 2R1ZA 4F1JA 4EW2A 3RFXA 5KTYA 3S7ZA 3EAQA 4DWWA 1MHTA 5ALJA 3RC7A 3S0JA 2OR3A 4XCQA 1PJAA 3P71T 1DZIA 5FPHA 5JXGA 2Z3WA 3RC3A 2RG7A 4F9EA 1EDZA 1JDZA 3AL2A 3CIFA 4LXXA 3OE5A 4F3TA 1KH3A 2WDPA 5C1IA 2DR3A 2J32A 1QWSA 5I9SA 5GOZA 1BWSA 1SG0A 5TT0A 2W42A 4YCCA 1I9CA 1YR2A 4P3XA 4PC3A 4YK7A 1E1LA 2CJPA 1A72A 2ZZMA 1E7QA 3PRJA 2JI8A 3GJQA 1JT9A 2CGEA 3NM6B 3ANMA 4LFCB 2VTBA 1C80A 1N33B 2XZTA 4AX8A 2FSUA 2XKBA 1PVVA 3ZWNA 3EWIA 4G5QA 4B3BA 3U4QA 2V5UA 2EL9A 2ZVQX 3HGTA 3LPCA 1NXPA 2K4MA 4B4WA 5KWEA 1VLZA 1M76A 3MOSA 5KYUA 2JFBA 3BSSA 5BYKA 1AGNA 2YYYA 1KOJA 3OJWA 4JN6B 1KEWA 4QFBA 1TT5B 1C1XB 1QAMA 5CNIA 2LDXA 5G40A 9MHTA 1EA7A 5AVZA 4RCZA 1KY5A 3L8MA 3MS2A 5HYVA 3G8DA 4RD0A 4L0DA 4WH0A 5I5GA 4B9EA 4I4TF 3ZDXB 1GO2A 1ZL2A 3VNAA 4S2UA 4AAYA 1HQYE 1CNMA 3GRZA 4HB2A 2Q0SA 1PYOA 2Q3LA 1QVRA 4QL3A 5KYYB 2REBA 1A7JA 2C4MA 3I5UA 4GBGA 3DAYA 3NTRA 4LG1A 1L5NA 1LBSA 1X8JA 2WPDD 2QL9A 4F3YA 3VTZA 2XSZA 1T0UA 3A26A 2R11A 4Q7EA 5BMVB 2JAUA 4Z0HO 2C83A 4PTYA 3ZLUA 4CKCB 1S5PA 4JVOA 2VQ3A 1Z74A 4W5JA 3N2LA 4ZOBA 1VHQA 4HXYA 2WHQA 4BLSA 4XTRA 2GEDA 2MT9A 1SHLA 1AXEA 3DVSX 4BCCA 4QM6A 3U7HB 1TO2E 2FN8A 3KKQA 5D5PA 1BCSA 3OE1A 4A0GA 4C2BA 4ZHQA 4B80A 1P91A 2FKNA 5BOSB 4OB6A 4J76A 1DTWA 3TX6A 3I6ZA 4E5PA 5ALKA 1QFXA 4CDMA 1XYGA 3OF5A 4WKNA 3SVZA 2ZWAA 1RADA 1UZAA 4WKPA 3CEHA 3R44A 5CLGA 3F3KA 1P31A 1RHQA 2CXRA 3VPSA 5A9SB 5K9ZA 1KH2A 4CF5A 2IS1A 4NEGA 5HWSA 1P72A 4TKZA 5KNBH 4MCJA 2NQTA 1J33A 3TAXA 3I37X 3QUCA 5LQUA 4CBVA 2CWWA 4BVJA 2VWGA 5I5EA 4ZJZA 4DDTA 3HP4A 1ATZA 3S68A 1NVGA 3AFMA 3P9RA 2WNSA 4FT2A 2HC9A 4BO3A 1G21B 5HKLA 2W11A 4K9NA 2WM9B 1Z18A 1JRLA 2BKAA 3NBYC 4TTJA 3U19A 1T0BA 3GD7A 1X1DA 4E7PA 2I66A 4KNVA 1Q7CA 5FJJA 1LY1A 1WWKA 1KFEB 3G7UA 4NBLA 4Q15A 2WWHA 2ZRAA 3GUUA 2JJ8A 4A10A 1N2OA 3LKVA 5ED4A 4UOQA 2I5PO 4K9QA 1UMBB 3HBNA 3HDGA 1FXUA 2VG8A 5EA2A 5DN6D 4WA8A 3V7UA 3EQ6A 4JNCA 4OHUA 2QVXX 2VNJA 3DP7A 4W5HA 3WLEA 5ADHA 3JQAA 4V1CI 3QTBA 4DV5B 2A9KA 3OJXA 3N3BC 4U2EA 4XJXA 4X8MA 2DWQA 5D86A 4B3DA 3CRVA 4NXNB 4GX0A 5G0WA 3OZGA 1OI3A 4RAQA 5FV7A 3HTXA 4BNKA 1Q0LA 4Q3DA 3IEMA 1XZCA 4X1YB 3R7DA 4K46A 4RYDA 1SB9A 3KYBA 2B4KA 5FFFA 3GZNB 2YN4A 3RSLA 2L82A 5EE5B 1SCUA 4KKXB 1ECFA 3AC0A 3GRVA 4C01A 5JAZA 5IASA 2BRUA 2G88A 3OJEA 5T4FA 1E3IA 2BJVA 1SOUA 4ZO4A 2ACWA 2N42A 4I9FA 3AR7A 1B14A 1SCJA 1C5KA 1HFKA 1L5VA 1TT5A 4HEJA 4A92A 4DR3B 2UU9B 3FNFA 1E6WA 3BRQA 3TINA 1W4LA 3O4IA 2VK1A 3B8EA 5DNEA 4DLPA 3WLSA 4PSVA 3TOXA 1WA5A 4QYIA 3ORQA 5IUNC 1C8LA 4CF7A 2R6ZA 5KWJA 1XF9A 4YAWA 1ECBA 2QMHA 4XM1A 4EVRA 4A0HA 3ZY5A 4BVHA 4QEZA 1GT91 1XB2A 3CLSD 1JEAA 3WBFA 5F7OA 2GA8A 5KYTA 2P2CA 1FU8A 1I4TD 2WYWA 4C4SA 5LR6A 2WT8A 4EDFA 3KKPA 5D3MA 5B1YA 3C6KA 1VJ5A 4ND3A 4LJSA 2FZ5A 3ASUA 3O8OB 2GFIA 1EX6A 3W9BA 2AMLA 1DAOA 2AJDA 2O52A 1D2AA 2NUAA 3O1IC 1TVEA 3JAKA 5KYVA 3T5MA 4KOAA 2R8OA 4U8GA 3G0GA 3QPCA 3TPZA 4X1KB 4F6RB 3F3MA 1DQPA 4IMJB 1X8XA 1YMQA 2NVWA 4M0MA 4Q7KA 1A5TA 3CTPA 2YW2A 4RLFA 4QT4A 3I2GA 4ND6A 1XHLA 3IHLA 4YBRA 2N9UA 5K3AA 4DW8A 1Z8FA 3HZOA 1ZGGA 3WFIA 1A4XA 4RMIA 1CY1A 1SXPA 4OGLA 1FDRA 3IVAA 1FQOA 1KH1A 3G89A 3I6IA 3Q72A 4L4ZA 3SM3A 1AQJA 1NMXA 2VSFA 1UMCB 1MT3A 1SB8A 1QANA 1WW3A 3NORA 4JVMA 4O4LA 4PYLA 4F1WA 2JIRA 3PXXA 2VYND 4GP6A 1JHUA 3FZQA 4JFRA 1A9QA 1DG3A 5HG0A 3W1VA 5CXUA 2E0IA 1V39A 3LP5A 3NCHA 3PKIA 4KDRA 4JBIA 2B1QA 3MT0A 5FTNA 5EY5B 1HWYA 4KVAA 3WL8A 4DL9A 1KYIA 3ZIDA 4PZEA 3JYQA 1UJ6A 3I73A 4L76A 3TQHA 3EGWA 4GYJA 3R0VA 3BK2A 4OAQA 3ZJ4A 1Q1NA 2XODA 4L4XA 2O8NA 4PPGA 4IJWA 4CMIA 1C0PA 5TT1A 1DWPA 1Q12A 4YQEA 5SZJA 3WTBA 3D6MA 3MC1A 4QOFA 1KZ4A 2PGIA 3LCUA 4C05A 2BMDA 2ZE7A 2BFFB 3N2EA 3FRJA 4WZ6A 2X8LA 2IYPA 3WB2A 3UXHA 2ANCA 1P0PA 1VG9B 4I0WB 1YVUA 1NBIA 3GLUA 4YI5A 2QL6A 4HHEA 2V7QD 3NIWA 4HFNA 5FH9A 4Q3CA 3M5CA 1Z0SA 5HVNA 3KEOA 3EWAA 4WLVA 1UQTA 3IBFA 5JO9A 3I1FA 1KY4A 1X7WA 1WCXA 4FTWA 4QOSA 1UK9A 4XGNA 1V37A 1YFZA 1RW4A 1B43A 5AI5A 5A4DA 3AQIA 3DYIA 5DGDA 5T8KA 1KE2A 2O8BA 1GNRA 4FWIB 2BIFA 3HV2A 3OU7A 5FI0B 1JHAA 4QO8A 2M6SA 1WXDA