1NW5A

Structure of the beta class n6-adenine dna methyltransferase rsri bound to s-adenosylmethionine
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
279
structure length
270
Chain Sequence
GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLRSYEIVEGAANFGAALQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION METHYLASE RSRI
publication title Structures of liganded and unliganded RsrI N6-adenine DNA methyltransferase: a distinct orientation for active cofactor binding
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
total genus 91
structure length 270
sequence length 279
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nw5A00
5JR3A 4P7GA 1XJ5A 1T43A 5ICCA 5K0NA 1QYRA 1TPYA 5FTWA 4RWZA 4RTQA 2PY6A 2AOUA 4QDJA 3C6MA 3KQWA 1R8YA 5DSTA 5C1IA 9MHTA 3EGEA 1BKYA 5K05A 5HEKA 2AOTB 5T64A 1DCTA 3A26A 2QYOA 1PJZA 3G88A 4KWCA 1YZ3A 3BZBA 3MHTA 1P91A 1OR8A 2HWKA 1FBNA 1NW5A 2BZGA 2CMHA 2O06A 2ZW9A 4H0NA 5E2AA 4QTUB 2NYUA 3TR6A 3GGDA 1X1BA 1I9GA 1Y8CA 3AY0A 3FZGA 2PGXA 2OB2A 5E1OA 3KPYA 3UJ7A 5G02A 4POOA 3FUXA 3E7PA 3THSA 3U81A 4BY9E 2JH8A 4M7RA 3MB5A 3C6KA 3I53A 2ZIEA 3FUVA 4HG2A 5FQOA 2PX5A 4KIGA 3T0IA 3A27A 5CVVA 4BP1A 5BW5A 2NXJA 4FSXA 3DLIA 3THRA 3LGAA 3NVMB 4OBXA 5FA8A 4HTFB 5E8JA 5HIIA 3M6VA 3TMAA 1N2XA 4AX8A 5LQKA 5K8VA 3P8ZA 1NBHA 3SSMA 1IM8A 5DTQA 4CWAA 2O0LA 2VP3A 5ICEA 2P8JA 5KYGA 1U2ZA 4E2ZA 2I9KA 3LDGA 5LR6A 2V7EA 1O54A 4QVKA 2PWPA 5EMJA 3UJ9A 2ZLBA 1SG9A 2YX1A 4FGZA 2OY0A 4X41A 5CCBA 2IH4A 4DKJA 3PTAA 5FULA 3DTNA 3KQYA 1F3LA 3CVOA 2OYRA 2HR1A 4PYLA 3DLCA 3B5IA 2GA9A 5CVUA 5FHQA 1R18A 4RVFA 3K6RA 3FUWA 5CM2Z 2NXNA 2PXAA 3B89A 3NDIA 4M36A 5EHGA 2IGTA 3MCTA 2OXTA 5K01A 2XBMA 2PKWA 4E2YA 4C06A 4LWPA 3S68A 3HCEA 5DLYA 5HOQA 3KR1A 1BC5A 5T6BA 4X63A 3T7SA 3UA4A 1HNNA 2QRVA 4AZVA 3AXTA 1JG4A 1NT2A 2AZTA 2QM3A 2P1DA 1QAOA 1FP2A 4B17A 2PWYA 1YFLA 4V0QA 3KR9A 3UJ6A 4YMGA 2H11A 1EIZA 3P9NA 4ER7A 4QPPA 2EG5A 1YUBA 5DXAA 2AN5A 3FPGA 3M6XA 3EPPA 3PX2A 2NNWB 1JR4A 1QANA 1WY7A 4U7TB 3REOA 4BLWA 5EEHA 3TKAA 3G8BA 3KQTA 1RI1A 1VBFA 3GWZA 4PIPA 4PONA 5C0OE 3DXZA 3EVGA 2ZULA 4AUKA 2UYOA 1JQEA 2IIPA 3VSEA 4KDCA 2VDWA 4HGYA 4P58A 4YMHA 1YFJA 3EVCA 3DUWA 3BT7A 1D2CA 2BM9A 5K0LA 3DXYA 4HH4A 3ER8A 2IFTA 2JHPA 5DM4A 1X1CA 1G8SA 1ZQ9A 5HIMA 3WSTA 4AZWA 4PCLA 4RSRA 5FCDA 1DUSA 1L1EA 1RI5A 1Z3CA 4X60A 3C3YA 2PSSA 5DM0A 1KPIA 5H02A 4RTRA 3FPFA 4MHTA 1JG3A 3RW9A 5FWDA 5HIJA 3KR0A 3MAGA 5GINE 1M6EX 2A14A 2JG3A 3L8DA 3NWBA 4O29A 2EFJA 2LD4A 3JWGA 5K0GA 2OKCA 2ONYA 4XUEA 3P9KA 1HMYA 3HVKA 1F38A 5FHRA 1KHHA 3EMBA 1EJ6A 3EVZA 1WXWA 3JWHA 4DQ0A 5EC8A 5K0BA 1NV9A 1UWVA 3A25A 4HC4A 3DR5A 2OZVA 5DSXA 4UOEA 2JHAA 3D2LA 3M4XA 3ME5A 2YQZA 3HVJA 3LSTA 3MGGA 1JQ3A 4ISCA 3G2PA 3VC2A 1N7IA 2FPOA 2KW5A 2CKDA 3BWCA 3PT9A 4R8RA 5EKXA 1WG8A 4YV0A 3BXOA 5EMMA 2BM8A 3BKXA 3GDHA 3G89A 5U4XA 3KQSA 3M33A 4AZTA 4C08A 3SX0A 3UJDA 3SM3A 3TQSA 3UZUA 4FT2A 3QOXA 4Z2YA 3BWMA 3GRYA 2AOWA 1NV8A 3I58A 4G56A 3QOWA 5CVEA 5CVJA 1KP9A 3I64A 4ER0A 1EG2A 2JHCA 2OBFA 3CGGA 3DMGA 4YUYA 2NP7A 4P7FA 4E70A 5HFJA 4GF5A 1JTFA 2AN3A 2CWWA 1ZHFA 3FYDA 4PYOA 5EIWA 3UBTA 3KPWA 2XVMA 4RVDA 4PWYA 3LL7A 3OZTA 1VP9A 3CJTA 1ORHA 2QY6A 4RTLA 4PGHA 3VC1A 4EQZA 2ESRA 5GM2A 5MHTA 4XUCA 4FR0A 2IH2A 5EGSA 2WA1A 2PX4A 1AF7A 5FWAA 1VP3A 4K6MA 5DRTA 3FYCA 4GOOD 3LKDA 4OQEA 1BHJA 2IH5A 4HSGA 2IBTA 3AWIA 3G7UA 3ELWA 4GOLD 1P1CA 2B25A 3NDJA 1YF3A 2GLUA 2GB4A 3BGVA 1TW3A 5EOVA 1KYWA 4MTLA 4CKCA 3FTEA 1VIDA 3R0QA 5E9QA 3HVIA 5DPMA 3SVZA 1JSZA 1XCLA 1XDSA 3BGDA 2O07A 3ELYA 5K03A 1NW6A 3SSOA 4LG1A 4R05A 5GWXA 5LQUA 3Q7EA 3OZSA 5EG5A 5IKMA 2P3LA 3TRKA 2AOUB 1AQIA 3HP7A 4PYKA 3VYWA 2XYVA 5ICFA 2GH1A 3HCDA 3PS9A 3C0KA 4GOND 3G5LA 2UYCA 1SKMA 5CVDA 2Q41A 5LQAA 1AQJA 2IDKA 3GIWA 3KU1A 1YB2A 3LCVB 5DTRA 5EZQA 1VQ1A 4YV2A 4FSDA 3PLAE 3UFBA 5CCXA 2VDVE 5LQNA 3UJBA 3FUUA 3CJQA 4FP9A 1RI4A 5FQNA 3LECA 2HMYB 3GRRA 4RV9A 5T67A 2PT6A 3FRHA 1R74A 4CKEA 2WA2A 5F2NA 3CC8A 4IKPA 2G71A 3MQ2A 3HA7A 2ZBQA 4C03A 2WK1A 4DMGA 4GOMD 3E23A 3HA5A 5K09A 3HCCA 4RTNA 1KXZA 3PX3A 3LPMA 1NW3A 2YR0A 2VS1A 3EGIA 3TFWA 2IDJA 4P7JA 3M6UA 4YUXA 1B42A 1XDZA 1JTEA 1IY9A 5BXYA 2EX4A 5EIFA 1IXKA 2FK8A 2K4MA 2ZTHA 5FA5A 3JWJA 4WVLA 4FZVA 3IEIA 4ER5A 2YXEA 5DT2A 2G1PA 4QVGA 3GRUA 1ZG3A 1ZGAA 4ER3A 5E9JA 4CTKA 3LDUA 2YVLA 4GEKA 5DM2A 3NW9A 2V74B 1XVAA 1NW8A 7MHTA 2PXCA 1X19A 1D2HA 2ZVJA 3F4KA 3LHDA 1RJGA 5E1BA 3EVFA 3TOSA 3P97A 4ATNA 4BP3A 1H1DA 5DTMA 1SQFA 5E9WA 2ZIGA 4XUDA 4F84A 5DXJA 3G2MA 3OU7A 3DXXA 1L9KA 3HVHA 4QTTB 3KQMA 2ZIFA 1YZHA 4ER6A 3Q87B 3TM5A 2IPXA 2Y1WA 4RVHA 2AN4A 4F86A 1XDUA 2I7CA 1BOOA 1D2GA 3EVEA 4CKBA 5DM1A 1QAMA 8MHTA 3PVCA 4R6XA 4C04A 1KPGA 3ERCA 4A6EA 3KPJA 2QRVB 2YXLA 4V0RA 3B3FA 1G8AA 2G8NA 1QZZA 3A4TA 3KQVA 3SSNA 2B9EA 3HTXA 2PXXA 4YUVA 2PLWA 3B7PA 2AR0A 2XYRA 4M38A 5LSAA 2ERCA 3R9XB 4EKIA 2FCAA 1KIAA 2XYQA 2FYTA 3HNRA 3RIEA 3GCZA 1NBIA 3B3GA 4R6WA 1P39A 1SUIA 3LBFA 3E8SA 5DRYA 5EKUA 4YUZA 2BR5A 3ELDA 3FPJA 1O9GA 2P40A 2PT9A 3G5TA 3RODA 1NW7A 2OB1A 4DM3A 5IH3A 4E32A 2DULA 3BUSA 1R6AA 3O7WA 3JWIA 3P9IA 4QQNA 3PFHA 3P71T 3TM4A 3LKZA 4CXMA 2UZ4A 5K0JA 1MJFA 3AJDA 3OZRA 2B2CA 3B3JA 3O4FA 4RTPA 3DMHA 2I62A 1DL5A 2PJDA 2R6ZA 2ZWVA 1WXXA 4E2XA 2ZZNA 4EMSA 4KDRA 1M0EA 3IV6A 5F2OA 5EMKA 3OE5A 5EEGA 1R00A 2OO3A 3KPUA 3MERA 4GBED 4EVIA 2H1RA 2PV0A 4OA5A 5D1NA 3UJCA 3OCJA 2ZFUA 3GO4A 4GC5A 4MQ4A 3LDFA 4X61A 5EQJB 4U7PB 2BH2A 3ORHA 3G2OA 3CJRA 3GU3A 4CTJA 2F8LA 4PYMA 4NECA 5HILA 3NJRA 4LECA 3OU2A 4EKGA 2JJQA 2G72A 4R8SA 5KVAA 4PCAA 4DA4A 1I1NA 2NP6A 1ORIA 2O57A 2OPBA 2PX2A 2I6GA 5DX8A 4HTFA 2P35A 4JXJA 4PYJA 5BP7A 2AOVA 2ZWAA 3CKKA 4A6DA 4RVGA 3LCUA 3ANXA 4PYIA 5DX0A 5K0CA 2HTEA 1X1DA 3AXSA 3TLJA 4PNEA 3O31A 1L3BA 2QE6A 3DULA 1R8XA 1RI3A 3P2IA 4XCXA 5EVJA 2ZZMA 4PINA 4C4AA 3IYLW 3HCFA 4OA8A 5KS2A 3MTIA 5FUBA 4DF3A 4DZRA 4BLVA 4RTMA 1PRYA 1QAQA 1RJDA 1WS6A 1X1AA 1L3IA 2VZ9A 4Y30A 5E2BA 2GS9A 2C7RA 1G38A 1JG2A 3EVBA 4YV1A 2AVNA 5CIYA 4YUWA 1KYZA 3KR2A 5D1HA 5HZMA 2YUIA 3OE4A 4F85A 3QV2A 5P8WA 1ZGJA 3HM2A 3KQPA 1FJXA 2ZCJA 3GNLA 3GRVA 2NXEA 3DH0A 1VPTA 2EJUA 1FPQA 3P9CA 4QDKA 4RX1A 4M37A 2GAFA 3G2QA 3OFJA 1G60A 1JQDA 3PFGA 2C7OA 1FP1D 4KW7A 1TW2A 5LQRA 1VL5A 3GXOA 1SVUA 5HIKA 3DOUA 2ORED 4GC9A 4PGGA 3SR4A 1AV6A 1XXLA 2ZZKA 3T7TA 3OPNA 2Z6AA 2Z6UA 2XVAA 1RJFA 4FS8A 1XTPA 3CBGA 3E05A 3M6WA 1O9HA 4OBWA 2ONZA 4C07A 4RTKA 5GM1A 2YTZA 4RTSA 2CL5A 3CCFA 3NWEA 2Y1XA 5GIPE 5GP1A 2R3SA 2P7HA 1G6Q1 3UWPA 2PBFA 3EEYA 4ZTBA 2ZBPA 3A7EA 2P41A 1RJEA 3R24A 5CUQA 3UJAA 4P7KA 3T7RA 2JH9A 4IV0A 5CD1A 3GJYA 5E1MA 3KPVA 3FTFA 5E8RA 3EGVA 3R6TA 1EQAA 4MIKA 4PIMA 5DWQA 3V97A 5KQRA 3SXJA 2G70A 5EZSA 2VDUE 4C05A 3UJ8A 3OFKA 3BWBA 1UFKA 1NE2A 3BGIA 3I9FA 3ID6C 3SGLA 2ZSUA 3H2BA 1VLMA 3BKWA 2BR3A 4BLUA 1VE3A 4Y2HA 2E5WA 3PB3A 2P3QA 3M70A 3GRZA 4KRGA 3BWYA 4AZSA 5KQSA 3UA3A 2ADMA 4MWZA 5BW4A 2IP2A 4PYNA 1EJ0A 5M5BA 5E1DA 2FRXA 1V39A 3KQQA 4HGZA 4OQDA 3V8VA 5GIOE 1SUSA 1SQGA 2N47A 4E33A 5JUWA 3FUTA 2EJTA 2AVDA 3MCZA 10MHA 2DPMA 3DMFA 2BR4A 5ERGB 5EPEA 2P7IA 3FTCA 3NMUF 3DP7A 1XCJA 2AOXA 2C7PA 3HA3A 3A7DA 1Q0SA 3K0BA 4GQBA 1JG1A 2UYQA 3KKZA 3NTVA 2IBSA 2HV9A 3FRIA 3ELUA 1JSXA 2NXCA 3LX6A 5LQCA 1ZKDA 4WXHA 4E2WA 3FPHA 3EEOA 3NVKI 4DCMA 4IWNA 3HCBA 2ZBRA 1UIRA 2HNKA 3G8AA 4PYQA 5EMLA 2P3OA 3MTEA 4FT4A 3C3PA 3I5UA 4E31A 1L3CA 4KVZA 1KPHA 4LWOA 3EVAA 3TPZA 3LBYA 5C9ZA 5LQJA 3X0DA 2AOTA 2C7QA 2PVCA 2O05A 4E30A 3HCAA 1N7JA 4GUAA 4IV8A 3EVDA 2CMGA 5EHIA 4X1OA 3HEMA 4RYLA 5GOZA 5K0EA 5DX1A 2Z6QA 3P2EA 3P2KA 5F2KA 4KIFA 2UYHA 1EAMA 4L7VA 3SMQA 1Q0TA 3ER9A 1MHTA 1M6YA 3LCCA 2FK7A 2B78A 3R3HA 5K0FA 5B1SA 2AS0A 2H00A 1INLA 4HRAA 1RI2A 4EK9A 3KHKA 3FPEA 4QQKA 4RTOA 3KQOA 2B3TA 1G55A 1NKVA 3FTDA 3IHTA 2FHPA 4QPNA 2PX8A 1WZNA 4OX9Y 1KR5A 1I4WA 4RTJA 1P1BA 3TKYA 5FADA 3EMDA 2YXDA 3OU6A 4DCGA 2GPYA 5ICGA
chains in the Genus database with same CATH superfamily
3SZMA 1XJ5A 4RTQA 5FV4A 2FZCA 4RF4A 2PY6A 4RWZA 4QDJA 4M4SA 4QZVA 1R8YA 3OTHA 3QI2A 1XVVA 9MHTA 2EL9A 5A0FA 2WF8A 3KBOA 2WY2D 3RGGA 4DS3A 4ETIA 4ZCRA 5LOVF 3VU3A 4DA6A 3L8ZA 4WNIA 1YE5A 1M54A 3OCWA 5K5EA 3SR3A 1E8NA 4AYWA 1R0XA 2IS2A 3QBTA 2RGEA 2HAEA 4H0NA 4MMXB 2GZAA 3IO3A 1VYVA 4R3UC 3N39C 3OT1A 2DAPA 2JS7A 3UN1A 3URKA 3GP5A 3ES9A 5K3FB 1P1HA 1USUA 3KXPA 4XDZA 1V7CA 2OB2A 1OH6A 3RBZA 1LNZA 4FSHA 4I19A 1GY8A 2QD4A 1JFFB 3HYSA 1BA2A 4M1SA 3I2IA 5DW0A 3EVTA 4KKVA 4ODIA 1WB4A 3AQ4A 5T4FA 1HSZA 3E7PA 3CCCA 4XEUA 4G4SO 4I8IA 4QM6A 3NYIA 4P80A 4KEAA 4EJ0A 3GC6A 4D3FA 5LFAA 4TYPA 4CETA 3A10A 1BVRA 1KAEA 3V8NA 1PFGA 4FSXA 3DMTC 3EEIA 5FA8A 1PJ4A 4ARCA 1BROA 1FPMA 1PQPA 2VJMA 1IEXA 5EJFA 2HWUA 3TMAA 3BHJA 5KVCA 1QCCA 3I5AA 2DSNA 3VPHA 3M1IA 3OJEA 5EJIA 1J0EA 2PM8A 2ZDQA 3AEXA 5C7YA 1UXJA 3BK1A 3SEAA 1L7OA 1GFIA 1AUPA 1ZRMA 3LDGA 1Q1NA 4IDGA 2I8CA 5EMJA 4JGBA 4CODB 3A4IA 3CEHA 3HZZA 3EPLA 4KE6A 3B7WA 3TNYA 1QQTA 4ZVQA 1BQ4A 4NS1A 1L8XA 4H6VA 3KQYA 2VK1A 1OH7A 3CVOA 1Z5GA 4TS3A 4WAUA 1QVWA 1KDYA 2WHQA 1K98A 2TMDA 1UADA 4K0KB 3O8LA 5EWMA 4M36A 2JLCA 1F12A 1QDUA 4Q4CA 5JZSA 5COAA 1NJ8A 2ETXA 3MRTA 3AEUB 3GUZA 4JT8A 1O4WA 4YJDA 4LHSA 1K89A 3ORSA 3TXAA 3VHXA 5JAUA 4C1BA 1NZDA 1QAOA 4BQQA 1QIIA 5JXWA 1DO2A 1E2QA 1ICIA 4DA7A 3KR9A 4CMIA 2V7GA 3I1IA 4DLLA 3CQ9A 2H54A 4L5BA 4RY2A 1EKXA 1GN9A 2AQIA 3G0BA 4J9VA 4YJKA 2HRQA 2IV2X 3KUCA 5JSZA 2CUKA 3NZEA 4Q4AA 5GJWC 4KXXA 5JSFA 3SHOA 4MUAA 1L5OA 2WFZA 2FSVA 3DVSX 3FUCA 1JQEA 3KJIA 1DLJA 1V2HE 1ZGCA 4P58A 2GAJA 1KK0A 4RMGA 4CMJA 3Q9SA 4Q1CA 3A3PA 1PT9A 4OXRA 5KTMA 2IP1A 5TRTA 1F2DA 3WGIA 4FI3F 2HO5A 1DKPA 1NVFA 2JI8A 3W8RA 4E5KA 5SZIA 3PG5A 4MVJG 4GKBA 4KK3A 4GX0A 5LNK6 1Y6QA 3F8SA 2P75A 4I6EA 1XEXA 4YQEA 4B73A 4IMJB 4YCNA 1GR1A 1RWQA 1Z0FA 1C2YA 1AS2A 4PC3A 1YZYA 2I3ZA 4HAWA 3EQ2A 4KO8A 3QUQA 1NUAA 1SCIA 4J1TA 3JWPA 4BRWA 2JZCA 4XCVA 3AX6A 4XUEA 1KSJA 5CK4A 3PEFA 3OQMA 2DQZA 3E0XA 3WLOA 2FOXA 4OKSA 2B1JA 4DPLA 3OZ7A 1NVDA 2BLNA 2YWGA 3WA7A 1Y8ZA 5DH9A 2GMWA 4KYUA 5IJWA 5K0BA 3CVJA 4DCSA 3WGQA 2YHAA 3QHQA 2FW7A 4Q3AA 4UOEA 4Q3LA 5LQSA 3ICQB 3WL4A 4BZXA 4OBEA 3D2LA 2FDXA 3ZDDA 4N8EA 3C2QA 4PICA 4QNNA 3GJ7A 5K4AA 1JQ3A 1YCDA 3TB4A 4M55A 1N7IA 3BWCA 4OL0A 1WHTB 3RS5A 4XWTA 2DFVA 1OD6A 4JI6B 3PZBA 3L77A 2YWJA 2IYSA 4FE3A 3PIRA 4C08A 1GNPA 4K9KA 1UAAA 3LGSA 2PD6A 4D42A 1CNMA 3FDFA 4FT2A 4QPJC 3BWMA 5EINA 5GPBA 3COZA 5KEIA 3VZQA 1K9VF 4YRKA 2PUCA 4GI1A 1JT9A 2X42A 3E58A 1ESDA 4ZCPA 4EBBA 2AEMA 4NZNA 1RKUA 1QF9A 3C1AA 4HWTA 1NQTA 4C4PA 4DJTA 3EGXB 1KYYA 3LL7A 4M6WB 4N41A 1WPXA 5KQGA 1H2BA 2QY6A 2W2MA 4OXQA 3TBHA 1MEEA 3EXFB 3H9JA 3PC6A 4YRJA 2VQEB 1K7XB 2WJVA 4LZLA 3CN7A 4N7JA 4KBYA 4NAVA 1ZNYA 4D0GA 1V3QE 3LG2A 5BOSA 4MA5A 5A62A 2CK3A 2QQEA 2QBYB 4HLCA 1G6OA 1JIVA 2PS3A 4KSBA 5EIHA 3UWOA 3AETA 4ZV4A 4BVGA 4IDFA 3H9UA 5AI6A 1YQEA 3IPAA 4NX2A 4PZUA 1NF8A 1AK9A 2JDID 1E9SA 2O2CA 3BCUA 2QY9A 4Y67A 2I2XB 5ALNA 5DHRA 3RRYA 1HDYA 2EZ9A 2RGDA 1VIDA 2VT2A 3HVIA 1GCIA 3P2YA 4NCAA 5BVHA 4WXMA 4KXQA 4LZWA 5CA0A 2HI0A 3SNKA 3AUKA 1MH9A 1IN6A 2VBFA 5G3YA 5IAKA 2IJGX 1T0IA 5NLLA 5JQGF 2P3LA 1RMYA 2VBGA 5LPNA 3W7BA 1TVMA 4H08A 2WEKA 1SNYA 2O0JA 3G5LA 2UYCA 1BRMA 1W8IA 1Y82A 4YDHB 4YRQA 5BVGB 2MYTA 3ZXIA 1IUNA 2QJTA 2P91A 2ZI6A 1C2TA 3CLHA 3KU1A 1NC3A 2OC9A 5KX5A 3E1KA 3JQPA 4K2AA 1ISGA 1SOAA 5KSZA 4Q3CA 1QGUB 4N3BA 2HB6A 4KL8S 4LJAA 5IKXA 3EWIA 4FLFA 2H5LA 4W8OA 3VNAA 2BFCA 5D5QA 2WWWA 3ESRA 3RE1A 3CRNA 1XLTA 4GOMD 4P0QB 5EXPA 2QRQA 4EGQA 2HN9A 1CDZA 1LPPA 1M2NA 2CBZA 3EIUA 4Q9KA 3ESZA 3M6UA 2VCYA 3HPRA 4Q6BA 5CTAA 1KO8A 1GZDA 1NJ1A 1O6ZA 1VJGA 1YA8A 3K94A 4MYRA 3RK1A 3SKXA 1R9GA 1YVUA 2WMYA 4RUKA 4LTDA 2CMFA 4WVLA 1I0ZA 1XCMA 1E62A 3JQEA 7REQA 3H42B 5AKXA 5DT2A 1LNQA 3ZY5A 5EPOA 2BTEA 3GQBA 2Q5JA 4ER3A 5CM9C 3P96A 1R6BX 4KBFA 2Y4OA 4GSKA 2VUSA 1M2FA 2APJA 4C0SA 3WXBA 3UGJA 1SQFA 1I6WA 3RFFA 2A94A 3FA2A 3G17A 4FOSA 3COJA 2V6FA 1C1DB 3IULA 2BHTA 2EDCA 4G9BA 1OFTA 2JF0A 3T3EA 5HMLA 4YAFA 2AMLA 2D4AA 2GM5A 1J70A 1A2BA 1YZHA 4ER6A 3GLKA 2VTEA 3FYSA 3LK7A 1EFKA 1P2UA 2I7TA 2QL6A 3C24A 3RYFB 1O95A 4UULA 3TQOA 1IBLB 2N46A 4C04A 5T4BA 4ECAA 1J0BA 3DM5A 1PD1A 1THGA 1SC1A 2BMFA 2NSLA 3A4TA 1QZZA 3BB3A 1QP0A 3VU9B 5CJ2A 4C0XA 5HRCA 4M8KA 1SQ5A 2F43B 5FI3A 3SR0A 4ZYXA 3OPMA 4R83A 3ZWCA 3T6KA 3VBCA 2XYQA 1DIBA 4FJ2A 1AMOA 2VSQA 3FF1A 3GFOA 5FBQB 3VR6D 3WWOA 3ZWVA 1J9GA 2BR5A 1O9GA 2R84A 2PT9A 2HDOA 1VLVA 4DUGD 1FX0A 4K6FA 2OB1A 4QUBA 3KOUA 3VSDA 3OOHA 1ACMA 1ST2A 3FNIA 1CY0A 3G82C 3EG9B 3QE2A 3P71T 4MUNA 4C7MA 4JI4B 1MJFA 3AJDA 2R11A 2ACVA 3HY3A 1TM5E 1HLFA 2WV9A 3I1YA 4Y2VA 2VYND 1OLXA 2V5AA 3SG0A 3UICA 3HB0A 1T2NA 2FOLA 3OG9A 4GM1A 2XEDA 4OAPA 4E2XA 3FTNA 4GLFA 4MGZR 3QUSA 4IMPA 5F33A 4DDUA 4H1TA 2DQ4A 3D8HA 3O7MA 3WJ1A 4B5KA 2CLFB 3I12A 3PJRA 3K72B 1Q15A 3DHWC 3JW8A 4AJEA 4TRRA 5AVTA 1UMDB 1DPGA 2V98A 2YXNA 1TZBA 4OGFA 2PMKA 5BQ5A 4F85A 2IIBA 2L0XA 3COYA 3GO4A 3HO8A 3SPXA 5KKCA 3K09A 4HLNA 2EJBA 4PHHA 2ZRIA 1VJTA 1UBKS 3MOSA 5CYPA 3SYRA 4CTJA 1YBVA 1FXUA 1UBFA 2QRKA 3EXAA 3OSUA 4GD3Q 1ICEA 2F8LA 4WFIA 4LF7B 1FQWA 1GG5A 1UDAA 2H2WA 2QG9A 2ZB8A 3N7UA 4P84A 1OX6A 4U9HS 3USCS 4YMTA 5CEJA 1FNMA 4FFBA 4O4IA 5FLKA 5JAHA 2SBTA 4R8SA 2DFPA 2XB2A 4DVGA 2ZYHA 4EHAA 1NNEA 2NP6A 3HWRA 3SFTA 4LNHA 2E4UA 1DX6A 1KEVA 1Q12A 4JC5A 5IXJA 4GAEA 3IC5A 1BE1A 1KO7A 1H4VB 3L7KA 1F8XA 1HG0A 4IXMA 3JQAA 2DEUA 1MW8X 4RMIA 5KKNB 3V46A 2VP2A 3U39A 2HF2A 1Q92A 4U2DA 1OBHA 2QE6A 2ZRGA 4FMCF 4LOKA 3T54A 2YL2A 3O73A 5HX7A 1PFWA 2VP5A 4U7FA 2XKJE 1RYYA 4EZEA 3OLYA 2D7DA 4D79A 1C8VB 3Q8KA 2A88A 1EX9A 1FP7A 3USZA 6REQA 3VM6A 4QXPA 3K6KA 5E2BA 1A98A 3ZU3A 3HGMA 2IPAB 1HE2A 4DY4A 4W1SA 1GCOA 5COQA 3O6VA 3MCUA 2AVNA 4YUWA 2VH2A 4D9NA 1HWYA 3BX1A 3PITA 2FETA 1GA4A 1H6BA 4N01A 1S1MA 2FMIA 1GUYA 1XZAA 2PNJA 3OTGA 1HDXA 1LLFA 2QLBA 2BZ0A 3DOIA 1N2SA 2TECE 4HJXA 4QUDA 3WYFA 3DH0A 4HNTA 1XTTA 2IXDA 2PSHA 5L8VA 4UFPA 2ZRLA 1DAOA 4HLQB 2A5YB 2V7UA 1ZJZA 4YRNA 3QPDA 1NJ5A 2IW3A 1II8A 2QX4A 3GXOA 4RO0A 1AHIA 3CZ9A 4DLSA 2MHCA 2WUFA 4QXOA 4ADSG 1TRKA 2DPLA 3K9FC 5KQLA 4REQB 5F1OA 1BWRA 3IP9A 3REFA 4DLXA 1LBQA 5CYGA 5JTUA 4Z7QB 2HLPA 1U3GA 2DY1A 4TTIA 5D6NA 4YYEA 1CJVC 2FWRA 4G3XA 4RTSA 2VIIA 3HBAA 4H7DA 3H84A 2R6JA 4J91A 4M0CA 4MULA 1G41A 1MA0A 1NM5C 3KJFA 4RYDA 5M7EA 2HMUA 4LPSA 2B8TA 2JH9A 8OHMA 1WTCA 3LYAA 4JLUA 3L8YA 4Y0VA 5A9TA 3ROQA 2ENUA 4D80A 1LDGA 3U56A 2Y1DA 2BFEA 4MOWA 4RESA 4HF7A 4LXGA 1ODJA 4LGVA 4C05A 4YJFB 3O8RA 2I4MA 4LNAA 2E4WA 2X5NA 3C3DA 3OIVA 4FZ5A 1P6UA 1FFYA 1KJZA 3RH0A 3KE8A 3WA6A 4D9HA 3JX9A 1Q22A 1KMCA 4XPIA 1Q0UA 2QNRA 4EZBA 5HKAA 1HNXB 3HJTA 4LOIA 2G1AA 4EM6A 1W49A 3LXXA 4BO4A 4D41A 4FEAA 4B6RA 1T5DX 1NP7A 2VAPA 4UU8A 2FPRA 2GPJA 2KWIA 4QBHA 1CE8B 4Z8YA 5GJCA 4TV8B 1H4QA 5E1DA 4X3OA 2RAPA 1Z0JA 4ZHQB 4E46A 5J4YA 1C3XA 4AJPA 3PC2A 5HZHA 5H4GA 1LY1A 3ILXA 3BM5A 2I6UA 2W7TA 1XCJA 3EFOA 4OM8A 4MRSA 3MGBA 4EPVA 1FQOA 2VNSA 3NM6B 3H3FA 5IZCC 2VOJA 4F97A 1V5FA 3JAKA 3EXIB 3TIIA 1MO2A 4CKXA 3FOBA 3H5AA 2OXCA 5HF6A 2J9XB 4J2HA 4LXIA 3L43A 3EARA 1PAUA 4HQNA 4HAZA 3MTQA 1U63A 3KOWA 4JDPA 2ON6A 2Y1EA 1B00A 4OHUA 2QLNA 3AUXA 4TVBA 1FYVA 1E69A 2E6KA 2Q1WA 3T5MA 5C9ZA 3RRMA 3AM5A 4AUEA 3JRNA 3OUZA 1T15A 3U3XA 5HCNA 5EPUA 1T4DA 1NF3A 4N49A 3RKSA 4B6GA 3I6ZA 2C5HA 3ZLJA 3PUZA 3QHPA 1YDMA 4LXTA 1D09A 2AZMA 2Y2UA 2VHQA 4TWRA 3JR3A 4BNZA 1Q7TA 1NFFA 3HWSA 2VL7A 3H04A 4FGKA 5C1DA 4L7VA 1SCDA 1RNLA 3SMQA 1UBGA 4BNMA 5KNCH 4RAQA 4HVCA 3FJYA 5HCUA 2V0CA 5L4SA 1U28A 2IV3A 3WAGA 1E3MA 4F2GA 3CURA 1W5BA 1RQXA 1S4QA 4ZCQA 5E7QA 5CW1A 3RS4A 1L5HA 1IDOA 4EKEA 4KXNA 3MCWA 1KI7A 3KB2A 1WZNA 3A1CA 3KKQA 4LMRA 1EFPA 3HKBB 4FYHA 3PUYA 2FQWA 1NP6A 2I91A 2R00A 2F9MA 4CTOA 4C9BA 3L7MA 3O3OB 3QEOA 1FFEA 4EPWA 4NE9A 2P62A 1GYPA 3AIKA 4EATA 3IUYA 4R01A 4ZYVA 1KI8A 1O94D 1AMUA 4LFBB 1Q3TA 1WXGA 2JFBA 1CUSA 2FJ0A 3OQIB 2J6CA 2W98A 1Y7TA 2C1ZA 2O06A 1NSFA 5IWAB 1RT9A 3EAGA 2CHUA 3DSRA 5F9FA 3ADCA 4HWSA 1DXYA 1T5IA 3WMRA 2PKXA 3AG6A 4NICA 4C87A 1KRXA 1SK9A 2QLFA 5CIQA 3CR3C 1XUOA 4LE0A 3QX7A 1UM9A 2QS9A 5JS1A 4EB3A 3C1OA 1KMQA 2OV2A 3LFUA 1DV2A 1Z7BA 1VKZA 2O20A 1CQJA 1MP0A 1JMVA 1HDRA 2L2QA 2XOKD 4MAFA 4O2AA 1M76A 3BL8A 3DZFA 3ENWA 3JVIA 4PSCA 3U44A 3AFIA 5ALRA 5CJPA 3GZJA 2X9GA 5F4ZA 4CG0A 4KR7A 1YRBA 3V1UA 3O2NA 4H3KB 3YASA 1IIBA 4N0MA 3H5IA 4YRLA 3R0JA 5FBHA 3SFVA 3CLRD 3JATA 4EJSA 3ZY4A 5CXQA 1UBSB 3S7TA 3LX4A 1K66A 3M6VA 4GP7A 1B0UA 1PLKA 1YHYA 3IVCA 4WGFA 3T35A 5LQKA 3QPVA 4CWAA 5ICEA 2CFIA 1ZCJA 2JD2A 4IUCS 1KYVA 1LU9A 2YOGA 2Z43A 1JAZA 3UJ9A 3RRFA 1XRPA 2HQSA 3TIXB 2NZVG 1T9GR 4DIMA 2O8BA 4LF6B 3TH5A 2YBDA 2AMFA 2ZB7A 3EQ8A 2NUPB 4OSOA 5GY7A 2FNAA 3VO1A 3EDCA 5JD3A 4UHHA 4RVFA 3ZDXB 4MDEA 5C7LO 1IMJA 4RLHA 3RVQA 4L22A 2H48A 1Z39A 1MPXA 4EB0A 4LDNA 5HS6A 3H4VA 1E3SA 5DLYA 1I14A 1NKTA 2AV6A 5E0KB 1C9JA 1COZA 4QYIA 2FEXA 2E7ZA 1EFHA 2Q4EA 5DISB 1G5PA 1KZ7B 2PWYA 4ND1A 3HM9A 4UREA 4YMGA 5I51A 1L4BA 3U4CA 1QS0B 1HZJA 4DDHA 1SOUA 4C7KA 3TKLA 1PKEA 3DYBA 1YVPA 4PONA 4DNQA 4WJLA 4E7OA 1GDTA 3Q85A 4G4JA 4KDCA 1OAAA 4K9RA 3K0CC 2ADOA 3E27A 1NVAA 1KOLA 1B41A 3BT7A 2WJAA 2VT6A 4Q9DA 4DCTA 4PX3A 4X3PA 1L7DA 4JB8A 5KYYA 3ZDQA 1B6RA 1I9CA 3PF8A 3ZXXA 3H5WA 4DV4B 4X60A 2J09A 4L4RA 3HYNA 4M0LA 3D8UA 5IX8A 3HB5X 4U7HA 4ZT4A 2PLRA 3TB6A 4L4SA 3ZHSA 3IT2A 3KR0A 1XE3A 3AP3A 3AV0B 4WCFB 1V7PC 2AN9A 2JG3A 4QDZA 2IZOA 4L08A 1E6EA 2CC2A 2C94A 2E4XA 3LX8A 2X8WA 3QWFA 4IHJB 4XSVA 5G0TA 4P7BA 3Q6MA 1N8NA 1PR4A 1CUEA 4I1YA 1VSVA 2Q2QA 4MICA 4JOSA 4CM5A 5JD5A 2DVMA 1CR4A 3OA0A 5DK6A 1K92A 2K6GA 3RNOA 2CL6X 4CM7A 3V1TC 3LIPA 5A4AA 1GDDA 2R7MA 3R3ZA 3C8DA 5EC8A 1GTZA 2RB4A 1JDUA 1WNTA 5IRCD 3KT3A 3THWB 3RG2A 2J3IA 1YRHA 3SK0A 3WOVA 2Z1MA 1D6JA 1KP2A 4I81A 1H8EA 1VE7A 4TSKA 2JKZA 3CR7A 4X0EA 5ELLA 1RYFA 5EKXA 3W5UA 3W05A 1SKAA 2JD1A 4KQ1A 3X1ZA 1BDIA 2JGEA 5EMMA 1BDBA 1HL7A 4DEXA 1T5LA 2P1RA 5HGJA 1KQOA 3M33A 3ZU6A 2GERA 1LRLA 1ISPA 1YRQA 2IHKA 1GZSA 2OCKA 2PWZA 3IUSA 1DEXA 1DOZA 3PQ8A 4KVAA 1KAGA 3MMPA 1CZKA 2OXEA 3C85A 3LBAA 3L7DA 5JCJA 1O6FA 3SC4A 4BLQA 4EENA 4F72A 2JKYA 1C8LA 2D8MA 4PQGA 4BKOA 4KR9A 5C1OA 2GOYA 1UKZA 2DKNA 1XEFA 3GFPA 2PUEA 2Q1UA 4MJXA 1Z83A 3DBLB 3AHEA 3C3MA 5LYYA 4FZRA 3OZTA 1VP9A 2QPLA 4GRAA 5HUHA 2DQKA 1F8FA 4RPCA 2MYNA 3R7NA 3DOJA 2FZKA 2O5EA 2PZFA 3PE3A 1YR7A 2ESRA 1N7GA 1WLSA 3W0LB 3Q41A 1N9GA 4C0JA 4Q47A 5JNRA 3DMRA 4RULA 3OEEA 4YRDA 3CF4G 4DB2A 4GZLA 4K6MA 2CYBA 2OORC 4DTIA 2QAGC 5FOVA 2CJFA 2IBTA 4TL6A 4Y2JA 5HXAA 2WD8A 3NHKA 2JFZA 1RR6A 1O5TA 5THXA 4J0FA 3L0YA 1A4XA 4ZVLA 3ZBUA 4GOJA 1AZWA 4U8GA 4CKCA 1V8DA 1E1NA 3L02A 5LZ2A 5FPKA 1RYDA 4PQRA 1XCLA 2F7SA 3T3MB 1Z5VA 2EJWA 1VRVA 2BCEA 3E7DA 1RXVA 1L7NA 5SV2A 1OW3B 2OQIA 4JYAB 2R4UA 4RCZA 1W6RA 3D4BA 1MO3A 5LYJF 1OIXA 2W6JA 3IDSA 2Y93A 4YI5A 5ALOA 1Y9JA 3TW0A 4WNAB 5EIBD 3B12A 3ED1A 3MJEA 3PNMA 3K0SA 3H2HA 1NYTA 3GIWA 3BTUA 4HUQB 1T5SA 2DH6A 2PV7A 2RHHA 3H9EO 1W581 2PTGA 4G8BA 1CIPA 3P9QA 1I4LD 3UFBA 4NK4A 3F3SA 4JSYA 3EISA 3BMXA 1DTWB 1R74A 1VIYA 2G71A 1P2VA 3PWTA 3KUDA 4KMOA 2WICA 3WNQA 5EFOA 4OIFA 4MI3A 1WUJS 4GQIA 3HCCA 2R7KA 1KXZA 1L5RA 1FY2A 2GHTA 3FNGA 1X87A 5ED4A 2IOQA 3EY4A 2JCGA 4BO6A 5A5GA 4NNPA 5EWLB 1CJKC 1VBNA 3P0EA 3PNVA 3SXUB 5BXYA 4PFQA 2E9SA 3WC4A 4DV1B 1QBGA 1YZQA 1Z63A 4WEQA 4EG4A 1SAYA 4R0NA 4IIXA 4LTMA 2HRRA 3C74A 3EDOA 5AUPB 3ZV4A 1FE8A 5BV0A 1XB2A 1WB5A 1G5TA 2HBYA 3F1KA 3HABA 2Q4OA 1JQLB 3A9WA 4HNGA 4G0ZA 4I1RA 3GLVA 5FBWB 2RHTA 1YI0A 3NBUA 3LY5A 5JZOA 1KQGA 1V35A 2FY8A 2WWVD 2FX2A 1Z38A 1ZRHA 2EJVA 2GK4A 1Z28A 4XLZA 3QELA 3VPFA 3MTGA 2K7FA 3ZDCA 4I99A 2GN6A 5DOVA 1SUDA 3RC8A 1KAQA 2PVPA 2EQAA 4CQJA 4GIBA 3L1JA 2DBRA 3ZGOA 2XCSB 5AKEA 3T1VA 1GTL1 2Q2OA 1BCSB 4E1VA 4FEGA 2H0RA 2JAWA 2DG2A 1GITA 1HSOA 3P2JA 3H5VA 4ERXA 1SOMA 2Y1WA 2Z2KA 1ZH0A 5ALGA 3CH6A 5KPJA 1QAMA 4ML3A 3RJ5A 1PZFA 1X70A 1T4BA 3KTFA 1V8ZA 2ORIA 3LUFA 2ABWA 4R2JA 1DRWA 3UPTA 2FRDA 2PUFA 4IH4A 4E1BA 2G8NA 3A4VA 5FKJA 1VA4A 3WGLA 4WLEA 1EX1A 2FW0A 3AF5A 3B7PA 2A1TR 2XWBF 1DQPA 3CT4A 4IPTA 4I55F 1L1QA 2NT3A 3ZDEA 2Z58A 5T5QA 2GYYA 4GOKA 4D46A 4BUJA 5KSYA 2C0QA 2WI8A 2PUVA 2IKSA 3PXDA 1SQ0A 3VPBA 4S2UA 3RUEA 3LP5A 2B34A 4Y1RA 1T9KA 1VM6A 2JGIA 1DC5A 4MB6A 3JWIA 5C8YF 1LPMA 2ZUWA 3OZRA 4FONA 4FYJA 3UFXA 4G0MA 3WB2A 2C5GA 2XF2A 1VMEA 3KXIA 1GL7A 1WXXA 3CRRA 5EXTA 4BBPA 5JRDS 5REQB 5I4KA 4DJ5X 1M1NB 5CLQA 3OE5A 3OQHA 2AI2A 3EDMA 1D2RA 2G9QA 4J0HA 9GPBA 1TCBA 1TZKA 4FUQA 1DCFA 1M34B 5KYVA 5CH3A 5GONB 1IIRA 2FDRA 3PSHA 5CD9A 1NXWA 4C7OA 1P75A 1RAIA 4GPAA 4R1PA 4D4HA 2FZ5A 4FYVA 1GPAA 4I3GA 4WZZA 3GU3A 3BWXA 3IR6A 3VJLA 3DONA 1GKKA 2WD7A 1VYTA 3C70A 1K6EA 4J0KA 3C4QA 1H6AA 4GR5A 2W6CX 4TKMA 5FPPA 4DR2B 1VLJA 3BHNA 3U13A 3HDQA 2G72A 3AR5A 2O2EA 1NDHA 2Q3BA 1P7VA 2CJWB 2FLVA 2OPBA 1AGXA 3MJTA 4BX2A 5KDDA 2IIVA 4TQAA 4NENA 2A57A 4QUGA 4K86A 4MR8A 4KGZA 4HB3A 1E2UA 1QV6A 3TVDA 1KY2A 1U0LA 4RVGA 3CX8A 1Y4DE 4FNAA 4GPEA 4LJLA 4NARA 4EKDA 1J7KA 4S2EA 1XQYA 5KTKA 1D5CA 1I2CA 1L3BA 1DC8A 1R8XA 1RI3A 1K7CA 3LPDA 2HCJB 3GWGA 3JVUA 3MCVA 4BV2A 5KYWB 1KSHA 4UMDA 5KS2A 2GBPA 4OKIA 5EQDA 3EB9A 2J0VA 3HLTA 5BSHA 1GVHA 3R0VA 2C8LA 1U1GA 1K5GA 2G3YA 1HNWB 4I9GA 5HJEA 3WL3A 1GRCA 2PLFA 5HVNA 4YECA 1SA0A 3VH4A 1Y8QA 5TPWB 3O74A 4ZI7B 3CPJB 3FKSD 4Z3DA 7MHTA 4BBJA 3GOHA 1RRFA 1XNJA 1IEQA 1KH2A 4HB0A 1V4NA 4RX1A 5K99A 2ZJZA 3AWDA 3G2QA 4MRAA 1VDMA 2UZAA 2W4MA 3RKUA 4ZDJA 2NV6A 3HNPA 1SGWA 4KDFA 2ZWOA 2R8OA 4G4IA 1VL5A 1KVTA 3IE2A 4G5GA 1QO7A 3EZYA 3PFFA 3PJFA 5HE9A 3THYB 5I8PA 1N25A 1ZM2A 4MCIA 2D2EA 3M2TA 1G4HA 1T4GA 1Z45A 1USWA 1XU7A 2R6AA 2VJYA 2X4IA 1R5BA 3NIDB 3EVNA 3I04A 4H1HA 3R76A 4CEIA 5JI2E 1C0EA 3KLNA 4PTLA 1JHXA 1M8PA 5TQ2A 2GYVA 2PFGA 3SJAA 5C53B 1FFCA 1XZQA 5JAIA 2OM6A 2VZLA 1DQYA 2OV3A 1P1FA 3V4ZA 4ZTBA 2OSBA 2H16A 1MNAA 2JGDB 3R24A 3X1MA 2X3UA 1XJWA 1Z4QA 3KSUA 3M9LA 3NM4A 4KN6A 1NNLA 5FBKA 2HXGA 3UO8B 5JZVA 3RNLA 1N5OX 3IAEA 3R6TA 4MIKA 2AF4C 2WUEA 4QYTA 1L9XA 1TA4A 4NBVA 2V7TA 4HVLA 3IEVA 2ZPUA 1JEYA 3PENA 5KJ1A 1XWWA 1JQ5A 3OWOA 4G25A 2XDYA 4HDMB 3RSGA 1EUDB 1ZCFA 2IZ5A 1REQA 5CVCA 1V9CA 1FSGA 1TA0A 1JDVA 3CZQA 4CLHA 4N7RA 4CGZA 3VNQA 2UVQA 3G8DA 4PG5A 4P92A 2Q2NA 4RQAA 4R84A 1DQSA 3DZDA 3LL4A 1WSWA 5JSYA 5GADl 2C54A 1OXKB 1JSRA 1TIPA 1Z06A 2QG4A 1I6LA 2Q9AA 3CY6A 4GRIA 4J75A 1U8YA 3ED5A 4JB3A 2AC7A 1ENPA 4LJRA 2IU4A 3EIWA 4BVHA 3GLHA 4MW1A 1UFVA 4YAUA 4B4WA 3KVNA 3PDHA 1UPBA 2GASA 2AEEA 2J3KA 2P7IA 4I5IA 1NBME 1Q84A 2WIAA 3OLCX 2QTZA 1BTOA 1P73A 4DABA 4HDSB 4Y1FA 5AVWA 4YCJA 2D2VA 2PWAA 3BPSA 3PI7A 3TTVA 2JLSA 4YVFA 2LDXA 1CNFA 3BIXA 3SC2A 3WDMA 1W36C 1JR3E 3GJ3A 3Q2KA 4H0FA 1NY6A 1JSXA 3QNUA 3I8XA 1BNCA 4E2WA 5K8JB 2AG5A 3GJ0A 3GMTA 5KTYA 1UIRA 3IPCA 3F0TA 5JYDA 1E2MA 2WUGA 3W2HA 2QN9A 3UPUA 4ZMBA 2JIRA 3ZGXA 2WDZA 4RDIA 1MU0A 2VN8A 4UTZA 4YIKA 3WK7A 2YHUA 4EHFA 2ZRPA 3BDAA 1NZJA 4ZVKA 3KXKA 4MPJA 3H8VA 3N2GA 3COWA 4EKNB 1Y6FA 1NQUA 1E4EA 3PHHA 4C4OA 1SD5A 3G68A 4OHRA 4NC9A 3G0GA 4JI3B 3FMFA 2P0AA 3E5RA 3WLNA 1Q0TA 3VR5H 2OGWA 5J5CA 1Q3HA 2QT9A 3WIDA 5B1SA 1WZUA 3TJZA 1DJLA 1G8YA 2ZJ2A 1ORRA 3OOJA 4EK9A 2BDEA 3FDJA 3IKLA 1RBYA 4Z0TA 4HQFA 5AVJA 4NCXA 1G55A 3U4HA 3PKJA 5K0ZA 3D4NA 4WOJA 3HDTA 3SE0A 4QPCA 1L4GA 1N5IA 4WKNA 1FRQA 3ERCA 4K6OA 1MEJA 4BLTA 2ZKIA 2W0MA 1Z5OA 2DJ5A 4TVOA 1Y42X 2QX7A 4I4TB 3TRHA 5JDIC 4BQIA 1NI3A 2JVKA 3D3WB 4FFMA 4M8LA 5COBA 4ENRA 5BSWA 3LCRA 3CGWA 4MVXA 1GGKA 4ZANA 3IL2A 4FMDF 1BKYA 1ZC4A 4KQXA 1GG2A 4RGBA 7ADHA 3C6QA 2ANCA 1QHYA 2I29A 3DPUA 2QVXX 1IB6A 3KTAB 3OHPA 2RH5A 2ZW9A 1TPZA 5D00A 3ZGLA 3HBJA 4CVNA 3NI2A 3LUGA 1M6WA 4DV2B 2VAMA 3GEHA 5J43A 1X7WB 1MO4A 1FP4B 2HJSA 3FHOA 4L6CA 2R1VB 4PHTA 2R2GA 3IIKA 3IODA 4J9UE 5B1HA 2RGNA 4B2PA 1MORA 4BDTA 3W3AH 1BXKA 4KAJA 1KMHB 4N3CA 4KC0A 4RU1A 5B6PA 5KNBA 4KGXA 2ZRAA 1WVIA 4ZK2A 1SXPA 2BBSA 2JJ1A 4ZCTA 5F5NA 5ABPA 1P4RA 5FA6A 4YACA 5GJVC 1CS0A 3UMMA 2H1CA 2C3UA 4MP8A 3BEDA 2BKEA 1Y1SA 2Y9PB 3EIFA 1S2DA 4D4KA 3OZXA 4S3MA 3DAOA 5HIIA 1XD9A 3V3KA 1N2XA 5H16A 5IJ9A 1VB5A 3LT4A 1VKHA 1C9EA 4A8TA 3KOXA 1VXOA 1D0SA 3VZSA 5K8VA 2J46A 3DQZA 3IMKA 4QGHA 5DTQA 4ZQIA 4F46A 3GT4A 2P8JA 4PHFA 4QO7A 4E2ZA 3GZNA 4IJMA 1GKUB 2AFVA 2XXAB 1UT8A 3H65A 3MLAA 4JKYA 1DEAA 1SXJD 1U0NA 1IK6A 1HTWA 1TMKA 1UBEA 1RXYA 3MNFA 5KNDA 2NUTB 3KJHA 3OMLA 1ZJ5A 4PYLA 5DB4A 3WBFA 3DQQA 4ZFNA 1BKDR 2V6MA 4P4UA 1QK3A 3FUWA 2NXNA 1QHXA 4Y1GA 5KOJA 2ZJ1A 3OIYA 1HOXA 3C5EA 4I5EA 1JJVA 1M6HA 5JJCA 2YH2A 2RB5A 3DZJA 1WSDA 4MTCA 5DGCA 4X63A 3F7MA 3E9RA 4IIBA 1JG4A 2ECKA 5C5IA 4ND5A 4IQFA 3V7UA 2WAYA 3OEWA 2AWOA 5HQ3B 5BW6B 4JIGA 2ZRMA 4CM4A 1YXMA 2WUDA 2NYVA 3Q4GA 4JT9A 5BW8A 3GLIB 5CBPB 4OMCA 1N2IA 3RUPA 4QIHA 4XCQA 2FJPA 5CIWA 5DYIA 3EVGA 4XIIA 1RWVA 1XAHA 4Y9UA 4NV1A 2WD9A 5ALUA 3IBTA 4KFSA 2QZ4A 4IUBS 4M3NA 5HIMA 3ZH2A 3TZCA 4LCBA 2YJGA 5H9WA 1R50A 1WF3A 2F2TA 3IJEB 1FTQA 4ZEMA 3X2EA 1QLHA 4QM7A 5DP2A 1JVBA 1XAGA 4J7AA 4F6RA 3RYIB 2H9YA 1T3LA 2YNMA 3K9BA 4WBNB 3QXHA 2CBXA 3H1BA 3L8DA 4YPFA 1NG1A 4FILA 4H77A 5C1PA 5KTOA 1NNSA 3W5CA 3DO6A 3W5BA 5K3AA 3VO9A 4XVCA 5JOQA 1YVDA 3CH5A 3P9KA 2ZU0C 2VQ3A 3VR3A 4HT3B 1NAHA 4AVYA 4C7BA 4YMLA 1JQJC 2E37A 1R8SA 2JCSA 4E5UA 2XNSA 5L3ZA 3N75A 2Z9DA 3ZNNA 3RF7A 5L3SA 1U7OA 2WTAA 2A67A 5BMOA 2CT8A 3KJQA 3OFSA 1UC5B 5IYZA 2EX1A 2OFOA 4F2HA 5ADVA 3VPCA 1BW9A 2A30A 4GL4A 4HLUC 2KW5A 4ZQCB 5K0FA 2CKDA 3PT9A 1TKBA 1LI4A 2VHJA 4AT1A 3KVVA 3HE3A 5DIFA 3TF5A 4AWXA 2FSIA 1I3LA 2WINI 3SX0A 4ITUA 1OY1A 3CNEA 2I6QA 4DC0A 1E2HA 1MV5A 1QCYA 2KX7A 3O8OA 4ER0A 5CVJA 1C3JA 4YDQA 3R23A 5KNLA 5IFKA 2ZAYA 3HFJA 3W6UA 4YUYA 4P7FA 4YRPA 1J2TA 1W5AA 2H63A 1U2RA 4KXVA 3RT1A 3QU9A 3GPCA 3AKZA 3RCBA 3UK6A 1B76A 2QW1A 1PYDA 4PZ0A 2HA4A 1DBIA 1DRVA 2RCNA 3UWKA 2HMAA 3PUVA 2ID8A 4RZXA 5HNKA 4E94A 3ILSA 2Z95A 1JZTA 4EQZA 1L2TA 3CW9A 3A6PC 2IH2A 4Z51A 1GG9A 3L4EA 2I78A 3FY4A 4L0DA 4JL6A 1KERA 4GOOD 3GI1A 1RWMA 4GI7A 3G7UA 5IKEA 3HA2A 4Q05A 2VXCA 4FXOA 4GOLD 4Q1FA 3TOXA 2VDQB 3C7AA 2F90A 3CXRA 1UCFA 2A9JA 1HQYE 1RPAA 3GD7A 1VJ0A 3BGVA 3EUFA 1D2AA 1OYWA 2VP6A 3V9PA 2YJ3A 3VKHA 1GCGA 2GQ0A 2FSGA 4GBGA 2HJ9A 3R0QA 1KBQA 3FTEA 1C4WA 4JEHA 1Q2UA 1G3IA 1TIKA 3GGPA 1U3UA 3HWWA 1A72A 2IITA 3RGWS 2H2IA 4GL2A 3VZDA 1M8FA 2Q9CA 5HKLA 1YNSA 3CFYA 4PYRA 4J7UA 3Q7EA 1F6WA 1QHSA 2F8MA 5JBNA 2H31A 4QDUA 2NVBA 3RRJA 2DBZA 2PMDA 2GH1A 1P4GA 3W6ZA 4PXAA 1UBNA 3X2SA 1UDXA 2B0CA 1JHYA 3IDAA 3NHRA 4HXEB 1XQ9A 4NJOA 2XYHA 4AICA 1DT3A 3L0CA 1WQ1R 3FB1A 1CRQA 3AEZA 1AK1A 4QYSA 5CCXA 2L82A 5CAEA 2O6LA 3KWMA 3T5TA 5BNTA 1OI4A 4QAJA 1E66A 5GV7A 1X7GA 5CFRA 2YQ5A 3CLUC 1RQPA 1YL7A 4U2FA 2BFDA 3TLKA 1S8OA 4RK1A 5KTRA 3OZCA 1JG6A 1N57A 1B0PA 2B82A 3PNOA 1P1IA 3HNOA 3JVDA 4L5YA 3AR2A 3JQ8B 4JEIA 4L57A 4LXXA 3AKCA 4YUXA 1VECA 3LUJA 4URHA 5KKAA 4F2DA 1DZ3A 2IOFA 5KVQA 3ZE6A 4BN0A 1VG8A 4YDSA 1JXMA 3GGCA 4KR2A 4PF1A 1ZD5A 4EW2A 1K63A 2QIOA 3PR2B 4N5LA 5AMXA 1XQ1A 4R8LA 3A4YA 3TG2A 2YJ4A 1ZGAA 3PQEA 4PSDA 4CT0A 5CLJA 2QRLA 3J81k 3A32A 3FVRA 4CTKA 3JD3A 3AR9A 3PQ5A 3NW9A 1W30A 1R0BA 2GZHA 1DWOA 4E5DA 5K6RA 1E0AA 1CNEA 5E1BA 2A33A 3FHJA 4V2IA 2GVNA 3CVVA 2G7MC 2GWRA 4AWAA 4BLOA 1AVTA 5GV8A 3G2MA 3HU2A 4JZYA 2Z8YA 3G3EA 4HGQA 3MWEB 4Q48A 4CN9A 4NQRA 5BSKA 3LC1O 5A2QA 7ABPA 3TEFA 2ZIFA 2JCVA 2ZE7A 4NESA 4RPKA 1U0OC 4LY6A 4FBLA 2VUIB 4NZOA 3BEOA 3F5DA 1GZHB 1HE3A 3U80A 1Z56C 1OTHA 3FYHA 1IN5A 3G9XA 4MUIA 3ZKWB 4EI7A 4BQRA 3IGFA 1IXRC 1HRKA 1U0FA 4LVOA 3MPOA 4V03A 5F7OA 1OFUA 5H1YA 3KBBA 5L40A 3QKRA 4Q7JB 2X9NA 3AR6A 3DAYA 5FNVA 2YFQA 1U0HC 1NUTA 2W11A 2IWHA 4IUYA 2FXVA 3DVAB 1Y5IA 3GJZA 3FCAA 1KIAA 3EF3A 2DR0A 4F11A 4U2GA 3GCZA 4XQ9A 1IN4A 3DDHA 5CPBA 5LBUA 3I42A 2PN1A 2I67A 5ENZA 3C3XA 1MCZA 4IO0A 1OKKA 4M9RA 1K5HA 2TRSB 4YUZA 3MIIA 3KQUA 3ZCVA 4G0NA 1LBEA 1NJGA 3IILA 1G3UA 2IXTA 2PJRA 4NBKA 1ECFA 3MYYA 3H5OA 1XZJA 1NRWA 3OX3A 4KACA 1BH2A 3QRWA 3TIVA 1E8MA 4NBTA 1M0SA 4EGJA 4KCGA 2XSZA 4E1AA 4E5PA 1L4HA 2XA1A 3HXMA 3KUUA 4YHBA 3TJRA 1NQOA 1N0HA 4TSFD 4C7VA 1KYTA 2HZ7A 4LYDA 5EMKA 5ISMA 3LVRE 1TJYA 3Q5EA 1T1RA 4UE3S 1I4DD 4JI5B 3BOSA 4WERA 5H81A 3ZWOA 4F6LA 1AKUA 1MDFA 5EHXA 3IKTA 4DV5B 3U4QB 4TLLB 1ZU5A 2CE7A 3EODA 4WZBB 3PCRB 1YZVA 5K3FA 2GF2A 3WWCA 1C4KA 2H1RA 2DUWA 4LOAA 4YJ3B 3SU8A 2UZ3A 1M2EA 2ZFUA 3AW9A 3M83A 3LDFA 3OCJA 4L5IA 5EQJB 3RRBA 3ORHA 4HMOA 3DE5X 2Z5LA 5DN9A 4U9UA 1SVLA 5E95A 4EL5A 1NXTA 3OOWA 3ZC3A 4URXR 4CEJB 4IFTA 2H2DA 1G2OA 1BMFD 3B51X 5HILA 4AJ4A 4UBNA 4G1BA 4CQLB 5CYFA 2JVJA 3T15A 2BN4A 1WXIA 3OU2A 2QPAA 3P1JA 5IT9A 5DHPA 2EYUA 2ZCVA 4YY3B 4HFRA 4X7RA 3QVXA 4WOCA 5DX8A 2QN7A 3H8SA 3JZAA 1Q1ZA 1OIVA 3SQOA 1WPGA 2C5FA 3B6KA 3CKMA 3DWEX 1S3GA 4C6TB 3GNQA 1LV8A 2ZWAA 2XTZA 1SCNE 3V3TA 4H31A 4CL3A 3AMVA 2AFIE 2GBIA 2XUHA 4TV9B 3RTAA 1X1DA 4DZTA 4UNSA 3V2IA 1U0RA 4NAUA 2PL1A 5BY2A 4QJ5A 1UBMS 1YFKA 1RQLA 3K0HA 3P2IA 4DMRA 1F7UA 4PN3A 3LUBA 4QOJA 1BEEA 4TWAA 3GVPA 4JJ4A 3UKDA 3NYRA 1L3IA 4ZOLB 1T5BA 1YJ8A 1NDUA 4P22A 4QELA 1HE1C 4B8WA 4DLRA 5JZ9A 2C7RA 4TZKA 1KMIY 3BMOB 1U8XX 1GQYA 3KR2A 3DMPA 3GJRA 5CJJA 3FFXA 3PU6A 3FTQA 4NMMA 1MIOA 1N36B 2UUBB 2ZIZA 1RQ7A 2HSDA 3AEUA 4JROA 4PC6A 1A82A 1JHOA 2MOKA 3EGDB 4RHXA 4A27A 5FIUA 1VZ3A 1W85B 4PHGA 2YHBA 2VZ0A 1PE0A 2CLHB 1IVNA 3ELBA 4MMZB 1WV1A 5HIKA 2ORED 4GC9A 2Y1OA 2VWPA 2YDYA 3CXUA 2H8KA 3F5FA 3SR4A 2ZZKA 1F06A 3GH1A 4MVYA 4B1FA 2DP4E 4HEQA 1VPLA 3DFFA 4U7GA 1VJ5A 3JZMA 1W87A 1XTZA 1OHHD 4RADA 5ALJA 1G8GA 2Q7XA 2HXYA 3MSCA 3LQYA 3NWEA 2EWMA 3DEJA 1R6TA 5A4FS 1Z0KA 4BNHA 1NLFA 4UQLA 1C8BA 3CW2A 4BOYA 3MWKA 2ORWA 1H3FA 1AZLA 1JNYA 1PQWA 1XQXA 3DC2A 3HUTA 1SURA 5C32A 2GDJA 3L4KA 1U6IA 2YCBA 1RU3A 3DBRA 1ZIPA 4W8HA 1S3FA 1TEZA 2AD5A 2FGKA 1Z6PA 4DYHA 1CDEA 3COVA 4UVIA 3B6MA 4FGUA 2HQOA 3BULA 4OQQA 4CCYB 3I45A 5KYUB 4GMDA 4YJHB 1PT8A 1ZWLA 4Y2HA 1RHUA 3O4JA 1K75A 3M70A 3PB3A 4LI3X 4EG3A 2J0SA 1BN6A 1KJJA 4NULA 4DCPA 2PZJA 4P36A 1FLDA 3T94A 4JD5A 3TSYA 1XIVA 4A10A 4U63A 5AO9A 4CLOB 1RP7A 4ROTA 3ITEA 2XB9A 1XKXA 1T9BA 2E87A 4JLBA 4BNIA 5JADA 1P1KA 3IQDB 3FN4A 3KSRA 5ESRA 3T0GA 4A1OA 2ZB2A 3OEHA 1FB5A 2X23A 3DMFA 2QTAA 1WHTA 3IAHA 2BHRA 3HZRA 4JQSA 3SCZA 3UK1A 2XNDD 3QFHA 1Z5PA 3SP1A 4AFNA 1F20A 4ZVUA 5CEFA 4B3IA 2UUCB 2CCKA 1I36A 2ZG6A 4RQTA 2W9XA 1SVSA 1DAGA 1OA0A 5AM3A 2JK1A 1X74A 1KVQA 1O8CA 1R4AA 2JFVA 1PTKA 2WBLC 1T9CA 3PGXA 3PQFA 5CNKA 1EDOA 3VNRA 1VKJA 2H85A 5KBYA 2AKYA 3HCBA 1ELOA 3K16A 1R15A 1VSUA 3GF4A 5TVGA 1YIDA 5AW2A 3G0HA 3GUCA 3O4RA 2QX8A 1VCOA 3F2VA 4GI5A 5BSGA 2G5TA 1YL5A 4TWIA 2E5FA 3EGXA 4GVXA 5FFMA 4E2FA 1W47A 2AOTA 2J41A 1MUUA 4B6FA 2X2OA 3EXFA 3EX7C 3PX7A 2SCUB 3HL0A 2JFQA 1KSGA 2C7PA 4OX9B 3K1ZA 5JW6A 1Y3FE 3BVPA 1XRMA 3U40A 5TC4A 3I28A 1ZLYA 4YLGA 3G8YA 1U2GA 4O0MA 3SEFA 2SHKA 3HI6A 2ZIUB 1A4RA 4X6XA 4EHKA 3T5PA 1AGYA 1H0RA 4ZZ2A 1FK8A 5K8IA 1LRKA 3AGPA 5CDGA 2JJYA 1Z18A 1FDUA 3SS9X 1J8VA 2B3TA 2BRUC 3RBVA 1SEVA 1UDRA 4PY2A 4E12A 5F3WB 3QFTA 1YJ5A 4IL5A 4NWIA 5GAJA 1TYCA 5J2TF 5K0SA 4RTJA 3ZHZA 2WNHA 3OU6A 4GECA 1Y3HA 4ZICA 5DLEA 1T43A 5HTKA 1E9CA 1TPYA 4PIVA 2DFKB 3KQWA 4FFRA 4QTXA 3SLRA 1Q7RA 3X3HA 3K8YA 4TPKA 3GN1A 4ALNA 4QGSA 1QG0A 1Q0QA 5BVGA 4OXYA 4NXMB 4WFKA 3WRWA 3I5XA 1CJBA 1IPHA 2V6GA 4BB0A 4PC2A 3KZXA 3VMMA 6Q21A 2PRYA 1KWGA 3KJEA 4GI2A 2OL4A 2V7BA 1DEOA 1TNDA 3WKAA 2BGMA 3CLTD 3M81A 1RZUA 1GGMA 2W6ZA 1T36B 3EAFA 3PRYA 5DBHX 3S27A 3HN7A 1K8ZB 2FPIB 4L4ZA 1OJLA 4ENUA 1RRVA 1P2FA 3D4PA 4TTPA 3QA9A 5AJWA 1H94A 4OJQA 3AV3A 3FUVA 5FQOA 4B0PA 2EP7A 5B7PA 3ZJVA 1LDYA 4KIGA 2RHWA 2QQFA 3T0IA 3W7VA 1NN1A 5BW5A 1WXEA 2H4ZA 2FLKA 4IJKA 5U4QA 3WGMA 2R2AA 1E79A 3BRQA 3D31A 1UEXC 1RADA 3B1YA 2EV9A 3BRWA 1TC2A 4X6UA 1MH1A 4U9IS 4QUEA 2O0LA 1SBCA 4DV3B 4L1KA 4MYUA 4ES6A 2BELA 1KS2A 1Y4SA 2AQ8A 2H1IA 2YZGA 3CR8A 3GZTB 3Q88A 2G76A 3O0TA 2F1HA 3PZRA 4WL0A 4WA7A 1M2OB 3D0QA 2EP5A 4OI2A 3SKYA 4CCWA 3KKMA 2DY0A 1BYIA 4Y2YA 2HXSA 3S55A 3KYDB 3W9UA 1FNCA 3H1PA 3I34X 4JUFA 2RHCA 3LUHA 1DJPA 4JP2A 4H6XA 1S5PA 1QR6A 5DHTA 3ZLTA 3ZNPA 3PXGA 1YR3A 2MYUA 2P2YA 4NYMQ 4ZVRA 3RYFA 1QFMA 2H2FA 3FYUA 4TMYA 3ZEAA 4E2YA 4BATA 2CV1A 2O8FA 1KZ4A 4F1JA 1DS6A 4NMHA 1WUIS 4WLNA 1ENZA 5A9SB 1NQVA 2XGOA 2H2AA 2B3DA 4OOEA 5J1TB 3VU9A 2BI8A 4HY3A 4AIRA 4BVEA 4M9SA 4E5VA 4YJ2B 5FYQA 2O2IA 2F43A 3KELA 4MV5A 3SZGA 2NNLD 3PX2A 4H35A 3DC7A 4JN6B 3T1HB 1N2HA 1OFUX 3DCJA 4D99A 5FR2A 1RI1A 3GWZA 1L5MA 1PR2A 1A7UA 1HG1A 5EYPA 1SXJB 2VDWA 2ZE8A 3UK7A 3ZYCA 1JP7A 4X91A 1OYVA 5EESA 3JQFA 4BNFA 1E9BA 2NLOA 1BA3A 4DBZA 1SCBA 1YHNA 5HMMA 3IVGA 3EG9A 4I8XA 4OQ4A 3RS7A 5DYWA 4F1WA 4RSRA 1A7AA 1O6BA 3A1FA 1RZVA 3RLFA 1DMSA 4EYOA 5C35A 3SOPA 1HGXA 4IS2A 3V80A 1RTTA 1SBIA 3WGTA 1JG3A 3E9NA 4OHWA 4Q7KA 3NUGA 2XZLA 2Z4SA 1HE5A 2GEUA 2WKWA 3S1SA 3STTA 1AXEA 2JL1A 2OCIA 3AVTA 5L45A 2F3UA 3GJSA 2OUIA 5EJ4A 5CA1F 1ODLA 1UPAA 4D9CA 4F21A 3RC1A 2AMVA 1UMDA 4LIPD 2XRFA 4KU4A 1KARA 2YWDA 3Q2IA 2NTYC 1G20B 1G5FA 1XTKA 2VT3A 2VYCA 2IYNA 3EMBA 4UBJA 2J6IA 5IN5A 2Q6OA 5A3SA 2BP7A 1J06A 2VHZA 4YP5A 1ZMRA 1K97A 3X1YA 1BN7A 2Z5GA 5E0OA 5LD2C 3TO5A 4MWCA 4NI5A 4N65A 5CB8A 2RE8A 1M2VB 1QUEA 2ZJ3A 1S2IA 3GJ6A 1E1KA 2PA0A 4RH1A 3SBXA 3STWA 1T10A 3UMGA 5JV5A 5IJXA 5KTPA 4ILEA 5AKKA 1M72A 5DM60 4B81A 2VHCA 2F55A 3D6FA 4JK3A 5AKZA 3SNHA 1UPUA 2ZAMA 4NFLA 5D01A 2Q0SA 4OLFA 2H08A 2PYIA 2WYIA 3R7DA 1E9FA 5KQMA 3FOEC 1O96B 1SHZA 2PYZA 3QOXA 4GE3A 4Z2YA 3TPFA 5TGZA 3FI9A 4RGQA 3VGJA 2DTDA 2QUJA 4WKPA 4GI3A 2YWFA 4U2BA 2AN3A 1UC4B 1UOPA 1XTRA 2CWWA 4X90A 1YZGA 3O8NA 4AO8A 3P9ZA 4KQKA 3Q7TA 4LC0A 2E4VA 1W34A 1DEKA 1P45A 1EWYA 1QE0A 2H51A 2LGJA 3GRAA 4R41A 3DWIA 4E6EA 3NWJA 4KXYA 3CX6A 2ZR7A 4WQMA 3VC1A 1P74A 1ZUNB 2G0TA 4MWOA 3HBNA 1BXGB 1KJIA 2CK3D 1P7CA 3GGOA 2CF5A 3B38A 3HYCA 1W4ZA 4RY9A 2XOXA 1KDRA 4MJ3A 2IH5A 3VKGA 3U7RA 1BQEA 2AD1A 2P1ZA 3FSGA 4BFYA 1L4UA 2B25A 1W48A 2V54A 4MP3A 4WA8A 2EZTA 1X6VA 2QVLA 1ZFNA 3IQWA 4HDRB 4BNJA 5E9QA 9ABPA 4GICA 4YLEA 5BQPA 1A8QA 1VOTA 4REQA 4FCVA 3QVSA 1KQ3A 1D4FA 1FYFA 4UPEA 4CF7A 4R05A 2W2KB 2DPYA 3V1LA 3NC4A 5EG5A 1Y48E 4BVLA 3RHSA 6AT1A 1OXMA 5E7MA 3U9LA 4HNQA 3OC0A 4LC9A 1TCAA 3MWJA 4RPJA 3CG4A 3IOMA 5E6RB 3ND9A 4D8YA 1MNQA 2GEVA 4F60A 4IJWA 2WMDA 1V16B 1LSJA 3HJRA 2CUTA 4F45A 3GL9A 5AVYA 3F7OA 4JXXA 4DIDA 3CJQA 5SY9A 1E63A 3VISA 4AY2A 4FFSA 4IIHA 1E2KA 4X24A 4L3OA 3CISA 4YJFA 4KVFA 4GUDA 5BT8A 1Y98A 2HQRA 2YN0A 4MVCA 4NATA 5HHTA 3F9RA 3NAGA 3QQ5A 5EAIA 4J1NA 2ZSHA 1KNQA 4PO9A 5LMUB 1JTEA 4XTRA 1IJBA 3L8HA 2IUUA 4C76A 5HF9A 1ILEA 2V3WA 4HTAA 1CE8A 1NOIA 3O2QB 3EBLA 3RVSA 2QSUA 1ACJA 4FZVA 2DLNA 2JIOA 2QROA 5BMVB 4ZHQA 2D00A 4M1YA 3OM8A 4TTJA 4LGMA 4ZT3A 3SYMA 4WXRA 2PMCA 2W8BA 5JVDF 1C5KA 4YT4A 5K7SA 3EF0A 3VPSA 1GM5A 3Q5GA 1O89A 1V6AA 2PUTA 5BN3B 5AVQA 1KK2A 1UZMA 3HYLA 1LBTA 4M8SA 4QNRA 3MGCA 5HK9A 5DTMA 5CFZA 2VSYA 4AO6A 3AM1A 2JLRA 1YDWA 3RHTA 3W2IA 4XUDA 4D43A 1GQ2A 2IEAA 4R2IA 3CF0A 1W4LA 4IIVA 3KLPX 5IZ4A 4PAMA 4Y6QA 2EKZA 4IEEA 3NKVA 5DYYA 5AQEA 3WLPA 2ZVQX 5AKIA 2Z3ZA 1UXHA 3D6UA 1O95D 5LC1A 2CSXA 4GKJB 1QZXA 1QB8A 2CKMA 3FCEA 2YXLA 3D3KA 2V6BA 1KAHA 2JIMA 2GJKA 3VZPA 4OYHA 1AS0A 2XZPA 4HZGA 1LDBA 5KCMA 2JB9A 1JW9B 2ZRNA 3NM5A 1MG5A 1QRTA 4W7HA 5DBIA 1V3TA 2GRAA 3OZUA 4TZ0A 3T95A 3FAZA 2ADFA 2IKQA 1CJMA 1XRSB 3WYAA 3OTQA 4CLXA 1SK8A 1CQXA 2QTTA 2NZYA 4Q3NA 2F8SA 5T41A 4BS9A 1QGZA 4HLDA 1VFPA 4B7XA 5BUSA 1E59A 1TL7C 4G0YA 3EPKA 5EUMA 1NW7A 2O54A 1ISFA 3N0XA 1AHPA 1F2VA 1UKVY 3ENKA 3HKBA 5E9AA 2O3TA 3P9IA 2UZ4A 1Y37A 3UWMA 1B6GA 3H97A 4OHCA 4Z0NA 1Y3AA 3BS4A 3TDKA 1V5WA 4I1VA 1KXJA 3PA6A 4UARA 1V4VA 2YHIA 2QHXA 3CZPA 1GP2A 3I6MA 3EFEA 4L27A 2WWTA 4MUHA 4Y1EA 5DLDA 1XTUA 2N0SA 3OQIA 3KYIB 3ZZUA 1SXIA 4KQHA 2W70A 1QPZA 3R9IA 2D5CA 2CHFA 1NX6A 4FHDA 1R00A 3ICPA 1CUUA 1L8LA 1SJ9A 2OFWA 4R9SA 3G2LA 4BNVA 4CI0B 1R27A 3RYHB 1C3OA 1Y9ZA 3L46A 4HNRA 4B6SA 4QE3A 1LW7A 4QXAA 3A1VA 3BILA 4MW7A 5L4NA 3C41J 4R2WA 5KOIA 2JI9A 3BDIA 3R7LA 5BOVA 1ODTC 2HLHA 3EC1A 3ZXSA 1Z16A 1OWPA 4MHSA 3TAUA 3WNBA 4NDAA 4BNGA 5GVSA 1YU6A 4BQOA 3G1WA 4KKXB 4PANA 2PL3A 5LA6A 4LECA 5HKBA 3U09A 2A0KA 2I4IA 2F4VB 1J9EA 3F2IA 3PD0A 3SHVA 1M6VB 2WQ7A 1R6XA 3VPGA 3QMWA 2A5FA 4ZA2A 4JXJA 5KVSA 2QMUA 3OLWA 3ITDA 2QW0X 3JQAD 2ZBFA 3D6AA 5GGXA 3NOVA 3VBEA 4BV8A 2DH5A 2QD5A 1ZUIA 4R2KA 3RWBA 3AHFA 4DIKA 4DRXB 5JECA 3AXSA 1DO8A 4ENSA 2F1OA 3DULA 3EIHA 5EVJA 2D0OB 3EIOA 1PSDA 3E9QA 4QGAA 1UL1X 3FG9A 2NUPA 3TTSA 4NFSA 1I2ZA 3D6MA 4ZC1A 3BIOA 3UANA 3I37X 3KS9A 1U9ZA 3TCNA 1WY5A 1X7YB 2XF8A 3ZVKA 2C4TA 4W4TA 2ODTX 4DKXA 4ENWA 3BBLA 3VVMA 2HRCA 5GZ3A 1ZGJA 2D3TA 4PFKA 1TUIA 4BKQA 3I5MA 3P9CA 1MOQA 1RKBA 4X93A 4BX3A 4B3RB 4KV9A 4PXYA 5JFTA 1Z4NA 4JI2B 3ZK7A 4D3ZA 1WSAA 2HZBA 1YI8A 4KB5A 2H9IA 3AY6A 3E3MA 1QS0A 1LK7A 2BBTA 4PGGA 4HDNB 4R1LA 1HLPA 1MAUA 5H59A 4M1EA 5AUOB 3OPNA 3TCKA 2XVAA 2OQVA 4HYTA 4DFDA 3I72A 2GPAA 2OV4A 1FS6A 2P5YA 2WWIA 3OKFA 2Z0MA 3CSSA 4RTKA 1V8BA 2A5GA 3FWNA 3NHSA 4XVQA 2R1TB 5GP1A 2P7HA 2VWHA 5E6UB 1RCUA 3EEYA 5K51A 2XY4A 4UHCA 5I6DA 4B79A 3P2MA 3P0FA 2QSJA 1IHUA 1MT3A 1P8JA 2HLDA 3QKWA 4K9PA 4EUSA 1BH6A 1UK9A 2LDBA 2DWQA 1EQAA 2Z3WA 3L79A 5JWRA 1I30A 2RSLA 3NR2A 3PDIB 2I4TA 4WCFA 5JXHA 1GAXA 4CKEB 4ZTZB 1SKQA 2V55B 1WMDA 1ZITA 1YUNA 3NFYA 1D4OA 4IHJA 2VK2A 3C4VA 2X0EA 4MGEA 4PZPA 1LK5A 1O03A 4AO7A 4C7JA 1AHHA 1IBCA 5JFGA 3TXXA 3DLTA 5DGHA 3TW8B 4AZSA 1A7JA 5F23A 1JLSA 4UBOA 4DCVA 4F3TA 3ISJA 5BW4A 3D0RA 1D2EA 2FZLA 3NP9A 2Q7OE 4DA9A 3ROXA 5JQGB 4PG6A 3THWA 1RRGA 3B2QA 3QU7A 4HGZA 1IHYA 4NBUA 2FWPA 1SUSA 3ONWA 5DEIA 3T3GA 4E33A 2AH5A 2JRCA 1Z4OA 3G0IA 5ERGB 3STVA 2X8JB 2BR4A 3Q7SA 4EF6A 3HA3A 2LKDA 4E5MA 3DBIA 4FEYA 4YWHA 3KKZA 1KKLA 5SICE 4OQNA 1G7CA 5B3JC 1X0XA 5MF6A 1HH4A 4HNVA 1C0IA 2CFOA 5IKOA 3G5AA 1XWIA 4XR9A 2IZ6A 4YRFA 2GDZA 4FLMA 5LZ8A 3NVKI 5AJUA 1K3FA 3BF7A 2FAXA 4KLAA 1KYXA 4PAWA 4FGWA 4TRNA 2R97A 3QUAA 3DBLA 1K0UA 1L3CA 1UZNA 4DLWA 4B7AA 1GTMA 4LWOA 3VJMA 3WO0A 4IDQA 2V8BA 2CLOB 2NSHA 3IX7A 4TTVA 4HB4A 4OBBA 3HACA 4X6LA 1E2EA 4YLYA 4E30A 3O4GA 4ISBA 4DLAA 5EHIA 1GGNA 2CMGA 4IQ0A 2M6LA 1JA9A 1EVLA 2EQ5A 4V0SA 2JIPA 3VXKA 5JHHB 1RCFA 4WJKB 3W4JA 3NJ8A 5B6JA 1ADGA 3Q40A 3RM3A 4QUHA 1EWKA 1T5TA 3FNFA 4EX6A 1XTIA 1G63A 4UU0A 2PZ8A 3CT6A 3BD9A 1JIQA 3HSSA 4OHMA 3T7AA 2WFLA 2P6OA 4MMYB 3F71A 3E61A 4U7JA 1J1ZA 2OCLA 3S99A 1SZDA 4KUEA 2XLCA 4XDHA 3BXXA 5FPHA 3TFQA 4K28A 3A9RA 1EMDA 3AF2A 3OT5A 4RK0A 2QN2A 5F64A 1RHKA 4UHJA 1PDOA 5CCBA 4ZO8A 3WWYA 5K8TA 2CGEA 1V96A 3LX5A 4P7GA 2PUWA 4KN8A 5H8WA 4A1FA 3BSYA 2V7WA 1UKBA 2W2NA 2G07A 3JASB 5GMOA 3F67A 5ITVA 2QTCA 3V1YA 3EMKA 2PSDA 3R8FA 4KO1S 3EA4A 2YYSA 1K4YA 4KSYA 3V8MA 3L2OB 3PE6A 4HSEA 4NJEB 5CLGA 3JZIA 3RHFA 1E2BA 2OAEA 1Y8CA 1CRZA 3FE2A 4M0EA 1GTRA 3E9MA 3OHMA 1FMJA 2BI4A 3WL6A 3DB2A 3AKYA 2GFHA 3K8OE 3NCTA 4EW6A 4W5TA 1WQ3A 2G88A 4HNAB 1UWLA 5L53A 3SQXA 4XUGB 5AI0A 3EC7A 4CN8A 1ZD9A 3OOSA 5KPDA 3I0ZA 4FDLA 3Q2OA 4PAGA 4HG2A 4JC8A 4BRSA 5LVAA 5LDGA 1L5SA 4HYQA 2PX5A 5EWLA 4EHDA 2ZYRA 3BL6A 1XZFA 1E92A 3V4SA 3DTTA 1XRLA 5AW8A 3NBZC 2ODPA 2POCA 1JKXA 4CT5A 3KQKA 1HX7A 2FHSA 3WRYA 3ADDA 1DAPA 4OKNA 3K4HA 2OFXA 4JP8A 1NBHA 1SBYA 2PRZA 3H0KA 2W2PA 4HFJA 1EINA 1QH1B 4TLAA 2EF1A 3WICA 4B3DA 4BIMA 4MLPA 4EQ6A 2I9KA 1GGHA 3WGOA 4DR7B 1PP4A 3BMCB 4QVKA 2RI1A 5KOHA 4X41A 1N2EA 2WAMA 4RKQA 2EKDA 2JI7A 5JS6A 4R9UC 1PNVA 2LNDA 3A11A 1OC2A 1ZIYA 2M1ZA 2XTNA 1F3LA 3VO2A 4YUAA 1OFGA 3RV3A 5AXDA 1L5ZA 4UAVA 2EEPA 1JE0A 2IHVA 3WIEA 1E1QA 1R18A 2CMKA 2AMJA 4G5HA 3BFVA 1P80A 4M9XA 4PBSA 4WKOA 3W6PA 3ZHBA 3WMGA 1S89A 3AUAA 3LU1A 2IP4A 4ZVVA 4PV7A 1FJHA 3U4IA 3AHHA 2QA5A 3TNJA 3LUKA 1QCZA 1E3WB 3CBQA 1AF4A 4DAOA 4P4GA 2JC3A 1W1IA 2JGKA 3AINA 2PT5A 1QHHA 3A14A 2G9UA 2VJMB 3GH3A 3M49A 3QJGA 3UJ6A 3F5QA 1OIWA 1VGRA 3E9DA 1GPDG 2C2WA 2AN5A 2GXSA 4NYJQ 4U6SA 3ZGVA 4CF4A 1JR4A 1RM0A 3H18A 2GFQA 3GLRA 3PR3A 4QQ8A 2XRZA 3NHWA 5T4EA 4TYYA 3DXZA 3CZRA 1SVNA 1ZI6A 3ZOKA 5HKOA 4A26A 1XV5A 3HGTA 1D2CA 4C3UA 3P45A 2IFTA 3LWZA 1MENA 2J5KA 3HC7A 3ZDZB 1LD3A 2W22A 2BUBA 1IY0A 3AESB 1ZQ9A 1DPFA 1NOJA 4BO9A 3BAZA 3TUIC 1BE6A 4A03A 4D0SA 1J00A 1U2PA 5DNYB 3O93A 3JU3A 1W52X 2O1XA 4U8HA 5C31A 4E14A 1JQBA 1ULUA 2DT5A 3DE3X 1RKVA 2XPCA 4TQGA 5FWDA 4ZYWA 4WLOA 1HKUA 1M1NA 4D8VA 4EYKA 1ODFA 2R8ZA 1XI2A 1FQJA 2RH9B 2XUQA 3MWGA 4I1OA 5TVKA 4DR1B 5I5EA 1MVOA 4JEUA 2OHOA 4FB4A 1ZVVA 3FJOA 3P20A 1M34A 3GRPA 4E7PA 5GONA 2OCBA 3LF1A 2AX4A 4GSYA 4XARA 3RC2A 4A8PA 3QFFA 4WPGA 3A3NA 3KCNA 1LLQA 2O3UA 4JJ6A 4YRRA 1HDGO 3N2IA 3NBFA 4R3WA 4WMLA 4XZ3A 1KI1A 2P27A 4L9SA 5DSXA 5A4IS 3DT6A 3Q3CA 1H5UA 3L7CA 3G9QA 1J8QA 1GQRA 2QJWA 3C5CA 4L15A 1H8ED 1VXRA 3F8TA 1CIJA 5JAMA 1I94B 3N07A 5IDXA 3FZQA 4QLAA 1P18A 1QTNA 2CJWA 3HR7A 1EU1A 1K5PA 2N9UA 5DBOA 4NCJA 3HEBA 4AZTA 1IN8A 1JXOA 1XROA 4DXDA 3UJDA 1L8OA 3CMMA 1AUQA 2BGTA 1NV8A 3BFPA 3QOWA 1XZEA 2FN3A 2GM3A 2NP7A 2BGUA 5EWJB 2OO5A 2PS0A 4AP9A 4LOJA 5KYWA 2SKEA 4BE9A 1DWPA 2I3GA 3CPHA 3R6DA 1P2SA 4LRQA 3C48A 1RFGE 4GWLA 1IK4A 1UBOS 3QWIA 4MKZA 4PGAA 2J5RA 3D5TA 4BO3A 5SY4A 3DDNA 4BFZA 1ZJJA 3PHCA 4C89A 3OEED 2M6SA 5TPWA 2I4RA 3A6HA 2ZTMA 4OUKX 5BNIA 2AXQA 1D8TA 3A4LA 3CRVA 3USES 1VE6A 5AWFC 3HS3A 3WBJA 3O95A 4YAWA 1HMPA 2L17A 1TK9A 2W4QA 3I1JA 2BCGY 4YTEA 3ZJYA 4BC1A 1E9DA 1HBJA 4UTRA 3U2QA 4KI0A 1TW3A 4IDPA 4QHSA 3WDLA 3IEMA 2ODNA 3ADBA 4HAUA 2I99A 1N92A 3PHJA 4LYEA 2QT1A 4QWWA 5DPMA 4EEXA 3THYA 1FFHA 4Q82A 4V1CB 1WOMA 1IU9A 5J47A 4EG0A 1PWXA 1ZD8A 4MR7B 5ALPA 5K3EA 1F51E 2EGHA 2YVUA 4KSCA