1NW5A

Structure of the beta class n6-adenine dna methyltransferase rsri bound to s-adenosylmethionine
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
279
structure length
270
Chain Sequence
GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLRSYEIVEGAANFGAALQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of liganded and unliganded RsrI N6-adenine DNA methyltransferase: a distinct orientation for active cofactor binding
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
molecule keywords MODIFICATION METHYLASE RSRI
total genus 91
structure length 270
sequence length 279
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nw5A00
3JWGA 4XUEA 2I6GA 2FK7A 2PV0A 4A6DA 3HVKA 4RTOA 1O9HA 3OZSA 1VIDA 5EZQA 2YXEA 3ER9A 3V8VA 5C1IA 3GXOA 4RVDA 3HCBA 4Y2HA 2UYOA 5HEKA 5CUQA 5DT2A 3E23A 1R6AA 5K0LA 4CKCA 3AXTA 1NW5A 2GH1A 1X1DA 3ANXA 1BKYA 3DOUA 2BR5A 4GUAA 1P39A 4OQDA 5K0NA 1VE3A 1XTPA 4C06A 3LKZA 4YMHA 2C7RA 3GJYA 2A14A 3ELWA 3DXZA 3EVDA 2ZTHA 3I9FA 3G2QA 3P2IA 4V0QA 3EEYA 3FUXA 5DM1A 5EHGA 4DCGA 4R8SA 2PX4A 1OR8A 2ESRA 3M4XA 4GC9A 3BWCA 5GM2A 3LECA 4IKPA 2CMGA 4E31A 4EKIA 5KYGA 4RTRA 1NBIA 1AF7A 1EG2A 3P9CA 4QQKA 5FQOA 5HZMA 1JG2A 1BOOA 3C0KA 2OY0A 2P8JA 1I4WA 2IBTA 1BC5A 2O06A 3GRZA 3FZGA 1H1DA 1ZGJA 4EK9A 4RTLA 5DPMA 4EKGA 1JQDA 3OFJA 1MHTA 1VL5A 1L9KA 2H1RA 3X0DA 3KHKA 5EHIA 5ERGB 2VDWA 4PYIA 3BWBA 3KQQA 5FHQA 3BGVA 1M0EA 2CWWA 2VS1A 2XVMA 3EGVA 2HWKA 5E1OA 4PONA 3SX0A 1VPTA 3THRA 2NP6A 3OCJA 2ZZKA 3C3PA 4GOOD 4M7RA 4CKBA 5ICCA 1RJFA 2Q41A 1SUSA 2B78A 5CVVA 4DA4A 2IDJA 3L8DA 3QOXA 1WG8A 3ID6C 1TW2A 1I1NA 2I7CA 2JJQA 2AOXA 3TM4A 2AOTA 3HA3A 2QY6A 3BUSA 1R8YA 1VQ1A 4DZRA 2PXAA 5CVEA 4R6XA 2QRVB 1R74A 2OPBA 3G7UA 5EMLA 2H00A 3LBYA 3BGIA 1FPQA 3GWZA 3IV6A 3UWPA 5ICFA 5FWAA 1KYWA 4BLWA 3MGGA 3DH0A 3CJRA 1QAOA 2PSSA 3KPVA 1WXXA 1NKVA 4QTTB 2FRXA 5DTMA 3G88A 2P3OA 2YR0A 1IY9A 5EMKA 1EIZA 2ZLBA 4FSXA 3KPUA 4UOEA 4RTMA 3P9KA 1YZ3A 5DWQA 4YUWA 3DMGA 1D2CA 3THSA 4ER3A 5LQKA 4FP9A 4RSRA 3SXJA 4LWOA 4PYOA 3SVZA 3TRKA 3R9XB 2PGXA 3NWEA 5FUBA 5EZSA 4QDJA 4Y30A 4AZVA 3MQ2A 4HG2A 4QPNA 4DQ0A 2IH5A 4ER6A 3DMHA 3TPZA 2XYQA 5KQSA 2OO3A 1RJGA 3GCZA 4WVLA 3GRUA 4CXMA 2XBMA 4NECA 4YUZA 5FCDA 2BM8A 1ZQ9A 1AQJA 5H02A 3LGAA 4RTNA 3EVEA 3PVCA 3UA3A 3OU6A 4HTFB 5DM2A 3UBTA 1NV8A 5E1MA 4B17A 1FP2A 3M70A 4ER0A 3FUTA 4DCMA 5KVAA 1G60A 1QAQA 4QTUB 3KQVA 2PLWA 2V7EA 4V0RA 1IM8A 2CMHA 1L1EA 5EG5A 2ORED 5HIJA 4RTQA 4PYJA 5JR3A 1FP1D 2UYCA 1ZKDA 3CC8A 3FPJA 2WA2A 4PWYA 5CVJA 4CWAA 5KQRA 5K03A 3OU7A 1ORHA 2ZVJA 4GBED 2ZULA 3SMQA 2ONYA 1SKMA 2PT6A 3C3YA 5E8JA 2P1DA 3LDFA 2VZ9A 4PGHA 2EX4A 2Z6AA 2EJUA 3LKDA 5FULA 3TKAA 1IXKA 1XCJA 1F38A 2WK1A 3JWHA 4BP1A 4DM3A 4PIMA 3KQMA 4BLVA 2NP7A 4H0NA 4HRAA 4JXJA 2P40A 3FYCA 1SG9A 5D1HA 3HP7A 1UWVA 4PINA 4KVZA 3KPJA 1SUIA 1I9GA 5F2KA 4FGZA 4MQ4A 2OB1A 2ZZNA 3KKZA 5BW5A 1XVAA 1U2ZA 2CKDA 2KW5A 3A7EA 4RTPA 1WS6A 3FRHA 3HEMA 4OBXA 3EVAA 1XJ5A 2OBFA 3G8AA 3AWIA 2GLUA 4QVKA 4C4AA 3PTAA 3FRIA 4XUCA 1VP3A 2P35A 5KS2A 2AR0A 4PYMA 2ZFUA 2V74B 5EMMA 2NXCA 4P7JA 5DXJA 4F86A 1NV9A 4EMSA 4RVFA 2ONZA 2K4MA 3R6TA 3EVGA 3A26A 5FWDA 2YTZA 1ZHFA 2GAFA 3JWIA 4WXHA 1B42A 3G89A 5F2OA 3MCTA 5BW4A 2DPMA 3TKYA 3D2LA 2QM3A 4HH4A 3E7PA 1NW8A 4P7FA 2PX5A 5DRTA 4YV1A 2IP2A 4Z2YA 2ZZMA 3MERA 5C0OE 3G5TA 3GO4A 4XCXA 5K09A 1WZNA 3KQTA 1RJDA 3FTEA 1QYRA 1NW6A 2O07A 3EPPA 3FUVA 2Z6QA 9MHTA 3NMUF 2PXCA 2IH4A 1NE2A 2GS9A 4OX9Y 1X1CA 5DSTA 3SSMA 3TR6A 3KPWA 2G70A 2P41A 3DMFA 1DUSA 2ZWAA 2QRVA 3O4FA 4HGYA 4BP3A 3E05A 2I9KA 3GGDA 5DX8A 2VDVE 5EMJA 5EPEA 3I53A 1JG3A 3P2KA 2JHPA 5EKXA 3U81A 4EVIA 2HR1A 2OYRA 3FPEA 5EIWA 5HOQA 1AQIA 1KIAA 4M38A 1NW3A 3SM3A 3OU2A 3LL7A 4E2ZA 4A6EA 2P3QA 2P3LA 4CTJA 3B89A 3C6MA 3EVCA 4FSDA 4YUYA 2FHPA 5LQUA 4KDCA 2BH2A 3B3FA 3A7DA 3QOWA 3R0QA 2HNKA 3K6RA 3O31A 5DM0A 3PB3A 3M6VA 5CCBA 4RTSA 3K0BA 1KP9A 3CGGA 5DX0A 5K0GA 4FT2A 4E2WA 4C07A 1QAMA 2ZWVA 3HCCA 4E2XA 1M6YA 2LD4A 4YV0A 4GOMD 3DUWA 4KW7A 4O29A 5EIFA 5E1DA 4LWPA 4ATNA 1EJ6A 5DM4A 2OB2A 5EGSA 1MJFA 5IH3A 1F3LA 3JWJA 3FTDA 5M5BA 4OBWA 3ME5A 1JSZA 5IKMA 3DLIA 4K6MA 5GOZA 4DF3A 3LDUA 3P71T 3FPGA 5FHRA 3MHTA 3KPYA 1RI1A 3BKWA 2AOUB 4QVGA 3OZTA 3SSNA 3V97A 5HIKA 4U7TB 5DSXA 3OE5A 1HNNA 3LCUA 3UJAA 3KR0A 1VLMA 4QQNA 3RIEA 8MHTA 3PT9A 2ERCA 3O7WA 1BHJA 1KYZA 1JQEA 3I5UA 3ERCA 2YXDA 4GQBA 4KRGA 4QPPA 4POOA 5EC8A 2YXLA 2NNWB 1KHHA 3PS9A 3BWMA 3CJQA 5K8VA 2NXJA 5E9JA 4P7KA 5CD1A 5FADA 3CVOA 2HTEA 2HV9A 4ER7A 2OKCA 1KXZA 3M6WA 5D1NA 1AV6A 2FK8A 3FPHA 3P9NA 1JTEA 3G2MA 3LSTA 2FCAA 3HA7A 3SSOA 5T67A 3MB5A 4FZVA 5E1BA 1INLA 4CKEA 3BGDA 3ELDA 3EVBA 1R00A 3TLJA 3UFBA 3WSTA 1JG1A 2PWPA 2G8NA 2ADMA 3NVMB 3EEOA 1V39A 2H11A 1YUBA 1DL5A 1KPHA 3FUWA 1YFLA 1N7JA 1RJEA 1D2HA 4GOND 1KPGA 3PFHA 2UZ4A 3UZUA 5DTRA 5GIPE 5K0CA 2O57A 3P2EA 3HVJA 5HFJA 4QDKA 1X1AA 4FT4A 1SVUA 2IBSA 3EVFA 2I62A 2GB4A 2ZBRA 3VSEA 1YB2A 2Y1XA 4XUDA 1TW3A 4F84A 3FYDA 4AZWA 4YMGA 3KQWA 5EVJA 1XDZA 2C7OA 2AOVA 5LQJA 2AN4A 1NT2A 4PCLA 4RV9A 3CCFA 3GNLA 3IEIA 5P8WA 1FJXA 3BT7A 2ZBQA 2F8LA 5GINE 1XXLA 5G02A 1WY7A 2O0LA 4P58A 1JG4A 3G8BA 2GA9A 3OFKA 1ZGAA 3T0IA 3VYWA 5LR6A 2HMYB 3HVHA 5K01A 3TM5A 1O54A 1JSXA 2ZIEA 2QYOA 3GU3A 5E2BA 4X63A 5U4XA 1XDUA 3FTCA 1UIRA 1P91A 2EFJA 1R8XA 3DP7A 3F4KA 4L7VA 5CVDA 4GOLD 4C03A 5B1SA 2B25A 3BKXA 1JTFA 4AZSA 3ELYA 3BXOA 3R24A 3FUUA 1TPYA 3GDHA 2PBFA 3LBFA 4FS8A 3DXXA 4ISCA 4MWZA 3EGIA 1XDSA 10MHA 3FTFA 2IGTA 3EMDA 2YVLA 4RX1A 2FPOA 3B5IA 4HC4A 5EEHA 3PX3A 3A25A 2XYVA 1G8AA 3OE4A 5ICGA 4M36A 5LQRA 3T7SA 2AZTA 2O05A 3M6XA 2Y1WA 4DKJA 2FYTA 2EJTA 1X19A 3AJDA 3KQOA 3G5LA 1DCTA 1N7IA 5LQAA 4RTJA 4KIGA 4X41A 3AY0A 3NW9A 4MIKA 1JQ3A 5ICEA 2PT9A 1G38A 1SQFA 4PYLA 3DXYA 1O9GA 2VP3A 4MTLA 2G71A 3P9IA 4RVHA 4HSGA 1T43A 4OA5A 2ZSUA 5EOVA 3QV2A 4GF5A 5FTWA 3I58A 3NDIA 1L3IA 1NBHA 5LQNA 2PJDA 3EMBA 3T7RA 1R18A 4LECA 3SGLA 3NJRA 2ZW9A 4CTKA 2IFTA 4X60A 2ZCJA 2JH9A 4PNEA 3UJ7A 1P1CA 4RYLA 4R05A 5E9QA 2AVDA 1SQGA 5GP1A 3Q7EA 2PX8A 5T6BA 2JHCA 3HCDA 2AS0A 4E32A 1L3CA 2R6ZA 4OQEA 5GIOE 2XVAA 5F2NA 5K05A 1YFJA 1QZZA 3KR2A 3CBGA 2ZBPA 2IPXA 4F85A 2P7HA 1XCLA 3FPFA 2BZGA 3T7TA 1EQAA 4DMGA 2DULA 4P7GA 2VDUE 3A4TA 2N47A 3Q87B 4PIPA 5BP7A 3MTIA 1NW7A 2NXEA 1Q0SA 1EJ0A 4KIFA 4KWCA 3RODA 5MHTA 3B3JA 2AVNA 3CKKA 3PX2A 5EKUA 2PKWA 3KQSA 2C7PA 3MCZA 5DXAA 5HILA 5K0JA 3KQPA 5C9ZA 2UYQA 1KR5A 1EAMA 2WA1A 1G55A 4PYQA 5LSAA 4KDRA 2PVCA 4AUKA 3DLCA 3UJDA 3E8SA 2AOTB 2QE6A 3ELUA 2JHAA 2JH8A 5DLYA 1YZHA 2BM9A 3LHDA 1X1BA 3TFWA 5E9WA 5EQJB 2AOWA 2EG5A 2GPYA 5DX1A 4M37A 5K0BA 3VC1A 2YQZA 4BLUA 3NDJA 2ZIFA 4E70A 3OPNA 4YUXA 3ORHA 3SR4A 2BR4A 3HCEA 2B9EA 3DR5A 3M6UA 2C7QA 3LCVB 1JR4A 1N2XA 3EGEA 2E5WA 3UJBA 2PX2A 3MTEA 3HTXA 7MHTA 1D2GA 3UA4A 4AZTA 4YUVA 1Q0TA 4OA8A 2IIPA 2OZVA 4HGZA 5CCXA 3DULA 3G2PA 4ER5A 2XYRA 4X61A 3GRYA 5CVUA 2AN3A 4C04A 4U7PB 4AX8A 1RI2A 2PY6A 2B2CA 5FA8A 1FBNA 1WXWA 5E2AA 4PCAA 2AN5A 3HNRA 3KQYA 3HVIA 2R3SA 3B3GA 4E2YA 4X1OA 3I64A 3OZRA 1VP9A 3MAGA 1G8SA 1PRYA 2PXXA 4C08A 4YV2A 2G72A 3REOA 2Z6UA 3ER8A 4G56A 4IWNA 3HM2A 5FA5A 3C6KA 4E30A 4FR0A 1M6EX 3HA5A 3LPMA 3UJ9A 4GEKA 4PGGA 1RI5A 1UFKA 1QANA 2IDKA 3R3HA 4IV0A 4IV8A 3A27A 1Z3CA 2YX1A 3TQSA 3NWBA 5HIMA 3EVZA 3BZBA 2OXTA 4EQZA 1RI4A 3IHTA 3LDGA 3HCFA 5K0FA 1PJZA 1HMYA 5FQNA 5DTQA 5GM1A 2UYHA 2JG3A 3HCAA 3BWYA 5HIIA 5LQCA 3VC2A 1RI3A 5DRYA 3UJ8A 5E8RA 5CM2Z 1G6Q1 3LCCA 4R8RA 1Y8CA 3TOSA 2IH2A 5T64A 2CL5A 3LX6A 4GC5A 3IYLW 3NVKI 1VBFA 3NTVA 3G2OA 3M33A 5BXYA 5EEGA 5CIYA 4MHTA 3S68A 3AXSA 5JUWA 2B3TA 3KR9A 3GRVA 3TMAA 4C05A 2P7IA 3GRRA 2YUIA 1YF3A 2BR3A 3PLAE 3H2BA 5GWXA 3RW9A 4HTFA 4PYKA 1ZG3A 2AOUA 1P1BA 3P97A 3P8ZA 4LG1A 4ZTBA 2NYUA 3UJ6A 4RWZA 1KPIA 2NXNA 3GIWA 4R6WA 3DTNA 2G1PA 3B7PA 3UJCA 2PWYA 2ZIGA 4PYNA 4RVGA 4BY9E 3KU1A 3CJTA 1ORIA 5K0EA 3PFGA 1L3BA 4E33A 3KR1A 4RTKA
chains in the Genus database with same CATH superfamily
4E08A 3MS2A 1LTHR 4R16A 4RTOA 3AOGA 1YQTA 1WMFA 2P4QA 3SIRA 1HYQA 2CZGA 4TKZA 3VMMA 2VHEA 3U7EB 5DI3B 4H77A 3FMGA 5FLYA 3NHFA 1DC6A 1PJAA 1FVFA 2Z2KA 1TZ2A 3CRW1 4QFCA 5CFRA 1CULC 2DBRA 5HQTA 4CKCA 2PG3A 4LZOA 4ENRA 1NW5A 1Z3IX 4NFYA 1TTQB 1NJSA 3D7NA 1XSEA 4J0EA 4X95A 3FBTA 3AHDA 5A5GA 1M66A 2ATVA 1RLMA 2H0AA 3F46A 4BX0A 4YMHA 3K2EA 3TE6A 3EB9A 2P8SA 4GP7A 3G2QA 2VT6A 5BSEA 3LXXA 3V4FA 5IN4A 3L05A 2I2WA 3CIOA 1UM8A 1YRYE 3NC0C 4EGJA 4Y9TA 1ISGA 1QGUB 3DLPX 4POAA 4NRDA 1BCRB 5C34B 3L4BA 5JZOA 4HLUC 3CF0A 3RSQA 2IBTA 3WXMA 2ZAYA 2HCTA 2VTDA 2BEJA 3DA8A 1ZISA 1AGRA 2ICAA 4BLQA 2XKKA 2XF2A 1P77A 4LJYA 1XTZA 2J3QA 4QYWA 3LXMA 4QUHA 3QEBZ 1K97A 3PNYA 2B69A 1TQ6A 3SQXA 1AJEA 1JP7A 2V0CA 4CR6A 1T1GA 4O25A 2AXPA 4D3FA 1JB1A 2V9ZA 4J0HA 5KQLA 4JSYA 1B6RA 1YACA 1JHVA 1JLKA 2Q6IA 3W4KA 3D6TB 1B76A 3OIYA 4HDKA 4EY4A 3I92A 3U4QB 2X13A 4RYDA 3U4HA 2WVHA 3QG5A 2O8CA 3BMNA 5J1SB 1DKUA 1SHZA 1Y7TA 1DLIA 2EIHA 1DV1A 3DKKA 3Q15C 4MVJP 4RE5A 5HCNA 3TM4A 4F3RA 4IOLA 3I12A 1EZ1A 1P2TA 1ZH8A 2VHCA 2L0XA 4N5LA 3NHAA 5F4ZA 4A5OA 3S1LA 1R4ZA 3OM9A 4RMNA 1A2KC 5MN4A 4U4AA 3ABQB 3TRFA 1B3BA 1LKZA 4GMHA 4W9NA 2QN9A 4LRSB 1U0LA 2WU1A 1MH9A 5CK5A 3T1OA 3IAS6 1VB5A 3MGGA 3ZV3A 3KPVA 1QAOA 1M6NA 2BFOA 4X24A 1AKWA 2VTKA 3Q3CA 3VU3A 3LUFA 4ZQCB 3A37A 3QVWA 1AGXA 3RTCA 3W5BA 2P3OA 3E7DA 1RTKA 4XYEA 1SIUA 3KL4A 3MD0A 2GWHA 2CNBA 4RKQA 3PWKA 4CFZA 1PBTA 3G8DA 2WE8A 2GRAA 3GLKA 3I4CA 3P9KA 4K46A 5DWQA 4ARZA 4F2HA 4F96A 5LWQA 3H2JA 3UJNA 3C24A 4S2UA 1IJBA 5BSGA 2G77B 4MEAA 4KKVA 2PUHA 1EEHA 5JFTA 5KQSA 2C78A 1NNUA 3GRUA 3P2OA 1NLFA 1N9GB 1VI6A 2GEFA 2HK8A 5AI6A 3COZA 5KSZA 1P45A 3TCNA 2NU9B 4DNXA 2PKQO 2D7DA 4XYBA 4R9VA 1X13A 2L82A 4NV1A 2HGZA 2IV2X 1YI0A 3PC7A 3NUZA 3W7VA 1ZSYA 4KPYA 1ENYA 1G8JA 3HDJA 2QMEA 1ACLA 3R2JA 4PLVA 3ZUGA 4D8TA 4DRXA 2XUFA 3OQIA 2CGEA 1H2AS 3B70A 5EE0A 1T35A 3ROXA 2GN9A 5HKBA 3COYA 1CZHA 3HPRA 1XJQA 3FYUB 5ICSA 3SIWA 4A8TA 1PWXA 2XCQA 4PSDA 3OHSX 2ASVA 3JAMA 1JH9A 1T2UA 3OOJA 5LXTA 1XZAA 2EX4A 1ADFA 3KVRA 4R31A 3N3BC 3HYNA 4PBSA 3ROFA 2PO5A 3IAXA 4CJXA 2YRWA 3ONFA 3VKWA 3PRJA 1YDEA 4OB7A 2OAGA 2ZXFA 2VCYA 2F9MA 1SVMA 2X4IA 2D2EA 4D4HA 5IABA 3C97A 3ICVA 3EZLA 4M6WB 4OHXA 3BFPA 3SBXA 4O2BB 121PA 3IAHA 5U1PA 3W3ZB 4Y1EA 3ST7A 3UMMA 2QI9F 4MV4A 3JXEA 3A04A 1IZ9A 5JTUA 3HKBB 4D41A 3KRTA 2CJWA 2JFGA 3O1HB 4MYHA 3TSOA 1KL7A 2A67A 3OBIA 1Q7EA 2UZ0A 3PQCA 4GL4A 1EQUA 2AN1A 1F8GA 1HOTA 1NHGA 4URHA 4BO2A 3ISJA 2Q3EA 2B7CA 4RE6A 4BYMA 1WPGA 3HXLA 4XUCA 1E5DA 1FX1A 2IUEA 2X5XA 1N2EA 3ICOA 1JFSA 3M2PA 1NY5A 1EWTA 5JAMA 2UZ3A 5C7IO 4GX5A 5CLFA 4EMSA 1UDAA 3RJTA 4ILKA 1MENA 3SPXA 3ICEA 1XNHA 2HLDD 2P1ZA 2PZLA 5DT9A 2CMFA 2H2GA 4PHTA 1O94A 4H7IA 2QX8A 2W6PA 5D5HA 5CB4F 3D2LA 3IP3A 5FIUA 4ALIA 2A1IA 3V5NA 4FPXA 3FPAA 4XM2A 1XDWA 1GHTA 1Y8QA 5CPBA 4F92B 4AN4A 2JFZA 2PKEA 3JV7A 3KJQA 4JROA 2FW9A 1A9RA 3HLKA 4NBVA 5EA2A 1OLUA 1UMCB 3C5CA 4EUFA 3PRHA 1HT3A 3WL5A 3B1KA 4OX9Y 1M2KA 3L49A 3QKIA 3E7FA 5KKNB 2VNHA 5I7HA 3ZGVA 4UMEA 3N6XA 1V4VA 4MVJH 3H9EO 3MGBA 4L74A 4I8XA 2O1WA 1VSBA 3N1UA 4P3NA 4TTSA 1YCDA 4V2UA 5IJ0A 1H2EA 4D0SA 4B0PA 1YQUA 4ZOCA 2GR9A 5L9AA 2FPPB 5EKXA 1VG0B 2PT7A 1E3LA 3SK0A 1R10A 3F5QA 4UUMA 5I9NA 2GX6A 4Y2SA 1DIRA 1D04A 3AUTA 3KJGA 1ISFA 1NUTA 1WKBA 2R1UA 3BB4A 1N5JA 2HWXA 4LRTB 4IUBS 5U4QA 4B3BA 5IUJC 4BLSA 5JASA 5HKKD 4R3NA 2QM7A 3TIXB 3CPSA 1VKJA 2CLMB 4LYGA 1Z4PX 5E3JA 2RG7A 4E5NA 1PS9A 5G2OA 3O31A 3RAPR 1TEVA 1T0BA 1G291 3K0BA 4A7PA 3GJ7A 3ORQA 1LGYA 4YJKA 2B6NA 2PZMA 5K4HA 4MQ6A 3L7OA 2DB3A 4ODIA 3DTYA 1SC6A 2IZZA 1G0OA 4EGSA 3CXRA 5DM4A 5EJ2A 3HP4A 2VNIA 4ALJA 1TU4A 4XVRA 1U6KA 2VQFB 2OHOA 3T3OA 1QMPA 3EDMA 3KTAA 3FTDA 2E49A 2QXYA 1QHHA 1Z4KA 3HXMA 2IK8A 1DQYA 3H9CA 3KPYA 4KFCA 1Z7YA 3ACDA 4LXTA 4Q4DA 3V97A 2Q4BA 4FIZA 2EZ4A 4IXMA 3U13A 3UAZA 2BIFA 2O8DB 1UKYA 2VF7A 3O47A 3AI3A 3GNTA 3A1UA 1YNSA 3IBYA 3D4BA 1MH1A 2NO6A 3OFSA 4EECA 4ZI2A 1CKEA 4B7CA 3FSJX 3K6JA 3TCKA 4QHYA 2JIQA 2X8JA 3QMPA 4JVOA 3H5IA 5ITSA 3OEYA 4BUJA 2I3BA 5GONF 3A2MA 4ZI3A 1PUIA 3WJAA 1U0SY 5A1TA 3H3JA 5LA6F 4D5GA 4H3HB 1GNVA 2PBZA 1TVCA 3IPXA 2HTEA 4W5JA 3DYBA 4J94A 3QE0A 2OKCA 5A02A 4BFTA 2I6XA 2P9JA 4TKVA 3P0EA 1PUJA 1CK4A 3CMMA 1XV5A 2P78A 4M88A 3W5VA 1WEKA 1O94D 4MR8B 3WK5A 2QVYX 1ODFA 2PUTA 2XPCA 2BTQA 2QRMA 4QC2A 5EJAA 5AVWA 1Z17A 1JG1A 2IZOA 1TYAE 2G8NA 2PWPA 2OCGA 2PGJA 4EPRA 3BIWA 2XTJA 1M8JA 4BO5A 4LN1A 1PWHA 3RYFB 4R7ZA 4UNQA 4ALMA 2EIXA 1D4OA 1H6CA 1U7OA 1JFVA 3ND9A 4I5IA 4N3CA 4P53A 4W5HA 5DBOA 1JVBA 5ALKA 4BVBA 4WJLA 2AZXA 4AMYA 1CB0A 4KN9S 3U7IA 1AVTA 3PUZA 2GM5A 2Q46A 3VFDA 4NPHA 1ZGZA 2EBFX 1C7FA 3ZG6A 2PUVA 1KMIY 3TKLA 4HNAA 3TN7A 2BYTA 4UU1A 1LSUA 5IM4F 4YMIA 1YDFA 3WHPA 2VDWB 4YMLA 3DMTC 5MDHA 3GCGA 3K7EA 3VOAA 4E6PA 1II8B 2PA0A 3MK31 3ZYZA 4MRMA 2WJZB 4O4LA 3UWKA 5K01A 1R6UA 4R2LA 3PKZA 3I52A 2IHBA 2XZDA 3JWEA 3QXCA 1UINA 4ZAXA 2FEWB 1WB4A 1FYVA 4RHEA 4ZMRA 3LL4A 3ZY2A 4AJLA 5JYCA 1UIRA 4RK5A 2WYIA 5LPNA 1N36B 4DR4B 2GPTA 2ZIAA 3DPSA 3KJIA 4GOLD 1IHXA 2B25A 3HDYA 3BXEA 3FLBA 1TPYA 3FZNA 4AXBA 1EA7A 3G85A 3FTFA 1GA1A 4B4OA 1ESZA 1FLDA 3MXOA 4UPEA 4FXPA 2V97A 3VU0A 4ASUD 1PYDA 1GXSB 2QLTA 2ONCA 5FI0B 3PX3A 2G07A 4LX8A 1X38A 3EIOA 2PUEA 1GZ7A 1G8AA 5BOSA 5IW8A 2BGLA 5IC4A 2VRCD 4K8OA 5G41A 1XTTA 3MTBA 4JQZA 4MRMB 4O4LB 5LQAA 2GN2A 4E7PA 3NW9A 4MTCA 1JQ3A 1ZVMA 1DBQA 4UNNA 5FEUA 1JXAA 4J43A 3NHKA 3I05A 1T9KA 4NAHA 4RULA 3EIEA 3WGVA 3GQBB 4TL6A 1CRZA 1JIUA 3ABOB 3U19A 2VYNA 1EVQA 5IAJA 4R01A 2F4VB 1Z0ZA 2N3ZA 2F43B 3EMBA 4G4SP 3D6JA 1MAVA 2J3HA 3CT4A 3EZXA 5CH5A 1TF7A 3QHQA 4PQFA 3FIUA 3MFYA 4A5SA 4KXVA 2O2CA 3UB3A 2FW7A 1Q1QA 4BWFB 3TWOA 4CMEC 3PX7A 2DLCX 1XO1A 4PICA 1D4AA 3GZTB 1LI5A 4V38A 2MMGA 2NMVA 5ALVA 5AJWA 1G2OA 2ZJZA 2ZTMA 4R9RA 4YRRA 1UMKA 2BM0A 5JO0A 1DUIA 3NGMA 4O4JF 5M3BA 3K92A 1U8TA 2QQ5A 3DMPA 4D56A 4BQIA 4UU0A 5B5SA 1QQBA 4NH0A 1E9VA 1P9RA 5KWIA 3RTEA 3CHYA 3T7TA 3FCCA 2VQ3A 3OC6A 3GZNA 5KYYA 4BXOA 3EIUA 2OFWA 4L4YA 3UYLA 4DDKA 3NFYA 4QOJA 3VKUA 4I4LA 2XD9A 3L6UA 1FNMA 4H9GA 2BHSA 1FDIA 4WZAA 5BN4B 1ENPA 4ARVA 5KSWB 4KE9A 4RY2A 2BBSA 1Y5IA 2UUBB 3CLTD 1Q44A 1CUYA 1H9BA 1K6MA 4AUKA 3DLCA 1K98A 3ILXA 2XXAA 1LDNA 3H5TA 4WX2B 4ZGBA 1CVIA 2P4UA 3LHDA 2ZRDA 2AOWA 2FZKA 3CNNA 4Y0AA 4DRZA 2ZRHA 4G3XA 4QX6A 3IR5A 3OPNA 4UM5A 3DHVA 3ORHA 3WWZA 2HWUA 5IT4A 3HCEA 1SHUX 1ZUHA 2W2PA 3M6UA 4J7UA 1GGEA 5BSFA 2JLVA 1SBHA 1ZCFA 3LQQA 4MW0A 1DFIA 3L6DA 5A9SB 4CU5A 3S5JA 1BRTA 1LQTA 3P0IA 2XB2A 4N41A 1NBAA 3C6ZA 3QELA 4DABA 2CB9A 5MN6A 2PQ6A 1CIPA 5K2MA 1H2XA 1VCIA 4DCJA 3B9BA 3F3KA 4MVJM 2XUQA 4NBSA 4KQJA 1G8YA 2JLSA 4P32A 3UMVA 4C04A 1ZH6A 2J5BA 4D9CA 1W2WB 2GDJA 1RI2A 3QMVA 4MUMA 1DARA 2ATCA 4OFWA 5EERA 2A4MA 2NQ2C 2QZZA 1EGVB 4XEHA 3V8PA 1RACA 2J5QA 3C8ZA 4G5GA 1P4GA 3KXIA 4X1IA 2GVZC 3ASVA 3A6FA 1W5TA 3N3AC 4AO8A 1V47A 2XMGA 4K2HA 4YREA 1NBEA 4C14A 3EMKA 3GWGA 3UJ3X 2H1WA 4YV2A 3PA6A 1VJRA 1KEUA 1RRFA 4G56A 5BRNA 3WGZA 1ZAKA 2RGGA 4E30A 1ISRA 5CB4B 4QRIA 3PUXA 1W96A 3DCIA 3TS1A 2HQSA 3ZVNA 1U8XX 3WGQA 4EQZA 3I8OA 2R00A 4P84A 4ZEVA 4RQBA 2P5YA 3BWYA 2Z3ZA 1V8BA 1PBNA 3CUVA 4FLFA 2JGIA 4JOQA 3UJ8A 1M2JA 4KNYA 3RTDA 4KPUB 1ZXBA 1VSTA 1HK7A 5AK6A 4RHXA 2NVWA 3H0EA 3WYBA 4NV3A 3FNFA 4Z0NA 3VNSA 2XMQA 3DQQA 1XG5A 2Q21A 1LPPA 4EPXA 3THOA 3IJEB 1YJ5A 4G0MA 1OXKB 4PTYA 4V1CA 1E3JA 3MWFA 2QNBA 3ZGZA 4TXMA 4XD2A 1BHQ1 1AQ6A 1Y4SA 1TJNA 3H6KA 5LJIA 1YI1A 3U5TA 4GR9A 4U63A 1M1YE 4F5YA 1QE5A 2AD1A 4HB4A 4DJTA 2X0RA 4ZYXA 2G1PA 3KQLA 4XWOA 5FOVA 2RC5A 2AJTA 5C8XA 1DEAA 1GYQA 2XE8A 2WG2A 2VP2A 4BE4A 4U6QA 3GUUA 1DIBA 5TEVA 4MW7A 4M83A 3CW2A 3EXIA 4HQOA 1I7DA 2C2HA 3O90A 3AHCA 4C0WA 1RZRA 3NIGB 3BJRA 1II0A 4PWZA 3LO8A 2GZAA 3BF8A 5AM2A 2HJHA 5T7BA 3ZE1B 1MX3A 3V1NA 3KOZA 4MV9A 3UMYA 2UYOA 1D0VA 2QJTA 4OQNA 3C3KA 4KCGA 1Y8QB 4HWGA 2H2WA 1XDGA 1VZ2A 3SDBA 3LY5A 3ANXA 3TVTA 3MOIA 4OQDA 4BZQA 1MQAA 2ANCA 3QYJA 4NBWA 5DEOA 3VH1A 1AUQA 1R4MA 4GRAA 4TGLA 3TK1A 5AXBA 6CHYA 1LDBA 4LC9A 2RH5A 5EZYB 3A6HA 1JDTA 3E3MA 4OEHA 4PVCA 4EHLA 1ADGA 3GB9A 3EEFA 1CQPA 2QM0A 3DXZA 4ZYWA 5ALEA 2ZJYA 5EHGA 1GSOA 1P9NA 1J24A 3LECA 2P9ZA 2P69A 4FMBB 4EKIA 2YY5A 3EGDA 4CE6A 1IQPA 5AJXA 4BHTA 1HQKA 1V5EA 2X2FA 3JQ8B 1S2GA 3NWJA 4UE3S 4QEKA 3BH7A 3ZNOA 2O8FA 1NXQA 1TT7A 1R6XA 1I8TA 3GOHA 3N86A 2ZGVA 4KYTA 1UJ5A 3IQZA 5FV4A 5ECYA 3AKZA 2JJ1D 1M9NA 3ZU6A 1QWOA 2GSDA 3BHJA 3LP8A 4BO7A 4TN1A 1ILEA 2CWWA 3RTBA 1T2EA 3GPDG 5E1OA 4ZVMA 2LKDA 3V3TA 3O8NA 4O2RA 3ESCA 4OXXA 3WR5A 1SKAA 2BY4A 1FB5A 4N1AA 5E0KB 4DG8A 2DWPA 1EHIA 1W76A 1EXDA 1AKYA 1N6LA 1PL0A 1VGRA 2HFJA 2QLFA 1VPLA 3DAFA 3O9ZA 3PWZA 4MQLA 3FTQA 1R6VA 3QKRA 4F71A 2FFRA 2H5EA 3EULA 3VYTB 4X7PA 2OG1A 3SZMA 1FTYA 5EWLB 3ROZA 2EHJA 2PKYX 2XNCA 5JMOA 3GEMA 4PQYA 1PZNA 4QUGA 1JQ5A 4BWGA 1WW3A 4X65B 3K0AB 2D7JA 1AGNA 1HH4A 2H4WA 4YB8A 5EE1A 3THYA 3E5NA 3U3JA 1KYWA 3V2HA 2DE0X 2XODA 2YC2C 4LCBA 1Y8RA 2D54A 2PSSA 2R7LA 4OP1A 2VUUA 2FRXA 2ZE5A 3EC7A 3LGXA 1FUKA 1QRRA 2D1FA 1Z6QA 3ROEA 3VPDA 2YR0A 4JQCA 1YDGA 2BGJA 4DUGD 2VPWA 3V7WA 2E37A 4AZ0A 5BNTA 1MHPA 2JAQA 4RTMA 3KM0A 3R5JA 1O0SA 1GTG1 2FEPA 3B2NA 5A9TA 5C35A 2GUGA 3E53A 1SVOA 3I8SA 3D6FA 3KYCA 1ZLYA 4DDWA 3ESYA 1GGKA 5KEIA 1CY6A 3A1WA 3OT1A 4MQ5A 5EZSA 3WLNA 4QPNA 1CLUA 2P65A 3DW3X 2JNWA 3NZEA 4PRLA 4QQ8A 3SC6A 3TPZA 2HBZA 1V5WA 2AEMA 3UUEA 1Z8HA 4N7MA 1JGTA 4UTNA 4TKUB 2Z04A 3PJFA 3LGAA 5KSOA 1MW8X 3AH8A 5FPTA 3VR5H 3FNGA 4DG5A 4CETA 3VH3A 3IO5A 1G2PA 1X0VA 3X1ZA 4C4PA 1US8A 1GRRA 3UBTA 2H59A 2ZI7A 1G5TA 3HHEA 3LK7A 1DG1G 5LKAA 1U3GA 1GSAA 2ORED 1AE1A 3JWPA 3CNLA 4MW4A 4PYJA 1EE2A 3UVEA 1C1XA 4CCYA 3LLSA 3P0FA 4DT1A 2BFFA 1HLPA 4ZU1X 1YIAA 1YASA 1GPAA 2CHVA 1Y3FE 1MOPA 2XMRA 1Z83A 4KB5A 5HIAA 1WOYA 1TUGA 3JWHA 3NJ8A 1GRCA 2GMWA 4GUDA 3NASA 3VR3D 3JQ7A 4BLVA 1XP8A 3INRA 3J81k 4FDUA 1NOJA 1WTCA 2BKXA 1SBCA 1V9LA 1WXHA 2R62A 4JKIA 4Y6OA 3E27A 4JXJA 3STXA 3W7AA 2FN8A 3DVRX 4JK3A 4LXGA 3CN7A 4YIKA 1ZLXA 5ENZA 3EF1A 4AC9A 4EJ2A 5F1PA 2ZYWX 3DLTA 5CD9A 4CF7A 1US8B 3E9QA 5FL7D 1LBQA 3KO8A 3HH8A 3IOBA 3I6BA 1Q50A 3JPWA 2AF3C 3TLCA 3OKFA 2V5VA 3HEMA 1GG9A 3BXPA 3I72A 4HH0A 1CB7A 1ZXLA 5E4TA 2WMOB 3R7DA 2P9EA 2RARA 2GLUA 4QVKA 4OKSA 3EHEA 2I66A 4JQSA 2A58A 4Q9IA 4B6RA 3HCPA 3Q98A 1Y42X 4KACA 5A3SA 4OAPA 3GD7A 1UP6A 2QTLA 3IXMA 1DO0A 2H18A 1YC5A 3PRKE 4OLHA 4NNJA 3ZE6A 3ZIAD 4TMXA 5FBWB 1OXSC 3G2NA 1FS6A 4JSRA 5DCWA 3PNLA 5IJ0B 3F5SA 4UPDA 1RC1A 2VF2A 2YFHA 3GJXC 4LZLA 3RGWS 1UPUA 2BDUA 2YS6A 4Q9NA 1D7AA 1ZPDA 2AHOA 1NC3A 4JUIA 3TCXB 4IUYA 4ZVOA 1GA4A 4QZVA 5LLDA 5M34A 4Z2YA 3MSCA 3I5YA 3OF3A 1OPRA 3G5TA 3GYBA 3NP7A 3QOFA 3OHPA 3K8QA 1J1IA 3EGOA 3VPXA 5LMZA 4X20B 1QYRA 4D6PA 1G4HA 5B58T 4ZIRB 4PVDA 1R4NB 3AFMA 4AM8A 3A10A 3TZEA 1QH1A 3IT0A 4QXRA 3ZDEA 1F60A 3E70C 3F8SA 4QOEA 1NYRA 1N3YA 1T8UA 2G70A 3DMFA 2FZWA 1M3SA 1THZA 3R3YA 3ZWAA 1G4AE 1QZUA 2ZR9A 4YRPA 4B3GA 1GPWB 4C6TB 3K9GA 5DX8A 3WBFA 3R77A 2OZEA 3RK1A 2G28A 1P0QA 1UFOA 3ZWNA 2Y71A 1ODIA 2YXBA 3R5KA 1UDCA 2VRNA 3TIFA 3DEZA 4DMHA 3VV2A 2XGMA 2C58A 4F4CA 3IHLA 2JGAA 3OU2A 3CBQA 3TD6A 3L8MA 5CVTA 1P9WA 2VDKB 3ZDDA 5F2EA 4F6CA 4B71A 1SIOA 3M6IA 4XVQA 4YUYA 5HWSA 4OM8A 2AW5A 1KQNA 5KTOA 5KYTA 1SCJA 3K6RA 1C4KA 3GP3A 3M9WA 1MQSA 3AUFA 4HLCA 2ZVDA 1I1HA 2B34A 1ORDA 1NXWA 1KEVA 3QXSA 4EJ0A 3FETA 3W4IA 3U60B 4GOMD 4LI3X 3FWNA 4ID3A 1R5BA 2XD4A 4IIBA 4OJKA 4PNHA 4IHAA 5HKOA 1SURA 1YZYA 4KH1A 4QPDA 1E5VA 4E2YA 1CUXA 1WP4A 2NTEA 1WZCA 2WZBA 1VECA 1AZLA 2A30A 4C0BA 5AVYA 1FFBA 3DOEA 4F3NA 4XDZA 3A6GA 5FBLB 1P5JA 4XTRA 1ZIOA 2Y0PA 1YMUA 1I2CA 1CFZA 1OMOA 2F7SA 1QK3A 1E1YA 1PZEA 3TFOA 1W5AA 3LCUA 5L6LB 3DZ8A 4QQNA 3ABSB 4CM3A 1I2ZA 5L95A 4ACBA 2NAPA 1XCOA 2FTKE 1K8XB 3HUDA 3O7WA 4GKVA 4HNSA 5KYXA 4AZ3A 1PK8A 1QGAA 1JHMA 1T5TA 1USGA 4KE7A 1KHHA 4UD6A 4Q4CA 3Q40A 3ZJ5A 4GMXA 4DTIA 5HNKA 4JAVC 1X7HA 3CONA 1P2SA 1UJ6A 1TDJA 4ETNA 1V48A 3THWA 4QFDA 4HH3C 1E69A 4UATA 4GVXA 4HDSB 1KXZA 2WWWA 5LBTA 2O23A 4WPGA 5LA6B 4IVNA 2FCAA 2I4IA 4JJ7A 5KDDA 1TT5B 3GFTA 4QRHA 5JI3E 1XMSA 1KNXA 1KE1A 3MB5A 5DTJA 3JQFC 4KQIA 3L0CA 2CLHB 2OQVA 4FFLA 2CFIA 3COPA 4UZFA 5ALQA 1J90A 2J08A 2XMDA 1R66A 3A9SA 3PC8A 3ESQA 4GSLA 521PA 4DC0A 2AQKA 5DCUA 1KO4A 2HJVA 5CB4A 4F5WA 1I6WA 2BFEA 1T5HX 3FGNA 1FTQA 3I37X 3QPBA 3EGXA 4URXR 3IOCA 4QDOA 2OGUA 4YCNA 2P0AA 4JENA 5CT8A 1UBRS 2VSXA 1YBFA 1ZIPA 2C9DA 2ZT8A 4LYHA 2LBPA 5SZJA 4F84A 3ZU5A 2C7OA 1AQNA 1MABB 2JJYA 5EZYF 4RV9A 3LQRA 4MI6A 3GDWA 3GGOA 3MTJA 3OT4A 4UCFA 2GRUA 4FKBA 3UK6A 3KYDB 1QG6A 2J6BA 4YCSA 5BVGA 3VYWA 2BGRA 3OWXA 1U8FO 4FOTA 1NVUQ 4K40A 3WIVA 1SBYA 2I8LA 1KYXA 3KSUA 2Q3CA 1EINA 3A0UA 4OM7A 4WESB 1G7CA 4Y2RA 5E2BA 3FTCA 4YBZA 5AWFC 4PZPA 5T4FA 4RHYA 3W79A 4R8LA 3L6RA 1KEEA 2F43A 5HGJA 1IY0A 2X0JA 4BLUA 5B1YA 3WJ7A 4CHGA 2GNAA 3S0JA 1FRVA 10MHA 4KLZA 5EIEA 2O0JA 1A1VA 5DYNA 1BDBA 1UBNA 2FWRA 3A3KA 2XNHA 4ZVLA 1Z74A 1K7SN 4NCNA 4KIJA 3F71A 3V4ZA 5ICGA 4GMKA 4LGVA 3CF4G 4OQLA 3TGPA 3HU5A 3KQOA 3DVSX 5AKEA 1U9JA 3Q5GA 2PFGA 3BDVA 2F59A 2X0FA 1RYDA 4NYMQ 3WE7A 1YCFA 2C29D 3MUOA 4N65A 1ZGHA 3OHMA 3RGGA 1MQ8B 4PYLA 1G38A 1KAEA 3HXKA 4BX3A 2I8CA 4NU5A 1L5NA 1OBCA 4MJXA 3BRQA 4CV1A 2PS0A 4D3XA 4B6EA 3EW7A 5E6UA 1C9EA 1TJ4A 1NBHA 5IRCD 3TW4A 5IDQA 5KTMA 3CRRA 1X6VA 3BIJA 3T7RA 2LGJA 2WNHA 4QJIA 5FUWA 1IEWA 2WNSA 3RE1A 1Z6GA 3GJ0A 3X43A 4RJKA 5ILOA 4OQZA 3LI2A 3FJYA 1P1CA 5ALLA 2W5UA 4HWRA 3VR1A 1KO1A 3DEFA 2JKVA 2I4MA 2BFWA 1IZYA 3G9QA 1ZUIA 2GARA 3S6JA 4G5QA 2XI4A 2AS0A 4E32A 5AESA 2RH4A 1OY1A 1MV8A 1TRKA 1R8JA 1ML4A 3OJOA 2R6ZA 2G1KA 1GG5A 2XVAA 4JZKA 4TV8F 4J75A 1ORRA 2C84A 1K0UA 4JHLA 5ULLA 5BWCA 2GILA 2ZS7A 2PSJA 2GBGA 5DE3A 1N2CA 3WO0A 3JQPA 1I4LD 1C7QA 4NC9A 3T7SA 4DMGA 4ZZIA 1JEYB 5K8TA 1KJIA 4ZQBA 3HKBA 4PX3A 1Y81A 5F23A 1ZI8A 2ZBEA 2F8SA 1Q0SA 1EJ0A 1IM5A 1Z4QA 3KLBA 2PMEA 1Z18A 2R48A 1DKRA 1MRNA 1UOPA 2PS9A 4O2BA 5DGIA 2AE1A 2OV6A 1U28A 1WKVA 1IMOA 4LJSA 2V7XA 3DT6A 4JGGA 1H4QA 3II6X 1JXMA 4MMYB 4KWEA 3EH2A 6PFKA 2W93A 1PQYA 5F33A 3HJFA 2ACEA 4JLWA 1YZHA 2Y1OA 3RV4A 4A10A 3AI2A 1T2CA 2UZIR 4IX1A 5E9WA 3Q9SA 4QU5A 2W9XA 3SQOA 1QYVA 1Q14A 2JFUA 3B9PA 3KC2A 3NRJA 1M8PA 3FB4A 3I32A 1IY8A 4Y9UA 1X80B 5FUYA 3TEMA 4BC0A 2BTEA 1N2CB 3FFBA 2WSSD 3RVPA 1G16A 4ZVRA 3VDNB 5JEDA 5IK2A 1RCFA 2I29A 3CZQA 2YWHA 4TLDA 3VZPA 2RK3A 3A4YA 4AY3A 2CXTA 5D3ZA 4ZI7F 5AUPB 1G21A 4ZRDA 4CR8A 3GUYA 1A8QA 2C9OA 3U3XA 2RI1A 1G63A 4AZTA 4YUVA 7YASA 3CS3A 3VO2A 2IPLA 1AO3A 2J9RA 2OZVA 3OZUA 2QIPA 3QM1A 4R2XA 2BEVA 1CP2A 3KOOA 2OHHA 1RKUA 2AN3A 5ALWA 5JSUA 4AX8A 2RGNA 3O8OB 1XXHE 4MVXA 5FA8A 5AVZA 4PG8A 1RPAA 2ORWA 3OCZA 3RS2A 4ZV4A 2OLKA 3ZU4A 5I5EA 4WZBE 3SJBA 1V41E 3KQYA 5TVKA 2DYKA 1J6UA 4DFDA 1KI4A 2BFDB 1KVQA 1QGOA 2E1RA 2HBRA 2VA9A 3GRKA 3O1JC 1H6DA 4R41A 4Z9AA 5EE9A 3U1BA 4C08A 3JD3A 1NDHA 5IAGA 4B76A 2A35A 1TKCA 2P2CA 2W6MA 4N5DA 1CEYA 1MPTA 2PMBA 1QV9A 1SPBS 2VLIA 3K8ZA 2PLNA 4IV8A 2FEKA 4Q1DA 1N2JA 3UAOA 3WAKA 3PQDA 4DSTA 1ESMA 4FYMA 2QLJA 5JS8A 3INTA 3EVZA 5EQFA 5IYZA 1ZY2A 3CEAA 4NBTA 1JKMA 1T6YA 1UBOS 5KYWA 1Z5GA 1U81A 2WKSA 3RYTC 1C1DB 1G5PA 3L8EA 2CLCX 4Q7KA 4Z3KA 1XQXA 2IYEA 1XEXB 2A7XA 3DL2A 3QTLA 5CM2Z 1XZDA 3ZV7A 3DHNA 2Q9AA 3T34A 3FGPA 2AZMA 1SUCA 3TX2A 3G2OA 3A36A 1BEEA 1L5MA 2Q4EA 3M33A 3S1AB 4C5BA 1G64A 4WBNA 4B3SB 5JJCA 5CIYA 5DZSA 4NXMB 3AXSA 4FGWA 1SQSA 2VAWA 4FU0A 4HPJB 4JEUA 1I4OA 1Z88A 4M60A 4RNDB 2X3FA 2I2FA 1ZA1A 2IHUA 3MINB 4ZN6A 3LSYA 2PGLA 3UIEA 4DWWA 1M1YA 4M9XA 1DHRA 2V98A 3P97A 1P1BA 2XBUA 4QE3A 3WLIA 4HVCA 2NYUA 1F5SA 2FX5A 3GIWA 2AD5A 2VWQA 4Z86A 5EINA 3K0SA 3H42B 2AFRA 2IT1A 3NV9A 4RMIA 3NHYA 5D3KA 4A03A 3RC9A 1YB5A 2QT1A 1Z2PX 2WUEA 3CJTA 1MTZA 3KU1A 2HHLA 1MJ5A 2IBMA 3FPSA 1CZLA 3MYYA 3OZIA 1C9NA 1UWCA 1S4MA 3E7WA 1EZZA 2Z9BA 3H5RA 1L7DA 4ZHQB 2FK7A 3BDIA 1VG8A 1CRWG 1DKMA 1U98A 2QD2A 3I45A 3NOQA 1ZH2A 4PFSA 4UM7A 4W6QA 4GPIB 1K3FA 4H1TA 3RVKA 5AQEA 3NHRA 1GNLA 2ODNA 3KZVA 3O8QA 3EWNA 4GX0A 4OJTA 4NULA 1UBGA 3M1IA 5B3JA 1UKZA 4XPIB 4IFIA 1L0BA 2QX6A 2O5RA 3IKJA 4HTAA 1I94B 4NZOA 1BKYA 1NXXA 2I4OA 2VK4A 5CYOA 4CIBA 4LS3A 1DC8A 5L7TA 1V8FA 3GAMA 3O2NA 5KJFA 1H8ED 2X9LA 3B6MA 3RCBA 4Z99A 1S2LA 1BIFA 1DSSG 1U04A 5FRDA 3OICA 4HAXA 1FNCA 1QHGA 2ZTHA 3EVDA 4RY0A 4ZP1A 5ED4A 2V1UA 2EKBA 4X8HA 1KQPA 2XZOA 3H18A 4Y9RA 1ZM7A 4N8SA 1VCNA 2GCEA 3FHJA 1TTPB 5ESDA 1YT5A 3TMYA 4RTRA 4R9SA 4X9XA 1JG2A 4DLLA 3W6NA 3PJEA 1QH9A 1XMVA 2F17A 2UXDB 1CY7A 1V45E 2IOFK 3VR5A 1VIMA 1UK7A 2XOEA 3C5EA 4YCMA 1JUDA 4FVTA 1WZUA 6Q21A 5IKPA 1VG1A 1THMA 2OTCA 1Z7EA 1ZBQA 1JKJA 4FUTA 3KHKA 3G0OA 4M0KA 5F51A 4ZK6A 3I01M 1ZESA 3O4VA 2QM8A 1MC8A 5AHRA 5L7YA 2Q1XA 3KIPA 4BGEA 2VS1A 2FWBA 2FSGA 1ZN9A 4R84A 2CNWA 1VPTA 2WIBA 4KBYA 1WA5A 3VKFA 1NG1A 3OP1A 3CMCO 1BOFA 4CKBA 1EWVA 1RJFA 2FI1A 3SBEA 5J1TB 5KCMA 5TQ0A 4AKSA 1KI7A 3F8WA 5TY0A 3JD1A 4BFUA 2ODBA 4BMDA 4CLRB 4EPVA 1BSVA 4HUQA 1WMAA 4ITRC 1SHTX 3BK1A 1ELOA 1TZJA 1ZNWA 2EWMA 3GCXA 3DZKA 4JELA 4OXKA 4YWJA 3T99A 1HSOA 3ZC3A 1VQ1A 3ETGA 2JJ1A 3JW8A 5IMBA 2DFLA 5CVEA 4C5AA 1RZVA 1EGAA 2VF5X 4OGGA 1G7RA 4PCUA 4LMRA 2AT1A 5HK9A 1SKUA 5K8CA 1PSZA 3UQYS 2FF7A 3KB6A 5ICFA 1J2EA 2G4VA 5K20A 5AW9A 5BV1A 4I14A 4ARIA 1U63A 1J25A 1CR1A 1BU8A 2R6CA 1EB8A 2BEVB 4ZZ2A 3U9TA 5AR1A 1GTZA 3G0DA 5KPJA 4TMKA 2N46A 3RVLA 4Y2VA 5GTDA 3V4SA 1A50B 3ZDRA 5LQKA 2HPZA 3DE4X 3Q8KA 1LVGA 3EZGA 1P7VA 1SY7A 3AETB 4IYRA 3VVMA 3WV4A 4EAAA 3S55A 3TO5A 3ECAA 1KERA 3PIIA 4MIYA 4NJMA 4CIYA 3G0GA 4RY8A 3EVEA 3NRBA 4GR5A 2X41A 1QHSA 2ZWOA 2VIIA 3H5WA 3W0LB 4HTFB 2PFKA 1LDGA 3UHJA 5CM8B 1RM4A 3TEJA 1PFUA 4BNYA 4DCMA 5CBPB 5IAAA 1YJ8A 5BYAA 1FFSA 2OOSA 3N07A 4F5ZA 3INYA 1BE1A 5CVJA 3VDRA 4M9CA 3L84A 2I1WA 4K6FA 2WRZA 3IUPA 4QOHA 3C7CB 4BX8A 3TJMA 2QGFA 5JNVA 1U8EA 3WMFA 3B5JA 5T57A 3DAGA 3N7AA 1V11A 1XCJA 2G1AA 1VL0A 1VJCA 2YC4C 4MEBA 3QV1A 2XE4A 2Q49A 1KH1A 3IVXA 3EPJA 1KSFX 3N6RA 4I9UA 5DWVA 1ZWLA 4O4HA 1EFKA 1JFTA 2AMJA 2W6JA 3O94A 4HEA1 2KLBA 1KH3A 1I9GA 1Z2EA 4NEHB 4U8GA 1HRKA 3INNA 4MQ4A 3PC8C 1BTOA 5I8PA 3IDSA 4D43A 3T9DA 1IRXA 4RO0A 1GAJA 2VEOA 3L6CA 3PDUA 3FRHA 6REQA 4OBXA 3M9XA 4OHPA 5EIHA 1SK9A 1QOQB 1WXIA 1TQ2A 1Y1SA 1FNSA 5T5QA 2RE8A 3HADA 4MIEA 5A3QA 3PK0A 4WOCA 3S8MA 1B7GO 4QYXA 1HURA 3MUEA 2IHKA 2CE7A 4AP5A 5CDFA 3RRNA 1H42A 4RNCA 2G1UA 1EFAA 4MH0R 5HFAA 1B8OA 4JC5A 4C6TA 2XWSA 2PU7A 5F12A 2X6RA 2XITA 4FN5A 4TV9B 1U9ZA 2KB0A 1DELA 3NPAA 5A71A 2QVZX 4A1OA 2YHAA 5KTSA 2FPIA 2H3EA 3S2EA 3SOZA 4EUEA 2VR1A 4IXWA 1ULAA 4P54A 4RFSB 1DEXA 3D02A 4R7GA 2JLUA 3OLQA 4LOJA 3NYRA 5C8VA 3U7FB 4Z7OB 5IWAB 4C4SA 1YAJA 3H04A 2GKGA 1XLUA 4RVUA 1ADJA 1XCBA 3BORA 1ZD9A 4XCQA 3U4QA 4DHWA 4UOQA 4XIYA 1XRQA 4CIWA 3B2QA 1XJWA 2P41A 1IULA 4AURA 4ESOA 4HGOA 2VZ0A 4EABA 1DWQA 1TD1A 3STTA 1KZ1A 3FCAA 3SF8B 2RGNC 1WVIA 1QRDA 4LK3A 5EPEA 1QFZA 2QVBA 4UEKA 2JHPA 5KTRA 5FPPA 4H7JA 3U81A 4R1PA 1K6XA 2OYRA 421PA 1C0KA 5B64A 3ZK7A 1W46A 3WP1B 1AS3A 3LC7O 1UZUA 1XVIA 2NUTB 3RG8A 2FSVC 3K0CC 2D3TA 3ES9A 1V2GA 4B83A 4ZODA 1AMOA 1UJ4A 4A8HA 4Z49A 2RONA 3AM3A 2JJMA 1O03A 3SE0A 5ERYA 4B4UA 2A92A 3RSCA 2IYAA 4BGDA 3WK9A 2JFPA 4LTDA 2FHSA 5ANRB 4HAOA 5F78A 1CCWA 1Q91A 2CDAA 4WKPA 2ZM5A 3MTQA 3Q0EA 1KP9A 4P3OA 1W581 1SXHA 1QH8B 1QTIA 2HV8A 1OPXA 1U7WA 2AQIA 4NU6A 4AZ3B 3TQQA 2C59A 1UXIA 3CRNA 4IJWA 3GJRA 3HRHA 1THGA 4FZ3A 4BUCA 4E2FA 2RAPA 1N8KA 3QVGA 4LXYA 2QPTA 3HNPA 1WF6A 1EVIA 2QN6A 1PT6A 2QS9A 1ZM2A 2B92A 4AP6A 3OTOB 3RRJA 4DUYB 1M2VA 5JANA 2W11A 1JSZA 3PXUA 3DLIA 3HACA 4K6MA 2X86A 3LDUA 4FMDF 4IDFA 4K03A 1N77A 5KTKA 4K3UA 4R9NA 2AOUB 2J4CA 4FEGA 4HUTA 1TUBB 3ERCA 3QX3A 1J06A 1HDCA 2OZLB 4K87A 3V9PA 1E4OA 3EWAA 4NTZA 4JYZA 4DLAA 3QU5A 1ZD3A 3WL6A 1C1YA 1XRNA 2NPOA 2YOHA 1PJLA 2ODPA 2X2OA 3I5UA 5EP1A 5CB6A 2RDMA 5K3DA 2G9RA 4M0MA 1EFVB 3OOWA 1G5FA 3W7BA 2W37A 1UUFA 2WEKA 1Y33E 2X4GA 3RIHA 1U2TA 4ENQA 3MM4A 1FSGA 3C3CA 4ZVUA 3RASA 3WMGA 5ARCA 1HR0B 1NI4A 4DCNA 4ND8B 3ZHTA 3M9LA 3QG1A 4I5DA 4MGHA 3IE1A 2HJRA 1SZJG 2XBLA 4K6HA 1YIOA 1GV1A 4LDNA 4KNVA 1GRQA 3HNOA 3N8IA 5JD5A 4C7OA 2GCIA 1CUEA 2ZE8A 4MHSA 4Q1BA 5JAIA 1X7XB 2I03A 1R4MB 3C15C 2WUGA 2QVCA 1ZICA 2OESA 4YLGA 5SZHB 2VC2B 3LUCA 3O26A 4LF5B 2FXIA 4U2BA 3AJAA 2GXQA 3OCYA 4INOA 4ZJPA 4Z5XA 3BIFA 1OZAA 5G53C 4B6FA 1EUYA 1UJNA 2QD1A 1WWKA 2FY8A 3QYPA 4MPJA 3NX4A 4LVUA 1WHSB 3ZCUA 3DQZA 4Q3BA 5KI6A 5FFMA 3T94A 2O57A 1E2PA 3MMZA 3RJMA 1KRXA 4HYQA 5AVRA 2F62A 1S7GA 4AX4A 3RF6A 5DP2A 5L4LA 2G4LA 2GJ9A 4MV7A 1W34A 5B4VA 3NU1A 5TPWA 2RHRA 1DRJA 2B8EA 2D2IA 4EGQA 4G67A 1QYIA 1EDOA 4PO1A 2QKYA 3AZOA 4GRIA 5COQA 4GM0A 4MWGA 4EA8A 1BH6A 4G8DA 1GPJA 4LJ5A 4ZV7A 2C2WA 5JNSA 3NYWA 2FG6C 4BNUA 3T0IA 3AVUA 4JB2A 4JJ6A 1O54A 2H4HA 1JSXA 4YPOA 1HF3A 4TQAA 5A7FA 2GOYA 4BNJA 3NOOA 2IWHA 1JDPA 3GU3A 4MWSA 5L6MB 5DLQC 2XTZA 3G59A 4X97A 5IKOA 2EBHX 3MWKA 2Y27A 1CIJA 4LJAA 3LFUA 2A0YA 4DA4A 2Y1FA 5ESXA 2H8KA 4M1YA 4PX5A 1EE1A 4CLXA 3R6GA 4DMRA 3L1IA 1K4KA 2VBCA 3DE2X 5ERXA 2GYWA 3GXBA 4N9QA 1OZ0A 3WK7A 2DERA 4A23A 5KOYA 4FR2A 4TXNA 4YT5A 4TKVB 4XFKA 5C7LO 2VRCA 2VZLA 2IPMA 3TYXA 3UWOA 3CVUA 3O8DA 1N2CE 4D9EA 2WJHA 4MR8A 1N7IA 1GPYA 3NVAA 3M4JA 5IJXA 1C9KA 2LCFA 5K3OA 2B36A 2R1VB 3IEKA 3WFIA 4QGHA 3LMKA 2EZ8A 3QX9A 4NABA 4OA5A 4TTVA 4X90A 3RO7A 2EJCA 2H4XA 4MNTA 5CT5A 3VZCA 3PGA1 5DVZA 3PEUA 1I5EA 2BEWB 3KEFA 4NWIA 2WY2D 2R8YA 3NH6A 2X8AA 1ZD8A 1ACJA 1PE0A 2OCLA 5CNJA 2GZHA 5AICA 2Q5CA 4H6VA 3R5XA 4Q21A 4CCYB 3OQJA 2DX7A 2GBLA 4RKRA 2H17A 4WZBB 2KBFA 4PIVA 3SYRA 2GD2A 4TUYF 1AGPA 3TL3A 4B40A 3HXTA 3C70A 3PHHA 4ZMSA 1Z0SA 3ONEA 3R3UA 1JECA 2IXAA 2DEUA 1POXA 2I7VA 1V26A 1KIFA 1UQUA 3EY9A 2JVKA 4NATA 2WUDA 3A4IA 1C0IA 3Q3VA 4KDFA 3SC2A 2D6FA 5J23A 2OPHA 5CYGA 1N7HA 1GLGA 5DYIA 2P7HA 4CQMD 1RJ9A 2VDUE 1PX2A 4Z9BA 3GBSA 4RD4A 4YJDA 1YS2X 4JR2A 2DJIA 5AH0A 5FOWA 1D1QA 2QMHA 2BLNA 3KQSA 2Z43A 5JDCC 4DARA 3VPSA 4X66B 1AHNA 3QF4B 4NESA 4DW8A 3UJHA 5DOZA 3CZ9A 3NEAA 4WCFA 3PWSA 5ITZA 2YWBA 3UY4A 1S3FA 4RY9A 3ZBQA 1Q57A 4MI9A 4LDRA 1DKNA 1XI2A 4UUPA 2I87A 2AOTB 1PS0A 1YL5A 2P2GA 3AR5A 3I1YA 1LPNA 3PTZA 4UEJA 3HFSA 2E5FA 1X8XA 3BEOA 2V8OA 3GFFA 1EFCA 1NXOA 3E82A 3FMPB 2ZIFA 4M0UA 5D6OA 5GPBA 2WDZA 4CMGA 2ORVA 2B9EA 2UZ1B 1KMMA 2IHTA 3LT4A 1PGQA 3HB5X 5H4HA 1LI7A 3GN1A 4IVPA 2JPDA 1ETUA 1KJJA 3EUAA 4AYTA 4EHKA 3ITKA 2QTHA 2HMTA 4B3CA 1OKKA 1PIWA 4W1QA 4Z9FA 1XAIA 3HM9A 4LRXA 1PO7A 4PEVA 1H85A 3G2PA 4S0XA 5J5VA 3CRZA 4D9MA 4C7OB 1EX9A 1NZFA 1XC7A 3DZIA 3KVYA 1SEVA 2CXXA 3MRXA 3TOZA 1YC2A 5B57C 4M8LA 3VZQA 3H6HA 1NX9A 4JT2A 4X1YA 1KNQA 5E2AA 5JWHA 1GGJA 2DHQA 1PR9A 1FJ2A 1LBTA 2KBEA 4K9SA 1OLUB 3TB6A 4ZT3A 1ZOLA 2ECPA 3G9UA 5AI0A 3CCBA 4MWBA 2RBGA 3MAGA 1FYXA 3B6KA 1CQIA 3TTYA 2ZIVB 1BS2A 4R69A 1TCBA 3GVXA 1QX3A 1SOVA 3LT0A 5GONA 1CY0A 1AKNA 1LBIA 2QMZA 3NBUA 4LPSA 3ADPA 5I7UA 1CLEA 2WIAA 4PLPA 3T15A 1BXGA 1DX6A 2B37A 1KP2A 3IJRA 5TGDA 1L9XA 3UV3A 3CX6A 3R3SA 2CXNA 1JPVA 1N6IA 3F2VA 1DBSA 3ITNA 4O4JB 2A1UB 3HCAA 4INZA 1SWVA 1CE8B 3VC2A 3W9SA 4WIAA 1G7SA 2VVTA 9LDBA 3L43A 1SUDA 3KFLA 3PUWA 4QOFA 3Q10A 2R6HA 3OQVA 3AVVA 1Y1TA 4FGLA 2FUNB 2JW5A 4J6EA 2PBRA 1UPCA 3MRVA 3NJ4A 1V37A 3IELA 3ODGA 4XEUA 4N76A 3EJWA 4C0SA 1LZKA 2GBFA 3QUQA 1Q0HA 1QFMA 1ZU5A 3B60A 3CT6A 3GV0A 4ZXFA 3TMAA 1MB0A 3K15A 4LYDA 1KFKB 4ON9A 1JR3A 1NAIA 3A9UA 1H05A 1AXEA 1QVRA 4PG6A 1K6EA 1EVKA 1KJWA 1XHLA 3AKEA 4JKYA 3HYCA 1HA3A 2O6LA 4KV7A 1JEQA 3VVCA 1P9LA 4BNGA 3OO1A 4RWZA 1A97A 4F60A 5LUAA 4R6WA 1RHQA 4ZO8A 2WD9A 3H8VA 5LP6F 1RQPA 5KDOA 2WYUA 3FGZA 1X94A 2C5GA 2I76A 4JDPA 1BQEA 3OWOA 2NV6A 3E9YA 4FYYA 4D9JA 1GQOA 2Q27A 3EHDA 1O9HA 3RUDA 4IR7A 4HFNA 1ZX1A 3K1JA 3EARA 3HMQA 5FBHA 1GGVA 1ZM9A 2M6RA 3KDAA 3L6BA 4JBHA 2SKEA 1GZ6A 2IQ5A 1GNSA 3D2AA 4CIDA 4KO3S 3QEOA 4W5OA 2BHNA 1CUWA 2QW8A 3BSWA 4EA7A 4BMZA 4WBSA 3N87A 1JBEA 4G1CA 1BQ4A 1WHTB 4JT4A 4ZT5A 5KWJA 1FUUA 2F3SA 4DBLE 1B74A 4TV8B 1XTPA 1EXVA 1K7XB 3T9EA 3DWIA 4QXOA 2J6IA 3CEMA 3IEXA 3H1BA 3ZPXA 3IS3A 1ZJ6A 1CHNA 2RIPA 3FUXA 3OA2A 3P2IA 1F3OA 1GDDA 4LGCA 3VAAA 3H1PA 2PAFA 3HUTA 3PDJA 2BE9A 2E89A 3G5AA 4W9RA 5LOVB 4DWOA 2CMGA 2QA5A 4QYMA 1U3FA 3LGSA 4RHUA 4WUTA 5F1KA 4Z4GA 1VL6A 1BHSA 4FDTA 3SHQA 2NV0A 1FBTA 2CSUA 3BN3A 1YZGA 3AG6A 4XYGA 4K6KA 3TEFA 3ZJ4A 3K32A 1MB3A 3P4YA 3IT2A 4W1RA 3L0YA 3D6UA 4YCCA 4OP2A 1WUKS 1YVUA 1WUJS 2DKNA 1NVDA 2W6NA 3PCRB 5SYMA 3K1ZA 1HL7A 1NN3A 3VGPA 1KOGA 2CDNA 2AI2A 2ATXA 4V1CB 2WQ6A 2FDCA 2PWZA 2TMDA 1SAYA 4RD2A 4LQLA 3DHYA 3QKUA 2CDRA 4ECEA 9GPBA 3RAEC 1GFWA 4PONA 1PHPA 4XGKA 2IIBA 2J07A 2AJBA 1Y6QA 1YQ9A 1N0HA 3JATA 2ZEJA 5ICCA 1SUSA 5JY6A 2IDJA 4QIHA 3EEQA 1J2UA 4A2QA 3AFIA 2AL7A 2TMKA 4S1PA 1TW2A 3SQLA 4Q3CA 2I7CA 3UATA 1SCKA 2AOXA 2QP3A 4CQMB 4E5DA 5CG2A 4AJOA 3O3NB 3PSAA 4UEOA 5CJJA 3F73A 1L1FA 4CT5A 4I50A 4FW9A 2QRVB 2XUKA 3AHFA 1IQUA 5LDHA 3BCHA 1K68A 4JOCA 2REXB 2J0UA 5J59A 5KZMB 3BGIA 3IV6A 4V2IA 4MYTA 2XRZA 1KOFA 2WWVD 2FPWA 2Z1MA 4YJ3B 1NW4A 1H4VB 1WIWA 3M6MD 1AHPA 1EK6A 1L7QA 2JRCA 1IY9A 2EX0A 2QWXA 3C8MA 1RYFA 4I8IA 2Z3VA 2ZIWB 5C46F 1IJKA 3R44A 1TM2A 1JFFB 1IN7A 2A0XA 5IXSA 4F1WA 2SNIE 2B0CA 3B2EA 3SVZA 2DPLA 2GJ4A 1GG8A 2PGXA 1E61A 3GMTA 5FFNA 3SE7A 1E7MA 2FG5A 1W5BA 3MQ2A 4R1UA 5T4EA 1SCNE 2Z4RA 5FNVF 4Z7NB 1EK0A 2JFFA 1JJAA 2OHIA 4H1VA 2OO3A 4EUHA 1CQJA 5DHUA 2XMCA 3H9GA 4MX8A 2JEYA 4OQXA 1QUEA 1VJ0A 2PBLA 4D3SA 1AQJA 4RTNA 3OF2A 3SYNA 1FE8A 5HA5A 3VBEA 3RJZA 2AXQA 4OHUA 4YHBA 5A9RA 2DPYA 1EGQA 3BULA 3H4VA 3WO1A 4KMSA 1TQ8A 1FOEB 4WT7A 1FCJA 2CMHA 2LR0A 2UAGA 2R8PA 1CY8A 2ZSHA 3TL6A 2A4KA 2FQ1A 3T1TA 1ZKDA 3FPJA 5K3BA 1TYZA 3RRMA 3KXKA 2IEBA 4WAUA 3O74A 1IDN1 2W6CX 1RQGA 5AUOB 2WZDA 3W6ZA 5FUXA 1SKMA 4JYMA 3NT2A 1N6PA 3GJ5A 5KNDD 2Q7XA 4S3MA 1WCV1 2EJUA 3AR9A 3L7LA 4Q4HB 1VSVA 5AVXA 1P62B 2D62A 3QU4A 2G83A 1I33A 3AVPA 4LZNA 4O2LA 3RROA 3A6KA 1XMQB 1PK9A 1XQWA 2FSUA 1BA2A 2OGZA 2WICA 3NXSA 4FJ0A 3BH0A 5FR1A 4CDNA 3GJ8A 3LVFO 4XFJA 3W2HA 4O5AA 1QO7A 4CKWB 3GLTA 4QFBA 4KDEA 2C9ZA 2F67A 4S1WA 4BX9A 3KUUA 3GELA 3AHJA 3KCQA 4EPWA 3Q7RA 4DYDA 5BNWA 1CC1S 5CAEB 4UCQA 5KYYB 3UG6A 1TM1E 4ZOLA 2C0PA 1NN0A 3KKZA 3VPGA 1VMIA 1B16A 3A11A 3SSAA 4AU1A 5FA6A 1KY5A 1PAUA 5GGYA 5CX1A 1L4NA 4FHCA 3EVAA 4DCSA 4ZOQI 1XJ5A 1ZZGA 4E3ZA 4FFMA 1ZYUA 2IELA 3ZZ1A 3K71B 3CE9A 4CM8B 1NJ2A 1LZLA 1TYEB 1T8PA 3KZNA 4YRLA 1NWCA 4DL9A 5BUQA 4X91A 4ZOEA 4F91B 2MOKA 2RGWA 2NUPB 1FFXA 1UZMA 2O3UA 5AJYA 4PZUA 5KVCA 4FNOA 3HZHA 1U5CA 3ZY6A 4COOA 3OSZA 3R6TA 3QLEA 1W73A 3NEPX 4BQRA 3QVSA 5BURA 5DN6D 5DHQA 3IESA 1ZHFA 1L4FA 1PYOA 2X58A 3JWIA 1IN1A 1B42A 4OTZA 2GCOA 3DT8A 1JJ7A 3OFNA 3OM1A 1JILA 3TAXA 2QM3A 3C3JA 3FOBA 3T3IA 4ZXPA 4AS1A 3F1KA 1CJMA 3TD9A 1M73E 1X0XA 1GNRA 2I34A 2O9JA 1WZNA 4XCXA 5BOSB 1Z16A 1RJDA 4Z1OA 5ADWA 4MDEA 1WMBA 2ZRIA 2XE7A 1QLWA 1PNOA 3DWEX 4GVLA 1DP4A 1K1EA 2EYQA 2ZYVX 3HMKA 5E7QA 4REQB 3TDNA 3R23A 3VH4A 2GS9A 3FNQA 4H6XA 3IIEA 1X1CA 3HB1A 1VYUA 4JBLA 1BJKA 4Q12A 4YDRA 3IR7A 1XD9A 5EIAA 1KDYA 5FUQA 2WF7A 4TYNA 3K4HA 2ENWA 5C32A 1HDRA 5LBUA 4W4TA 4DVGA 2QAGB 3IIMA 3N2KB 3ABRB 3VR4H 1BVRA 3FMOB 4ABYA 5TB5A 5EMJA 5FWXB 3T7JA 2NWQA 3I53A 1KTVA 4IIJB 4IS3A 5T6MA 5I7VA 5U9CA 2OBYA 2A9QA 1AZWA 3NTXA 3HG7A 4JJZA 4QICA 1AURA 2QUHA 4Q4AB 2A33A 1JZQA 4D26A 1GAWA 2D4AA 2GTIA 2JFQA 4MUJA 1QGZA 2RGBA 4CDMA 4O2AB 1A04A 2CFSA 2FJ0A 2OM6A 2BBWA 4OQQA 4R5HA 2YRXA 2I5PO 4H7HA 4U7FA 3K96A 3V6MA 1GTSA 2ZUCA 1PJQA 2FP4A 2IYSA 4UASA 3H97A 5C8YA 4F2DA 4IDDA 2H2IA 3HO6A 4IIDA 1KI3A 4RL4A 2J4FA 4R3UC 2D1RA 4U0KA 2FSHA 3AYXB 3RYHA 4V24A 4ESEA 2ZAOA 2OBXA 1R3DA 1OLOA 1SXPA 2GDZA 1MC4A 4LWPA 4Z4EA 2EKQA 1EJ6A 1Y89A 2BAGA 4QNMA 1AKUA 3ZGLA 2GD1O 3ZXXA 4CIAA 2HOQA 3K9FC 3AJEA 1D03A 1QHXA 4UDOA 5IH3A 1AT1A 2ZRKA 3I2GA 4YJ3A 2AW3A 1JMYA 3GARA 2OHFA 5M5BA 4B85A 1X8JA 3LT1A 1NJ5A 3K9WA 4GX1A 4FFDA 4NR0A 5GOZA 4D3ZA 3BJEA 3F4LA 5HFNA 1BHO1 1TM5E 2BGTA 4P0PB 1XD8A 1HNNA 2OM2A 3UJAA 2HU5A 4QSMA 5JBQA 3N0XA 2IIVA 3A1DA 1IJFA 2AYYA 4AECA 3F3SA 3HL4A 1OLSA 2ERCA 3ENZA 3VR3A 2NUBA 4LF9B 1SQ5A 4WKNA 3ZCXA 5EVCA 5F52A 5CFPA 3A2KA 4WZAE 4KSCA 2ZXEA 1PD1A 3ISVA 4NENB 5CJPA 2XTMA 4CEIB 4LE2A 4LZWA 2WIDA 2I91A 1MIOB 3CVOA 4NH4A 1D6NA 3WJ1A 2HV9A 1IN4A 3UKDA 1LLQA 2Q1WA 3DDUA 1UADA 2FK8A 2OQIA 2XQJA 1TM7E 3R20A 4LC1A 3HGQA 1NPYA 4OHOA 1KFJB 4UEQA 5E1BA 1D8TA 1RD4A 4L7QA 3ELDA 2PZGA 3EVBA 2ARKA 4PSVA 4BB0A 4CDGA 3JYHA 1H2BA 4YJFB 4X1IB 3AF2A 1EFHA 5A6SB 3LC1O 4LBWA 1NMEA 3LQYA 3H3FA 1Y6GA 3FPBA 1D0IA 4II2A 2B94A 4FC7A 3NBKA 4INPA 2VHXA 3VR4A 2XRYA 1ZD1A 3P2EA 1GGNA 1L7XA 5A5DA 1PT9A 1S9HA 5HP4A 3CGWA 4CMCA 3VSEA 2C83A 3OJCA 1BS9A 4AZWA 1Q6ZA 1XRSB 2N9UA 4JOSA 2JAHA 3WIOA 1Y6JA 3JQAB 1L4BA 3M5PA 9LDTA 3O82A 2Z1DA 1TU0A 4OHZA 2G8LA 2Q6VA 2X0DA 4D9KA 1QU2A 4S2EA 2QV0A 1XX6A 2B82A 2P79A 3RFCA 3KZCA 4BVLA 1O6ZA 2FSSA 1ZGAA 4WE3A 4COKA 1XAHA 3AUYA 2AFHB 3D8HA 3E3OA 4LY9A 5AW3A 2WIGA 3GFPA 3RKUA 1TJ5A 5EJ9A 2O2DA 4J1SA 2ZRLA 1EBFA 4GQIA 2MHCA 3E15A 4LNUA 3PC3A 2BCGY 3KVNA 1I2DA 4C03A 3QQ5A 1UBFA 3KT8A 3PSHA 3ELYA 4ZCSA 5A7HA 4D82A 2ZUFA 2AZ4A 1RWWA 1KY2A 2D74A 1EXWA 4JVLA 3ZWBA 1G9TA 2WD8A 2PMKA 1F6DA 1EAYA 4FHEA 2YQ5A 3GUVA 3T5PA 3TXYA 3R4VA 2JD1A 3KYIB 3OE4A 4IIYA 2ZJ2A 2GTPA 2R8XA 4ICIA 4UFOA 1Z28A 4A27A 5F73A 3NH9A 4DKJA 3HHPA 4OL0A 1UKBA 2J0EA 1OTXA 4C87A 4XX0A 3BXFA 3F4BA 3U26A 2GVNA 4I1RA 4K8RB 5CXQA 4L9RA 4XQGA 1UXKA 2ZRGA 3DMYA 3F7TA 3QWAA 1CR6A 2AMVA 2F3RA 4CKCB 1VKNA 2QTGA 3GLSA 4AQ7A 2GSWA 3FW1A 4TSFA 3UAVA 3DP9A 4YGXB 4BATA 1PLKA 1VOTA 1O95C 3PGVA 4M22A 3VU8A 3IMGA 2JVIA 1EUDA 3PQ8A 4BIMA 1MR3F 3AONB 2C04A 2I9PA 2G5GX 3COSA 3L7CA 4JA2A 1YR9A 5JARA 4TWRA 4B87A 1YMVA 1NNEA 1Y37A 4PNEA 2E21A 1YS9A 4MUGA 1MU0A 5LQSA 3OG9A 1TZKA 3GBVA 1E18A 3FG9A 3NVDA 5ARDA 5GP1A 4EHAA 5EQTA 5CBPA 4RVCA 1HTWA 2GAAA 3A8TA 4LYYA 4I9GA 1X1TA 3KL2A 4FFSA 4B7UA 2D1YA 4TLCA 4BNZA 4W5RA 3F67A 3I9MA 5KWVA 1D2NA 4U39A 5FNVB 4DM4A 3FD8A 3QLUC 3SFZA 3GLFE 3FCUB 3RS4A 1W7AA 4G0UA 1BFUA 2HK7A 1EIWA 2XQGA 3ONVA 2DULA 4HGQA 3MF4A 3ZWOA 1UFQA 5COAA 1FSSA 3MTIA 5GJWC 7ABPA 1E6UA 2JGLA 1FYFA 3OPYI 4YC7A 4J0KA 3D3NA 4WGFA 1GKIA 4HQ0A 3ZIUA 3OZXA 1C2TA 5KJ1A 1K4MA 2X5KO 1M8GA 3QFRA 3JATB 1R2QA 4F9EA 1PT5A 1SN7A 1J0BA 1T0HB 3D64A 3E58A 3H1AA 4HMPA 1C8BA 1RQ7A 3OQ6A 2R8ZA 2Y1KA 3DAYA 3E8SA 3GG2A 4OQYA 1M6VB 1Z12A 2FF5A 4PXSA 2Q6OA 3T0GA 4BFLA 2GF2A 3EXHC 1ZIDA 5G0TA 1IBKB 1E60A 1SOWA 1MDFA 4TPKA 2XSZA 3U4GA 4BLTA 4FFNA 1OH8A 2NZYA 1Q0UA 1N5MA 1FF9A 2LWIA 3ANTA 2W2OA 3CUTA 1O2DA 1EP1B 1BVUA 2H1CA 2BUCA 5DYWA 1IBSA 2ZS8A 2YVQA 3GCDA 4TXHA 1IG0A 4EMBA 4GWKA 2VKQA 4KFUA 4RZQA 3N53A 2W4QA 4IDCA 4JP2A 2IWRA 4H1UA 4XRGA 1C14A 2Q6KA 3V2IA 4ZVKA 3F9RA 4ZYZA 1CUIA 3JD2A 1EBBA 2JCBA 4ZDWA 4ZYYA 3DZGA 5ALOA 3D5EA 1E99A 4KXNA 2CLKB 1RMQA 3NORA 1MGOA 4DMFA 4FQ8A 2V5AA 2HJGA 2R68A 1B3RA 1OJLA 1WXWA 3EFEA 1AY0A 3H11A 4ZYTA 3CM0A 1IONA 3GJZA 3DNFA 3GIDA 1D2MA 1OAOA 3NC4A 3P27A 4FWIB 4D25A 1RMTA 5GAJA 3AFNA 1H66A 2C4NA 3P4UA 3U3OA 1QF6A 5BYKA 2H9YA 1KAOA 2XLBA 2EFHB 2IOQA 3D8NA 4M46A 4MCHA 2YX1A 4YJHB 4XLTA 1IL0A 3H8JA 1TA4A 2WJAA 3NWBA 3LLVA 1CS4C 1JG6A 2OV2A 1PJZA 5DHTA 3K1AA 4MRRA 3R7AA 4Y1RA 2HSJA 5E8RA 3ZJTA 1CZRA 1UDXA 3BCUA 4F56A 3V00A 3H11B 1RVV1 4ZFNA 3KOYA 4MR7A 1HDZA 1XMXA 2DFPA 4HNRA 4P92A 3SFVA 4JLMA 4C0HA 4HY3A 3TZHA 3IOYA 3I42A 4WXEA 1MG0A 1E9RA 1Q22A 4F9TA 1QMGA 3OLZA 4A0HA 1ODJA 5AW7A 2B1RA 1USKA 1DLJA 1U4SA 3KB2A 2GETA 5HTKA 5JW6A 2PUCA 3BGSA 1WQ1R 4KG7A 2IHZA 3WLTA 5JYEA 3G7SA 5JJIA 1KMCA 2HA7A 2G82A 3N59A 2E4UA 2CY0A 4UHEA 3B7PA 4WFIA 3UJCA 3MEQA 3PJDA 1IXZA 1JEOA 3WB2A 3EQ8A 1U0TA 2FE4A 2PKQP 3MUFA 2QR3A 1NLYA 4ENUA 1FFXB 1ORIA 4OLJA 1NXPA 3DAOA 4GMDA 3EJ6A 5AUQA 4MCIA 3DFMA 3SNKA 3T7KA 1DPFA 1XL1A 3LBNA 3PFKA 4W1PA 3GOQA 1U8ZA 5DMXA 4DR2B 3AZQA 2VN8A 3JQGB 4ESHA 3H4TA 3ER9A 4G5OA 3ZI0A 4HL6A 4TWAA 4XXHA 5HEKA 3QXXA 1DWPA 1WTAA 1JZSA 4D96A 4JB3A 2XCOA 4KR9A 3LHIA 1QRSA 2QSYA 5ENDA 4JI7B 2Z0MA 2YN2A 4UXHA 2DRIA 1UQRA 3LKZA 3OJWA 3OZAA 4UUNA 4BZZA 4F8JA 3JAKB 4G5XA 1X15A 2AJLI 4BPRA 2RGAA 1T9AA 2XT6A 4PSAA 1E8DA 2P4HX 2ZM6B 1FP7A 1CTQA 4RLSA 5B3JC 1KDZA 2WB2A 2ESRA 2YBEA 3D4IA 4LJ6A 3BWCA 3NUGA 4NK5A 4O8ZA 1ZAYA 1M34B 1TA9A 1W19A 4DTCA 1JA9A 2O2ZA 4BNNA 1E5XA 1NBIA 5HZMA 5KQGA 1DX4A 1KC3A 1ZW1A 1HFKA 3ESXA 3U31A 5LOVF 4YN3A 1MRSA 4EW6A 3L01A 3LNCA 2MJLA 1J7KA 1WDTA 4RDHA 3S1AA 2VPPA 3VX4A 1XP5A 3EFBA 4WBNB 1BROA 4KSYA 3MW8A 4HHEA 3GMDA 1HE1C 3EE6A 1O9BA 1L9KA 1U9IA 2WHPB 4HGPA 4OK5A 1ABFA 3M5DA 3RPEA 1Q21A 4EKEA 4LGYA 4YRDA 3LJKA 1GADO 4JP8A 5FHQA 4ONEA 3LLCA 4KQEA 2CLOB 2V03A 3H17A 1W25A 2PGNA 2MWMA 3A70A 2BFCB 4F8YA 3UWSA 3VOBA 4ZKEA 3D7KA 2QJFA 4OIMA 2VXOA 2RCNA 3ID6C 4JMPA 4IIEA 4PO3X 1M72A 2JJQA 3P52A 4MVJD 5A4DA 1R8YA 1JN0A 2B20A 2VK2A 3ZDQA 3ZQUA 3LX4A 4J3FA 5EMLA 1KFCB 2G7MC 2H00A 1V8ZA 2A6PA 5JCJD 1OGIA 2DT5A 1GARA 5JVDA 4YUAA 2H1VA 1E3WB 4AN1A 5AHKA 4IIHA 4H1HA 2C9BA 4W1SA 1GEGA 4AWXA 1PS8A 1VE5A 3DLAA 1G8PA 1Z7WA 3N6VA 1HLDA 2ILVA 1MW9X 2C5LA 4PAWA 5EMKA 2GBIA 3EEIA 1P4AA 2FW6A 4LRQA 3KPUA 3G2KA 2G63A 3KUKA 4RVNA 2C4HA 4LZPA 3W2GA 3W5HA 5GY7A 1DOHA 3Q2KA 4FFPA 4DY6A 1N0IA 1XUOA 4E3WA 3AHIA 4HX9A 5LXTB 2O54A 1JIKA 5AHXA 4X3CA 5ENVA 5EKTA 4QJ4A 4CEIA 3PXEA 4L50A 2VCHA 1R0WA 1HEIA 1H0HA 1TLLA 3GCZA 3HDHA 3NWPA 1HDYA 4AWAA 1DINA 1Q7BA 3JQ8A 4TOIA 5A0FA 3RIMA 2ZITA 3DEHA 1NVWQ 5TRTA 1J07A 3D7SA 3HFRA 3QXHA 1Y7PA 3JZMA 1JPNA 1SULA 4I4IA 4NOLA 1BX1A 4S05A 4CTOA 2GKOA 5JZMA 3FUTA 1RRPA 1Z6XA 1IM8A 1HEUA 2ZAIA 4FKZA 5DDIP 4FINA 3UPDA 4H4CA 1AB5A 4ZJZA 4H7KA 1N4DA