1NW5A

Structure of the beta class n6-adenine dna methyltransferase rsri bound to s-adenosylmethionine
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
279
structure length
270
Chain Sequence
b'GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLRSYEIVEGAANFGAALQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION METHYLASE RSRI
publication title Structures of liganded and unliganded RsrI N6-adenine DNA methyltransferase: a distinct orientation for active cofactor binding
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
total genus 91
structure length 270
sequence length 279
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nw5A00
2NP7A 3BWMA 3GRVA 3BXOA 1NW8A 4RVHA 2VDWA 1L3BA 3EVFA 3MB5A 3TPZA 4RTKA 3X0DA 4E33A 5EKXA 2IBSA 4P7FA 2FYTA 5M5BA 5DSXA 5K8VA 1QANA 3PX3A 3UJCA 4C04A 4EQZA 3PB3A 4M7RA 1X19A 3MCTA 1KHHA 2GS9A 3DMHA 3AWIA 1L3CA 3B3FA 4HTFA 4PYLA 3EVZA 3DTNA 4YV2A 1D2HA 2B3TA 1IM8A 2YXDA 4YMGA 1P39A 3ELUA 3KQPA 3GRZA 2V74B 5BXYA 5FULA 3E8SA 3HM2A 3JWHA 5EMLA 1Y8CA 3TLJA 5KYGA 2CMGA 5EPEA 2AR0A 3PX2A 4RTMA 5CVVA 2Y1XA 3RODA 4DCMA 2NXEA 5DWQA 5BP7A 1WS6A 3G5LA 3ORHA 4GUAA 7MHTA 5K03A 3FTDA 2FK7A 4X63A 3M6UA 1PJZA 4X60A 5ICCA 3EVGA 5EG5A 3UZUA 4DM3A 5D1HA 4OBXA 4P7KA 1JG2A 2ZLBA 4EK9A 5C9ZA 4PYKA 5F2NA 9MHTA 3TMAA 3EMBA 2AN3A 2B25A 5DPMA 2GAFA 3LKDA 1JSZA 4DKJA 5CVUA 3FPGA 3LBYA 1WXWA 4HH4A 1FJXA 3ME5A 1R00A 1JQDA 2CWWA 4CKEA 1JSXA 4GOMD 1EAMA 2AOWA 3TFWA 3A26A 3IEIA 2IH4A 3C6KA 4E32A 4AX8A 2O06A 5FCDA 3DXYA 4PGHA 4PIMA 3C3PA 4FSDA 3Q87B 2H00A 4R6WA 3T7RA 3GWZA 5DLYA 4F84A 3A7DA 4WVLA 2FK8A 1VIDA 2O0LA 2BM9A 3BWYA 3CCFA 3GRUA 3OE5A 5C0OE 2P3QA 4EVIA 4V0RA 4KVZA 3AXTA 4RX1A 4BP1A 4HSGA 1XVAA 5GOZA 3CBGA 4ER3A 2HMYB 3R3HA 4RTSA 3EEOA 3LBFA 3P9NA 3GDHA 4NECA 1RI3A 4CXMA 3PFGA 5DX8A 5BW5A 2PY6A 2F8LA 2ZTHA 2O57A 4Z2YA 3DXXA 4CWAA 2BM8A 4PYMA 1DUSA 3EMDA 3HCCA 1UWVA 5EOVA 2ZSUA 1EQAA 2H1RA 4PONA 4E70A 4OX9Y 2OB2A 2XBMA 1D2GA 5E9WA 1KIAA 1V39A 2P3OA 3M6VA 1SG9A 3KQVA 3UA3A 4GOOD 4RTNA 3SMQA 1Q0TA 4PYIA 2XVMA 10MHA 1KR5A 5KQSA 3HCEA 3RW9A 2JJQA 5EKUA 3DXZA 5KS2A 4BY9E 2YQZA 3VC2A 2BZGA 4RTPA 5K0EA 2PLWA 2XYRA 3AXSA 2CL5A 2C7OA 4OBWA 1RI1A 4K6MA 3CJTA 2ERCA 1L9KA 4HGYA 1AQIA 2NXNA 4MHTA 1QAOA 2PBFA 5FADA 3DOUA 3FUWA 3LKZA 1M6YA 3PTAA 2G71A 3HEMA 2HNKA 3SGLA 1ZG3A 3I5UA 2PWYA 2HWKA 2AOXA 3PFHA 4C06A 4E30A 3BZBA 1SUIA 1BHJA 4BP3A 5CM2Z 1AF7A 3P2KA 1VP3A 3UWPA 1NW3A 1UIRA 2IP2A 3EGVA 5EGSA 5HIKA 3FYCA 3FZGA 5LQAA 3G89A 3HA5A 3OPNA 4OA8A 4RTRA 4IV8A 2GPYA 3P9IA 3RIEA 1R8XA 2GA9A 1TPYA 2OB1A 4PCAA 4PYOA 3REOA 1JTEA 3UJAA 3KPWA 5LQCA 5GM2A 5LQRA 1F38A 1JQEA 1X1AA 3HCDA 4RVDA 4X1OA 3HCBA 3KPVA 3G8AA 5DM4A 2OO3A 4QPNA 3CKKA 5FQOA 2B9EA 3GCZA 1HMYA 5GWXA 2GH1A 2AOTB 3G88A 4FT2A 5HIMA 5HEKA 4QDKA 3G2PA 5BW4A 2Z6AA 1EJ0A 2YXEA 4FP9A 3O4FA 3KPYA 3T7SA 4RV9A 4QDJA 3K0BA 3KKZA 2FPOA 5T67A 4RTLA 3HVJA 3DUWA 2PXXA 1JG1A 4GF5A 3A27A 5IH3A 4GBED 2ONZA 5DTMA 1KYWA 2QM3A 3M33A 5ICFA 3GRYA 3V97A 1YFLA 3GRRA 5FQNA 3NDIA 2P35A 5K09A 2G1PA 5E1MA 2IFTA 2YR0A 3G8BA 5EHGA 2OBFA 4ZTBA 3OCJA 3IYLW 5FTWA 2FCAA 3MTIA 1EJ6A 2XYVA 3KQSA 3QOXA 5K01A 3BGDA 3EVAA 3MTEA 4EMSA 1YZ3A 2P1DA 1KP9A 2ZW9A 4IKPA 2JH9A 5HIJA 4DF3A 4E2WA 3ERCA 3UJ6A 2PX2A 3HCAA 4C08A 2Y1WA 1P1CA 2FHPA 2YVLA 2HR1A 5E2BA 2BR4A 4Y30A 1G38A 5EQJB 1WY7A 4HGZA 1AV6A 4P58A 2ZFUA 1M6EX 2H11A 2O07A 3HCFA 2G70A 4LWPA 4F86A 4RYLA 3ER9A 1Q0SA 2AOUB 3KQQA 1ZQ9A 4GOLD 4KW7A 1T43A 4PYQA 2YUIA 5GP1A 1VPTA 3R24A 3TKAA 4E2XA 5DXJA 3KR1A 5K05A 4POOA 3D2LA 5KQRA 1X1BA 4ER0A 2G8NA 3A7EA 3HVKA 3KQWA 4RTJA 4A6EA 2AS0A 2AZTA 2P7HA 4G56A 3EVCA 3C3YA 2UYHA 5DTQA 3Q7EA 5T6BA 1O9GA 5K0NA 1NE2A 1VBFA 2HV9A 3NJRA 4L7VA 2P7IA 4PWYA 4A6DA 2AOVA 3T7TA 1XXLA 4DA4A 5DSTA 1X1DA 3MGGA 5C1IA 2IH5A 2HTEA 1P1BA 3FPHA 5EC8A 3G2QA 5LSAA 2ZZNA 2P40A 4R6XA 4GC9A 1U2ZA 4U7PB 1KPHA 1FP1D 3EEYA 2FRXA 5E1DA 4PNEA 1L3IA 1XCJA 4HG2A 3SSOA 3TKYA 2EG5A 4PYNA 5FA5A 2JH8A 3EVBA 2AVNA 3ELWA 4C03A 3FTFA 3KHKA 2UYCA 1WG8A 4AZSA 2P8JA 5DTRA 5E1OA 2B78A 2ZULA 3AY0A 2OPBA 3G2MA 2ZCJA 1YFJA 4YMHA 3FUVA 2I6GA 5EMKA 2V7EA 4PGGA 4RVFA 3T0IA 4RTOA 3BT7A 4XUCA 3KU1A 1IXKA 5K0GA 1R6AA 2BR3A 3KPUA 1BC5A 3KQTA 2LD4A 3SM3A 2P3LA 3AJDA 2ZIEA 3SR4A 2JG3A 2PGXA 5FA8A 1XCLA 2QYOA 2R3SA 3SVZA 3GO4A 3DMFA 1R18A 2PJDA 4QQKA 2AOTA 4M37A 2IDJA 3UJBA 2OKCA 4RVGA 3KQYA 4OQDA 5E8JA 5GM1A 2PX8A 3BWCA 4C05A 4MTLA 2EJUA 4IV0A 2G72A 3B3JA 5DX1A 2OXTA 3M70A 2PXAA 3ER8A 2K4MA 5F2KA 4EKIA 2UYOA 3FUTA 1YUBA 3B89A 1KPGA 1TW3A 4KRGA 1G60A 5K0BA 4GC5A 4KIFA 5ERGB 3LDFA 2B2CA 5DM0A 2A14A 3FUXA 1YZHA 5D1NA 5EEHA 1JR4A 3B7PA 2IDKA 5EMMA 3WSTA 3DR5A 4CKCA 4B17A 4X61A 4R8SA 2CKDA 2XYQA 1HNNA 4CTKA 3LCVB 4OQEA 5FWAA 1RI5A 2PVCA 4M36A 2IGTA 3P2EA 3DH0A 1Z3CA 1RJGA 3CJRA 5EVJA 1I9GA 5CVDA 1G8SA 3P71T 3LDUA 4FR0A 3LDGA 4WXHA 1SKMA 2ADMA 4YUVA 4YUZA 5CCXA 1FBNA 2BR5A 1VE3A 2PSSA 1H1DA 1BKYA 5EMJA 2ORED 4DCGA 1NW7A 3NW9A 5EZQA 3UJ7A 4GOND 3A4TA 4HTFB 1O54A 3U81A 1XTPA 2N47A 4BLWA 4YUWA 5GIPE 3THSA 3E05A 3PLAE 4ISCA 2NP6A 2YX1A 3FUUA 5GINE 1DCTA 4KIGA 2EJTA 1NW6A 2AOUA 5JR3A 3TQSA 1DL5A 2BH2A 3FTEA 1RI2A 3G7UA 1RJFA 5E9QA 4FZVA 3DLIA 2VDVE 5F2OA 2DPMA 3OZRA 3LECA 2ZVJA 3I64A 3EGEA 1ZHFA 3LPMA 5U4XA 5DM1A 3EPPA 1SVUA 4E31A 4OA5A 3MQ2A 3LX6A 2PX4A 3MAGA 3I58A 3OU6A 4F85A 3TM4A 3SSMA 2JHCA 2PKWA 4GEKA 2R6ZA 4DZRA 4ER7A 1ORHA 2IBTA 5LQUA 3HP7A 2O05A 2XVAA 3UJDA 3I53A 2C7QA 4RSRA 3FRIA 2PT9A 1PRYA 3CVOA 5E8RA 2I7CA 3C0KA 4HRAA 5HFJA 3B5IA 4MIKA 4PIPA 2AN4A 5EIWA 1M0EA 4CTJA 1R74A 3IV6A 4ER6A 2NYUA 2AN5A 2JHPA 4FT4A 3JWIA 4QVGA 3OE4A 1G55A 3CJQA 1ZGJA 2YXLA 1QZZA 1RJDA 4P7GA 5CUQA 3DLCA 1VLMA 4AZWA 5IKMA 5KVAA 4ER5A 4H0NA 3QOWA 5MHTA 3QV2A 2ZWVA 4C4AA 4ATNA 3R9XB 5DX0A 4AUKA 3TRKA 1NV8A 1YB2A 3JWJA 2ZBQA 3KR2A 3TM5A 1D2CA 4DMGA 2I9KA 2GB4A 2ZZMA 4GQBA 5EEGA 2QRVB 3OU2A 2VP3A 3NMUF 3NWBA 5LQKA 3DMGA 1JQ3A 3CGGA 1WXXA 4R05A 3TR6A 2C7PA 1R8YA 1VL5A 3PT9A 3V8VA 8MHTA 3GU3A 3KQOA 4FSXA 5HZMA 1OR8A 4QPPA 3VC1A 1XJ5A 1QAMA 1X1CA 4FGZA 4V0QA 4PINA 3F4KA 4BLVA 4YV1A 2VDUE 1I4WA 2ZZKA 4Y2HA 3MHTA 3LL7A 1RI4A 1NBHA 2EFJA 3FTCA 4AZTA 2OZVA 5FWDA 2PXCA 4E2ZA 1N7IA 1NBIA 3IHTA 3LCUA 1G6Q1 5DRYA 1FP2A 3HNRA 2ONYA 3ELDA 3JWGA 3NTVA 5DM2A 3TOSA 3P9KA 1JTFA 3M4XA 1I1NA 3UFBA 1B42A 5E9JA 4U7TB 3FRHA 1XDZA 3NVMB 3LGAA 4BLUA 5LR6A 2YTZA 5ICEA 2Z6QA 4CKBA 4M38A 5JUWA 3NWEA 1WZNA 4E2YA 2IPXA 5CVEA 3BKWA 4YUYA 3ELYA 1QYRA 3E23A 1BOOA 3HVIA 4KWCA 4PYJA 1MHTA 1QAQA 3GJYA 4LWOA 2ZBPA 3HTXA 5DT2A 5LQJA 1N2XA 5CD1A 1RJEA 1TW2A 4LECA 5GIOE 4AZVA 1N7JA 2PWPA 4JXJA 4KDRA 2UZ4A 2PV0A 1G8AA 1KPIA 2KW5A 1FPQA 2PX5A 2WA2A 2AVDA 3BUSA 3DP7A 3FYDA 1INLA 3BWBA 4KDCA 1EG2A 1SUSA 4P7JA 4QTTB 4R8RA 5HOQA 2PT6A 3HVHA 5CIYA 5FHRA 3GNLA 5ICGA 1IY9A 1VP9A 5B1SA 4DQ0A 5H02A 1NKVA 2DULA 1KYZA 1NV9A 3KPJA 3G2OA 3MCZA 4MWZA 2NXCA 3BGIA 3K6RA 4XUEA 3B3GA 2OYRA 3NVKI 5EIFA 3ID6C 4YV0A 1O9HA 3O7WA 3KQMA 1KXZA 3BKXA 5CVJA 2GLUA 3PVCA 3OFJA 2NXJA 3P97A 3UA4A 3LSTA 3PS9A 1VQ1A 2QE6A 3S68A 4C07A 3FPJA 3R0QA 5K0JA 4X41A 3HA3A 3GGDA 4QVKA 2Z6UA 2E5WA 2UYQA 4YUXA 2NNWB 1AQJA 4RTQA 5G02A 1ZKDA 3GIWA 3MERA 4IWNA 5CCBA 4XUDA 2QY6A 1P91A 2ZWAA 4FS8A 5K0FA 1XDUA 2WK1A 3O31A 2P41A 1UFKA 4O29A 1EIZA 2I62A 5DXAA 3P2IA 3I9FA 5P8WA 1NW5A 3EGIA 2IH2A 3BGVA 2C7RA 3FPFA 5HIIA 4MQ4A 5K0LA 4HC4A 3R6TA 5E1BA 1JG4A 5T64A 2Q41A 3M6WA 3NDJA 1JG3A 1F3LA 2ESRA 2ZIFA 3THRA 2OY0A 2QRVA 3EVDA 3VSEA 5LQNA 5HILA 3KR0A 3OFKA 3H2BA 1YF3A 4RWZA 5E2AA 3OZTA 3OU7A 3E7PA 1ZGAA 3A25A 3G5TA 3OZSA 3HA7A 5K0CA 2EX4A 3P8ZA 4QTUB 4QQNA 3ANXA 2VZ9A 3VYWA 2ZBRA 1NT2A 2VS1A 3LHDA 5FHQA 2CMHA 2ZIGA 3SX0A 3L8DA 2JHAA 3KR9A 2WA1A 3EVEA 1ORIA 4XCXA 1MJFA 1SQGA 3CC8A 3M6XA 4LG1A 1SQFA 3P9CA 3LCCA 4PCLA 5FUBA 3SXJA 3UJ8A 4EKGA 3UBTA 3DULA 5EHIA 4UOEA 3GXOA 3UJ9A 1L1EA 5DRTA 3FPEA 1XDSA 2IIPA 3C6MA 3SSNA 5EZSA
chains in the Genus database with same CATH superfamily
4YFYA 1EQUA 1IH8A 3IT2A 4G0PA 4R1UA 3BGWA 4L6CA 3EVFA 3T1HB 5M04A 1QFXA 4QPDA 3PU6A 4MCAA 4BCDA 3GLHB 5BORA 3T5DA 3JY6A 5D8DA 4BQNA 5LFAA 2ZSIA 1SA0B 1Z7WA 3JZFA 4BKQA 5KNCH 3EXIB 4HEA6 1SKBA 4IYJA 1VI2A 3DE3X 4K05A 2B3TA 5ECDA 3Q1KA 1SZPA 3SIPA 2AX4A 1XK6A 1KWKA 3I6ZA 3OMXA 4KVGA 4UCQA 2PZKA 4PN7A 1XJQA 2PGOA 1VSTA 1Y8CA 3TLJA 1GLNA 3UJHA 2IZ0A 3N86A 2B1QA 3F98A 4V0MA 5CX1A 1ZMXA 3NS7A 3AU9A 3KV3O 5L7TA 3T5GA 2VQDA 5FAXA 3QEBZ 2HMSA 2Y4OA 3M6UA 1N92A 1NW4A 2W2LD 4YAWA 5EKTA 2AKEA 1NPYA 1GT91 4NYMR 2V4ZA 5BR7A 2JGAA 2XNJA 1UT5A 3QLTA 4DLRA 2RI6A 3IP8A 1GNRA 1I7PA 1GPYA 2H18A 2Y2UA 2HQ1A 2Q5OA 4C01A 1GN9A 2HLDD 3RVRA 1IHYA 3Q88A 2QTGA 1Z5PA 4MVJG 2GERA 1SU6A 3QVGA 4HQNA 2BFCB 2Q2OA 3M2TA 1SXIA 4HDQB 1NVFA 1U3CA 3UYKA 1DP4A 2RC6A 3QITA 2ZRNA 2P90A 4Q6WA 2B6NA 1J25A 3QBJA 2W93A 5JNSA 2DFLA 2R7KA 3L8EA 3ORYA 3Q8MA 5C0OE 1Q83A 3GLTA 4E22A 1LPMA 1T2CA 3EDCA 1KU0A 2Y1LA 4MV6A 3E81A 3ROTA 4RX1A 4WCFB 3R7FA 1DBIA 3H97A 2ZM6B 3LRPA 1CVIA 1UBUS 2OZKA 4M9UA 4RMIA 3UAYA 3UMBA 4NCIA 4BMXA 4XWOA 4DLWA 1EVLA 3DVAB 3W5VA 2JEZA 2GSWA 3VTFA 2F8LA 1P9WA 5DNUA 1QKJA 1GGJA 2VAMA 1RIFA 4ETWA 4RE5A 3G3EA 2BM8A 1DUSA 3CRQA 1OXKB 4IIBA 1B15A 3IPRA 4FI3F 4JCOA 5KPDA 2F1OA 3AYZB 1PT6A 3EMKA 4Q15A 5FV7A 1J6UA 1NGSA 5IJ0A 2VDNB 2YVAA 4FZ5A 1EXWA 4IGIA 1NVUQ 4M9XA 2ISSD 1R0LA 2W37A 2WAOA 3N2GA 4UNSA 5H68A 3SMQA 2XKBA 4ZAVA 1A5AB 2CFIA 2Q0SA 1CY0A 5GMOA 3IQEA 2CV2A 1ODCA 4ALMA 3DZ8A 3BORA 4BO2A 3AF5A 4F45A 4JWTA 1P4SA 4G9GA 5AKEA 1Z6ZA 1W5SA 2ORWA 2HA6A 5LP6C 5F33A 5PNTA 4DUGA 2HREA 2JIMA 1AKYA 3O26A 1WSBA 1Z16A 3CO0S 1R9JA 2CF6A 2XODA 5TMEA 2H0RA 5DNEA 7ADHA 1XD2B 1MVNA 1NN0A 5H0IA 1H0KA 3MWJA 3EASA 4NDZA 3Q12A 3U3JA 3VNSA 3EG9A 2WHPA 4OFXA 1I6KA 5KNDA 3QVSA 1JJ7A 2IUEA 2I91A 3EFOB 4A23A 2NM0A 2ZUWA 1ITZA 3IUPA 1F2TB 3PXUA 1Z9BA 2PUTA 1EG7A 4AKSA 3C87A 5AVVA 1EZ1A 3EFHA 1JIVA 3WK5A 2PUVA 3ZV5A 4KC0A 4WL0A 1T8PA 3PK0A 3PRJA 1JSCA 3ICWA 3OKPA 1K86A 1XVLA 4QTXA 3HA5A 4HRYA 5JAOA 1XVVA 2CWDA 2WJPA 1Y34E 4FNAA 3G6KA 4GVXA 4RV4A 3VKUA 4BMYA 1C0EA 3JSXA 4DGQA 2REOA 1GZ5A 1F51E 1EBBA 5C1OA 1P9NA 5E6SB 3LX5A 1XO1A 1VG8A 4HMQA 2IXAA 4FHGA 5CLJA 3OETA 5B6PA 3ZJVA 1TRKA 9ATCA 2IW1A 1VMAA 2GH1A 5NLLA 1GPLA 5KYXB 1LI5A 4TKMA 5ARCA 3NX4A 3E70C 3L4KA 4EJ6A 4DDKA 4Z3KA 3Q7QA 4BBZA 2GPJA 5BYAA 2IS1A 3NIBA 4XVHA 1W25A 2Z5FA 3WGHA 1HOXA 4J0KA 2JDID 1E4EA 1LQ2A 5IH3A 5CBKA 5A3SA 1JKJB 4OQNA 5H70A 3V97A 5CD9A 2LCQA 3ZDEA 3ZDDA 5IMBA 2ZXEA 2P35A 2ZWPA 5K09A 5JXHA 2Q0XA 1O6ZA 3VR4D 1WU8A 1XHFA 5JDIA 4IIJA 2Z8YM 1BS1A 1M6VA 3E8MA 1JHDA 4MARA 4ZTBA 4D99A 2D1FA 2XX3A 4BHTA 1Q1NA 4RF4A 2CN1A 5CXSA 1YZ3A 1VHJA 1SC6A 5D87A 1EUQA 3SMVA 2IT1A 2FZGA 2Q6TA 2EP7A 2X42A 1CF2O 1YASA 2I1VB 3GG9A 5D01A 5I9BA 5J9FA 3TR0A 3UHFA 1Y3FE 4A8PA 2FPGA 3HADA 2I33A 4BVAA 3KKPA 3CEHA 5FR2A 3RV4A 2ZAOA 3NQ41 5EIEA 2PE5A 1C3XA 1YRAA 5DGTA 1I3LA 1XEAA 4KQHA 4RQTA 3S81A 3J81A 1N0WA 4F91B 1T13A 4GOLD 1YI0A 1ZQ9A 1UMDB 4KCGA 4YJKA 3UCEA 1T43A 2ZUSA 5JCJD 4NG4A 1CUDA 3K15A 4NZMA 3W6ZA 3IGFA 3QM1A 2R8RA 3AERA 3ABZA 4E2XA 4MYUA 5D3MB 1PEYA 4E5SA 1YQDA 1TF2A 3QFHA 2VWPA 3W5IA 3WL4A 1U0FA 4AYWA 4ER0A 1XALA 2YOGA 4UCWA 3UAWA 1E9SA 3FMVA 2AS0A 4YRQA 2BFMA 4HDMB 4B34A 1XL0A 1P2VA 5DYYA 3K8YA 4PS0A 3TB6A 2UZ3A 1ZHHA 1HZZC 3N7TA 4XCVA 1C30B 2AI3A 4A6DA 1BWPA 4K1XA 1BYIA 4EDHA 2QVBA 4EBFA 2QUJA 4DA0A 2UZIR 4OLJA 1Z5VA 3ETHA 1IOZA 3QE4A 4LDRA 5HRAA 4KNYA 1HLPA 1M0WA 3CIFA 3TE6A 1PV1A 2MSLA 3CTPA 1ENPA 4FIZA 4BO4A 2UUAB 1QIJA 2W90A 3EZ7A 4CF7A 5FUQA 3VHXA 2BMFA 1PN3A 4CN8A 2QMYA 3JQFA 2PH5A 5IEBA 4AS1A 3QENA 1ZJWA 3C1TA 2O23A 3E9MA 4JSYA 2XKJE 3WWCA 1IUPA 1WU7A 3G9ZA 1ZQ1A 4Q1AA 1IN7A 1G9XA 3TNJA 1Z56C 3ZXXA 5CB4F 5LWHA 5ILQA 1S1MA 3RPEA 1TADA 3PC6A 3RGGA 1HXHA 4IVNA 3ADBA 3I2JA 5D3QA 3PR1A 1IXKA 4O8CA 1R6AA 2OG1A 1BC5A 1FP6A 2IEBA 3IAXA 1JE0A 2ZKLA 1IIRA 3V8RA 4O63O 3ZLJA 3I23A 5HMMA 2WRZA 4RE6A 1QIIA 2XYHA 1R50A 1X70A 2AWNA 3K1YA 4UE6A 2A33A 3G7NA 3EVNA 1J0BA 2C5EA 2VNSA 3W8EA 5IEJA 4IINA 3UJBA 3W78A 2JB9A 3QTLA 4ZQFA 1WBJB 5J2UB 3SQOA 3L02A 1U2SA 4DLPA 3ODPA 4XR4A 4QYWA 3H8SA 1IWPB 3IPXA 3OQIA 5C34B 3UUGA 4QG3A 1KI6B 4BJ6A 5LXTA 1ZO8A 2VSNA 3BX1A 4BMZA 1TW3A 4GDMA 3LDAA 5K0BA 5FEMA 4IXNA 8OHMA 3ONEA 1AGPA 2CEKA 1KVTA 4MS4B 1DJNA 3U6BA 1E89A 1YDHA 5CA1F 3VMMA 9LDTA 1IZZA 1CY1A 2ZJZA 4K9DA 2VJNA 2ZEJA 4N82A 4TSRA 4UPVA 3S5UA 3L7CA 2G28A 3G0GA 3U7JA 3WSTA 4WJZA 3UXYA 1V8PA 1JR3E 3K8OE 5HF6A 2Y1DA 3PDWA 4LXQA 1ZJJA 2WPDD 1I9GA 2ZBGA 1T3GA 1MP0A 3TNYA 4BRWA 1SKMA 2CHVA 1KI3A 4UQPA 5G3ZA 3T1VA 4YUZA 3BIXA 4JI4B 3I2KA 1GCOA 1QFZA 1YK1A 2ORED 2QP4A 3FI9A 3NW9A 3RS0A 3VBEA 3UJ7A 3IRVA 1WZUA 4US2R 1VKJA 2WWTA 3LYAA 4FVTA 5AOCA 3VZBA 1OZ0A 1K88A 1QG0A 4F4IA 4ENWA 2O59A 1CS0B 3IURA 1TJ3A 5ALGA 3SEFA 1DCTA 2O6HA 3M4YA 5BOVA 3KAPA 4DDMA 4CIAA 3F9CA 5EHQA 4BEJA 1GJRA 1ISMA 1ML4A 1EVKA 3WP0A 1JFFA 2B6HA 2UZAA 3D8HA 3OZRA 3LECA 3SZMA 3C15C 4BYGA 2ILTA 3FW1A 4KJZA 4WNAA 4YJ2F 3RFTA 4C0KA 3S1AA 1VA4A 2IV3A 4KX3A 4RCVA 3LX6A 4AKEA 4F85A 1VIVA 5ITVA 1GYRA 1P1RA 2ZPAA 1P44A 3D5TA 1N5DA 2HJRA 5D86A 3SK0A 1DDGA 4CKXA 1JT2A 121PA 4ZVPA 4Y0VA 2JCXA 3L0CA 5IHPA 2WWGA 3D6TB 4MPTA 1XTSA 5EE3A 4LK3A 1YKGA 2MTBA 1QZUA 2F2TA 4RWEA 2QMUA 1CUJA 1G98A 3F5DA 3PGA1 2ID7A 3A8TA 4NLLA 3RIMA 1UC9A 1QTNA 3EISA 3RYHB 3OJLA 1QZXA 2PRKA 2WU4A 3L8HA 3L1KA 3INTA 3NYIA 4JJ7A 5ER9A 4AVYA 2V6MA 1NFRA 1KOJA 1WBBA 1QH0A 2FP4B 1N6LA 2E6UX 5FBKA 1X7XA 2JBHA 3F90A 1DXYA 4ATNA 1VG0B 5I4KA 3TL3A 3C3WA 2DX7A 4Y0NA 1QHHA 3RAFC 1RZRA 1JYFA 1LRLA 3O47A 3PF9A 5DLEA 3RWOA 1WWKA 3RS2A 2OAQ1 5J2TA 4BGDA 1WXXA 5JWRA 5K8JB 1GTJ1 2JIDA 1TFUA 4RK5A 1T0HB 1TYBE 2CUTA 3UAZA 3ZZMA 2RB5A 1U1DA 1OZAA 2BKVA 2ZYAA 2HZ7A 4RETA 2WHQA 1X8LA 1IJBA 4R16A 4XB2A 4MWBA 1XN4A 4XB6B 4BVBA 5KJ6A 4UXHA 3F8SA 1RPNA 4ND2A 4N5NA 5IT9A 2MJLA 3IOCA 3BJZA 1QGUA 4OVKA 4NJMA 4CM8A 1Z5OA 1GGVA 2VPIA 3HWWA 3HNRA 2PH7A 1TJPB 3HHPA 3N2YA 4R1LA 1A96A 1N2CE 2DY1A 2BFPA 4LDQA 3GD7A 1RLUA 4TQUS 2Y4NA 4FLEA 1ADGA 4WNCA 3ZWYA 2YWHA 4BLUA 1EP9A 4DJ5X 3HCPA 1ZSNA 2EWWA 5K3BA 1JLRA 2BEUA 2HSWA 1U0EA 2PS3A 1SUBA 2WT9A 1K6JA 3AVOA 3OUUA 3SBDA 3PENA 2I71A 2Q3JA 4YHBA 3UAXA 2XITA 3ELYA 3K0HA 1AUXA 3OWOA 5ES4B 4OP2A 1SCNE 4IDEA 4DLZA 4ZWNA 2W6PA 5DM70 3K1TA 1XP8A 2NT4A 4NZYA 1KK2A 4E5YA 1WDMA 3VO1A 3FG9A 2C29D 1QP8A 5BQPA 1G8AA 5LPNA 2Q4RA 3A58B 1XLVA 2W83A 3G8CA 1JDNA 3MD0A 2ZJ1A 1P4JA 2X3YA 2FLKA 4QXRA 1KVRA 3QIAA 1JKXA 3U80A 1CG6A 3FETA 4CV0A 3BF7A 4ZIRA 1H1LA 5IVHA 2QVGA 3WYNA 5FA6A 1P5JA 2VJAA 3R5KA 5GJCA 3D2BA 3HUUA 1DBSA 2BGWA 3BKXA 3KVNA 1X92A 2XQFA 5THKA 2WT8A 5H5JA 3RG8A 3SYNA 1J39A 2UVQA 3AHEA 4XSGA 1Y4UA 1FZQA 3JR7A 3PP8A 3G8YA 3NHRA 2X0FA 3KKQA 2W42A 5KYUB 1ZITA 2C8JA 2G1JA 2ZM5A 3BRCA 2W5UA 1AC5A 3EQ9A 4E5PA 3IEPA 3LC1O 3I5AA 2OCPA 2WLSA 5I7WA 4R7GA 3SEQA 5HQTA 5ELLA 1PAUA 4L8VA 4ZMRA 2VATA 3WLFA 3VJLA 1BDIA 1MB3A 2ZXFA 3GWGA 2ATXA 1LLUA 2JLXA 2J6CA 5F1YA 3U9TA 2F8MA 2GZMA 3BREA 3HNOA 3IAHA 4IDPA 4X3OA 1TAHA 5SZIA 4J07A 1AHHA 1J49A 5L8VA 3EIWA 3B8HA 5AUQA 4RF3A 2D13A 1UOPA 4BO3A 4AT1A 3V5NA 1T8TA 1UKYA 2EBFX 3EPLA 1WHSB 2CW5A 3O2NA 5IKXA 1W2HA 1HZZA 3GEMA 2RONA 4D0SA 4P4GA 4C0JA 1QTRA 1Y48E 4K03A 2ZB8A 2AFHE 3MWKA 5JZVA 2IHTA 2OXCA 5FJIA 3A1DA 2C07A 5FWNA 1I7DA 1HQKA 1XD8A 2WF9A 2ZIGA 2XHEA 1O0CA 1Z17A 3H5RA 2VNKA 2ZG6A 3EVEA 2HPVA 1VCHA 4Z54A 2UUBB 1DMRA 3BXEA 5FUBA 2GR9A 1KI4A 4IMPA 5BYBA 2V6IA 3BMOB 1I1HA 1TO1E 1U2QA 1HSZA 1TM1E 2J7KA 1HG0A 3NT2A 1NJ5A 4IFTA 4UNQA 4B6FA 1N6PA 1YGYA 2P6PA 2Q62A 3C6MA 1WZ2A 1O4VA 5BPFA 2OAGA 4WX2B 4AJ2A 3NATA 2G5GX 3FGOA 4WXMA 3NWJA 2C99A 3IT1A 5C51B 2F1KA 3VHRA 3S2IA 3VSAA 2W8BA 5DSXA 2WJZB 2AE1A 1E1NA 4H59A 4DMRA 1M2KA 1JL3A 3QK7A 4LY0A 5A62A 1PWXA 1TMGE 1U6IA 3LQ1A 3CH7A 3IVRA 1NNLA 2ZJAA 3HC7A 1K98A 1DJOA 1XMSA 2AB0A 3PQ8A 4OAPA 3DTNA 2RHGB 3OIWA 4K6OA 3W8RA 2IA5A 2X0IA 2CE2X 1DRJA 2YV4A 5KNDD 3SIRA 3GLGE 4MO2A 4TN5A 5FLEX 3U56A 4WBNA 4LRUA 3GRZA 1K63A 4JFRA 3BE6A 3T5TA 2YIJA 5K2OA 4OAQA 4QHTA 3W2IA 2X2FA 1K7FB 4PGFA 3S44A 4PLGA 1L6RA 4LFAB 3PNOA 2RHHA 4HBGA 2VPTA 3L0OA 3C14C 4S12A 1QRDA 4QO8A 1UXKA 2VLBA 4MW6A 4Q3BA 5JCXA 1FIUA 1JJVA 3ZG6A 1GXSB 1EFDN 1GTL1 1WOMA 3G2JA 2VBGA 1Q1ZA 1HOTA 1K8ZB 1A4UA 4ROSA 1P45A 2RDMA 3CUWA 4QBFA 4BO1A 4IHJF 1XQWA 2R6GA 2PZFA 4MJLA 1M34B 2PRIA 3CEJA 2H52A 3D4PA 4Y1FA 1P72A 4Z2AA 5JC1A 3FOEC 1UJBA 2KHZA 3H9BA 3I4FA 4EO7A 4QYSA 4DV0B 3FVWA 5C1BA 3CIOA 1J1IA 4QPCA 5C5CA 4GQIA 3D6HA 4DE5A 3MCAA 1VKOA 4FFDA 3W0LB 4DCOA 4EHIA 4KXNA 3SXUA 1P0FA 4TS9A 3BTOA 5CM9C 2BKXA 1Z2EA 1ETUA 1LPPA 1NR5A 3FHLA 3OG9A 2FV8A 5EQFA 2C5FA 5EE9A 2YV2A 4ZV4A 4D96A 5LMNB 3LUGA 1UC4B 4FW9A 1OTYA 2Q2QA 4J9UE 4YO8A 2JGNA 5G4LA 3ZCSA 1RWXA 1JEYB 1I0LA 3VR6A 2PMDA 4WXYB 4NICA 4CR8A 2ZUCA 2H63A 3WADA 4ITVA 3PHLA 3T5MA 1KDZA 1VOTA 1ZD5A 3KQHA 1YZYA 3M5PA 5AM3A 2GVNA 4CWAA 1T3HA 1X87A 3F49S 4M9QA 5KYYA 1QYXA 3AVVA 1IK6A 2OXEA 3SF8B 4IDNA 5JECA 1A7AA 1WRBA 2GKOA 2HXGA 2XT6A 4N4AA 3G2LA 2Q7XA 2B61A 3VV3A 3WGLA 1NC1A 4A8JB 4DS3A 4K28A 3R3ZA 2V1XA 1VMKA 1L8OA 1JAYA 2OO5C 2WNIA 4FBMA 4MRMA 2X9LA 1D8AA 5HJ7A 5LLDA 1RM5A 4H1TA 2LV8A 3DOOA 5TB5A 4GMDA 1W4CA 2M2IA 2I8CA 2QAIA 1PNQA 1OILA 4HI0E 1Z8DA 5C8YB 2A5LA 2D1TA 2CUKA 2XDQA 1NVVQ 4HQKA 2C7OA 2W4IA 2B4RO 1FY2A 3O92A 3S8MA 2QZ4A 2AHRA 4W5WA 4HMOA 4Y6LA 2OFWA 1BGVA 3R5HA 3AHJA 1LB1B 2QD5A 4TV9B 3WIVA 4TRRA 4YIHA 2PT5A 4C6SA 5BWLA 1UBCA 4LJ9A 3OBBA 2PMFA 2Y0BA 4D82A 1AKVA 3LT5A 5KOIA 4UJ5A 1PGPA 1ARZA 1BHJA 4JLDA 5EE5B 5IBCA 3KKMA 1PJTA 4KVFA 1XN1A 4W9RA 4Y6RA 4RZHA 4JZYA 2V3WA 2EX1A 4DCSA 2VTKA 4Q4LA 1Q5PA 1WX1A 4RTRA 5CURA 1NIPA 1T5SA 1YZLA 3H1FA 4OA8A 1JAZA 1F5NA 2YWEA 5DV9A 4E13A 5ILOA 1HE2A 3U1VA 5CAEA 5CHYA 5FORA 1I7SB 3F6YA 1FW6A 1KDOA 1TZMA 1PF7E 1QSGA 2ODPA 1ZP6A 1LDGA 2GUGA 1XX6A 2OO3A 1M5UA 1CD5A 2DKNA 3IODA 3PJGA 4PPYA 3ZD9A 4FD2A 3OX1A 1HL3A 2V5UA 3DFIA 2AOTB 2P4HX 3R0IA 5HIMA 1GPJA 3EF0A 3I9MA 4M0LA 2WTMA 1RT9A 4YBZA 2Y93A 2JI7A 5B1IA 5A02A 1J70A 3GYGA 4I4TB 2VH5R 4G41A 4UREA 3KDPA 2MU1A 2K2WA 1T5IA 3N58A 3SQNA 1QRAA 5EN4A 7REQA 1MB4A 3WXMA 5T6MA 5F5LA 3JCZA 4CMJA 2RHCA 1TUGA 1XQ1A 4NE2A 1RYFA 2R8OA 3FFAA 1LNQA 4ZQGA 1MPXA 1CUAA 5FQNA 4DHEA 2PUJA 1WA5A 1EYZA 1Y5MA 1FTSA 3R7NA 4DNOA 4YRAA 8GPBA 1YTUA 4FYXA 1AA9A 3GY0A 4E03A 3KOZA 3MTIA 3Q1LA 1ZVKA 1TAUA 1M1ZA 3ERCA 4KJXA 2HYDA 3NDRA 4MYRA 2CXOA 1KEEB 5E95A 2QQGA 2WW8A 1U7OA 2HRQA 4U9IS 3KWLA 4AC9A 3L07A 2J5QA 1CY2A 3SJAA 5JVDB 2FZ4A 4JLJA 5ER6A 2ZFUA 4GEGA 4XWKA 2O07A 3RFCA 4WJLA 5KWEA 2Q9CA 3IE1A 2H7YA 1E63A 2QUZA 4Y7DA 1E77A 5CFZA 1SVKA 3O3MB 1XAHA 1G63A 3MK31 1D4ZA 2RJNA 2PO7A 2HT6A 1SHLA 3CE9A 4HGNA 1GKUB 3TIXB 1IAVA 3M83A 4L51A 5GTDA 3USES 2AJBA 2YY5A 1NVBA 1FSPA 4AUEA 3KJZA 1KAHA 5E6RB 5JDCC 3RVQA 4E88A 3T7EA 2CVOA 2PUEA 2Z2JA 2QZJA 1T0JB 3HO8A 4FCVA 4B73A 1YQWA 1NZJA 3MD9A 4KYUA 3ZDCA 1PGQA 2BGIA 3KTAA 4YWHA 1F4VA 2A59A 1FSZA 2ZKIA 5F21A 2A9PA 1K7SN 3E5NA 1VLLA 2C9CA 1H5NA 1ZM2A 5AK6A 4PYNA 3I05A 2A0FA 4ARSA 4F6RA 3U37A 3LCRA 4I5EA 3ELWA 5B3JA 1LS1A 2OHXA 1BH2A 3OUZA 2B5VA 2YDXA 4HJXA 3WYEA 5E1OA 1XTIA 3BM5A 4DIBA 3OZVA 1DIBA 2H3EA 1TK9A 5H3HA 1JB9A 3DHYA 3BD8A 4YVFA 3STWA 2AUTA 3TIVA 1SVWA 2DM6A 3IDQA 3CRRA 4YONB 3R23A 2D62A 2HNBA 1ULSA 4OKSA 4AUMA 4DR1B 1B23P 3GBSA 3K9CA 4F2PA 3WKEA 3WJ2A 1RZRD 3SM3A 3U7QA 1NBMD 3LFHA 3KCNA 3S27A 4H3VA 1XCLA 1DHTA 1FNSA 2WVJA 4ZVTA 2ZRLA 1U2TA 4AQ7A 1RAHA 5KTMA 3L3BA 2DF8A 3RU3A 4JI2B 4TTPA 4M37A 4OBEA 2N46A 2QBYA 4P4SA 2PHZA 3ZQUA 1RAAA 2I6SA 2HB6A 1VA5A 5DI9A 1XNRB 1J00A 2BBSA 4JDUA 3R3VA 4QXAA 5DULA 4JT2A 4BFYA 4CFZA 3NEPX 3Q7PA 4R9VA 4REQA 3B89A 3ZTWA 2ZB2A 4HAIA 2B2CA 2VXOA 2JJ2A 2QI9F 3EDYA 3ZQ4A 4C6TB 4Z51A 1KU6A 1UBTS 3ASZA 4M1KA 2DTDA 1PFGA 4GYJA 4CKBB 3CR3C 4ZFNA 1P0MA 5IZCA 1Y6RA 1NVWQ 3AZQA 1MC1A 2IGTA 3M8KA 4R2IA 4WXEA 2LE0A 3CJRA 1X42A 1EFTA 2QTMA 4H7JA 5TGTA 3ZHOA 4MKZA 1SWVA 5IDXA 4X8OA 3V2HA 1NONA 1AZTA 3JW8A 2ZDHA 3Q2KA 3C6BA 4MVJP 3HYNA 4GKJB 1ZNZA 3LUKA 3HXOA 1IC6A 3TJRA 1ULHA 3PQ2A 2DPLA 3U49A 2REXB 3KFXA 1UC8A 3B1FA 5A3QA 5JW6A 4KQEA 4IJMA 2FMKA 2DHQA 2GZRA 4I2NA 3EGDB 3O4RA 3MUEA 3PXDA 4RO0A 3X1XA 1UFOA 3RAJA 3KTFA 1A4RA 2IPOA 3H0CA 3ZHVA 3T4XA 5DM1A 4DQDA 1U5BB 4R1PA 1JVNA 1DO2A 2PMBA 3S2FA 5I7UA 3ZNPA 3ACDA 4QOJA 2JHCA 2V65A 3RGWS 4XM0A 1X77A 3CT6A 5EFZA 3BH6A 4M7OA 3RK4A 2I2DA 1CPYA 3DT8A 1W44A 5I7SA 2ZJ5A 4L2IA 3OZCA 2F3SA 1VKNA 3M6LA 4RF5A 4EX6A 1YWGO 3WE7A 2X5NA 3K9NA 3O3CA 4I5DA 4B82A 3SWWA 2JJ1A 2W8ZA 4CKZA 1ZINA 2AZDA 3RTGA 2L0XA 3FIJA 5J2UF 4M0UA 1NQXA 3DVQX 4MGYR 3UHPA 4ZYZA 1XRPA 5JSQA 4TTRA 1UFVA 1W5FA 1U3GA 3NTUA 1C5KA 1KOLA 4Q34A 1UBOS 1PSDA 4N0PA 1G8MA 1T0UA 3OZEA 4W8OA 1OFIA 2C0PA 2VPZA 3TX6A 1BVUA 1NV8A 2D0PB 3EG9B 5F7ZA 3V1KA 2GB4A 3CKYA 2R1VA 4TTQA 1L7XA 4DLBA 1P75A 4JVOA 5JISA 3T7IA 3K1ZA 1MFZA 1OD6A 1P33A 3DMGA 3HFGA 3J7AC 1H2AS 4KR6A 1II9A 2XHZA 1W0CA 1PGNA 3AP3A 4A92A 4UD2A 2OLEA 2GX6A 3D2CA 5SYAA 4FSXA 4Y1RA 4BNDB 2WZCA 1NVEA 1AZLA 4DY6A 4CUZA 4RLQA 1G8PA 3PDCA 1KZ6A 4AU1A 3R74A 3DM9B 1UKZA 5DTJA 3K0SA 2OT3B 3EH2A 4MI9A 3C4JA 4R2JA 1A50B 4Z7OB 1Y6GA 4KKVA 3GEBA 1TT7A 4LVOA 1UBSB 1Y82A 2P2YA 3GZTB 3NTVA 4H31A 4DA9A 3OTWA 5JD6A 5MN4A 4JBLA 2ZBVA 4IHAA 4U7TB 3NWPA 3VNBA 3EFBA 4N8EA 2X1VA 3NV7A 1TVKA 5DGDA 3A6FA 2WD7A 1A4IA 4DNQA 1HEUA 2V1UA 1JEAA 2NLOA 4EL0A 3I9KA 3W5DA 4WSOA 3K6SB 1B6RA 2OAEA 3JAKB 5IAJA 4PLVA 1MOQA 2C5LA 4FJ2A 1NRXA 3E2PA 2C2WA 2IZ1A 1HDZA 3ZUPA 1A95A 1D4AA 5GPBA 3SVTA 1CQIB 3HSKA 5EQTA 1WP4A 2JCBA 2V4MA 3AY6A 4HGQA 4JR2A 3B51X 4AZVA 1U80A 1OE0A 1QYCA 4BL5A 1XF9A 2R60A 1N2SA 3BUSA 3DYBA 4L3WA 3ZGYA 3HXMA 4ZCPA 1CZLA 1Y3IA 3E22B 3R0XA 1N6NA 3VKWA 5FHRA 1ZEMA 5BSGA 1VMDA 3VTKA 1OXUA 4DQ0A 4W9NA 4MX8A 1NV9A 2NXCA 4DT1A 5K6AA 3JYNA 2ZJBA 3P0HA 5HUHA 1MLDA 3RB8A 2DBQA 4LGMA 3VPBA 3GPCA 4EB6B 4MAAA 3PJEA 5K1ZA 1HI9A 4K0RA 1SIWA 3KQMA 4RHYA 2G3YA 1SIOA 2P67A 5FOWA 1GUDA 2J3KA 3FOWA 3GMDA 4W63A 3T0FA 1HYQA 1EFRD 3GELA 3OKFA 1PUXA 1FXWA 1UQTA 1XDBA 1GPDG 1YDWA 2EBWA 2Q2WA 4W4TA 2G9NA 3FROA 2R00A 3LHSA 4ALNA 3HDGA 2EZ4A 2FEWB 2J8ZA 4G2TA 4GSLA 3G13A 3IERA 3RO7A 4OK5A 5EHXA 2XB2A 5TARA 1GPUA 2FN8A 1RWWA 1P5FA 5AHOA 2Q46A 4K3VA 4JGGA 5ALLA 3A9VA 4D02A 4OSEA 4XUDA 4EG7A 2Z09A 3PGKA 4JL6A 3IOBA 2ALJA 2WLTA 4B6SA 4IJ5A 4YRGA 1M8JA 5A71A 3SEZA 3AEKB 4JBHA 1E9EA 1WP9A 3MTBA 4GKVA 5E7MA 2BFNA 3WBKA 1R3UA 1JG4A 3H5AA 3I12A 5T64A 4KOEC 2C8VA 4M99A 3ZJTA 1AZSC 4IO1A 1VIYA 2XB8A 3I2GA 4RM2A 2YY6A 5LA6A 2FJPA 4HVAA 1HT0A 4KMRA 4H3KB 4PSVA 1BNCA 3WL3A 4ZRDA 4F3YA 3BL5A 3GYBA 4KXYA 4ZZ1A 3S2GA 2HPZA 2XWQA 2HGZA 3OZTA 3VHXB 3NNSA 3CBQA 1CVLA 4C5BA 5EXEA 4BDTA 1EP3B 2RGWA 1OC2A 1KDTA 3H1BA 1J2YA 3O9ZA 3VR6D 2DLCX 1MH9A 2VJPA 3HUFA 4QQNA 3RCBA 2ZBDA 3QKIA 3RJ9A 1L4KA 1JQKA 2EXXA 2C7VA 1LLDA 1UFRA 1Y5RA 3DLPX 1F6WA 2P1RA 2UZ1B 4V3CA 4LHSA 2HU8A 2JHAA 3FGPA 5SICE 1FDTA 3MB8A 1E0SA 4ZQCB 4TTIA 1Q77A 1P5HA 1THZA 2BELA 4NFHA 4DEYA 1YB4A 2C04A 1V35A 3JASA 1VE1A 3VR2D 1I94B 3ZDYB 4J6FA 2Q6OA 4G63A 5FAKA 4RJIA 4AQDA 3QPBA 2E4WA 3FPEA 2BOVA 4PAWA 4XM1A 1CRLA 5AESA 4KHZA 1VE6A 3E15A 3CVUA 1JKMA 1ZMRA 5CT4A 1R4NB 2A1TR 3QKRA 4U0KA 4ADSG 2IELA 1BEEA 1ID1A 3H83A 4OKIA 1LU9A 1UDRA 3Q3CA 1OKKA 3L40A 4JI6B 3SQLA 2FPPA 3TINA 1PFVA 1GGHA 5K0ZA 3JZIA 4JJ6A 2NU6B 3C5WP 1MQ8B 1UAYA 3ABRB 1JS1X 2LCFA 3ER6A 3SU8A 4C08A 2CB0A 2XQIA 2I2XB 2JVKA 1T4DA 1EVZA 4HUQB 4JQZA 3BMNA 2DJ5A 4JJZA 3DBLB 2JS7A 4FZJA 1WMAA 5IBQA 4MUXA 3RANA 2G1KA 3PX2A 4K6HA 5K5EA 1DAGA 3BL8A 2QPAA 5DWQA 3OCVA 4E5VA 4BMCA 2GZ3A 1Q2XA 3F96A 3M1IA 4DR6B 2FK7A 4LHYA 5ICCA 2UV8A 3EHDA 2CJWA 3UZUA 4TMVA 2PR2A 2IKSA 3QMMA 1QJCA 1VCOA 2XOKA 1X86B 4XEUA 1H42A 2GPAA 4CR7A 3I92A 4H1UA 1LJ8A 5FR1A 1JIQA 4MRVA 3WIOA 3JAMA 1V5IA 3R9IA 3LWNA 2AOWA 5BMOA 4PIVA 1JFFB 5TEVA 2WFMA 3GNSA 3PE6A 4HYTA 2D1RA 1W73A 1KOFA 2KM1A 4PTLA 3TAUA 5LU9A 3N05A 4ZEMA 1PL7A 1DV1A 3LJKA 4LRQA 1UDWA 1NC3A 3KXIA 3SYTA 1T8RA 1O5IA 4X8MA 3LHFA 1KKLA 4UM9B 2EKLA 2E21A 5DWDA 2HMUA 2X8JA 2BL4A 2QQ0A 2Y0EA 2FK8A 1Y6ZA 2ORIA 2NUPB 3C5EA 4LJ4A 1IEXA 4P5EA 3PYXA 5KAPA 1SOUA 3BWYA 3BN3A 4BFUA 4YMIA 1UT8A 1JI3A 1FA9A 3AVQA 1NKSA 4Z9XA 3L01A 4BU0A 1ZK1A 2QSUA 4OP3A 4OEHA 1HO3A 2HMYB 4TT8A 1PD0A 3R3XA 3BFPA 3ZCUA 3OESA 4ND8A 3QMPA 4IV5A 1KWGA 3IVCA 2F8TA 2X22A 4TXJA 1RI3A 5AIBA 4MXDA 5AD1A 1EX6A 3GC6A 5C5DA 3GLHE 1BXRB 2AKAB 1FP7A 3MUNA 2A67A 5F35A 4J9VA 1ZVJA 4DLTA 4AD8A 1B7GO 3TXYA 3E7WA 4K9OA 3ZPXA 4A0GA 4JYMA 1S2GA 1DC6A 3OSZA 4B48A 5AVZA 1Q7GA 4LHEA 3ITDA 4ZT3A 3FF1A 4JBIA 1NIJA 3DMTC 5DJ5A 1IXRC 1OIVA 1PFKA 1DNPA 1P8JA 1E64A 1Y81A 3BMXA 4EHJA 4RK7A 2A1IA 3G49A 4H7KA 3KT0A 4D97A 5LP6B 1TK2A 2OVBA 1Y6FA 3O0TA 4NIMA 1SEVA 2J59A 4EHBA 1AKNA 2G0NA 4IXMA 4UFOA 3THWA 3ZCQA 1Z4QA 1N6HA 4UE3S 3TW4A 3M81A 4B3BA 1KYIA 1E6UA 2GZAA 5JD5A 1QGUB 4NJMB 2ERYA 3B7WA 5F5NA 5GVSA 1DJLA 3CRNA 4OXQA 1QAOA 1DKRA 1XV5A 2PBFA 3KSRA 3X1JA 4AJHA 2R7LA 3R3UA 2YINC 5DOVA 2VCEA 5AJHA 1M0TA 5CDHA 4HNAB 5JRJA 1T4CA 1OREA 1CIPA 3AONB 1P74A 2B94A 4X3PA 4BP3A 5IHXA 2POCA 1XA3A 3P2KA 4MAMA 2JLYA 1AQJA 1Z5UA 1AXGA 1AXRA 2F7SA 4AJOA 4KO1S 1AY0A 2X86A 5TMBA 3RUIA 2H4WA 1GZVA 1VPEA 3GF4A 1FYEA 2Z4SA 3OJWA 3T9BA 2QD3A 4F6CA 1ISHA 2XD9A 2FMXA 4QOIA 2IBMA 2QUAA 3CZCA 1ZW6A 4QREA 2RGCA 1CUBA 5AVKA 3SKXA 1GLVA 1TPYA 4ESOA 1XEXB 3LG2A 5CYPA 1LDEA 4Z7QB 2AFVA 3N5CA 2ZK7A 1XF1A 4L7QA 4ZQHA 1D4OA 7ABPA 2P4SA 1S8FA 3KB6A 3W8FA 1RRGA 4DQXA 1YE5A 2AC4A 1OBVA 3G0DA 3ZE0B 4LRTB 2ATIA 4UXIA 3HABA 5BUZA 2BF4A 4KH1A 1QK4A 4MQFA 3KPYA 4F4DA 5HKKA 4BE9A 2HBZA 3D6VA 1XMVA 3KVRA 1VJRA 4RV9A 2OK7A 4I1YA 2BHSA 2FJ0A 3RUCA 1V8BA 2QL7A 3EZ9A 4IFIA 2DHRA 3HVJA 1PVOA 3D3WB 3AQ4A 4CI0B 4F3TA 1KYWA 4DRXB 4EEXA 5A9TA 4TYPA 5ED0A 2WP0A 1K0UA 2YN2A 4B6JA 1ZUNA 1V4BA 2PIDA 5BSVA 2OBFA 5TQVA 1QCDA 3MQFA 3BQMB 1KJ9A 4Y2YA 2PFKA 4RD6A 1KBOA 1OAAA 4WLVA 4ZEWA 4Q00A 1PJCA 4CQMB 2Q45A 4YWJA 4WKPA 5B55A 1GQFA 1UK7A 5BMVB 1YS2X 2ADFA 4L0MA 1D6JA 5C8YF 4G5XA 2WUWE 2XADA 4U2KA 2H1OA 4HSEA 4G67A 3R76A 5A4MS 5BN4A 5LZ4A 3UXEA 1P4AA 5LYJB 5JASA 3P9QA 3QBVA 3V34A 3HB5X 3GOHA 4C4OA 1Q1BA 3DWFA 4TV9F 3WHKA 4YLEA 1AV6A 1ULTA 3BB3A 1EX9A 2H11A 2ZS9A 3ZNOA 3HRHA 3CZRA 5G4KA 1EUCB 4UDYX 3WLQA 4D9IA 1YBFA 2Y99A 2AOUB 3KE9A 4FGKA 4KV7A 2QRMA 1QUEA 2VOEA 2GNPA 3EB9A 1CDEA 4Q7KA 1IY2A 1VPTA 5A04A 1TO6A 1TZJA 3WMFA 4CMGA 1O8CA 3DAYA 3JALB 3QUAA 2GM5A 5CX4A 3UJ3X 2R7NA 821PA 3N6XA 4WOKA 3U4IA 3ZS9A 3U3OA 1D1SA 4UD6A 3OCWA 4PZUA 1KZ1A 1EPUA 2PD3A 1XQ6A 3VDRA 3Q7EA 1PK9A 1GV1A 3RFFA 4CETA 1Q7EA 1L8LA 4FDMA 1XTBA 2FR1A 3W3ZB 2V58A 4PLTA 4UHKA 1W5TA 3CF4A 1W36D 3QKSA 4TYQA 4DOMA 2VAWA 3TH5A 1EFLA 3IXLA 3G2QA 3CSUA 4G4IA 1L4HA 4GRDA 3W9BA 1ATIA 2W2XA 1T8SA 3X1DA 1E2BA 2PUDA 1XCJA 4PLPA 4XFJA 3CH5A 2R5NA 4KVAA 1R0RE 2E55A 1HQDA 2EG5A 1FX0A 2HWYA 1R8QA 5I45A 2JH8A 1M1UA 2JJ1D 1IJEA 3ROKA 5EXSA 1ICIA 2JIOA 4I4TF 1S7CA 3MJHA 4LGVA 2O2ZA 3LT1A 4LVCA 5C81A 3KHUA 1T9BA 1WO8A 3Q9SA 4B6OA 2XE8A 2FSIA 3SC6A 4C3VA 1R6VA 2I6GA 2BE7A 4MRRA 3K2QA 2KB0A 3GJXC 3OLZA 4RVFA 4UMEA 5FL7A 2A94A 4MUEA 2JAQA 3P26A 3DLBA 2AMLA 3HWX1 5A6SA 3TIFA 3KQTA 2CLLB 2Y1GA 1ZD9A 2W6NA 4QKQA 1IJKA 4Q4AB 3KC2A 4YAKA 2VH1A 3M9XA 3BC1A 1PFQA 3F1LA 4R8KA 4O2RA 1FUYB 1SBHA 4P82A 4MVJF 2ATVA 1MVLA 5D5HA 4BXOB 1EUDA 2RHJA 3B85A 1YA4A 1YZKA 4XIFA 3VAYA 3ETNA 2QMHA 4M0CA 2VK4A 4BLQA 4XVQA 1RQXA 2IV7A 2RB4A 3RVKA 2OXTA 2B9VA 4W99A 1JT9A 3CEPB 2CY0A 1J2JA 2K4MA 4EKIA 5B3KA 5JVDF 1GQ2A 5TMDA 2VSOA 4MCJA 4YA6A 5BR8B 2C9DA 5BQ3A 2WEKA 3DZBA 3E7FA 1G60A 3O94A 1SK9A 4KIFA 4HAVA 4XRRA 5TR9A 4KPYA 3B2NA 1XI2A 1G64A 2RHLA 1J23A 3B7PA 3G79A 4H7DA 4R7ZA 4XYEA 5HCIA 5LB4A 1DMSA 1X9GA 3GAFA 5EY5B 4R8SA 3L0DA 1XPOA 1EP2B 4BP9A 4EYEA 3MTDA 3DEKA 4L9WA 5TPWB 1ZS9A 2W2TA 2X4DA 1OU0A 1RMQA 4E5KA 2AMYA 4ZAYA 4TVKA 4F92B 1KYVA 4BZWA 4C3UA 1QKKA 4WXHA 1M8PA 1Y5LA 4F9FA 2PZBA 2P3SA 2P2CA 3NEYA 4JLSA 3SZRA 4DTIA 4NAVA 1QO9A 4P0QB 3R9WA 3T99A 4B85A 1Z73A 3WGVA 2Q49A 4GXQA 2NP6A 2EL7A 1H0HA 4AWBA 3FCYA 3VR3A 4LJRA 4FXOA 4M1EA 2NVUA 2NX2A 2EJTA 3NC4A 4NOLA 1PJ4A 5BW6B 2GM4A 3LSYA 5KWIA 1US8A 2NPOA 2P2GA 4Q7MB 3DMRA 1R6BX 3ILHA 4NC9A 4WOJA 5IABA 2BBOA 1FDVA 3H0KA 3OECA 3A14A 4JODA 4LMAA 3NTRA 4TLCA 2CV0A 5KYYB 4A0HA 2QG6A 5BQXA 2NYVA 3OJ0A 3OU6A 4JP1A 2I4NA 3B1YA 4PSCA 2QYSA 5AXAA 3FFXA 1SURA 2HBYA 3DD1A 1JWAB 4NEQA 4S2EA 1DCKA 5FBVB 2XF8A 5C35A 2IHKA 2VDMB 1R9NA 3LKVA 2G5CA 3FLMA 3RSLA 6YASA 2PUBA 1RAGA 3HJGA 1DB3A 1JHQA 2O05A 2UDPA 4GZLA 3OP1A 2WYWA 5EJEA 2AG6A 4UU1A 2BUCA 4UEKA 1SKYE 2QM8A 1U0GA 1LBIA 3Q41A 1T1IA 1U81A 2HRZA 4JFAA 5JI3E 2PSEA 1RJDA 4YC7A 5KVAA 4ZODA 5BN5A 4CHGA 3EXG1 1UPCA 4ZI7B 3R9XB 3P0JA 5I9NA 2V8BA 2V8OA 1WXGA 3USCS 2ZZMA 2GJKA 2R6R1 2G83A 4IEFB 4ANFA 5AVSA 3K8QA 3BRWA 4MS1B 3S7ZA 2H2GA 2CUZA 2YYYA 4FBLA 1PW5A 1Z7BA 1BJRE 3FRJA 1WDKA 1SUEA 1TQ4A 5CW1A 2C00A 4NYJR 4B3DA 2C1ZA 4N65A 3NR2A 5DIFA 1G4UR 2VCYA 4DN6A 1RJ9B 3AIOA 2O8NA 2WOOA 1ONPA 3L8YA 4TV8B 5DHUA 2P9QA 4ARUA 4L0CA 2BRUC 4J76A 3ZHQA 3KXKA 1T1RA 1GZHB 1XZ8A 3A3PA 5KNLA 1QG6A 4BEBA 2MSDB 2XUDA 3NONA 2XTNA 3NM5A 5GONB 3QZUA 4EGAA 3OTIA 1MIHA 3ZCTA 3AFNA 4M38A 4CMKA 4AMYA 3RV3A 2O2IA 2J0SA 2NVWA 2YNMC 3EG5A 1B8PA 2VDWB 1E1RA 3I72A 4KZKA 4K9RA 1HG1A 3BHMA 2VH2A 1M2OA 4K7JA 2OBMA 4LOKA 4TRJA 2B5OA 2GT1A 1MHTA 4CIVA 3K8ZA 3X3HA 5TLSA 5K3OA 1R15A 5ULLA 3ZU2A 1OKKD 3BK2A 1LPNA 3Q0EA 3SE7A 4D9GA 4LHVA 2IEZA 1OWNA 1AHNA 2KW5A 4PX2A 4I2VA 5DEOA 4IFBA 3S7TA 2PO5A 3IUJA 1G5HA 3OPXA 3RT1A 3T15A 3JQGA 4LTNA 4WRRA 1TIPA 2JAOA 4ZQBA 4YRBA 4LHZA 1CJMA 3NVAA 5FUXA 5A3RA 3V2GA 3ZR4B 4YV0A 3KJXA 4R5MA 4C3ZA 1Z0KA 2NO0A 3KU4A 3TBKA 5BYJA 5AM5A 4B3CA 2QTBA 3CXUA 5BSUA 3TTUA 3IP7A 1CR4A 2IS6A 5IXJA 1DV2A 1T5TA 3UA4A 1LPSA 2GF9A 4IRMA 3S68A 4B44A 2B30A 4KRFA 3IQHX 2IHVA 1OSNA 2XOKD 3ENWA 4O1IA 4AWAA 1Y89A 1YH3A 1ZWLA 1SD1A 1XELA 3WMWA 4ETNA 1EE2A 4OBBA 3Q3EA 3CKMA 2LIPA 4NJOA 1OA1A 1T6XA 1HQYE 2VJLA 1SVIA 3W6OA 3RWMB 1R3DA 2PNFA 4HB4A 4BNGA 4OLAA 1MXHA 3AOEA 2HIGA 4FLFA 1EIZA 3WFJA 1TKCA 2JAXA 4WKNA 3D31A 2IH2A 1FP4A 4Q47A 2C7RA 4D4KA 4E3ZA 2VJBA 2O7SA 3K71B 2IK8A 2IU6A 2VUIB 1PG0A 3WLPA 2ZR0A 4AJ4A 1RDFA 2DQZA 2J6HA 3H5LA 3QNUA 4FFBA 1YF3A 2JI8A 3JQPA 1CY4A 4NHOA 1GARA 4RWZA 5EWLB 4CQLA 3OU7A 2YIVX 3WRWA 3E7PA 4MP3A 4PG4A 4BVHA 3IVGA 4LOAA 4MW5A 4PPNA 2GK4A 1G4HA 3LV8A 2XKKA 3I0MA 1T9GR 4PXAA 1P2SA 1Y7HA 4NJEB 2AQIA 2CE7A 2ZVQX 2QIOA 2RK6A 3AR4A 3O03A 3P5SA 2HQRA 1XXHE 3NHLA 4G5HA 4I9HA 4RIFA 4U3JB 1J0CA 3LHDA 4IRXA 3JR3A 5DK6A 5FHQA 3RHTA 4C4PA 3Q15C 3VYRB 4DFDA 4A4DA 2AUMA 4B4KA 4HF7A 1DIRA 1M83A 2HJVA 4HD8A 4LYAA 4Q1FA 3ZLUA 3UY4A 4ZYLA 2XEDA 5FNVB 4EELA 1EFAA 4HZIA 1WPXA 3Q40A 4Q4JA 2RFLA 3O9VA 5ERXA 2RGNA 1VL0A 3KTDA 4R2XA 1X80A 3D0RA 1ENZA 5I47A 4MEAA 2FVXA 4OYLA 3W1VA 1CEEA 2QLNA 4MIEA 2MSCB 2CC2A 4ENRA 4YRFA 1L3BA 1E59A 1PT5A 3TQFA 3WY9A 3X0DA 4HH0A 2Z5VA 3BPSA 5EKXA 1YFKA 4LDPA 3RVPA 2DBZA 5IPFA 4ED9A 1OASA 3PX3A 5K8VA 1OFGA 3JYLA 3PXXA 3PB3A 5I4IA 1MMFB 1DEXA 3VPHA 2GHRA 3TUZC 2C5SA 1JP7A 3B3FA 5D85A 9GPBA 2AXPA 1GL3A 2Q1TA 1Y5IA 2ZB7A 3GDFA 3ND9A 4F3KA 5M29A 2Z4RA 3QQ5A 4RD3A 1TJ4A 1V1RA 4OV6B 2V74B 2WPNA 3MLAA 3O8LA 5IANA 3PF8A 4XQ9A 2C9YA 3CZ9A 2E4UA 4OUDB 5CLQA 1RM3A 3MWGA 2ZIAA 1SXHA 3OM1A 5FWXA 4BCCA 4KFCA 5EPEA 3WKDA 4EJSC 5LC1A 3A6EA 2OCIA 4EM6A 2WKRA 4JNKA 1MPTA 2GKGA 2JH3A 2X23A 4AFNA 1XOIA 4B5KA 5JSUA 1ZICA 3F1KA 1CFJA 1CR1A 1JPNA 3ABSB 4PYKA 4ALIA 4AP6A 3HZRA 3JPWA 1FRZA 3C2QA 2VJCA 4Z8YA 1T1EA 5JH7A 1WSWA 2AZ4A 3D64A 1BEZA 2IIBA 1QVVA 3E7DA 3FPGA 3H3XA 4J0QA 3UQZA 4GZMA 2O50A 5KNDH 4U2FA 2CWWA 4YASA 4Y2TA 4YJFB 1XROA 3OFVA 2B35A 3PIDA 2X6RA 4QUJA 4IXDA 5GZ3A 3HSYA 3EXHA 3QV1A 4MICA 3WGJA 1SBYA 4CM6A 1EHIA 2BFFA 3D59A 3EUWA 4FX2A 4BB9A 1RHQA 4HXYA 1OJLA 2WSLA 3I2YX 1NU8A 4K87A 5JJ5A 5B7NA 4BMDA 2E0IA 3AJEA 5JFOA 3ZCPA 1LJLA 1R0CA 1T1GA 3PEYA 3H6KA 5T41A 3GRUA 4PR3A 1DDIA 1T6YA 2DZDA 1PJLA 3ZWWA 2BTQA 4G65A 3HDTA 1GAQA 1BEUB 2PSHA 1NUUA 2R6JA 1ZOPA 3D8SA 3LYLA 3CBGA 5JWHA 2H54A 4ZAFA 1A9SA 2LXNA 3NAGA 2JLUA 4MK4A 1H9AA 1Q7CA 2DRIA 3P1JA 4CKWA 2D2EA 3ZVKA 4F6LA 3WBFA 4KYIB 1UH5A 3B38A 3IIEA 1M72A 5KOHA 1TKRA 1TCCA 3CUKA 1N32B 2VPXA 1T10A 4TKZA 3LBNA 3UWMA 4CF6A 5JAIA 3WWYA 3HCWA 5DH9A 1CDDA 1R0ZA 3KYCB 3WLRA 4OHWA 4A82A 1G66A 1ZXLA 3BJIC 1QE5A 1I6WA 2W6JD 2KJQA 4KV9A 4M22A 1E0JA 4OM8A 3DV9A 1N3BA 2IYFA 4DLSA 5IKPA 4RTNA 2G7MC 4MW4A 1ECFA 1U1GA 4M6WB 5EUQB 5AICA 4I50A 1N2EA 4PX5A 4D9NA 1NUQA 3SVLA 2I4OA 2GBIA 5K3CA 3AM1A 1M2NA 1U2PA 5C7OO 1AJEA 3R7WB 1Q84A 3D4IA 1KBQA 1MJHA 3RROA 3KVOA 1MZPA 1QTIA 3A37A 3SZLA 5IM4A 5FOSA 3EE6A 4JN6B 3FUWA 1QQBA 3U16A 5AO9A 1LI7A 1M34E 4JXKA 3N7AA 2DY0A 4BFTA 1LVGA 1JGTA 5A4FS 4MJ3A 3MW8A 4XI9A 2PIAA 4L15A 2WM3A 4EFDA 4LZNA 1L5QA 1QJ4A 1DTWA 3EGVA 4Z1MA 3G2KA 3ORRA 3R5SA 3NBUA 4LYHA 4YT4A 1NXPA 1DOZA 1ZN8A 3IDOA 3G85A 3QLUA 4I08A 4LBWA 4RUKA 1VMEA 1XD9A 1P62B 2OB1A 4WN3A 2BGTA 4F2GA 5EMNA 1EGAA 4UEOA 5FL7D 4UUOA 1VSBA 2JIBA 2LW7A 3V9PA 4CLRB 4EFMA 1PK8A 1PUJA 1ZLXA 4GZ3A 2HDNB 2ZGVA 1SCUB 3CMCO 1JUDA 3H1PA 1UL1X 4E12A 2O8BB 1JIXA 2XE4A 3QELA 1F0NA 4OU4A 4C30A 1DDOA 3WQSB 4EB3A 3G2PA 1AU9A 3GT7A 4REMA 4J7XA 1KEZA 2QVZX 1MFPA 1N2ZA 2IGBA 1SVSA 2W2VA 3Q4GA 4DA7A 2VDRB 4QOEA 5AYVA 1EHCA 4RDIA 5T67A 3WGUA 2I4TA 5CH3A 4LSMA 1ST2A 3A1UA 3E27A 2QP9X 2ONZA 3VDMA 1XQVA 1F0YA 1E7SA 3E5RA 3ZJ5A 5C37A 2DERA 4LISA 3PICA 4U0JA 4BU1A 2OV3A 5ALFA 5LP6F 3GLFA 2XZPA 1HE8B 1QDEA 3LPDA 1A9RA 4JITA 3ZHUA 2F43A 1PW7A 1UR5A 5DN6A 2O0KA 1SIBE 1V5FA 4YRZA 1IVSA 4IKPA 3QFCA 2NZ2A 4ZAXA 3VX3A 4R8VA 2O2JA 2PX2A 3HCAA 4JDPA 1CEYA 2VHCA 3U19A 5F9FA 2NZXA 2YVLA 4HAOA 2RKWA 2AIRA 3NAZA 4HV4A 1B1CA 2NO4A 3K5IA 2BR4A 3MT7A 5E2BA 2JVIA 3N0WA 3TLGB 1QGDA 2JCYA 4UZSA 1Q16A 2X4IA 3U4QA 4DJFC 4IVPA 3DEIA 2GILA 4W1RA 3UMMA 3L1JA 2F3QA 1E3SA 2BVNA 1IMJA 3MILA 4C43A 5EWMB 3QRWA 3VPSA 4PYQA 3R24A 1LDYA 2G1UA 4UNIA 5HP4A 1JHYA 2ZJOA 1PFYA 1OZFA 3BCSA 2IYAA 4RTJA 4JROA 3USZA 4CIDA 3RYCB 2NU7B 1PZHA 2BH9A 3VOBA 5B12A 3ESBA 1ADFA 3I01M 2V6FA 4X65B 2VF2A 1RPTA 3RVLA 4L7VA 2V7QA 3KYBA 4D44A 5LWQA 3CW2A 2PUCA 4J0CA 3B6EA 1HPLA 1V48A 3O9MA 3MGGA 2F90A 1PP4A 3F3MA 4O5AA 3SX4A 3W5JA 5LIRA 3IA7A 3JASB 3MOSA 1I51A 1UANA 3FWZA 1TYDE 3IUBA 2HFJA 5IK2A 3K5WA 3CNLA 3L8GA 1HNXB 1WUJS 3OQ1A 2DH5A 3TQCA 2IZ5A 1CJBA 1GLGA 3H3JA 1W87A 3FYUA 1FFXA 3NHWA 3AB7A 4UULA 1J5XA 2VJDA 1U94A 1V0JA 1Q95A 1GZ7A 4FFPA 2ICAA 4EHLA 1BCSB 2QMOA 1RPZA 1ZDMA 4CM5A 3ANLA 2AJLI 2TMYA 1AS2A 1CUXA 2B78A 2JGDB 1QV7A 2DQ4A 1K66A 3DHVA 4IJUA 4XKJA 3FZNA 4WFKA 1O57A 3MMXA 2GPSA 1ZIPA 2H65A 5EMKA 1X7ZB 2Z5LA 2V7EA 1A1VA 2QX9A 1A9OA 1BRMA 2C8KA 5HPYB 1QB8A 2YYSA 1RWPA 5U1PA 1QPBA 5EJFA 2WB4A 1FDWA 2GHTA 2LD4A 1J9ZA 1UZLA 2P3LA 3BRWD 4AY5A 1Z13A 5KOJB 3U44B 2FE1A 1QM5A 4MVJE 2GD6A 5BMVF 3LLVA 4F5WA 3LGSA 2VHEA 1NX9A 4JIMA 4PZ9A 3IPCA 3WWZA 2P9HA 2WMDA 4OI2A 2BN4A 5ERYA 3LHIA 5LYJF 2H85A 3Q98A 1JJFA 1PT9A 5K3FA 1IUKA 1QR6A 1UBGA 3B3JA 3F4BA 1CX9B 3ZEAA 2L82A 1D2NA 1I4TD 1K9SA 2IWHA 5FD8A 4HT3B 1XIVA 3EH1A 1XZEA 2C2XA 2P2NA 3OCUA 3HS3A 4JC5A 4TS3A 4DY4A 4X7PA 2J9ZB 3QOFA 2A14A 2CNBA 5DM0A 3DZJA 2BPOA 5B36A 4YJHA 2VR1A 1G1AA 1G0OA 4GPAA 4MDFA 3AL0C 2BLNA 2VYND 3EZYA 4X61A 2PRZA 1SU7A 2XCIA 4B17A 1OW3B 3KQKA 1DHRA 3EOBI 3N2LA 4AJEA 1GFIA 2AV6A 1I4EB 2H4XA 3GUVA 5KBYA 2FR8C 5EXDA 4H3HB 1L7PA 3DCNA 4HVCA 3NBMA 3EPHA 4HYYA 5FWYB 4AKGA 1IM2A 2CLFB 3DWGA 3JD1A 4HPXB 4LXHA 2BR5A 3LW7A 4JELA 4MVYA 1OGYA 4WLEA 2ZREA 1F60A 3QGMA 4KQ6A 3RDPA 2V59A 5EZQA 1OHHD 1KDVA 1O54A 3BBLA 4GYYA 3O4VA 4M49A 3THSA 3OZIA 1WLSA 2YX1A 3IXMA 1PS0A 4GIBA 2QRQA 4JLBA 3ZHBA 2D1QA 1OI2A 3CH6A 4QEDA 1U63A 3FTEA 1Y3AA 1W4ZA 4KYVA 2GASA 1QIEA 2JKVA 1QPZA 4UTRA 4G97A 5KKCA 1YR2A 1MC5A 4TRMA 1GRCA 1JR3A 1EMDA 1PR3A 3LIPA 4XM2A 4XYGA 4E31A 4HH3C 5BUQA 2I5PO 2W71A 1W76A 5B37A 3E0XA 3V7WA 4OB7A 3E9DA 1HLGA 2A9KA 3TN7A 4L76A 1BGXT 1C1XB 1G16A 3MCUA 3AJ9A 5CVCA 1CETA 2FB9A 4DEVA 2Y66A 4EFKA 3ENVA 4Q01A 2IBTA 2HY7A 2VTDA 5HK9A 1FS6A 2JARA 2QTLA 3OQJA 2NN3C 4V0ME 1BMDA 1UEIA 4HRAA 1Z2AA 2DHDA 5EIWA 4FK8A 2O1XA 1ZH4A 2CBXA 4NMXB 4WGFA 4OJMX 2JHPA 2NZWA 3JWIA 3OE4A 3D6UA 3ZKWA 1QZZA 1EB9A 3EA5A 3DLCA 2BSAA 3H75A 2BEKA 4IIYA 2DMRA 2D8MA 5MHTA 1YUNA 3PHGA 1TPZA 4R7TA 2PUGA 1SC3A 1AO3A 2VF8A 4M53A 1JH9A 1AN0A 4DMGA 1Y1RA 3JWJA 1N33B 1HH4A 4RD0A 1NVGA 2H1CA 4AB1A 3OU2A 2QU7A 5EESA 1UOOA 4ZC1A 3ZNQA 5K8IA 2BW0A 2G7ZA 1C3VA 2LWIA 3BE8A 4NCAA 5JLAA 1U2DA 5AFSA 3D8NA 5DYIA 3RTAA 3WK4A 3LXMA 2C7PA 1Z38A 5DO9A 1DXHA 4IHKA 4MKGA 2B0JA 3GQBB 4C5AA 2JFNA 1OLUA 3CVJA 4MW9A 3TSYA 4BVJA 3UXMA 5CFRA 4IVRA 1GU1A 2QRJA 1YOBA 4IMJB 4D9KA 1NQAO 1EGHA 1Q0HA 3FMPB 4KQXA 1TEVA 4BLVA 1C50A 1VI6A 4Y2UA 5C18A 3MJCA 4KKXB 1ST3A 3IKVA 1IPEA 1EVYA 2R11A 1OC4A 1G6Q1 5C31A 4DLXA 2GN2A 1CJCA 5DM2A 2E89A 1GR1A 1L7RA 5IUKC 3DLAA 5KTNA 5KWSA 4HDCA 2REQB 1WCIA 1B42A 4D80A 5CB8A 3CPSA 2WAXA 4W7SA 3VZCA 4EI8A 4EKDA 1KNXA 1HL7A 5DVZA 1DAKA 2MSEB 3GFFA 4WN9A 5K3AA 4K9PA 4U00A 2E1RA 3OTGA 1QHGA 1HUQA 1XU4A 1HFJA 2ETVA 3BKWA 4XH9B 4BLOA 4F1WA 2QLJA 5L3QB 1PQWA 3KD2A 4WTOA 2PA0A 5FO0A 5FYDA 2PGAA 3L1HA 1BJTA 1HDGO 3L04A 4H4DA 4LJAA 2W0MA 2I6TA 5TXGA 3PC2A 5HXAA 4BNNA 4U2EA 3H2JA 3L5OA 4JT8A 5KSOA 4HDNA 3TSCA 1T8UA 4KDRA 3EPJA 1ONSA 1EJ2A 4CL3A 2GXAA 4XJTA 5IVKA 4UVDA 4QTTB 1VCMA 4RXMA 3MT0A 1KYQA 2H2DA 3A4NA 3HVHA 2R6CA 4HJRA 3SICE 2DFKB 4WY5A 1N2CA 2R1TB 4IMIB 2WF5A 3K0KA 3WYDA 3K6RA 1K8RA 4IJQA 2O6LA 3BXHA 4B75A 4UHBA 2K7FA 4QEZA 3A10A 2AD5A 1DT5A 4ZI7F 5F5XA 3TI7A 3BULA 4CDRA 4H17A 3PVCA 2HBRA 3QUBA 1FFEA 2JAPA 4KXQA 1T9AA 3V42A 4QECA 4UC0A 2DEUA 1ZJYA 4X41A 1O6GA 1CQZA 1GQOA 1RADA 3DCYA 4L6AA 3BFJA 4K6FA 4MR9B 4EG6A 4FYHA 1K75A 3JWEA 4RTQA 3RADC 4WY8A 5BR4A 1QLHA 3MCVA 1PGOA 1PJRA 1OI7A 2DFDA 1T1SA 4JLWA 4TV8F 1F8GA 4GX0A 2ZIWB 1FVHA 5B53A 2ZUEA 1CW2B 3ENQA 5CXUA 1CUGA 5DXAA 4BP8A 1SOVA 1O4WA 5IDQA 1I13A 5U9CA 1M0SA 2XWJI 2GFIA 1F8YA 3EC2A 3LUFA 1UBNA 1WUYA 3PXEA 5FFNA 3E82A 3TZCA 4B3MB 2ZVPX 3CNEA 4KE6A 5GONF 1CP2A 2A86A 3VI3B 3GA7A 1CE8B 1VTKA 1Y63A 1IE3A 2VWHA 3KOWA 3QLJA 4ZREA 1TA4A 2Q1SA 4PXSA 4RHXA 2C4MA 1SKAA 1JA1A 2AL7A 3SZOA 3UEOA 1JNXX 2CYBA 2N3ZA 3HA7A 4B3GA 1L5HA 4EVQA 4EYSA 1DEOA 1W35A 5J63A 2GAAA 3WWPA 2JI9A 4P54A 2IUUA 3EGXA 5JSHA 1CZUA 1Y9AA 2JC3A 4JJEA 1EHYA 2CMHA 3UMFA 1GDTA 4EY4A 3TBHA 3Q6MA 3V00A 1V43A 2UVPA 4D0GA 4E09A 3F67A 2VP2A 2G9RA 3F7MA 2X0RA 3GGSA 3KDSE 5I7AA 2J07A 4QBHA 5AXBA 4MVJI 3SEAA 1YQUA 2RAPA 2UVDA 3SSNA 4E5UA 1EK1A 1WKCA 1T6BY 1GCIA 3LUCA 4RESA 3VNRA 3E03A 3GUYA 1C81A 5AW0A 3IB6A 3GP8A 2M98A 2Y68A 3BXOA 3VR6H 1LBSA 4RVHA 1B16A 4YXWA 1HLFA 3W2EA 1ISIA 4RTKA 4XIIA 2QW1A 1VHWA 1UBHS 1JKFA 4RK4A 1YBAA 3B9BA 1DKLA 4DIDA 2HU7A 3NG1A 2AFHA 5IJXA 2D00A 3HZHA 3KQLA 3DQQA 1LTHR 4HK4A 4UFNA 4QUAA 3A3KA 1WHTA 4L5YA 4NDAA 4PZYA 1W85A 4PAQA 3NJ8A 4LQDA 3LK7A 3P5BA 3L41A 2ID8A 1N8SA 4OH1A 4RDCA 3GA5A 3R3YA 1P39A 4UZEA 5BW8A 1Z34A 5FULA 1R4MA 1IB0A 3E8SA 4GS5A 4MR7B 1E1CA 3T0GA 1QF7A 3GEHA 3KOUA 4RTMA 3UH1A 3IP9A 4GQAA 4LYFA 1UKEA 1K5HA 1Z6PA 2X76A 2ZYGA 1TI7A 2V7WA 3B2EA 1R12A 3GFTA 4IDQA 3ZWKA 1E6KA 1FRVA 3KXLA 2PT7A 5AHRA 4B47A 5EIXA 2FXVA 2JCSA 1UJNA 4E2FA 2GCNA 4LI3X 1P1KA 3ISVA 1FTQA 4QWWA 5I9SA 3KP1A 4OMFG 3UKJA 4DKJA 3IP1A 5LMCA 1DKNA 1YQ9A 3HKCB 4V2UA 4YPFA 5JBQA 1UXGA 5ALQA 4GOMD 5F9MA 1NVVR 3AYXB 3PR2B 4FSHA 1TEZA 4MWEA 5JMPA 4XSVA 4C1NA 2OV1A 1BFKA 4PEVA 4ZJYA 1AKWA 4GYWA 3UO8B 4FSDA 3NKVA 5AM1A 5LDHA 3G0CA 2G9QA 1Q50A 2BKLA 3Q87B 3M1AA 4XR9A 1Z6QA 3FB1A 4HPWA 3VM6A 3WIBA 1MABB 2G9VA 3SCZA 2IXTA 4YRCA 3T9FA 2TS1A 2FP3A 5F64A 3R3JA 3OZGA 2GRUA 2Q3MA 4HDSB 1YB6A 2O0LA 2YZ7A 3BJMA 1TK3A 5FNVF 1YIDA 3ESDA 1SFRA 3EVTA 1U7PA 1JLMA 4QYMA 2JK1A 1FQOA 4BP1A 2P0YA 2HLPA 3R77A 1N2GA 1EFVB 2YFHA 2ZDGA 5T5QA 3EEOA 3P9NA 3V1YA 4AIRA 2BIFA 1UZAA 2HMWA 2ZE5A 1Y7PA 4EJ0A 1GM5A 3AHHA 3E9YA 1VXRA 2A88A 3PUZA 4KGDA 1QFYA 3HPQA 5F7OA 3AR9A 4DDVA 4HLUA 3IA2A 4GUDA 3TBFA 4TTVA 1NBOA 3ROMA 3UWOA 4PQEA 4RENA 1TQDA 3RUFA 3I6IA 4P4NA 2OB2A 1U2GC 2ODBA 3L7KA 4BX0A 1HYBA 4DREA 4GOOD 5A0VA 1A2BA 2XVMA 3TD2A 4C21A 3PQCA 3T52A 1ZCAA 2CLEB 1YR9A 3GARA 4JJGA 4Q48A 3C7CB 5BVHA 2YZKA 4M8NE 1IN6A 4WLOA 1NQWA 4PZLA 4RA6B 2EZUA 1ECBA 3LT4A 4RLSA 1K3TA 5AW5A 4EMUA 2QRUA 1HZJA 2ILVA 3H2SA 1JIUA 1HDCA 2RBKA 4IEIA 5TPZA 3UMVA 3JQAD 3TXAA 2OGZA 4B4DA 4OX9B 1GCAA 1Q0ZA 4FX5A 4MR8A 2ETXA 2LKDA 4HGYA 4I3GA 4YH1A 3RS8A 1GFZA 3TAXA 4PFKA 2F00A 4OB6A 4QA9A 4EAAA 5KYVA 4ZCSA 3E7XA 1Q22A 3HEMA 4Z99A 5IXSA 1SQ5A 2HA0A 2PLRA 5IK2D 1F9EA 3K53A 4U2CA 1NLUA 1UK6A 3KOYA 1Q0RA 2W2NA 2IP1A 4TN1A 3WOVA 3ZU3A 3C7KA 3HBLA 4Z0NA 2IP2A 2VHXA 3I8XA 5F2EA 3B1ZA 2NPIA 4NCXA 1BMFD 2MMCA 1N5OX 4J4HA 1SOWA 3UOAB 1DKUA 2EX0A 1QDLB 2AFRA 3PD7A 4KNWA 4H4CA 3KLMX 3CUVA 2K7ZA 3W9SA 3FOFC 1HK7A 1KAMA 4O33A 1NN3A 2YVUA 2BEVB 3AM5A 3WL8A 1ISFA 4C1BA 4EGJA 3OQPA 1XZAA 4B71A 1Z2NX 4G0NA 5A6VA 3K1AA 3HKBB 3REFA 4UQOA 4CE6A 1C14A 2XNCA 2BFAA 3W7AA 721PA 2YXEA 1RBQA 4WZBB 3DEJA 1ZH0A 2GDJA 3A1SA 4HN9A 5DCYA 4N9WA 2AUNA 2YQ5A 3KKZA 1KYXA 2H57A 4OU5A 4BB5A 4CCWA 2H2AA 4RTLA 1QHSA 3NBKA 3QFTA 5HIAA 1U3WA 2CNNA 1SELA 4L08A 4C7OB 2X40A 4QAJA 3M33A 2D74A 2RSLA 1YZVA 4QXQA 1TIBA 4FTWA 4F60A 4HDRA 1J22A 4AW9A 5JYDA 4RH0A 4TXLA 4L73A 1EI9A 3OCJA 4G1FA 2A5GA 4L27A 5FTWA 2XB6A 5HK8A 4BAZA 3BGDA 1CUWA 4BV9A 3MT8A 2CVHA 4FINA 1L5MA 3LX4A 3FUCA 2FHPA 2H2HA 1FP4B 1CF4A 3OJOA 3ZGVA 3QPUA 1Q11A 1FTYA 4GI2A 3GJ7A 4UBIA 2Z0MA 2NZUG 5DFAA 5D5QA 4PC2A 1KSFX 4JP3A 1NHWA 3H1EA 3LUAA 3GQVA 2FEPA