1NW5A

Structure of the beta class n6-adenine dna methyltransferase rsri bound to s-adenosylmethionine
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
279
structure length
270
Chain Sequence
GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLRSYEIVEGAANFGAALQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION METHYLASE RSRI
publication title Structures of liganded and unliganded RsrI N6-adenine DNA methyltransferase: a distinct orientation for active cofactor binding
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
total genus 91
structure length 270
sequence length 279
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nw5A00
4PIMA 3EGVA 1I4WA 1SQGA 5K0CA 3LCVB 4EMSA 1INLA 2HNKA 1G55A 4P7JA 3EVEA 3DULA 5T6BA 1XXLA 5E1MA 4AX8A 3EPPA 1EIZA 2YUIA 3HVKA 3HA5A 2FPOA 4HGZA 4KW7A 5DSXA 3D2LA 3T7RA 3EGIA 2YTZA 4ISCA 1F38A 4QTUB 3X0DA 1X1BA 3OZTA 4LWPA 3KPYA 4XUDA 2QRVA 4U7PB 5K0LA 3B7PA 2PWYA 2YXDA 3AJDA 3DP7A 3PTAA 3G2QA 3UJ7A 5DM1A 1Y8CA 3C6MA 5KQSA 1RJEA 1YFLA 4CKBA 1JG4A 1M6YA 4CXMA 1M0EA 1RI5A 3C3PA 3I64A 4PONA 2YX1A 1JTEA 3DXYA 4YUWA 3B3JA 4BLVA 2LD4A 5K0BA 2E5WA 2I7CA 2FRXA 3ELDA 5FWDA 3LCUA 3BZBA 4RTLA 2GH1A 5E9WA 5EGSA 2QY6A 3M6WA 5D1HA 3UJAA 2K4MA 2VS1A 3EEYA 1VIDA 4JXJA 3M33A 2DULA 1TW3A 1EQAA 4KWCA 1FPQA 4YV0A 2IIPA 4RTSA 2OO3A 2IDKA 3LDFA 1R8XA 3HEMA 4X1OA 4QVGA 3DLIA 3TLJA 3JWIA 5EMJA 5DWQA 2NXNA 2QM3A 4PIPA 2B25A 3LHDA 5EHIA 4RTKA 3TPZA 5DXJA 2AOVA 5EC8A 3CCFA 5IH3A 4RV9A 5JUWA 3EVFA 2CL5A 4FR0A 5EZSA 4IV8A 2VP3A 1KP9A 3MTIA 5C0OE 1D2CA 5EIWA 2GA9A 2ZSUA 3K6RA 4AZTA 2ZZNA 4PGHA 5K0NA 3KR9A 2AZTA 3SSMA 5EVJA 1YUBA 3M4XA 3KPUA 4YMHA 3HTXA 1MHTA 3DXXA 2ZBQA 2P35A 3E7PA 4ZTBA 3KQOA 2BM9A 2B3TA 5GM2A 5T67A 4E33A 3CKKA 5HIKA 2R6ZA 2ONZA 3I9FA 3MAGA 3KQPA 3KQTA 1QAQA 4AUKA 3IYLW 3QOWA 1Q0SA 4PYOA 4PYLA 4PYJA 4FT2A 2NNWB 2NYUA 2BZGA 1L3CA 5LQRA 4RTPA 5KQRA 2AOXA 2YQZA 3GIWA 5HFJA 1N2XA 1ZQ9A 4YUZA 5LQNA 1KPGA 4RTQA 3EEOA 2ZWAA 3EVZA 2OB1A 3GRRA 2BR4A 5LQCA 4HH4A 5LQUA 3HM2A 2IBSA 5B1SA 2GB4A 4M37A 4PYMA 3ELUA 5DX0A 3JWGA 3GRYA 4E70A 2P7HA 1RI4A 2XVAA 5CVUA 1L3BA 5BXYA 2O06A 2NXJA 2P7IA 4GOLD 3BWYA 3O7WA 4P58A 3HP7A 3KPWA 2ZIEA 2IPXA 4X41A 3UJ8A 4DM3A 2HV9A 8MHTA 4LECA 2IP2A 4DA4A 2G71A 3MCZA 5DLYA 4OA5A 4MWZA 5GIPE 1FP2A 4WXHA 4ER0A 2YR0A 2ZIFA 4QTTB 3FPJA 2QRVB 2GS9A 3ELWA 3KQQA 1UIRA 7MHTA 5ICEA 2PX4A 2DPMA 3FRHA 3PT9A 4POOA 1QAMA 5ERGB 4YUVA 1VPTA 3V97A 3FPGA 4RSRA 5E1OA 5C9ZA 5K01A 2AVNA 2XYVA 3P8ZA 4DKJA 1IY9A 3TMAA 2UYOA 1BKYA 4GC5A 4NECA 3CGGA 1H1DA 2ZVJA 3G8AA 4F85A 3DH0A 2NXCA 5FUBA 2XVMA 2QE6A 3OCJA 2C7QA 1X19A 2ZTHA 4FT4A 5DT2A 1EAMA 3GNLA 2IFTA 1L9KA 4YMGA 2ADMA 3RODA 1QAOA 1KYWA 3B5IA 5KYGA 4OBXA 3K0BA 5FULA 4C06A 3PB3A 2FCAA 3F4KA 1ORHA 3ME5A 4EKGA 3ID6C 1O54A 3EMDA 3BKXA 2FYTA 3FYDA 4RVFA 2GAFA 3UWPA 4BLUA 3R24A 1HNNA 1ZGJA 3HVIA 1G60A 3NVKI 4GOND 4PWYA 2VDWA 3FPEA 4RVHA 3M6XA 5DM0A 4DCGA 4PNEA 4YUYA 1JSXA 4X63A 4E2XA 2UZ4A 2O07A 3AXTA 3OZSA 4HRAA 1QZZA 2V7EA 3FZGA 4X61A 5CUQA 1YB2A 2IH4A 2Z6AA 1RJFA 3A4TA 4OQEA 5LQAA 3C0KA 5CM2Z 2AOUA 5CVEA 4QVKA 5LQJA 3P71T 2WA1A 4YUXA 3KPVA 2P3OA 1JR4A 2QYOA 1SQFA 4R8SA 1SUIA 4RYLA 1P91A 3G2OA 1B42A 4P7GA 3SSOA 4PCAA 2BR5A 5EMKA 3EGEA 3E23A 2B78A 1VQ1A 2OBFA 5ICFA 4EQZA 1WXWA 3ELYA 4R6XA 2Y1WA 4V0RA 2C7PA 2BR3A 2PXXA 2OXTA 2I9KA 5FA8A 1R00A 1NW7A 1X1AA 4FGZA 1NV9A 3B89A 2PT6A 3P2EA 4HTFA 2ESRA 1MJFA 5FCDA 1JSZA 1T43A 4QQNA 5EMMA 3FTEA 4A6EA 4RTRA 1QANA 5DTRA 4CTJA 2R3SA 4KIFA 2OPBA 3VSEA 3ERCA 4L7VA 3UJBA 3UJCA 4QDKA 5K03A 2AN4A 1TPYA 3SMQA 4BLWA 2JJQA 9MHTA 4PYKA 3LCCA 1JQEA 3BWCA 2PX2A 1WZNA 3UA4A 1SVUA 1KR5A 3DUWA 3GRZA 2Z6QA 5GP1A 5BP7A 3FRIA 5EHGA 1TW2A 3OU2A 5P8WA 4CTKA 4DZRA 4GOOD 5E1DA 4GF5A 3T7SA 1NW3A 2UYHA 3SX0A 2JH8A 3UA3A 4CWAA 2H11A 4DCMA 5CIYA 5E2AA 4AZWA 1OR8A 1SUSA 2P8JA 3DTNA 5HIMA 3FUUA 1AV6A 2I6GA 4QPPA 3BWBA 3AY0A 3MB5A 2GLUA 4LG1A 3NTVA 4MQ4A 2VDUE 3BUSA 4GUAA 2O05A 3G89A 2ONYA 4OQDA 2P3QA 3TQSA 1KXZA 4F86A 3OFKA 2P41A 1WXXA 1RI2A 2N47A 3CBGA 3OPNA 3PS9A 2OB2A 4IKPA 5HZMA 2I62A 3KQSA 4OBWA 3DMHA 5DTQA 3GCZA 3GRUA 3P97A 1N7IA 1R74A 5EIFA 2EFJA 3HVJA 1VLMA 4H0NA 5EZQA 5ICCA 1I1NA 3BWMA 2PVCA 4EVIA 3R6TA 2AOTA 3GJYA 2H00A 5DRYA 5E9QA 3G88A 4DF3A 1JG3A 2G8NA 3THSA 4ER7A 3SM3A 3EVAA 1XTPA 2VDVE 3BXOA 4E32A 4ER3A 2AR0A 3AWIA 3MTEA 3OE4A 3NW9A 4XCXA 3TM4A 5DSTA 3SGLA 1P1CA 4EKIA 3GDHA 5FTWA 4FSXA 3DOUA 3FPFA 5GINE 5IKMA 2IBTA 3GO4A 4XUCA 4RTOA 5DXAA 2XBMA 4FS8A 4R8RA 3UFBA 5E8JA 5BW4A 2C7RA 2FHPA 3LBYA 3UJ9A 1YZ3A 3GGDA 4LWOA 4R05A 5EQJB 5T64A 1XCLA 1UFKA 4PYNA 3FTDA 3ER8A 2Y1XA 3BKWA 5F2NA 4C04A 4YV1A 5CCBA 3P9NA 1XJ5A 2AOUB 2OY0A 3B3GA 2AN5A 4AZVA 2YXLA 4GBED 3MQ2A 4BP1A 1ZG3A 5GWXA 3FUTA 4WVLA 3M70A 2PX8A 3FPHA 2C7OA 2JHPA 1SKMA 2PV0A 3FUVA 1DCTA 4C03A 1DL5A 2AN3A 1D2HA 4MTLA 2PWPA 2ZZKA 2PGXA 3TR6A 3KU1A 2ZIGA 4HGYA 4KDRA 1N7JA 5GIOE 4QPNA 2GPYA 3TFWA 4P7FA 1FBNA 1KHHA 3KR1A 1FJXA 2IGTA 5FQNA 3I53A 4O29A 1NW5A 3GWZA 3SVZA 1YF3A 3CC8A 4P7KA 2AVDA 4C07A 3NWEA 4HTFB 5GM1A 4XUEA 2O57A 1M6EX 5M5BA 4Y2HA 2PX5A 3KQVA 4BP3A 2PT9A 3LDGA 5KVAA 5E2BA 5FHQA 1JTFA 4B17A 3HCAA 3B3FA 5EKXA 4RTMA 3LECA 3VC2A 3P9KA 1KIAA 3KQWA 2CMGA 3MGGA 4CKEA 1RJGA 3A7DA 2P3LA 5K0EA 2ERCA 3UJ6A 4PYIA 5LR6A 4UOEA 3T7TA 3UZUA 3KPJA 1D2GA 3KR0A 3PLAE 3QOXA 1PJZA 3BGVA 5HOQA 2BH2A 5HILA 4F84A 3FYCA 5CD1A 5EPEA 5K0JA 1RI3A 3C6KA 5F2OA 2PLWA 3NVMB 3R3HA 2ZBRA 2ZULA 3ORHA 4RVGA 3PX3A 3V8VA 4ER5A 4MHTA 3LDUA 1JG1A 1JQ3A 1O9HA 4KDCA 5U4XA 3VC1A 3GXOA 10MHA 1R8YA 3HCEA 2ORED 2PY6A 2WK1A 1EJ6A 1JQDA 3P9CA 1AQIA 5HEKA 2EX4A 3HCCA 2NP6A 3HCBA 2KW5A 3G5LA 3ANXA 3NDIA 5F2KA 1VE3A 4E2WA 5K0FA 3LKZA 3NJRA 4M36A 4PINA 2XYRA 3KKZA 5C1IA 4ER6A 2BM8A 3R9XB 3A26A 1VL5A 2XYQA 1R18A 3O31A 4QQKA 1YZHA 5DX1A 2ZLBA 3O4FA 2AOTB 4PGGA 1XVAA 5CVVA 2PJDA 4U7TB 3RIEA 4E2YA 4OX9Y 3E05A 4YV2A 2P1DA 3KR2A 5KS2A 1G8AA 1ZHFA 4FP9A 3VYWA 3M6VA 1ORIA 2JHAA 2VZ9A 3OE5A 3A7EA 4G56A 4FSDA 3BT7A 1EJ0A 5EEGA 1VP9A 4DQ0A 3DLCA 2UYCA 2A14A 4Z2YA 3TKAA 3EVCA 2EJUA 5LQKA 2PSSA 2HWKA 3PFHA 1BOOA 3I58A 1G6Q1 3RW9A 1VBFA 1DUSA 4HSGA 5DTMA 3THRA 2EG5A 1X1CA 3HA7A 3LL7A 3LBFA 3PX2A 5JR3A 2ZCJA 5DRTA 5E9JA 1AF7A 5FA5A 3MHTA 5K0GA 2Q41A 2HMYB 2HTEA 4KIGA 1NW6A 2PXCA 3A27A 3TM5A 3FTFA 2B9EA 2FK8A 4M38A 3SR4A 3TKYA 5DM4A 2AS0A 1WG8A 3EVGA 1R6AA 2PKWA 5CVDA 2ZWVA 4C08A 2ZBPA 2O0LA 3BGDA 2IDJA 3M6UA 4M7RA 1FP1D 2F8LA 1U2ZA 5CVJA 3DMFA 3H2BA 1I9GA 3EVDA 3OU6A 2P40A 1WS6A 1XDUA 5H02A 5HIJA 3U81A 2G1PA 5FWAA 4PCLA 2V74B 1XDZA 3Q7EA 3LSTA 5K09A 1VP3A 2JHCA 4GOMD 5EOVA 1IXKA 1UWVA 3C3YA 1BC5A 5BW5A 2AOWA 5EG5A 3REOA 1F3LA 5G02A 3NMUF 3AXSA 3PVCA 5EKUA 3LGAA 1YFJA 1PRYA 2UYQA 3BGIA 3OZRA 4RTJA 2H1RA 4IWNA 3HCFA 4RWZA 2CWWA 2YXEA 3UBTA 3MCTA 3QV2A 4QDJA 2HR1A 1IM8A 1P39A 2CMHA 2PBFA 3EVBA 2B2CA 3G2MA 3LKDA 4A6DA 1KPHA 3NWBA 3DMGA 4E31A 5HIIA 1ZKDA 3G5TA 1P1BA 4CKCA 5MHTA 2YVLA 3G7UA 3T0IA 3GU3A 1KPIA 3HA3A 1NBIA 4MIKA 5GOZA 4C05A 5FHRA 3HVHA 1JG2A 1O9GA 3S68A 2ZW9A 3A25A 5DM2A 1X1DA 3JWJA 3G2PA 1NE2A 1BHJA 3OU7A 4GQBA 4KVZA 4PYQA 2ZFUA 3IHTA 3P2IA 4DMGA 4EK9A 3CJRA 1NW8A 2FK7A 3L8DA 2OYRA 2ZZMA 3PFGA 1KYZA 1V39A 3FUXA 3ER9A 2G70A 4V0QA 1WY7A 2JH9A 4E2ZA 2WA2A 2NXEA 3IEIA 5E8RA 3KQYA 2OZVA 3HNRA 1Q0TA 3JWHA 5EEHA 2Z6UA 3IV6A 3R0QA 1AQJA 2IH5A 4ATNA 4OA8A 1RJDA 3G8BA 1SG9A 4BY9E 1G38A 5LSAA 3I5UA 2EJTA 3EMBA 3LPMA 5K05A 1RI1A 5E1BA 3TOSA 2NP7A 3UJDA 2JG3A 2PXAA 5DX8A 4K6MA 5D1NA 5FADA 4E30A 1NBHA 1XDSA 1HMYA 4RX1A 1EG2A 3GRVA 3P2KA 3Q87B 5ICGA 1QYRA 1ZGAA 2CKDA 3KHKA 2OKCA 3HCDA 2G72A 1G8SA 3MERA 4R6WA 4FZVA 5K8VA 5CCXA 3CJTA 4GC9A 1NKVA 4IV0A 3E8SA 4RTNA 1XCJA 3WSTA 3OFJA 3CJQA 4HG2A 4C4AA 1NV8A 5FQOA 3DXZA 3KQMA 3FTCA 4X60A 3SSNA 3TRKA 3LX6A 1NT2A 3NDJA 5DPMA 3FUWA 4AZSA 2IH2A 3P9IA 1Z3CA 4KRGA 4RVDA 1L3IA 3SXJA 4GEKA 5EMLA 4HC4A 1L1EA 3CVOA 3DR5A 4Y30A
chains in the Genus database with same CATH superfamily
4C89A 4HQOA 4PAWA 1YZGA 3AVUA 1W2WB 3IT2A 3K70C 2AE1A 4KN9S 1RZ3A 4DGQA 2A9PA 1AY0A 2YMMA 1DKUA 3NETA 4CQLA 4PLCA 1Z3IX 2Z6VA 3L4BC 2F59A 1NUHA 2F1IA 3H75A 1AN0A 1GRCA 2YJGA 3PC8A 3UG7A 5DSXA 2YFKA 1EUQA 1EQUA 2W00A 2O3QA 3AF2A 3COWA 1JT2A 4TL6A 3WB1A 3DFUA 3IP7A 1U94A 1Z5ZA 2R1ZA 3DT9A 1ADBA 3F5QA 3OT1A 1G291 4RFSB 5K0LA 3V5NA 1NNI1 1SVSA 4C01A 2PWYA 4MYHA 3QLVC 1JA0A 4G24A 2JFGA 1OCEA 2NPIA 3RANA 5GONA 3C6YA 4D0LB 1I24A 1Y1PA 3FI9A 4QWMA 2ZYDA 2ZVPX 3O3OB 4OHUA 1MTZA 1MDFA 3I28A 4JJ6A 4GECA 1B3BA 1CPYA 1U3TA 3FGOA 1I1OA 1WF3A 4OJQA 1Z6TA 1ZOSA 3U4IA 4JSYA 3RC2A 1BD4A 16PKA 2WYOA 4ZVMA 1FYWA 1AMNA 1O97D 4G81A 1S1CA 3E8XA 2B8EA 3CUEF 4TS3A 3BCRA 1OXUA 3VPCA 2I65A 1P0PA 2I3DA 3BERA 2IYTA 3ECCA 3K9NA 3M33A 5EMNA 3KL2A 2J9ZB 3N53A 4W7SA 2CNOA 4CLOB 1ADJA 1O6GA 3C5HA 3U60B 2XXAB 3OOYA 2XZDA 4GEGA 1W49A 3KG2A 3WYGA 3I6ZA 3I39X 2EP5A 4XPZA 1W1UA 4BQEA 1B00A 3AW8A 4HX5A 3H2YA 4QNMA 1E9RA 3CGWA 3H83A 3KOUA 4Z9FA 4J2OA 1T34A 4WGFA 3VR2D 2NN3C 2VQ3A 3CF4A 1X77A 4MKFA 3MTIA 2X1HA 2E87A 2V6IA 3HI6A 4XCQA 3U7QB 4GKJB 4N6OA 5EVJA 4YAIA 1ZY2A 3HTXA 3LTNC 5IU6A 1VG8A 2OOKA 5FR2A 2Q9AA 3JQ7A 2CN1A 2Q6TA 1ECJA 1UXOA 2AG6A 1HDCA 5KJ1A 2B1JA 4JR0A 2ZI7A 8ADHA 5FO1A 3DV2A 3NHBA 4ZOBA 4AWXA 2A7QA 4I8IA 3OPYB 4CQNA 3P0IA 2PR7A 5F98A 1YOVB 2HRBA 4IDGA 4CCSA 4QXMA 2O8EA 1NF8A 4WA7A 3WDKA 3EFEA 1LF5A 1R16A 2ZRCA 1ZIPA 1U2GA 1GKLA 2QN6A 1BH6A 1KYQA 4LIPD 3U19A 3QPWA 4LWZA 1P2UA 2NSJA 4FYPA 4LCBA 4ZCRA 4G89A 4KG7A 1KYTA 4GMGA 4BEVA 5KNBA 2PGOA 3ZC3A 3U44B 1RLUA 1N1MA 2H5LA 2HBZA 2XTMA 4MVJP 1PTJC 4WECA 4AS3A 4UM9B 5LQAA 1OLSB 4QARA 2ENUA 4YRIA 4DADA 1LC0A 4L4YA 1UKCA 1DRKA 3AI7A 4GGMX 2AJLI 1L8OA 1OT5A 4N76A 4Q1DA 2Q46A 1HFJA 1ZW1A 2XQIA 2PPLA 2YHUA 3UJPA 2GCOA 3BZWA 1R8JA 3DA8A 5FPYA 4EYKA 5ED4A 4IG4A 4F93B 1PJRA 3AJEA 1MAHA 3N2YA 1G5QA 3R0ZA 1PGNA 1M8JA 2HIHA 4DNQA 2ES4A 3LRXA 3R6GA 1DAPA 2AYXA 3NEYA 3OLZA 3WWCA 3ZXUB 4ENRA 3OE7A 2O48X 1Z62A 4IH9A 1CY0A 4NYIQ 4OSPA 4MPPA 3IBGA 3TOZA 4POOA 5GGXA 3VKWA 1FU8A 2G4CA 3C1AA 4MUGA 4GX1A 4OBEA 4DR3B 3REGA 2P9GA 4BAZA 4KNYA 1P5FA 2GF0A 1Y7LA 3THOA 1DBQA 1XZIA 2MIIA 3ZLVA 3Q5EA 6PFKA 2OORA 2C7VA 4LW8A 5JSYA 5ALRA 3G8AA 1OIVA 3VTKA 4F4HA 3YASA 4RZ2A 4EA8A 4HNHA 4RK0A 4A8JA 3OP4A 2NO5A 3P96A 4JLOA 2CXPA 3Q72A 3RSZA 1YMUA 4PFKA 1XNHA 4TZKA 4V3CA 1JU4A 3PGMA 3LO8A 5HQJA 2E4UA 5IN5A 3R20A 4Z2AA 3CE9A 3DWGA 3OIGA 5FULA 4C06A 3CVUA 1XQ1A 4JHXA 5F64A 1QCYA 1RPAA 1ZM9A 1EWVA 2J9XB 3E5MA 4K8OA 1DTWB 4C7BA 3JALB 1VRVA 4U8HA 5J40A 2VN8A 2O0HA 4OGGA 4RGVA 3IEKA 1SXJB 1HR0B 4C2UA 4F72A 4KXFB 3DDCA 3R7WA 5IXSA 2GO1A 1QJCA 1T2EA 2IZ5A 4WK4B 4FJ0A 1NSTA 5AQ1A 3KT3A 2BGLA 3VZDA 1NOIA 1E77A 5TGZA 1WMAA 2H7YA 5GY7A 5SICE 4MYCA 3KXPA 4QX6A 1TUEA 2IYNA 2OCIA 4R01A 1YULA 5FBZA 4WX2B 5BN1A 1J0BA 3AR7A 2REQA 4JYCA 3KELA 5JNSA 1LSUA 4X5OA 3HPRA 2XYGA 4RYLA 2NVUB 1QYWA 4BNNA 4GXTA 4ND1A 5EMKA 3HJFA 4BZZA 5K0ZA 4OHRA 1L5GB 4WLOA 3BIFA 5IVDA 4JYZA 2EWVA 2WT9A 3GN1A 4GSYA 3HN7A 3AERA 4MR8A 4R6XA 1J25A 1FUEA 1OZHA 2R96A 3QKRA 4PFJA 4LVNA 4RMNA 1JV2B 3D7KA 4PC7A 4FKBA 2PKQP 5FA8A 3BGWA 4L22A 4PZAA 1IM2A 5THXA 4EUSA 2IITA 2Z5VA 2MYUA 3RG8A 3LP6A 2RHDA 4I9FA 5E2IA 4FCVA 4QQNA 1PT6A 4Q0MA 5SY6A 5JS7A 1WX1A 3M5CA 4I6JA 1BA2A 1HFEL 4CV3A 5JLJA 3VX4A 4H0CA 2YVKA 4OUDB 1VLZA 5EJ8A 1C1YA 1HE4A 3EVTA 1POWA 1IATA 1GKYA 1Q3KA 1R9GA 4O4JB 4E5VA 4W5TA 2Y67A 3IKLA 3LOQA 3MS2A 1QDUA 2Q6OA 3ORSA 3H11B 4FU0A 3BWCA 4R0MA 2Y1GA 3IV9A 4TKZA 4WBXC 2P68A 2PT5A 1Z6YA 5LU8A 4TT3A 3K70B 1B8UA 5EIEA 4KH0A 1CB7A 1KMNA 4F9GA 4JV5B 1Q84A 4D3SA 1G3MA 3OF2A 1L1RA 3NOVA 4EY8A 5CT9A 3T7EA 4AZWA 4LBZA 4NEHB 3B52X 4XWTA 1NQ5A 1SU4A 2Q8PA 1SHZA 3ST7A 1LK5A 5BPFA 1WW8A 1ISGA 1Z12A 1Q0QA 3P9SA 3L1VA 3NTVA 5F7JA 4D80A 3RJ5A 1X2BA 4RS3A 1FVFA 2BH9A 1KYIA 3PJGA 4K3UA 1JPVA 1O08A 1RP7A 1XVLA 3AIMA 2OB2A 5LDDC 4MXDA 1EFLA 2KS6A 4MWTA 3GRUA 3P97A 5BWLA 1ZCFA 3SVTA 3IEVA 4Y6OA 5DYNA 1Z0KA 3L6RA 4QG7A 3BWMA 4G1UC 5FYQA 1OC4A 3LQQA 3R6TA 3H2ZA 2P9FA 4K86A 4FDLA 4UXIA 2G8NA 3TKLA 3OLWA 5I9IA 3ZE2B 3UW3A 1SELA 4FIZA 4JKOA 3ZWAA 1E9CA 3KVRA 2X7JA 1ZDMA 3AT1A 2VCHA 3E53A 1A4RA 3PL1A 4I14A 2XOEA 1LDMA 3TM4A 3DOUA 3TR0A 3KEFA 2QTWB 4R8VA 5DCLA 1EVQA 3Q10A 4XI9A 2HU2A 3IP3A 4K6OA 2FX2A 4KAJA 5ELXA 4TVOA 1UAGA 1M5UA 3KD2A 4UMEA 3PI7A 2NQ8A 3BIWA 4G0YA 5BWMA 1H4TA 1D4FA 3I8XA 3VAZA 1RVV1 2JAWA 5AVXA 5LIRA 1XZAA 4J75A 3W3AH 4IHAA 1FA9A 4QFBA 3P9NA 1DAHA 1JZTA 2C5EA 1P5JA 2CXOA 3B3GA 1JKJA 1U5CA 3M4JA 3QLJA 2CBZA 1NBME 2FZGA 2GYWA 3T7KA 4YN3A 3ZBUA 4PR3A 5G3ZA 5KAMA 3H6KA 5IKPA 3AV3A 1TLLA 1JAHA 2FNAA 1DCTA 2NU6B 3AFNA 1I6KA 2B8TA 4QZVA 5AUOB 1N5DA 1NJGA 2VPYA 1K9SA 1KH3A 2WVHA 2PGXA 2ZYGA 3DNFA 3PSAA 5J2UB 2JAHA 2DPGA 1IPHA 1FVHA 4S1NA 3GOQA 2Y76A 5KX5F 1R6XA 1EBBA 3KR1A 3FF1A 4QOFA 1CQWA 2DHDA 4PPYA 2FFBA 2P2SA 3QKWA 1AKTA 4ZVTA 3SYLA 4EIWA 1RKVA 5C3UA 3O82A 2GHTA 2DG2A 1H22A 3AILA 4EO9A 4M0CA 4N8DA 1P4HA 2HCTA 3GT3A 3BD7A 3NHUA 4YMWA 5JALA 5L7TA 4YFVA 1N8KA 1T5DX 2A5JA 4INZA 5M2QA 1ZC4A 2FX3A 5IJ0A 4R1QA 4OHYA 1M2VB 2MYTA 5DXFA 3AI3A 5FWXB 1NN0A 1OPXA 1W44A 4A0RA 4UD2A 3QWHA 1BFUA 2Z9DA 1ZUHA 3K2EA 4CKZA 1FDWA 1Z45A 3RJ9A 4UUBA 3BGVA 5G0SA 1MQAA 4TTIA 5HILA 1IJKA 1M2JA 1PG5A 2GERA 2JD0A 2JFNA 4LCJA 5GOTA 3TOVA 3J81k 5B4VA 4KU4A 3B60A 2GRAA 1H5NA 3NVMB 4YJFB 4XDGA 5AVOA 1T5IA 3ER6A 3PX3A 2P11A 2R6JA 3PNYA 2Z1NA 4HMPA 1U0BB 10MHA 1BROA 1EUDA 1LNZA 1MJHA 4E88A 4KH1A 1IVSA 1IOLA 1D4ZA 1ZD8A 4O2BF 5C1DA 5J4LA 1C14A 4AI6A 1T24A 4NG5A 4BYGA 1PG2A 4RM2A 1KY2A 4MS1B 1VTKA 3U17A 4CDRA 4A5OA 4ERXA 2ZJ1A 5G0TA 3MTJA 3I5XA 1K3UB 4PINA 1DFIA 3LS2A 3P0RA 3IC5A 4R2HA 5A4DA 2XYQA 2D1RA 1UKVY 4MYDA 1YBVA 3K2IA 4EH1A 5G53C 3P2MA 1XVAA 3G59A 4QASA 4U7TB 1PAUA 5L3QB 1T4BA 5ESDA 5GGYA 2HWYA 2QI9F 4QULA 2KMLA 3ZH9B 2HC9A 1ZR4A 4FINA 2R60A 3FFBA 4LXGA 1P7WA 1L7DA 2IYOA 4BZPA 1OROA 1CD5A 1JHDA 1XA3A 1TT7A 1G20A 5JSUA 4MUHA 2UYCA 1FMFA 4QTZA 2QKYA 2VJKA 4P5DA 1YI0A 5FNVA 1AGXA 1JPUA 3PUJA 2Y3IA 1YXMA 4FPXA 4HZGA 4KVAA 3RLIA 4GRDA 3SS9X 3QKSB 1P1RA 1G6Q1 3TJZA 3PV0A 1P1KA 1CYDA 2VKQA 3V8BA 1Z75A 3W90A 4BBZA 5JJKA 3THRA 2EG5A 2OV4A 5HGJA 4OXKA 4L6CA 1NU6A 4KHPB 3BF7A 3O75A 3MHTA 2CYAA 3SWWA 4EYSA 5DBOA 1CS4C 1DARA 3AEYA 4KXXA 5JFTA 3TKYA 1JLSA 1A9XB 3EVGA 1HSZA 1IQ0A 1WKCA 2I7TA 1J09A 1HY3A 4DA9A 2NTYC 9LDBA 5JSZA 3DZBA 3NAGA 2A5LA 1N5IA 2NG1A 1BCSA 2Z30A 2IDJA 1AMOA 2DETA 4NCBA 5THQA 1GSAA 1W59A 2R8ZA 2WRZA 3G23A 3LYUA 4PHGA 3T15A 3WBFA 3UJNA 1ZJ5A 4ZRNA 3WMXA 1F8YA 2CHFA 3RFXA 1LWNA 3JQ6A 5JWHA 3JARB 1I2MA 3OJEA 2OGTA 5TGTA 2QLJA 2MSKA 2XMRA 3I6YA 1VKOA 4DBVO 3OU6A 3ZLJA 3GJ5A 5H1YA 2QLMA 3NKLA 5AOCA 2A9JA 2H9IA 4Y9UA 2YICA 1WXQA 1JAIA 1IXKA 1UWVA 3RABA 2WIBA 1RYNA 5BW5A 1IBMB 2C29D 2EJWA 2ODWA 3GPDG 2PBLA 4BX3A 2Q0XA 1SZDA 3KAQA 3LGAA 5KSOA 1GV1A 3LLVA 4WJZA 4YGXB 5AM5A 4EVQA 1PFWA 3WFJA 3JQAD 3LZCA 3SDZA 4L78A 5A2GA 3QV2A 4L74A 5JLAA 3M0EA 3VHQA 4P93A 3N8HA 3E3NA 4XXHA 3QBTA 5ICMA 4L0DA 4DJAA 1GGNA 2JFHA 3AB3A 1HZJA 1URPA 2OGSA 4CDGA 4X1IA 2UXCB 1O9GA 4I6EA 2W98A 1DJOA 4ZN6A 5BR1A 1KETA 4XQ9A 4PYQA 3QXJA 4DMGA 1S9DA 1ZAKA 4EK9A 2D0PB 1NW8A 2XQKA 1ODTC 3IAUA 5JMOA 2CW5A 3HDHA 3E5RA 3FUXA 1V39A 5DHAA 2I80A 3QVJA 1M6VB 3VDNB 4YWHA 3D1JA 3KE9A 1REQB 4J16C 2JJ8A 3FYHA 1KMHA 4CIXA 1Y1QA 2Y1OA 4ZXFA 5DNCA 3HSYA 2AXQA 4X93A 2F6RA 3SQWA 2I66A 3BCSA 4HPXB 4IIFA 2OECA 1SG9A 2MHCA 1J42A 1NOKA 2CYBA 3S2UA 2VHTA 1EXWA 3HBJA 1WB6A 3B8EA 1UOQA 4C3UA 3MLAA 3DTTA 1LU9A 3HB0A 4PSVA 4GKBA 3TOSA 1K27A 4E30A 2C0QA 4GLLA 5AKGA 3FBWA 1R6TA 1KRXA 2ZJZA 2QS9A 2PZAA 4LI3X 4KQ2A 3HDTA 5IJ9A 2OKCA 2PMDA 2Q6KA 1JX6A 1ODKA 5JJBA 1DE0A 4KDEA 1SC9A 4ZHQF 3HCNA 3D43A 3F96A 3OFJA 4AO8A 4DWVA 1T0UA 2IOHA 5FQOA 2G04A 4D25A 2H0RA 1M2EA 2OZPA 4FM9A 5JS8A 1YC5A 4IOJA 2J7PD 1RXIA 2REOA 5BYJA 3T94A 4BO5A 1A9SA 3NRBA 3NTLA 5CT8A 1CP2A 2RK3A 3OQHA 3KSAC 3KUUA 3GLRA 1MAAA 1JF8A 3P9RA 4DT1A 1NVGA 3OKAA 4BQNA 1CUWA 5F1YA 3F5DA 2VPIA 3DULA 5KTMA 2DGDA 3QW2A 3JZMA 1ACLA 5FIUA 2QJTA 2FPOA 1Q91A 4QEZA 1FLAA 2X4DA 5GMOA 1B26A 1PWHA 2BHRA 3EGIA 4M7WA 1UMDA 3O83A 4PSUA 1D6NA 1QFMA 4IXMA 3GLFA 1AUQA 5IVPA 5FR1A 4RSHA 2GBLA 4Q9IA 3OFNA 4DMRA 1J00A 2PU7A 4Q3OA 1N7HA 1Y8CA 5KQSA 1M0EA 2QQGA 3K0AB 1XDWA 1G98A 1LDYA 1KO7A 1PKXA 4IF6A 2NUTA 2EBWA 1HQKA 1O94A 3T7JA 4DLRA 1LK7A 2BFBB 2DR3A 2XF8A 4OK3A 3OTHA 5FWDA 3S2EA 1UPBA 2JIPA 3AY6A 3M7IA 3S8MA 1YZVA 4X95A 1TF5A 4LUCA 4KYUA 1LDNA 5TIIA 3M6WA 3DWEX 4ZVOA 4Q9DA 2YIDA 1YRQA 4XM2A 4YJ3F 1P4JA 1KI6B 2XWBF 4R4JA 4FC7A 3VKFA 2V97A 4Z9YA 1L4LA 2ZUTA 2PUWA 5ES4B 2B25A 2QGZA 1NVTA 5T8KC 1JU9A 1IWBB 4AY5A 3PLNA 5JUWA 3PEEA 4IDAA 3VNBA 2G67A 3AX6A 4PAGA 2GA9A 3L4SO 7MDHA 3MAAC 2ZZNA 2JEZA 3IUQA 2RI6A 3NT5A 3JVDA 4CQMD 3WYNA 2I4NA 4HYYA 3FVWA 5CPFA 3TXXA 3C3JA 5ADHA 4OP2A 1E0KA 5KWJA 4B3DA 1ZN7A 2ACKA 4YT5A 1VLLA 2AD5A 4PZCA 4IVPA 1BS2A 3LC0A 4U3JA 1I3LA 2I4RA 1FYXA 1EK1A 3JSAA 4I50F 1GWNA 1K1EA 1MOSA 4PYOA 5D3MB 3TZLA 4AF8A 4K9OA 3CLUD 3IAAA 3IPCA 4YMSA 1R66A 5EP3A 4EKEA 3AJ8A 1KPGA 3EJ6A 3UKDA 3MB8A 2LDXA 5JAZA 1AD2A 2IV7A 1PWYE 1YU6A 2FSSA 2UAGA 4IJUA 5F12A 2ECOA 2F2TA 2VYND 2RHHA 4FOTA 4P33A 2XMSA 2HEGA 3FAKA 2I6UA 2PGDA 3O84A 3BXGA 1ZGCA 1YVPA 2DFTA 4JT9A 3AEKA 4RJKA 2DKOA 2W2QA 3SYKA 2X1MA 4P3NA 4LVOA 3V4ZA 4QGHA 4WKGA 1GNPA 1MOQA 1G20E 1H23A 4HN4B 4KEAA 3CNNA 3ZKWB 5AM0A 3H2IA 3HQ4O 2XMPA 1D6SA 2P6OA 2QLTA 1PGQA 3DLAA 1M2GA 1PWXA 1TO1E 3FNGA 3LWNA 3DCNA 4IDDA 3LUKA 4OA5A 3MVEA 4C21A 1RZRD 1CUCA 4PRLA 4QTTB 3IULA 5DHFA 2DKNA 4XQCA 2ZSBA 5TT1A 3SIXA 3UAXA 3UWDA 1SEVA 3IRVA 2PX4A 3FRHA 1BVRA 3PXCX 3DZHA 3HU1A 1QAMA 1MORA 4PG8A 3T52A 3RU7A 3WKCA 1XD2B 3PBKA 3D1VA 3EGXB 3TLXA 5J1SB 2D5BA 4PTLA 3TMAA 2HX1A 1DXYA 3PG5A 3BWXA 5CYOA 1QC5B 1BW9A 3AK4A 1JMKC 2WZCA 1CSEE 1ZSVA 3ECSA 3U0BA 5CFRA 5EWMB 4YIKA 1SC3A 3HO1A 5DZSA 3WHLA 5CJJA 4DSTA 2DBYA 3K5PA 2WABA 2Z1DA 3VR6D 4AYWA 4OBXA 1JT9A 3RK0A 2G9VA 1N2SA 5I8PA 5KNDD 1LGYA 5C8DA 1GTL1 2V5AA 3L8CA 4O4HB 4HNUA 1VCNA 1J2TA 3RVRA 5IRCD 3X1KA 2MR5A 4YPFA 1VDZA 2OM2A 1ZGJA 4C9BA 5ARCA 2IGBA 1Z0SA 3O4IA 4MV8A 3UC9A 9GPBA 2JJ1A 3OZIA 3PP8A 4IIEA 3OC6A 3RIYA 3OY2A 1J07A 1JSXA 1J39A 2L42A 3B2QA 3D6MA 4IX9A 5SYAA 4O5AA 3MG9A 3BEDA 3OPVA 3PENA 4F7WA 5JJ5A 2HPHA 4OQEA 2WYIA 4UU8A 2A88A 5K2MA 1ENYA 2G4LA 5ILOA 2EBHX 2P9YA 4XH9B 1U8ZA 5CA1A 5T4EA 3PVSA 3CNLA 4FDTA 4G63A 3DXFA 3ZDAA 4C2AA 4U6SA 1JLKA 4Q47A 2P65A 5B58C 1K5GA 1BE8A 3TDMA 3EG5A 2J8ZA 4Q4AB 4EQZA 1OI7A 2XOKD 4OQFA 3KJZA 3K31A 3CX6A 4HDNA 2Q5HA 3TNYA 2I54A 2VJDA 3C1UA 4HN2A 1GM5A 1XQXA 4GSKA 3BH0A 2C7PA 3WZMA 1MC5A 3CEAA 4D7AA 1JWLA 1NV9A 4U7WA 2PZBA 3V7NA 5FCDA 3SCZA 4TOIA 1JSZA 1A98A 3ABQB 3ZV7A 3AUYA 1ZM7A 2ZSDA 2IQ5A 2EOAA 2R8BA 3I9LA 3PWZA 4FOOA 1PR4A 3GCDA 2GAJA 3GZNB 3SBEA 4KTTE 2WILA 4DLUA 1Y48E 1NKSA 1LB1B 2AN4A 4Q7LA 2X19A 1RCTE 4J9VA 3RC7A 3RUDA 1SVUA 2ATEA 2W4MA 4R71A 4DCUA 3SZLA 1JJVA 4C2BA 3NJ4A 5F7XA 1XCGB 1ZD3A 1UBGA 2X0NA 1VBNA 4CYMA 3JVIA 1ZNWA 1GA1A 3FMGA 3G49A 5TEWA 1ZXLA 1GPKA 2OG2A 4OHVA 4Z0PA 1DKPA 1DMRA 5HIMA 3TUJC 1E1QA 4FYYA 3FUUA 3NBMA 3WA6A 4WNAB 3TK1A 3E8MA 3B48A 5A6SA 5I7SA 1E2HA 1YDHA 2NUBA 2QSJA 1IL0A 1FFHA 1NASA 3G89A 3KAPA 4LS3A 3LC2O 5BRJA 2IPMA 4YY3B 1Y6ZA 3QXHA 4IRXA 1WXXA 3J80A 1XNJA 1AUVA 3LY7A 3JZDA 2IS2A 2Z58A 4BUJA 2GZHA 3B13B 4OI2A 5AJXA 1OW3B 3ONFA 3Q9SA 2IXTA 5B58T 3G0HA 3VR0A 1DAKA 1M74A 2DWPA 2RKWA 4CTNA 3IUBA 1JJIA 3K6KA 4ES6A 3V7UA 4NMWA 1BH2A 3R41A 3JS5A 4HAVA 4C4ZA 2E85A 5I5GA 1PGOA 1U2QA 2O7SA 3WKEA 3O4GA 2ZIXA 1PJ8A 3K0SA 4RH3A 2J6CA 4XYEA 4TS4A 1JHAA 1U8EA 3GDHA 1TIPA 5AVJA 5ADUS 5HVNA 3U3XA 2A0UA 2OBMA 3MS7A 3RCBA 5IUJC 4Z54A 1G9TA 5BW4A 4Z53A 3I6QA 4P32A 3EIEA 5DFAA 4OXIA 2YVAA 1WE2A 3SD7A 1TIBA 4AK9A 5J4HA 1IIRA 1QMGA 2P9HA 4P3XA 4IFEA 3TNJA 2WQ6A 3D8SA 1NMSA 1SKYB 1PR2A 1FNCA 4OMFG 4L5YA 2F62A 2NV0A 2OY0A 2YH2A 1L2TA 1YC2A 4MP3A 3MQ2A 2WY2D 4MR9B 4LQCA 4Y7DA 4Q9JA 2NAPA 2GBPA 2I78A 4C14A 3RRXA 3JQ8A 3AZPA 3GUYA 4MDFA 1FNMA 4YP9A 2CXXA 4ZI7F 4NOJA 4KIWA 5JTTA 1E1YA 5A3VA 4CM8B 2VC2B 2PWPA 4EPVA 3I1FA 4P7FA 4PFQA 2ZANA 1GA6A 2ET6A 1YJ5A 3MAJA 3OQIA 1P5RA 1I7QB 2WZDA 1YF3A 5FOUA 3G1TA 1EVEA 2AVDA 1DEOA 1A2QA 4MGKR 1NATA 2XW6A 4RENA 4ZTUB 3C8DA 3CFYA 3QVUA 4MUBA 4AWAA 5KJFA 1PK9A 4LHYA 1V4VA 1BHQ1 1RYHA 3JCZA 5AKLA 1DTEA 4C22A 4S1OA 1O89A 3O4RA 5DI3B 1CIJA 1CDOA 2CNLA 2D2EA 1PZXA 3B3FA 4HH0A 4YASA 5GVRA 1YACA 3TIXB 2CBGA 3X1XA 4Z1MD 3AO0B 4CEIB 4EB6A 3SF0A 1RCUA 1XQ9A 4J1SA 3W4KA 3JQFA 2Q5FA 1K8ZB 5K0EA 1RQXA 2ZJ4A 5GV7A 3KUCA 3QG1A 3T7TA 4R1PA 1ISMA 2NTNA 1I01A 2QTFA 4AF7A 4Z6KA 1BE0A 2FLVA 1N6LA 5GJCA 1VPLA 2GEDA 4HTAA 2WLTA 3QGMA 4DUGD 2XOXA 3R3XA 2QR2A 3B9PA 4M7OA 1A96A 1KFBB 2YWRA 3OKCA 4HS4A 1D3AA 3HCEA 4IDOA 5PNTA 2BFNA 4ED9A 5KOIA 2QRMA 1QJ4A 1QVRA 2ISSD 1QG4A 2YN4A 5TRTA 3RM3A 1N6NA 2QMQA 1TKBA 3AR6A 5FJIA 4AQ7A 3K1ZA 4LNUA 3B1KA 4M36A 3WL3A 4CG0A 3KKEA 2D7JA 1K3TA 4KITB 2P5UA 2VHCA 3T3OA 1YL6A 1S2NA 4QU5A 4JHLA 5CVUA 5C8YF 2C84A 2Q4DA 3UUFA 3AUTA 4BTLA 4MUIA 4CKWA 4XWWA 3ZH2A 1WU8A 2BGJA 3GFRA 3FOEC 3FWPA 2ISCA 4MB6A 2K7FA 1G8AA 1YD7A 4TKUB 3PQ6A 3WLNA 2JGAA 1Z15A 3B1XA 2HIMA 3I9OA 4N49A 1F2TA 1JYFA 4Y67A 4BNZA 4YVFA 3NATA 5F5LA 4OGFA 2QDKA 3SNKA 3AKDA 4J9UE 4UBIA 1N1EA 3MWEB 3ROFA 2QK4A 1KMCA 1EYZA 3ND8A 1DFHA 1C8VB 5DGDA 5KYUA 8OHMA 4KR6A 2XB8A 3KQUA 1ZCBA 3R77A 2J08A 2W8ZA 3TS1A 1P4SA 5FWYA 1EDEA 5EKTA 4JGBA 4WFQA 4LDJA 3H87A 3UGQA 1DJNA 3A27A 1E2PA 5KTNA 2P4SA 4FFMA 3A3KA 1CDEA 3KKPA 3TXAA 4GD3Q 4C6TA 4U02A 1JU3A 3TNDA 3D4LA 3IKJA 3PQ8A 1UPUA 3OQNA 3B3AA 1FP1D 1N2CB 2WKQA 5CFPA 1E5VA 3A6GA 2CLHB 3I9KA 4B3RB 4IJWA 4W6QA 1K5DA 2ZTUA 3I01M 3KEGA 1IAVA 2TYSB 3EBOA 1E3TA 1M76A 3NJ8A 5D3KA 3WGHA 5K8IA 1L5YA 4NBVA 4GOKA 4I2NA 4XA8A 4ZCMA 2FFJA 5BMVB 3WDLA 5EOVA 3TLCA 4FCCA 5EIXA 4R5HA 3H18A 1W85B 5PGMA 3WGZA 2QD5A 3QXXA 3BE6A 5IK2A 2F9LA 2NUAA 1TJ5A 2YHIB 1PRYA 2O3UA 3C48A 4OHOA 4TV8A 2A78A 4OKNA 4N8SA 4N3CA 3KHTA 3I2YX 3CA8A 5E6RB 4OG2A 5F73A 4MW9A 1UUFA 3K6JA 2VDPB 1OBOA 2P2YA 3ISJA 3CSSA 1SIOA 3SR0A 2GK6A 1XP8A 3L6CA 2WJAA 3EPJA 4H1VA 4Y98A 4C05A 1J8MF 2PMKA 3QX8A 3GZTB 5JANA 5EJIA 2IS4A 2AG5A 5J5CA 2J3EA 3ADDA 2VBCA 4IKOA 1QOZA 3N59A 1ESDA 4FE7A 2H6EA 1W5SA 2QX9A 1AKRA 1S01A 4KQIA 4ESOA 3BB4A 1C4KA 4PZDA 5IANA 3RGWS 2G9UA 3T9EA 2R79A 3I1IA 1T2CA 3VMMA 1DC3A 5B6IA 1GZHB 2QX8A 1AF4A 3RVNA 3SYRA 4S04A 2Z2XA 3TTUA 2Z6UA 3KKNA 2R85A 1HTTA 1Z22A 4MINA 4BNMA 3ONEA 4N5MA 2DFLA 1LRKA 2BV3A 1PR0A 1ETUA 1Y33E 3RK4A 1S8FA 2EJTA 3ACBA 1FTYA 3OIUA 3AETB 4G5RA 3DEJA 3QJGA 3DEZA 1BEEA 2W2KA 3SBXA 2Q2NA 2OXEA 3UJDA 1TT5B 3GRFA 1BDHA 4P5EA 5BRNA 1E18A 4RLHA 2HADA 3G6KA 1Q7BA 4RLSA 3O8NA 4NMLA 3W06A 1JDJA 1I2BA 4UBOA 2J9FB 3PHGA 5CCXA 1G8SA 1DFGA 4PZYA 4CV1A 4PZ0A 2WM8A 3CJTA 4MUJA 2VNSA 3EXG1 4RTNA 1XCJA 4Q9KA 2HMWA 5KB3A 3UF0A 2KM1A 2LVBA 3LZDA 4G5XA 5LB4A 5ENZA 1PX0A 3SLRA 4C4AA 2C1ZA 4CG2A 4GKVA 4LOKA 4M87A 4LSGA 1Z3CA 4QELA 5FKJA 4GRAA 4EYEA 2REXB 2BPOA 1XO1A 3PUXA 4MARA 2B4KA 3T54A 1JJAA 1VRWA 3AVXA 1MO5A 3WE7A 2AFHA 1V6CA 3EZFA 3WV4A 4BMSA 3FYUC 2JGEA 4MEJA 3UOGA 4M21A 1Z9BA 2RGRA 4OHPA 4V0OA 5FEMA 4BGEA 3V8QA 3RVSA 2EWWA 1Z7GA 2WG0A 4RABA 3HLYA 3TSCA 5T6BA 3AEQA 1T2DA 4NMMA 3BAFA 3C97A 1YK0A 2Z08A 1Q11A 5C7IO 2DPYA 5KTTA 4E07A 3SOPA 4F21A 1BN7A 4LDPA 3ZBQA 1GU0A 1XHLA 1GGHA 3DTVD 4O2BA 5CX1B 3T3DA 1JR6A 3UWKA 2QA5A 1W0JD 1WW3A 1Z8DA 2ZJBA 3WLFA 1TC1A 2YIMA 3ONDA 3MWYW 3MXOA 2FZKA 4JLUA 2QZPA 1KKMA 3TW4A 3TW8A 4B7UA 5LD2C 4B73A 3LPCA 1H3NA 1SKBA 1OTXA 4JDUA 4CXMA 2PIAA 1WVMA 2P1ZA 5HZGA 3DM5A 4W1QA 2AKEA 4DQVA 3SK0A 4P4SA 1X94A 1XEFA 1VYTA 4BLVA 2LD4A 4BNTA 3RTDA 3WI7A 1EK2A 2CUTA 4CT5A 3EXIA 1Z2OX 5IJXA 1AZTA 2AR9A 2GH1A 1S7GA 2Y71A 4MHOA 1UMCA 1OU4A 1YHZA 2HQ1A 4R1SA 4C3OB 4DMKA 4YCMA 3OZDA 3EEYA 2CXUA 2XSZD 4ZODA 1BKSB 4RD4A 3KKKA 5I7HA 3W7VA 2WZQA 1DC5A 4HJXA 3PE6A 2OO3A 2QZSA 2HHHB 1DKMA 5IXJA 3FFXA 3P19A 5HHTA 4OI0A 4L5JA 5AM3A 1ZMXA 1EP1B 1HORA 1ZNYA 3Q12A 5HX7A 2ERXA 4UXJA 1IPFA 3CCFA 3GFGA 1G42A 3IQWA 3RV3A 1N0WA 3ZWNA 1Q7GA 4QT0A 4AZTA 1GPWB 3GJ7A 3K6RA 4DLTA 4N7JA 3ROMA 4MS3B 3AFHA 3O4VA 1Z6PA 3M4XA 2G77B 3IT1A 4YMHA 1NSFA 1OZ0A 1JSLA 2IIQA 1XZNA 3CUVA 3VHRA 3VR2A 4WVFA 4ACBA 1PE0A 2C59A 3BPSA 5H81A 1YQ9A 4MA4A 4TUYB 4E33A 1LRLA 1P19A 3UMVA 2R6ZA 4IXDA 2BMVA 2IZ0A 3MAGA 4OMDA 3COPA 4RCYA 1Q0SA 2EXXA 2X8LA 4PYJA 1WSDA 2QRGA 1JVSA 2ECFA 2ZYHA 2HU7A 1IQPA 2YQZA 3QEJA 1X0VA 4PCVA 5LZ7A 2ID9A 3T06B 4CETA 2ZWAA 3A3PA 1O8BA 4QUAA 1JFRA 1Y7HA 1STOA 1PUIA 2ZYUX 3B1VA 3HFSA 3QEMA 3S44A 2IBSA 3O03A 4HAIA 4AL4A 2K6GA 3ICEA 3HRKA 1Z28A 2F00A 4GGOA 1MGPA 3BXHA 2AC7A 3NBQA 4HQ6A 1D6JA 3E35A 5IC6A 1QQAA 1GLGA 2OMKA 4FNAA 3IX7A 2I2DA 2NXJA 3QBEA 4NCJA 2AC4A 4XGQA 4GOLD 2VPPA 3BWYA 3E70C 4JQCA 4MPDA 4OTZA 1AK2A 3V4LA 3DBLB 2YS7A 3C8HA 4UQPA 2IP2A 3W78A 4MWBA 3VHXA 4A10A 2CV1A 3F5SA 4I8XA 1EFCA 1O2DA 3GUZA 4Q19A 4RVOA 4AY2A 3H2KA 3G9TA 5H0IA 1I94B 2ZSEA 2WWRA 1YE5A 4WXHA 1JDZA 4BL5A 2ZUWA 1WL8A 4KAFA 3JAMA 2XRYA 4FN5A 2BF7A 3AM3A 1CUJA 5ICEA 1X7ZA 2GN2A 3AJ9A 3PYLA 1BKDR 1FUUA 2Z2ZA 1MO2A 4DJJA 1JIKA 1NNSA 2BMFA 2KI5A 2XNJA 2C5GA 4KBYA 2A9FA 4L9WA 5E1OA 5K2OA 1E79D 4R2JA 2AXNA 4MDHA 3S70A 1BHO1 3VU1A 4RZ3A 3QNMA 5CCDA 3L82B 2NYRA 4AMZA 4HAUA 1LVHA 1Y1KE 2HMUA 3MW8A 4KZPA 2HI0A 1YK1A 1DO8A 2EATA 2X6RA 4C0SA 1YWGO 1ZVJA 2CFIA 1YO6A 4EECA 3QNWA 1EAMA 3KB2A 4K6GA 1IE3A 3EOAI 6REQA 2PLAA 1Q21A 4RSMA 3ZHZA 5BR8B 2HJSA 2P75A 3P1JA 3CLUC 3D0QA 5H5JA 2HU8A 5JC1A 3F4KA 3UAGA 2BCEA 3AR3A 1T9BA 1B0ZA 1ISHA 2F1RA 4UEOA 1GO2A 2IYRA 1VYVA 1EA7A 4IS3A 4MJXA 2DPLA 3DSRA 4OLJA 2BFCB 1T4CB 1VJGA 1XEWY 3I0NA 3HEAA 4YO8A 3ZCTA 4NQZA 1XQ6A 4ZHQA 3MT7A 2O6HA 5EXPA 2IYVA 4LYFA 3ZHQA 5J2UF 3BWEA 1DUIA 4E6EA 1VKHA 1K0FA 4X61A 2ZRPA 1KBOA 4DJDC 4K9LA 1J7JA 4MUFA 2GF2A 4NMHA 3W1WA 5TMPA 3R7SA 5ARDA 4O8ZA 1NA5A 4DG5A 4ZJZA 1PI3A 2SHKA 4KRYA 4ZC8A 1P91A 4P7GA 2MSCB 3HEBA 2ISQA 4KNVA 4UREA 2VEOA 3S55A 1KMQA 2YXNA 5ICFA 4FWIB 4ZGGA 4PXAA 1C81A 2ZYWX 3ZXYA 5L9AA 1Q0UA 2I9PA 2PT7A 4Q3BA 1RQ2A 3LT5A 4V0RA 3UK7A 2PXXA 1QRDA 4F8YA 2FN4A 3L49A 1NW7A 3U3MA 1UDCA 2JH3A 4ZZIA 3GLHB 1AKYA 2OO5C 3FD8A 1ZJWA 3ZKAA 5HF6A 1WQ3A 2O7NA 4MV1A 1YBHA 4WXPA 5FUYA 4F8EA 4LI0A 3JQAB 2XUPA 3MGKA 5DN6D 3TNFA 1XPUA 2B5VA 3E1SA 2ZRLA 3TLMA 1JJBA 2XRFA 3W77A 2IXFA 4HNQA 1G3UA 1W25A 5D01A 4ETMA 2JIBA 1PR3A 3A2MA 4PYKA 4IO0A 3NIFB 2GFQA 2VVTA 1M1YE 4QE3A 2CMFA 3LC7O 4UM8B 1ZI6A 4YJKA 5E4FA 1NJFA 3AB8A 1VECA 3FRIA 3FYUB 2V3VA 5JS1A 4A0SA 1U28A 4I4LA 3U4AA 3VO9A 4EW3A 1EUCB 2QYHA 2XUKA 3K9QO 3F49S 3LBIA 1DWQA 2H5IA 1VE1A 2PS0A 3BJMA 3JD3A 4IG9A 2WSBA 5DULA 4BQRA 2F3RA 2JD1A 2JEOA 4EJ0A 5CIYA 4DR1B 1JBEA 4B7CA 2WC1A 5KMGA 5C53B 3KZXA 3THXB 3HDGA 1YVEI 5LXTA 1MB4A 4N3NA 4YJ3A 2O05A 4OAPA 2ONYA 4YAEA 2GA8A 4HWOA 3N3BC 1ANKA 3WXMA 3OPNA 1R10A 3KFVA 4HDCA 4N9QA 3OPYI 3L04A 4WWHA 4OBWA 4CMAA 5SY4A 1GSHA 1SOWA 3DKVA 3DDWA 3FNQA 4B81A 1F1BA 2DQKA 4H0NA 2BMEA 3PJEA 3WKBA 3F7MA 2EZUA 4FYVA 4M0KA 3U4HA 4M54A 3VU3A 3N2ZB 2AFHE 3PRHA 5H4HA 3SM3A 2Z9BA 2RHGB 2RD2A 2JBAB 3PXBA 1RZVA 2W6JD 2CMDA 3EZ9A 4QIHA 1TKCA 2Q2QA 1S2IA 2X4LA 1B15A 1L8QA 2KX7A 1O95A 1NNUA 4LSZA 4YECA 4YFYA 4WPGA 3EF0A 1QHHB 4FSXA 4YJGB 2PGAA 5FTWA 1QPGA 1SKYE 2H2AA 5H16A 1UDBA 3AQ4A 1G21B 2EBUA 3KZOA 3PITA 1C7QA 4PGFA 4BRUA 5K45A 2XQVA 4I50A 3ZDXB 4Y6SA 3WGVA 4TSFD 5KU1A 1P2GA 4R16A 4ZOEA 3T1NA 2AN1A 1FSGA 1FLNA 1A4IA 1P6QA 1YDGA 4S0XA 4XD7D 3VOSA 3T5MA 4F1WA 2RK6A 4BGDA 2O2SA 3L0YA 4ROTA 3OLVA 1FPMA 1SHJA 3T0GA 4DVJA 2O2ZA 3D6JA 4GBED 2CNWD 3ZI7A 1THTA 5C8ZA 4NU5A 4N7MA 2QD2A 1KEUA 4O2LA 4E4YA 3RT1A 4QODA 3EF3A 3CEPB 3M6LA 1D1TA 5EUCA 2ZZKA 2HWWA 5KINB 2O7VA 4HGYA 4NFHA 5HK8A 4L8VA 1NQWA 2ZR7A 3GGPA 3WFZA 2X6QA 1ZINA 2CVPA 3H1AA 2PK3A 4ALJA 4TQAA 5COQA 4O29A 4JXXA 3Q8MA 1WKVA 4PN7A 1Y8ZA 4K28A 3F73A 3ZE6A 1F6DA 2IUFA 2YMPA 1FQOA 3PYMA 5GADl 1Y1RA 1SY7A 4GZ6A 3QVOA 4P1ZA 2VDLB 3NP9A 1KJ9A 1XMSA 3GQBB 3BRQA 4IRMA 3MJTA 1V47A 2PX5A 2AZMA 4J2HA 2PT9A 3Q0TA 5TPWA 2OV6A 4K6HA 2XGOA 4J3FA 3L6EA 2ZR9A 3A04A 5BVGA 4RHEA 2Y05A 5BN3A 2CFOA 4PG6A 2HA5A 1VL0A 2ZXEA 4WE3A 1PV4A 4PBSA 4MYUA 2PL5A 3CNEA 3COSA 3HL4A 5LR6A 3AEXA 2ZBVA 5FOTA 1OV4A 1C50A 4RAQA 5J9FA 3RVDA 3FMOB 4KWTA 3OLCX 4MVCA 1KDTA 3OZVA 2VRWA 4UUNA 4D9MA 1N8TA 3GT0A 2JGMA 1E69A 3TGPA 1B3RA 1B6RA 4O0LA 4MHTA 4F5ZA 5DW0A 2CK3D 1ZIXA 5CLQA 3AG5A 1OH6A 1FMJA 2GFHA 1AZLA 2JNWA 3I45A 3JQDA 5DNEA 1E99A 2WI8A 4OH1A 1TD9A 4NE9A 4TQGA 1K88A 2FDXA 5EJ9A 2JFBA 4HHEA 1GQ2A 1OHHD 2VXBA 2ZROA 1Z38A 3NOOA 5BVHA 3L1UA 4TVKA 2VQDA 1GDDA 1VE3A 4V0SA 3LKZA 2HWUA 5EE3A 1OXMA 4LZJA 4RULA 4DNFA 2B30A 3DVLA 4L76A 5JY6A 1RTTA 3EOBI 2KSQA 4E03A 2NZ2A 2AOTB 2EL7A 3O4FA 2NO0A 2OCPA 2BFOA 2H4WA 4UTXA 4HN9A 2P4UA 3KR2A 1NNEA 2C8KA 4XEHA 3PZRA 4JYBA 4C0AC 4KXVA 2FWIA 2XTZA 1JEDA 1ORWA 2ZGVA 3DJFA 3WLTA 4BWYA 5K9ZA 5EEGA 3H1TA 3TSYA 2XH8A 1Z5NA 3DDZX 2ZUUA 3DYVA 3OPMA 5AW3A 2HWKA 3RW9A 2VJOA 4NP6A 1U9YA 2F1OA 5EFOA 1VBFA 1NW4A 2QDXA 5CDUA 1BDJA 3QYPA 5CM9C 2PD3A 3FUCA 3ZYCA 4C6RA 3IQZA 5GJVC 4DDKA 2MTBA 3PDIA 2L69A 4V02A 3INNA 4EUEA 4UHBA 3TZKA 3W2GA 2VJPA 2HMYB 3HSSA 5B6JA 1YL7A 2D0DA 2W4IA 1KVQA 1JXOA 2B9EA 3CH6A 3Q3GE 3A9TA 1KDVA 4U2FA 4MVJD 3OIWA 1ZZEA 3DOEA 3WLLA 5KWEA 3RC8A 2IF0A 1G3RA 3QU5A 4KX3A 3EOZA 1HFWA 5BYBA 3R7FA 2NSDA 5JNTA 4EKYA 3WRXA 5JCOC 1QK4A 1N33B 3E9MA 4DRXB 4MKRA 3AHEA 4EGSA 2I6FA 5C52B 4CBVA 1PS8A 5FF9A 5TSDA 4MP6A 3O21A 1HL3A 1RHRA 1BWRA 1JFTA 2IU4A 3P9QA 4RY2A 2OD9A 4TXHA 3L1JA 2YN2A 5ALFA 5KVAA 5KYYA 2QM7A 4OOFA 3G7NA 4MDEA 2ZUEA 3CNOA 1QDEA 3FKSA 3A9SA 4R1OA 3FDZA 3QWBA 4RNDB 2FPPA 2ZJYA 4O63O 4R9UC 3TEJA 5CT4A 1II8B 1ADCA 5CDHA 5HQ3A 2OAQ1 3UGJA 4RGQA 4IWNA 1ESNA 4Y0NA 3TLGB 1OBCA 5I8ZA 3BQNB 1TRKA 1YKGA 3BE4A 4G07A 4AROA 2C92A 3UBTA 2H2GA 4NE7A 4Z86A 2P9BA 4JI5B 4Q1BA 3G2MA 1M9NA 3FBTA 4E31A 1V0JA 2RG1A 2NU9A 1YRYE 1ZIDA 4PE5B 2C2ZA 1SRRA 2OCAA 3JQ9A 2PO7A 2PGLA 2O20A 3RRJA 3TRHA 4OQPA 1Y4SA 3STYA 3VMFA 2FUKA 3W3ZB 5DASA 2QW1A 5E0OA 3OIYA 2M32A 3A25A 2FPIB 3G2JA 4LXYA 1BHJA 4Q1EA 1T0PA 2ZRMA 2OVFA 1Y8RB 3IHTA 3NT4A 3P2IA 1I13A 1Q7EA 4Q34A 2QTVA 4QJ5A 2BKEA 3ELBA 4QGGA 1COWA 1M33A 2C00A 2FUG6 3GFBA 3CRW1 4NBNA 4RELA 1MRZA 1Z0JA 2G06A 4EB8A 3VU9A 4CF7A 1MZVA 3G2HA 3U6BA 4N65A 1BIFA 1Q16A 1WY7A 3VYUB 2FLWA 1L4MA 1OXSC 1MPXA 4QXAA 1NI4B 2YCBA 3OEEA 2P6PA 4EWLA 1Z4IA 1MZPA 3IMCA 4EHBA 2WBLC 2Q21A 1TTPB 4X8MA 4ZI7A 3PCRB 1K5HA 1K6EA 1C3XA 2HCFA 3LLMA 1HDIA 1VHLA 2IK8A 3MGAA 3NVDA 1LJ8A 1RRFA 1TUBA 3ENVA 5C5IA 3U40A 5D86A 1C3OB 4CM9D 1RQGA 4ZOLB 4BO3A 3ODPA 5EL0A 2EQAA 2WOOA 2O54A 4YC7A 5ALIA 2I99A 1I0ZA 1ZGAA 2OV3A 4RH0A 4WKNA 4D9KA 4YRQA 2A0FA 3O2SB 4EPYA 4MHSA 1E4EA 1PEAA 3MERA 3DHWC 3RH0A 2EX1A 4JR1A 2X4GA 4PQGA 2FDCA 5DHTA 3V8MA 1V6AA 3ZS8A 1QLJA 4BFTA 2OZKA 4MV4A 2JAUA 2R4QA 4CTOA 4CMJA 1Z29A 2QTTA 4FD3A 2FSGA 3ZYZA 1ZITA 1R9JA 2ZUBA 1UDXA 2BKVA 4RKFA 5MDHA 1LLUA 3PSHA 1L7OA 1L3IA 3QPBA 4D3DA 3HUDA 2VF8A 2CFRA 1K7FB 2QRZA 1I5OA 1SUEA 3AP1A 2WAMA 3EBLA 3HP1A 4HSEA 2VNAA 2ZATA 3D8BA 4PIMA 2GLTA 3KZKA 4V2UA 5EZYF 1HG0A 4N0MA 4ZEOA 1EVZA 1O6FA 2C2YA 2PS1A 1OF1A 3NGXA 1PJQA 2D54A 3KJFA 4ZA2A 3ZGLA 4ARIA 2C9CA 2YJ4A 4G97A 3ZJ5A 4P7JA 2B92A 4K7JA 1RWOA 3SY8A 2Q4RA 4RPKA 1B93A 2YUIA 2AMLA 3LRTA 4L9RA 4PZ9A 2C5AA 1GYPA 6GPBA 5AWFC 4DWWA 4CT0A 2CLKB 4ISCA 1XTQA 3E61A 1QLWA 2DLNA 2QNBA 4RA9A 2RIRA 1ZBQA 3AI1A 3EUAA 3KPYA 4XUDA 5LMZA 1HZZC 1VPDA 2JIMA 3PZBA 3JD1A 3ND7A 4GLFA 4CL8A 4EHDA 4ABTA 1EE2A 5A03A 3D59A 1O0CA 3OTWA 1SZCA 1V26A 4LXIA 3S0JA 4B84A 1QRSA 2YWCA 2CWDA 2ZIZA 5AXDA 3VJRA 1YDMA 5C8YA 1L5HB 4PAQA 4CKBA 4QEKA 2HDNB 3V6MA 1HLPA 1TFRA 3UTCA 2FRVA 1VE5A 3I64A 4HEA1 1JTEA 4BNFA 1SA0A 5IVHA 2WT8A 1TU3A 3B3JA 2NSYA 3QQ5A 1N9ZA 5LLTA 1GG2A 2WWYA 4OCZA 4I5FA 3JPWA 4I08A 2V7GA 1ZJ4A 2NW6A 5JPCA 1A04A 1E0SA 2ZI3A 4H9GA 4ME6A 4OFWA 3LX4A 4XM0A 1Q19A 3K35A 4M2LA 4B09A 5F7ZA 4QO8A 4DIBA 2DRIA 2JIZD 4DARA 4EY3A 1TOAA 1VKNA 4ZVQA 5B1HA 1DCFA 4LNAA 1C8KA 4C6SA 4P3KA 1EM8B 2H4ZA 4AZ0B 4BQFA 3KLPX 3L7YA 3PWTA 5ETJA 5JRJA 3QEAZ 3O8QA 3DG9A 1K66A 4ZI5A 3W8EA 3OFSA 3TPZA 2HRZA 3BICA 2WJHA 2O2JA 3LVQE 4G8DA 4N7RA 3WNBA 2C07A 1LA2A 2EJVA 3DR3A 3QMVA 4AICA 4B35A 2JLWA 4IMPA 5BYAA 5K0NA 3CZAA 1DKNA 1VL6A 1YUBA 4RFSA 2H16A 4TM7A 4X97A 3HLKA 4AZ3B 3ZIUA 1VMIA 1A76A 2H0QA 3C70A 4PBTA 1AGNA 1U8XX 3FNIA 1ABEA 4H16A 4OU5A 4ZMRA 1QM5A 1NPDA 3OWHA 1C5KA 3GPLA 3BK1A 1LK0A 2O0KA 3G6WA 2DWCA 2JFYA 1MQ9A 2OP0A 1Y81A 2YWXA 3SHOA 3OTGA 5IUKC 3CUKA 4JUCA 2HEIA 2Q29A 1HE2A 2VHVA 2R9VA 4PICA 2OA0A 3NHAA 2EYUA 2VTEA 3N8NA 4CGYA 3IMGA 1DHRA 3GRRA 3BRSA 1PJSA 3HM2A 5AJYA 4K03A 4HJRA 3WDSA 4CR8A 1S7CA 3BXPA 4FR2A 3HL0A 3S5JA 4DY4A 2CF6A 2XZPA 5J5AA 4Z7NB 3O8RA 2A9QA 1OAOC 4YRCA 2I7VA 5A7GA 2FGKA 3W3AD 5HOEA 2VEDA 4RKEA 3U3DA 5H3LA 2XVAA 3H9CA 3C5VA 1A9PA 1T2VA 2EIHA 2VOEA 3K8YA 3GVIA 1XEXA 4UUMA 1NZJA 3WKDA 4F6RA 1KDOA 3EW7A 4P58A 3KPWA 4QJIA 2IPXA 1VLHA 1NQVA 1T8RA 4L0CA 5F5NA 3CNBA 2H1FA 1SPBS 4IH4A 1Z4JA 3G82C 3T4XA 1CY4A 1RYFA 3DQQA 4IEIA 4RESA 3QMMA 4GMFA 4XAQA 2BAGA 3TLKA 3TUIC 4ZMSA 2E37A 1YB5A 2FW7A 1ZVKA 2FSPA 4IOMA 4G86A 4NATA 4H7JA 4OOEA 4DYVA 3PT9A 3VDXA 1FZTA 5ERGB 3V97A 3PNQA 4GBJA 1RZRA 3REQA 4IVQA 1IY9A 4MRMA 5CYGA 3MCVA 4EJ2A 3MJRA 3P52A 4X7RA 3OPYA 3IKMB 2D7CA 4F85A 4MSUA 2ZOSA 3C39A 2XVMA 2ZAMA 4GIBA 3ZCUA 3L40A 2A9OA 4ZAFA 5FBWB 1TA0A 2I3AA 5JD3A 4AN1A 3D8TA 1CUBA 1GV0A 1YNOA 3PPIA 4ZEMA 1Y8QA 4MWDA 4HMOA 3CX8A 4NE2A 2J6BA 3MWGA 2QZ4A 2E4VA 3CN9A 1A69A 1TYZA 2YC4C 3WGKA 2BBWA 2P78A 3ZHSA 2WJIA 4NXMB 1ZEJA 1NDHA 3G85A 1OBFO 2Q1SA 3AB7A 3R24A 4R40A 5ULLA 4BU0A 4PWYA 1Z68A 1A9RA 1JLMA 1RRKA 3ONVA 4PNEA 1P1HA 4EUKA 2FE1A 3P5SA 2GBCA 4TLBA 3WB0A 1XJQA 1Z6GA 3FNBA 1R8SA 3DZFA 5IKOA 5MF6A 4B6QA 1XMOB 3F8TA 3RI3A 1YZUA 1IJBA 4MVXA 1QHNA 1F0NA 2QQEA 2WA1A 2GM9A 1JXQA 5A5EA 2GASA 1R64A 3RS8A 1JHVA 2IEGA 3UANA 1JDSA 1JJ7A 3GWGA 5K3BA 5JZSA 3GLHE 4C4OA 2VJAA 1FE8A 2VZEA 3DWFA 1WMSA 3K5WA 1UC9A 3MS4A 2IVZA 4Y2VA 1E2NA 4BFZA 1CNFA 1I7SB 2RHCA 4DZZA 3NM4A 1P33A 2PUBA 5DV9A 1XPOA 2WWXA 1N92A 2AIRA 2Y1DA 4KPUB 4HTFA 1OYVA 4BMXA 4F5WA 1RWNA 2YJTD 4LJYA 5EMMA 1EUZA 3LHKA 4FEAA 5ALTA 3U4MA 5HR5A 3ERCA 3ZE9A 5BWOA 3HKBB 1OX5A 2R7MA 4WDQA 3WAKA 3ESDA 5KSZA 1NVVR 3SC4A 2GKOA 4QDKA 5K03A 1MC4A 4BLWA 1JKXA 4MWEA 3L05A 4KXLA 1RBQA 2PIDA 2PKQO 2DFPA 4YK7A 5EYPA 3SVLA 3P45A 2VHEA 3R0VA 4PPNA 1SXJA 2QAIA 2W90A 2E55A 2PZLA 1UJ2A 1H2FA 2BBOA 2VSNA 3OU2A 5EHGA 3ZD9A 4B74A 4B3MB 1N2HA 1RAFA 3C45A 1W4LA 1HOTA 4D02A 1NW3A 3V7YA 1GLVA 3EZLA 3G9ZA 4GOJA 1AXRA 2PUCA 4AJEA 1DC7A 3DT6A 1YE3A 2ACWA 1RJ9A 2CJWA 2J6HA 3FPLA 4EMTA 1CVRA 1M1ZA 1C0KA 1AV6A 1KI7A 3MB5A 1S1MA 2GDZA 4TTPA 2SBTA 3O1JC 1GAWA 1BDMA 1L6RA 3EGOA 4DSNA 5EUMA 2W2LA 2WJGA 3PQDA 4HZUB 2P3QA 1GCGA 2NVUA 4NBWA 4X54A 3EPLA 3CPJB 3H2JA 2Z2JA 2GD1O 3DMHA 4UHJA 4DDTA 3IALA 2W2MA 3PC7A 4N47A 5DNUA 1RVDA 1NVEA 5EIFA 2X23A 4DCTA 1X7YA 3PQCA 3JQBA 4MCIA 5EZQA 2PUJA 2OG1A 3NONA 4FFBA 1XJWA 2WUGA 3BK7A 3L7JA 4QTXA 1FFEA 1S2GA 3T1TA 1M0SA 2IF2A 3SI7A 3BXOA 2QP4A 3HJRA 4YACA 4YRKA 4MULA 3SKXA 5I9BA 4OKSA 1BXKA 3HKCB 2WMDA 1FVOA 2OCLA 5H3CA 3OTIA 2R2AA 2HCJB 4BP9A 5A3SA 3H11A 2QAJA 2O8BB 2G0NA 1CRLA 3PDUA 3MUNA 2H85A 1PFUA 1EI9A 2BEKA 2PUHA 3WIVA 1K9VF 4L85A 3ZX5A 2JLRA 1Q6YA 3EUWA 2J5QA 4ARZB 5A6VA 3H8JA 4X00A 1JKMA 2MT9A 2FPKA 2PJRA 1PSDA 4II2A 3GLKA 3BMQA 3LQYA 4R2LA 4KKVA 5ALMA 4B6FA 4BZWA 4B8WA 2YWFA 3SFZA 1BWPA 2YINC 2EW1A 4MJ3A 3KSMA 1E3JA 3G0GA 1P7YA 3KU1A 3HK2A 5EERA 4HUQA 4RMJA 4QPNA 2GPYA 2K5UA 4PCUA 3KVNA 3PLRA 4EVRA 1AOXA 1GXSB 5FQNA 4CMGA 3CO5A 5KKNB 5EXEA 1I1HA 3GDGA 4NESA 1TM5E 3Q8XB 1QV7A 4LCEA 1K92A 5CFLA 1Q3HA 4HZIA 3SS8A 4V38A 3HM9A 1JEOA 1UBLS 4AY3A 1GFWA 2WG1A 1Y7IA 4JEMA 1PLKA 4UPDA 3MPOA 2V59A 1IVNA 1TEHA 4FONA 4RVUA 3AUSA 2CMGA 2WWHA 3ZHTA 1SCIA 2DQZA 3ZWMA 5FOSA 3K1AB 2QUKA 1TCCA 3EQ7A 2TMDA 1ULZA 2PMBA 4ZV7A 4JBGA 2P4QA 2ABWA 1Z5UA 2Q3EA 3QOXA 4WOKA 4Z1MA 3TAHA 3OI7A 4IDQA 5CD1A 5CLIA 2L2QA 1B0PA 3AVOA 1IULA 1TRHA 5A3JA 3JVVA 5JI3E 4CIAA 2PLWA 4MUYA 4TN5A 4WBNF 3ORHA 2R6R1 4LMPA 3FB4A 3WJAA 3PKIA 4A5SA 4A8HA 3KU4A 5HGXA 1U7ZA 2VPTA 3G13A 2OLKA 2NU6A 5E38A 4HDQB 2EARA 2JLQA 4B6GA 2QNIA 3E03A 3WMGA 5JSHA 4QECA 3DO6A 3NWOA 3T1YB 3HCBA 2KW5A 3G5LA 1Y82A 1U7WA 2P2CA 4PZUA 4QSMA 2WD8A 5F2KA 2O3JA 3RU3A 4DCVA 5JQGA 5J2UA 3WNCA 2DBZA 3BD9A 1YQWA 1Q1EA 4QQKA 1H8HD 3A36A 3NXSA 3RIEA 3NEPX 3MTDA 4RHFA 5CNJA 5DVZA 3T5DA 1SCBA 5JPIA 3GLUA 4ALLA 3NDBB 1VJDA 4LXQA 2FEKA 1E1DA 2WTEA 3LG2A 1E2LA 1NZDA 1H9AA 3N05A 2FSVC 1VP9A 1AXEA 3JYQA 3V48A 1KY3A 1KC3A 1NYLA 3DLCA 3FNFA 3U7EB 4J4BA 1X15A 1C2YA 4FFWA 5JSKA 1Y5NA 3MK31 2BM0A 5LQKA 2X8WA 1WWKA 3PFHA 1E9SA 1RKXA 3L07A 1IAQA 1YQQA 1FW6A 3OQMA 4H17A 3TTSA 1PHRA 2EG9A 3MN1A 5HF8A 3TIVA 3SHVA 1XTTA 1E1RD 5KQPA 3HA7A 3PFBA 3IODA 4FW9A 1AB6A 3FOBA 1P74A 3DCIA 3FH0A 4FGSA 1DQYA 1AHPA 4EENA 4D45A 2ZRGA 4YJFA 3SZ3A 2NU8B 3PEFA 3WADA 2BRUA 2I4MA 3EWNA 2C8JA 4EZIA 3WGQA 2GUGA 5JSQA 1TJ4A 1LBQA 4M8SA 1AGYA 1B8NA 3G8CA 3RYIB 4QG3A 4JSTA 4ITVA 3AOEA 3GA7A 3CPHA 1PJCA 3M1AA 4NVRA 5DJ5A 3RF6A 2V65A 2C9BA 3VZQA 1IVYA 1WPGA 2PYIA 3E2IA 3OEHD 3VXKA 1N8NA 3WSVA 3KOZA 4ASUD 5JVDB 4N39A 1IHPA 3KKMA 4C7VA 2Y4OA 1PT5A 1R0YA 1IOZA 1FXWF 2WWIA 2WYVA 1H2BA 2FMKA 3G9UA 4DQUA 1DGQA 1IQUA 3TCKA 1M7GA 3DW1X 1NN5A 3RHZA 5EG5A 5A62A 3V1YA 1K75A 3PEVA 4ZJPA 3I62A 3WO0A 1I2AA 3SN6A 2FAXA 1RWWA 4YLYA 2DHQA 5HKOA 1CJKC 2W0MA 3MFQA 3WS7A 1E94E 1HRDA 3QKSA 4HWRA 4RXMA 3E3AA 3ITNA 2VLIA 4RHUA 1V11B 2FEMA 2PEYA 1OFVA 3FKQA 4J0JA 3GRCA 4FFPA 1AZWA 4B3GA 1YZQA 3P0EA 5HIIA 4CKCA 5CTJA 1VE6A 2V7QD 3A4IA 3R76A 1T26A 3GU3A 5A4IS 2GXSA 4X3OA 3LW8A 4YDHB 1ACMA 5ER6A 4YHHB 3K0FB 3S68A 5NLLA 1A9XA 1ABFA 5K3OA 3HFJA 4ALNA 4KVZA 2B4YA 3MJHA 4YRSA 2C54A 4X24A 2XT6A 1FYFA 4AN0A 4XJXA 5BUQA 1SURA 2IV3A 1QGED 2AQ8A 5B53A 1CC1S 3JARA 3IDAA 4GPBA 4TUYF 3V1NA 5KTOA 2F67A 4YJ2F 4QREA 5KOJB 4YT4A 4DUZB 1MLDA 3RREA 4BX2A 3M89A 4W8HA 1Z2PX 2XCTB 4HGRA 4P3YA 1RJDA 3GEPA 2R00A 2Z43A 1QIMA 3I5UA 1GPUA 4KUHA 4FE3A 3ZY3A 3UT6A 4W5RA 1XZPA 4U7HA 3NGLA 1CZOA 2FW1A 1PR5A 3QF7A 3RFCA 3QLUA 3TO5A 2LGJA 1NBHA 3ETHA 5IP5A 1BFDA 3NDPA 1EE1A 2P67A 5FBKA 4PSDA 4FEYA 3EQZA 4JJ4A 1HLGA 3TD2A 4BO8A 1QWSA 1V7PC 4GC9A 1FDRA 1W52X 3UPDA 3GQVA 4RIGA 1FP4B 1I10A 5D5QA 3WGOA 2WR8A 2R6FA 3T3NA 2CE7A 3GMIA 4R0NA 9ABPA 3T4PA 2D1QA 3M9XA 1IUOA 3GVPA 3IDQA 3NNNA 2WTAA 2B5OA 3P7MA 3AYXB 1F2DA 1YT5A 3SXJA 2I4LA 1S2DA 2AUMA 2J48A 5EMLA 4DCPA 3W2TA 3CVOA 4R9NA 5H82A 2J30A 3EC7A 4KL8S 3NIWA 4K1XA 4IZHA 4IQFA 3MJEA 4HNSA 1A7JA 4KMMA 4DCSA 3E2PA 5IAGA 4WERA 1DWUA 2J6IA 1NXWA 2VF4X 1NUUA 2OFFA 4DXAA 1I2CA 1K86A 1REQA 5L3SA 4KQJA 7YASA 2C4UA 5TY0A 4LZOA 3SU8A 5JAIA 2O9JA 4TRNA 1ZHOA 4C1NA 3GMTA 1O03A 1XTVA 4L8WB 1N2ZA 1ZUNA 1FDOA 3N6XA 1NBEA 1D9XA 4RF4A 5REQB 2R8YA 4B3CA 4G4IA 4LY9A 4CCWA 2QRVA 2VK1A 3V9PA 2HJRA 4YP7A 2JCXA 1M8GA 1EJBA 1UZUA 2YXDA 1UP6A 2QPLA 3DP7A 3LW7A 1J2JA 4LZNA 3V9AA 3PTAA 2R7AA 2BTQB 2NO4A 1H2YA 2OHIA 2OZLA 5EXTA 4A3SA 4B7AA 3I72A 1DX9A 3ASYA 3G68A 4LYJA 4J7CA 2YWJA 5C5CA 3DTVA 5CB8A 1DJMA 2VZLA 3W5IA 5EN4A 3LVBA 1J8FA 2O8FA 1XVTA 3CINA 3W5JA 1T13A 4JEIA 2WSLA 2A9RA 4GH5A 2NPFA 3TMYA 5JYBA 4CIYA 3FDIA 3R4CA 3N8GA 3HLTA 1I4DD 4KI7A 2PZGA 4KO2S 4Q1CA 5AIAA 4EGAA 1PEDA 2FZLA 1DAEA 3KBBA 4UNQA 1SVWA 3UICA 3ZCRA 2A35A 1SBYA 1Z33A 1IOWA 1OZGA 4G67A 4CL3A 3PHCA 3F4LA 4Y2YA 4EX6A 3LPDA 2KBFA 1QK5A 3NLLA 5KYWA 1H0HA 3FOWA 4PTYA 2Q62A 4X1OA 3IUPA 2DHRA 5DGCA 3NH9A 2H9AA 3JWIA 4FS3A 3ZE1B 3CX4A 2II6A 1ICEA 5AW0A 3ZHBA 4BBPA 3FOCA 3TBKA 4DCNA 4RPCA 4W7HA 4HK4A 4RY8A 1GU7A 4ZQBA 3T5BA 5I9SA 5LYJB 1A4XA 2A9VA 4FR0A 1QPZA 5ALWA 4WY8A 5AYVA 3SZUA 4DMLA 2J0EA 1RWBA 4A1OA 1KZHA 4CG3A 1YVRA 2V0NA 5ALVA 4N1AA 3N2KB 2OHOA 1NVDA 2RBEA 3KPUA 3KYDB 3MBKA 2G3YA 2A1UA 2A59A 2CHEA 2P35A 2XUZA 3H3XA 3HU5A 1O9BA 1RAGA 2W6MA 4GWKA 1OWLA 3ZV4A 2XCSB 4ESVA 3E27A 3KWFA 4KR3A 2G09A 2XT0A 3I9FA 2AEEA 5HRAA 2OGWA 5LZ4A 1C3JA 1TGVA 3GJQA 3RS5A 2V5VA 2H8GA 4BZXA 4YAKA 1DDOA 5BY2A 4MQBA 2BFBA 4EYQA 1U8CB 2JPDA 1K08A 2WTBA 1ENOA 4JODA 1P8AA 4JROA 3EXFB 2R5WA 3C7CB 3NI2A 1FS4A 1XXHE 3CLSD 3Q7SA 1B14A 4U2KA 3TL6A 3W5HA 5LQCA 5A0VA 3AVWA 2Z98A 3ANLA 3VNAA 4OFZA 5D84A 1U9IC 1Y5IA 2UZ0A 2QEQA 3GFTA 5BXYA 1T3HA 2WSYB 5TE9A 3MFYA 2VTBB 3VFDA 3SQOA 2G5GX 3RHSA 3DF9A 4EPWA 2HYIC 5LC1A 4OXRA 4BC1A 4QXRA 4BJ1A 4GLOA 1SXPA 1OTYA 2RC6A 1EHCA 4WD3A 3OM9A 2FMHA 4YYEA 1PD0A 3OCZA 3HB7A 1FRFS 3ZUPA 1GY8A 1W0CA 2VHQA 3UUEA 3VC3A 2VWQA 4PLWA 3VV3A 3KXKA 1HL7A 4JUBA 1F9EA 2WTXA 3JYNA 5CR9A 1QE3A 4WADA 2YRFA 4I1PA 2NVWA 2PZ8A 1DZIA 1XTJA 5K01A 2KWIA 2C83A 5CJPA 4A92A 2XVXA 3L7IA 2DT8A 4EL5A 2QTRA 4TTVA 5IM4F 2V7BA 1RHKA 2VHZA 5JBNA 4QUBA 4U2GA 1ML4A 2IYWA 3EARA 5U4QA 1GPMA 1UMBB 1E5XA 1VHTA 3SM9A 3IXLA 3U3KA 4P4UA 1SMKA 2QE6A 1MC8A 3T8YA 4KQWA 5J5VA 3TXYA 3W8NA 3ZWWA 3MQFA 2AK3A 5MN5A 1HWYA 4F04A 1A97A 1L9KA 4M4SA 4UHHA 1ZZGA 3GJ0A 2RARA 1FL9A 2X5KO 4GGPA 5KOHB 3S81A 5DWDA 1IM5A 2MMCA 2Q7OE 3T9CA 3K8ZA 2HMTA 1RWVA 3LXRA 3QSYA 2OENG 4KI0A 2Y0PA 1OE0A 4E2XA 3C14C 2OD7A 1CRPA 2BHLA 3FZGA 5J4YA 3ZKWA 3Q6MA 4CFYA 4WLEA 3LT0A 1QZXA 2HIAA 2O4UX 2WJ6A 2YVUA 2Y4NA 5KSPA 4GZMA 3SE7A 3V4VB 1ULAA 2F43A 3C0KA 1O0BA 2ZUCA 4M83A 5CVEA 4AM8A 4E5SA 4AJOA 1ST2A 2YOGA 1OI2A 3SICE 1QHGA 1KEZA 1SQFA 2GVNA 3B82A 3QP9A 1EVIA 1SUIA 2ZT7A 4DPKA 5EZYA 1U7PA 3L79A 1NP7A 3E23A 4OQNA 4F9FA 2B8WA 3VO1A 4AJ1A 1I3MA 1KKUA 3LQ1A 3MCWA 4CM7A 3DZIA 4MS4B 2PTGA 3EGXA