1NW6A

Structure of the beta class n6-adenine dna methyltransferase rsri bound to sinefungin
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
279
structure length
271
Chain Sequence
GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLQRSYEIVEGAANFGAALQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of liganded and unliganded RsrI N6-adenine DNA methyltransferase: a distinct orientation for active cofactor binding
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
molecule keywords MODIFICATION METHYLASE RSRI
total genus 91
structure length 271
sequence length 279
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nw6A00
5EHIA 2EJUA 4E33A 1RJEA 3B3JA 3EPPA 5DRYA 2ZWVA 4HTFA 2PGXA 4PONA 5DTRA 2GA9A 2O06A 4YV1A 2ORED 3QOWA 3BWMA 3NW9A 3NVKI 1YUBA 4JXJA 4QDKA 3T0IA 3KQVA 1G8AA 3AXTA 3G5LA 5P8WA 1KHHA 1R00A 2EX4A 3CJTA 3EMDA 3KQOA 3FTEA 5E2BA 1JQEA 3FPGA 1SKMA 1NT2A 5EQJB 2GPYA 2I62A 2AOUB 4GOND 4RVFA 2OKCA 4HG2A 4CKCA 3EGIA 3RW9A 5C0OE 3B89A 3C3YA 3OFKA 1WXWA 5D1NA 4F85A 3FUVA 4PIPA 4RVHA 4U7PB 5GIOE 1BC5A 2G70A 1ZKDA 3SSMA 1NW6A 3PTAA 1BKYA 5E9QA 5BW4A 3JWJA 3CJQA 2A14A 3FUTA 3ORHA 4PYJA 5F2NA 3P97A 1H1DA 4KWCA 4V0QA 1RI5A 5FWDA 5K0GA 2Z6UA 3UJ7A 4BY9E 1DL5A 5GM1A 1KR5A 2ZSUA 3HP7A 3TPZA 5K05A 2ZZNA 1X1CA 1R18A 2ESRA 3DMFA 4FT4A 3I9FA 4X60A 4Y30A 4RTKA 5BP7A 3GJYA 1F38A 3HA3A 3SX0A 1U2ZA 2ZIGA 4YV0A 3A26A 2IH5A 3KKZA 3I64A 3MTEA 5DX1A 3AXSA 1XDZA 4OA8A 3HCAA 5DX8A 1IY9A 2OB1A 3BXOA 2P8JA 4EQZA 1WG8A 4RTQA 3BGIA 2IFTA 5DM0A 2PLWA 3LHDA 5EVJA 5ICEA 1ZQ9A 5DLYA 3OFJA 2QE6A 3C3PA 3FUUA 5K8VA 4DMGA 1M6EX 2DULA 1JG3A 1TW3A 2YXDA 5EKXA 3TOSA 2JHPA 5DSTA 3FTCA 5FA8A 1G6Q1 4R8RA 4BP1A 3B3FA 1EQAA 5DM2A 5FULA 4F86A 4WVLA 3UJBA 3FYCA 3E8SA 1SUSA 3KQMA 4EKGA 4L7VA 3UA3A 7MHTA 3ELUA 1YF3A 4EVIA 4PCLA 1P1CA 4R6XA 3THRA 4ER7A 5KQRA 1ZGAA 1YFLA 1DCTA 1UIRA 1L3IA 5DTQA 2UYQA 1AF7A 4OA5A 3GU3A 2LD4A 2OY0A 5GWXA 4DF3A 3AY0A 3NDIA 1XTPA 4Y2HA 4AUKA 4DCMA 3FRIA 3MQ2A 3HA7A 3A7EA 3EVFA 3PS9A 3T7SA 3O7WA 4QTTB 1QAMA 1ORHA 5HIKA 2KW5A 1AQJA 3P2EA 1G55A 3TM5A 4YMHA 2OYRA 2ZFUA 1YZHA 4ZTBA 2G8NA 3DOUA 1VIDA 3LSTA 1EIZA 2VP3A 3GIWA 4YUYA 2Z6AA 2FHPA 3EMBA 3KQQA 1VBFA 2BR4A 2PVCA 5E1DA 3LDGA 4OQDA 3PT9A 1WY7A 3KQTA 5DTMA 1L9KA 1O54A 2IBSA 3A25A 1VP3A 3GO4A 3EVAA 3GRVA 4C07A 4RWZA 2AN4A 2PXCA 1EAMA 1N7JA 3UJDA 2P35A 3HCCA 3I5UA 4OQEA 1KPHA 5EKUA 2NP7A 4E30A 2HMYB 3EEOA 5HIMA 1HMYA 1O9GA 1RI1A 3HM2A 5LR6A 5LQUA 3P9KA 3HCDA 4CXMA 3DXYA 4MQ4A 2YXLA 3LKDA 4PINA 2GLUA 5K09A 3Q87B 2AOXA 1JTEA 2XYRA 4XUDA 3HCEA 3LGAA 5D1HA 5EMMA 5GM2A 3TRKA 4ER6A 4POOA 5MHTA 3M33A 4RV9A 3SSOA 1SVUA 3T7RA 4C05A 2XVMA 1MHTA 3G2QA 3P2KA 5FHQA 4BLWA 2UYHA 3GRRA 5IH3A 1BOOA 5EG5A 2ZCJA 3M6VA 4QVKA 2FRXA 2PT6A 5KQSA 2FYTA 3MERA 2GB4A 2YR0A 2O57A 3UJCA 4AX8A 4KRGA 3ER9A 3E05A 5EMJA 1FPQA 3KR9A 4AZWA 2AN3A 3KHKA 1RJFA 1JSXA 3MB5A 4HSGA 3B5IA 1X1DA 3OU7A 4MWZA 4X61A 2G72A 3E23A 4RVDA 3DR5A 3K6RA 4FZVA 5T64A 1TPYA 1QYRA 3QOXA 3LBFA 1G38A 1O9HA 2ZZMA 3MGGA 5EZSA 4PYLA 2AR0A 2CMHA 4GBED 4CTJA 4GC9A 4QVGA 2C7OA 2PX2A 4PYIA 3C0KA 5E8JA 3LKZA 3VSEA 2ZULA 3GRYA 2XBMA 5FHRA 2HNKA 3IEIA 3OPNA 4MIKA 4YUVA 3X0DA 4BLUA 2NXNA 2AOVA 3UJAA 4MHTA 2I9KA 3I53A 3L8DA 3DXZA 1Y8CA 2YTZA 1DUSA 3EVBA 5FQNA 3LDUA 1PRYA 4FGZA 2YX1A 3OU6A 5DWQA 3PFHA 2P3QA 2P7IA 5JR3A 5CCBA 4M36A 4C08A 4E31A 3KR1A 2ONYA 1FJXA 5E9WA 2HWKA 3SXJA 1VL5A 4GQBA 3KQPA 5E8RA 3PX2A 1AQIA 1KIAA 2B2CA 2CMGA 2H00A 2ZBQA 5HILA 3MHTA 3REOA 5CIYA 3TKAA 5CVDA 2ZBRA 1IM8A 3SVZA 2BH2A 3BKXA 1JG1A 4R05A 5E1BA 2P3LA 4OBWA 4PCAA 1PJZA 1QANA 4PNEA 1I1NA 3BWCA 4DA4A 3KPJA 4PYOA 2PSSA 4AZVA 2V74B 1RJDA 3KQSA 3M6WA 1NBHA 4CTKA 4CKEA 1M0EA 1EG2A 2BZGA 3P8ZA 3EVDA 3A27A 3HTXA 3G8BA 1RI3A 3FRHA 3KQYA 3SM3A 2AVDA 1OR8A 3G88A 3LPMA 3P2IA 2ADMA 2B9EA 2QRVB 2ZW9A 4PIMA 1R8XA 1EJ0A 5ERGB 4FP9A 1NV8A 1KXZA 2NP6A 3LCVB 1AV6A 5EGSA 4YUZA 5FWAA 4YUWA 2QRVA 3KU1A 5CVEA 2JG3A 3P71T 4DZRA 5JUWA 3VC2A 1Q0TA 8MHTA 3FPEA 2NXEA 5EIWA 5K01A 1MJFA 5K0FA 1WXXA 1P91A 4GC5A 3G2PA 4X41A 3HEMA 2NXCA 4P7KA 4CKBA 2ERCA 2ZTHA 5EEGA 3PVCA 3E7PA 1IXKA 3EVEA 3LCUA 5DXJA 4A6EA 5K03A 4RTPA 4ER3A 3MTIA 4X63A 4HH4A 4XUEA 3P9IA 3HVIA 2AVNA 5LQCA 3KPWA 4RTMA 2ZIFA 2P41A 3S68A 3MCZA 2ZWAA 4HGYA 5GINE 2JHCA 5DRTA 5F2KA 3F4KA 5T6BA 2PX4A 4A6DA 4QQKA 3SGLA 3IHTA 3MCTA 4OX9Y 2FK8A 3TFWA 2OO3A 2O0LA 2VZ9A 1QAOA 3LBYA 4KW7A 3BKWA 1NE2A 3UJ6A 3BGVA 3LDFA 3R0QA 3DLIA 4PYKA 2R6ZA 5E1MA 4DQ0A 4HTFB 1RJGA 1ZG3A 4IKPA 4P7GA 5EMKA 5LQKA 4FT2A 2V7EA 1N2XA 2JHAA 5LQAA 3CKKA 4WXHA 4EKIA 2XVAA 4PGGA 2CKDA 1D2GA 3ERCA 4QPNA 1KPGA 2PWYA 5K0CA 5EHGA 1TW2A 3P9CA 2XYVA 2R3SA 2P3OA 1V39A 4R6WA 4RVGA 2OPBA 3MAGA 5DPMA 3PFGA 3VYWA 3NWEA 5C1IA 5E1OA 2WK1A 2YUIA 1ZHFA 4R8SA 3UA4A 2PV0A 3BUSA 2JH8A 3UJ9A 1F3LA 3BT7A 4E32A 4AZSA 2IH2A 2GS9A 2AOWA 5DSXA 2PWPA 2PJDA 5CM2Z 4GOOD 5EZQA 1X1AA 3NVMB 2BR5A 3KPVA 4PWYA 4EK9A 1SUIA 4DM3A 3R9XB 2FPOA 2YQZA 5GP1A 3ELYA 2UYOA 5ICFA 2OXTA 4XCXA 1YFJA 4KIGA 5HEKA 3CJRA 5GIPE 4LWOA 4RX1A 1I4WA 3CC8A 3D2LA 4DKJA 3BWYA 4M7RA 1JG2A 1SQFA 3NMUF 5CVVA 2IH4A 2C7PA 1L1EA 4AZTA 1KPIA 2VDUE 2DPMA 3ELDA 3KPYA 3IV6A 1JG4A 3KQWA 3PB3A 3GXOA 5CUQA 2HTEA 1G8SA 3FPHA 4KDCA 3DUWA 3IYLW 1JR4A 1ORIA 2IP2A 3B3GA 3H2BA 1INLA 5BW5A 1Q0SA 3CGGA 2E5WA 2IDJA 2O05A 3FUXA 1XDUA 1SG9A 3BGDA 4GF5A 4H0NA 5DX0A 4Z2YA 3T7TA 3LCCA 3AJDA 3R3HA 3SSNA 4QQNA 1ZGJA 3DXXA 4BLVA 1NBIA 1UFKA 5EIFA 1I9GA 5FTWA 1XCLA 3O4FA 3SR4A 2H1RA 4DCGA 2GAFA 2UZ4A 3FZGA 2YXEA 5LQJA 5LQNA 3HVKA 3R6TA 3CBGA 4RTNA 2H11A 2EFJA 3DMGA 4QPPA 4OBXA 4KDRA 9MHTA 3LECA 5KS2A 3G2MA 3EVZA 2F8LA 1NW7A 1QAQA 2IPXA 3DH0A 3K0BA 5BXYA 4M38A 2IBTA 3C6MA 5ICGA 1VQ1A 3GRZA 2FK7A 4ER0A 4V0RA 5FA5A 3EEYA 2NNWB 1FP2A 4IWNA 3LL7A 3RIEA 4RTJA 3BZBA 2O07A 2OZVA 2QM3A 3HA5A 5K0JA 4UOEA 5DM4A 3M70A 1WS6A 4RTSA 5CVUA 2NXJA 2ZZKA 2ZLBA 3OZRA 2PX8A 3UZUA 3GDHA 4PYMA 5DT2A 4EMSA 1Z3CA 3RODA 2PKWA 1XDSA 1NW8A 3BWBA 2IGTA 3CCFA 3OCJA 4ATNA 5EPEA 2P40A 1NKVA 1XCJA 4M37A 3UWPA 3KR2A 3OZSA 3AWIA 4P58A 4C03A 2AOUA 4QTUB 3TMAA 2AOTA 4FS8A 3NDJA 5K0BA 3SMQA 3FUWA 2ZIEA 3JWGA 4X1OA 1EJ6A 2PX5A 2Q41A 2PY6A 3OZTA 3M6XA 3FPFA 5HFJA 4GOMD 5K0NA 5KYGA 4PYNA 4FR0A 2AOTB 4LG1A 3KR0A 1NW5A 5HZMA 2FCAA 1WZNA 1KYWA 2CWWA 3NJRA 3JWIA 4HC4A 5DXAA 1D2CA 2AZTA 3NWBA 4K6MA 5F2OA 3THSA 3V8VA 2QY6A 1VPTA 2K4MA 1YB2A 3DTNA 3HNRA 3A7DA 3UBTA 2I7CA 2OB2A 2I6GA 4G56A 3FYDA 3HVHA 1XXLA 3WSTA 5EEHA 2HV9A 1G60A 2Y1XA 3OU2A 2BR3A 4IV0A 3ER8A 4YV2A 2GH1A 2Z6QA 3U81A 2WA2A 3GCZA 3B7PA 2ZBPA 3TR6A 4FSXA 1SQGA 3KPUA 4RYLA 1BHJA 3G7UA 5EOVA 2B3TA 3HCBA 1RI4A 4E70A 5EMLA 5GOZA 1L3CA 5K0LA 5C9ZA 3QV2A 5HIIA 3GGDA 1JQ3A 3EVGA 3LX6A 1D2HA 3R24A 3ID6C 1R74A 2N47A 2VDVE 5HOQA 2UYCA 5E2AA 3G89A 5CCXA 3ELWA 3UFBA 4CWAA 1M6YA 3DLCA 3GRUA 2P7HA 4RTLA 3OE4A 5LQRA 5FQOA 1X19A 1RI2A 4FSDA 3M6UA 5FCDA 4F84A 2G71A 1XJ5A 2AS0A 5K0EA 2BM8A 2P1DA 2JJQA 4GEKA 2AN5A 1HNNA 4MTLA 3PX3A 4IV8A 1XVAA 5CVJA 2HR1A 4E2XA 2QYOA 4B17A 3G5TA 1NV9A 2B25A 4LECA 3G8AA 5KVAA 3EGEA 2EJTA 3DP7A 5LSAA 4KVZA 4QDJA 5G02A 5M5BA 2C7QA 4NECA 5E9JA 3M4XA 1VLMA 4PGHA 2OBFA 3DMHA 4C06A 3FTFA 5FADA 1JQDA 2VDWA 5U4XA 4C4AA 3FTDA 4KIFA 3C6KA 3TLJA 3UJ8A 1B42A 1FBNA 4ER5A 4YMGA 2PXAA 3TKYA 1JSZA 3FPJA 2ZVJA 3P9NA 1L3BA 1N7IA 4GOLD 4HRAA 3I58A 5H02A 3ME5A 5HIJA 2YVLA 3V97A 3EGVA 1FP1D 2PT9A 3CVOA 3JWHA 5DM1A 1R8YA 1JTFA 1UWVA 1X1BA 10MHA 1VP9A 2Y1WA 2EG5A 4XUCA 4RTRA 4E2WA 4E2ZA 2WA1A 3ANXA 1T43A 1VE3A 4O29A 4U7TB 1KP9A 5B1SA 4E2YA 5ICCA 2JH9A 2XYQA 4HGZA 2ONZA 4GUAA 3HCFA 4RSRA 1QZZA 4YUXA 3DULA 2CL5A 3HVJA 4P7JA 1NW3A 3G2OA 3GNLA 3TQSA 3PLAE 3NTVA 2BM9A 5CD1A 1P1BA 2PXXA 2VS1A 2IDKA 3VC1A 4BP3A 2PBFA 2IIPA 2C7RA 5T67A 1YZ3A 3EVCA 4LWPA 3OE5A 2B78A 4P7FA 2NYUA 5EC8A 4RTOA 2G1PA 5FUBA 4C04A 4PYQA 3O31A 3GWZA 3A4TA 3Q7EA 4ISCA 3TM4A 5IKMA 1KYZA 1R6AA 1P39A
chains in the Genus database with same CATH superfamily
1PR9A 2EJUA 4ZV9A 1DC8A 2Q9AA 4JLOA 2YN0A 1TMKA 2VJYA 4TUYA 4UXHA 3DOJA 1QVWA 3P20A 5D6NA 4ESOA 1CDDA 4N3BA 3AKCA 2J08A 2JGNA 3HRHA 1RTTA 1J9ZA 1CR2A 1RZRD 3EMVA 2Q29A 2Q3JA 4IDPA 1KDTA 4QDKA 5A0TA 4YCJA 5JVDA 3UTDA 4NJEA 4YRJA 3CVYA 4FXOA 3HJAA 3ESQA 2XNSA 1J8YF 4MUMA 4LOJA 5MGBA 4D0NA 4B3JA 2NOAA 3THXA 3KUXA 2VDQB 2DB3A 4A0HA 4BRUA 3QNUA 1CUCA 3E18A 3H1GA 3L1VA 2H1CA 1VJ1A 4UZSA 4YLEA 3QLUC 1AGPA 2H7XA 1SKAA 2JGFA 3OCCA 4X92A 2VUIB 4PFSA 1NW6A 4S1WA 4BGVA 4ARBA 5KB3A 5A1TA 5ICMA 5CLLA 3RV3A 2REQB 4GMGA 1NF2A 1G6OA 3GLTA 3QBEA 5FWDA 5WRFA 5HJ5A 2QD4A 3Q9SA 2FZGA 2P4UA 3HCWA 5ALQA 3WP1B 1IN8A 3DMFA 3I39X 2C8KA 4Y30A 1S8FA 3L01A 3MRTA 3TMKA 3NHUA 4CF3A 4O4IF 5FNZA 3I72A 1FVFA 2RI0A 4DOMA 1DOZA 1SC3A 1TIKA 1U2ZA 2YNMD 4QOFA 4XLTA 4YV0A 5JSUA 1BN6A 5IM4F 1KK3A 4UASA 4LVNA 3NUZA 4XFDA 4B80A 3BXOA 2CJXA 1QRTA 3H1TA 1E7SA 2XOKA 5ESDA 1RADA 2EBHX 2G1AA 2ZE5A 4GWLA 2WVAA 3M6AA 1U2DA 5DHQA 4AG3A 4ZDIA 4EKNB 4RJTA 3PYMA 3WLAA 4H9GA 4DEYA 2C4HA 3DL0A 4QGBA 2H4YA 2IXTA 2ZXEA 4YRIA 4HGRA 5JYDA 4LEIA 4UFOA 1U4OA 2YFQA 1A4IA 2JIDA 4WVLA 3UJBA 4BVEA 2HMTA 4ZAVA 1NQXA 1V3UA 1QSGA 1ENZA 4AMYA 1CE8A 5T5QA 4FDTA 2FPUA 3I0ZA 3KAQA 4FDMA 4QODA 5JALA 2FR8C 4LHWA 4FFSA 3IDQA 3JQ9A 5LNK1 1F6WA 2XUHA 2PT7A 3GT4A 4MUJA 1AF7A 3EFHA 2AJCA 3O6VA 1F8UA 1ACLA 1VDZA 2QE7A 3WAJA 2YMLA 1O0BA 3IOYA 5FBVB 4OMCA 5BPHA 2OA0A 3LOPA 3N3BC 2P11A 4RABA 2DE0X 3FYSA 3L0BA 1UDBA 1V0JA 2CK3A 1CX9B 2CXTA 2YWBA 3AB3A 3AC0A 3IJ5A 1KC1A 4B75A 5A7FA 2WYVA 4JQZA 2QLFA 3L46A 3EVNA 4HMPA 1E3IA 5EINA 1H2AS 2AN1A 3HU1A 3OY7A 1C4WA 3DOUA 4B4VA 2CVHA 4LFAB 3EXFB 1JA0A 1GNSA 1HT3A 2ZJ3A 1YVDA 2QE7D 3KQQA 4L78A 4F2PA 1XZDA 2P2SA 2IWHA 2VTBA 3AKZA 3OKCA 3TQIA 4YECA 1Y81A 5DMXA 4QEDA 5FNVA 2YICA 3RHTA 5JASA 4MP6A 1IEWA 4YLYA 3IA7A 3GO4A 3VR4D 3FVTA 3A1EA 2AW3A 2Z83A 3GGPA 3GYGA 1HWYA 4AMUA 1M2OB 3EDRA 4M86A 5EP4A 4IX1A 1JLHA 3L02A 4HN2A 1GGEA 3CNOA 4XB2A 3RC2A 3PYLA 3SI7A 3G59A 5IZCA 4CXMA 4MQ4A 4RKYA 2Q7OE 1L1FA 3TZHA 2ACWA 4I5DA 5K0SA 1C8VB 4PC1A 3IILA 1FX0B 3PD7A 3PGJA 3GT0A 4D7AA 2A1UA 1AT1A 2W6MA 4C05A 2Y0PA 4CMIB 1DWOA 4PYRA 1Q16A 1YI8A 3U0BA 5G41A 1I2ZA 5IN4A 2GPTA 3TAUA 2OBLA 2MYTA 4OHFA 1UBEA 2DUMA 3UJCA 4DUPA 4EQ6A 1OXXK 1CUXA 2ZWMA 4CV0A 2B6HA 2VZLA 3OVMA 1EM6A 5JSHA 3GLSA 4RIFA 3TIXB 5AO9A 3SHVA 1GYRA 3QUTA 2GCOA 4GKAA 1DDIA 4MWZA 1UAAA 3SS7X 4DIBA 2X0KA 2XA9A 4EJ2A 1Z4NA 2FUCA 1C4XA 4RHCA 5JRDS 1PWYE 1K86A 3CVJA 2BZ0A 5TVGA 1QYRA 1PNQA 1S2LA 2DUJA 4RK0A 3RSOA 3RYFB 1E2FA 3KKOA 3TXXA 2JJ1A 1MC8A 1UBMS 2ZBUA 1TA9A 2JVIA 4YRSA 5FAKA 1RQGA 5H9VA 1JFVA 3FZNA 1KFKB 1C7IA 1LUAA 2RHTA 3F6BX 1ODIA 5HRCA 1V6CA 2RGUA 3NM5A 3O4GA 2PT5A 3ODGA 3ODPA 1N6OA 2HUNA 3DCIA 2R8BA 1VE7A 1T13A 2BT4A 1VKOA 3D1VA 3UJAA 3LQQA 3O3MB 2RGEA 2EX1A 1Y8CA 1V5GA 1NP7A 3GBSA 3NRBA 2V9PA 3ZE2B 1WD7A 4NX2A 2VUHB 3CEMA 4MV0A 5D3KA 1E3LA 1XZLA 3OZ7A 1KI2A 4HLNA 3MEQA 5J43A 1U63A 1JF8A 4XX0A 2JJ8A 1Z63A 2GCNA 1HE1C 1KJ8A 1WXEA 1Z7BA 1C8LA 3R3UA 1VL5A 3JQ9C 2GVDC 3NHMA 3ESBA 4ZT3A 2B2CA 2N46A 4DDTA 3ZHXA 4XFKA 2P69A 4I4NA 4UEOA 3H42B 3GCDA 2G80A 2Q0XA 3JALB 1IM8A 3QEKA 2JFUA 4JC8A 4BQOA 1G42A 1YO6A 1ZN2A 3C85A 1P3JA 3WGQA 1NBOA 3IL2A 2O50A 5BQXA 2B21A 1TZCA 3U49A 4BATA 1ZIPA 1QKKA 1QTIA 1BU5A 4RSGA 2P5TB 2PSSA 3VQTA 3X3HA 4HDQB 4A8JC 2JVJA 2HPVA 2Q6OA 1B00A 4FMPA 2JASA 4QUEA 5AK3A 2TYSB 2AVDA 1QXSA 1U2PA 4X64B 3I61A 1V35A 3TSYA 3P9XA 1J0BA 5AR1A 4DA8A 3RS9A 2LNDA 4UAGA 1FMFA 1NU8A 3LCVB 3LU1A 3GEEA 2VHVA 2WKRA 1PR6A 2PIAA 3CCBA 4JJ6A 4XOIA 1FDWA 1YS9A 3WWZA 4A82A 2UUAB 2OWDA 3P71T 2IOHA 1UOQA 2A0YA 3CRQA 1KJ9A 1GT91 2XQIA 2YS6A 2YBEA 3RAJA 5I7FA 2XRZA 4BPRA 4M0MA 4X41A 1Z6QA 1DNPA 1TQ6A 5BN3B 3CVVA 1MR3F 1W2HA 4A8JB 2M6SA 2W5UA 3EA4A 3GFOA 3KOOA 3WJ2A 1CR4A 1N36B 3UV3A 3DAYA 4FYWA 4U2FA 1YS6A 2GD0A 3TZEA 3DWFA 1DHTA 3L05A 5KSPA 3BVPA 5BYBA 3WYEA 4BO7A 5IVPA 2HDNB 3VDRA 3ILXA 3TVTA 1RKVA 2B8EA 3DF9A 3LHIA 4DC0A 4EECA 1RWXA 2CLDX 3IEUA 4KXWA 1PFUA 2C3OA 3TTWA 1U0SY 2Q49A 1SBHA 4BNJA 5C3MA 5M29A 1QRRA 1NRWA 4X3OA 3UUFA 1X86B 2FHSA 3HL0A 4XQEA 4D46A 1XMXA 3BKWA 1H2ZA 3DLIA 2EFYA 1A50B 2A5JA 3WIEA 2BCGY 3OY2A 4PANA 3CLKA 1GRNA 1OE0A 1OSNA 1JXOA 4V0LA 3OECA 4JAVC 2Q07A 4K8RB 4WLNA 4UBLA 4BO2A 1UT6A 1OA0A 1ZEMA 2OBYA 2WU1A 3VSDA 3NYRA 5K0CA 2I29A 1ZSVA 1PJ3A 4EEZA 4J0GA 3ZJVA 5EZYF 3DMTC 4M7WA 4MR9B 2VN8A 3IP3A 4PG6A 1FS5A 2EEZA 1XT6A 2AQHA 1TK2A 2QU8A 5AXAA 1Z12A 3LNCA 3SHTA 3ZV7A 1OB5A 2DP4E 3QPCA 2JH8A 2PGLA 4GZMA 3T7DA 3HY3A 1SCJA 1JI3A 1VYVA 3QWFA 1S2NA 4EFLA 4PN3A 1Q83A 4U2BA 3MQ4A 3KPVA 4MLDA 1VYTA 2F2TA 3WYGA 2WWRA 1V4BA 1SN7A 4EK9A 5L8VA 5IS2A 4RHFA 1IXYA 4TQAA 1L5YA 4LYDA 3OZFA 2UYOA 4FR5A 5DH9A 1DELA 1QC5B 4KTTE 3GBVA 1SHTX 5ICFA 4DCCA 2XSZA 2YHIA 2DG2A 3H6HA 4JL6A 3W2FA 2X42A 2FW0A 3D6VA 3IHKA 2R7AA 4YQZA 1NSYA 3PEUA 1BCSA 1PL6A 1P9LA 1RM5A 3M9XA 4YCSA 2OUIA 2VNJA 3FPSA 2O8FA 1V9SA 4LI3X 4CU2A 5LKAA 4DRXB 2FMHA 1QHGA 2H48A 5IBRA 3SQLA 3ZWBA 3IYLW 1PLJA 3M89A 1NYLA 4UBKA 4KVFA 1RACA 2NUTB 3PQ7A 4LF9B 1Q0SA 1HR0B 1SMKA 1UBKS 1W36C 1BSVA 1DFGA 1ZD8A 3IULA 1B7GO 4BGIA 6YASA 4MQBA 1RT9A 1T36B 4O4JF 1P1JA 4B45A 4BNDA 3N0XA 3ORRA 1Z16A 2P4EA 4FS3A 4NL4H 3TI9A 4NSNA 3TVYA 5JCOC 1JI0A 1V16B 2VPTA 1NMEA 2JLZA 2D6FA 1W4BA 2QRUA 1ZUIA 3K35A 5KJCA 1P2FA 1ENPA 1Z0ZA 4H7PA 5IF3A 1ES9A 4ZZ2A 4DFDA 2QMEA 3PNVA 2CLHB 2H59A 5EI5A 5B2EA 1BWPA 3WLHA 3UYLA 3H9GA 1QAQA 2A7XA 3ZWXA 1HNXB 3I4LA 1EFAA 4BFSA 1R5OA 4U02A 1I1OA 4TKZA 4JC4A 1UBSB 4LXTA 5AJXA 4AW9A 4EUSA 2I1VB 3KXDA 4TXHA 4F4HA 4U7JA 1V71A 1QTRA 1YK1A 3JZIA 5FA5A 2ATCA 1R6VA 3R7BA 2XZDA 3GDGA 1UBNA 2QM3A 1TUGA 4J0KA 2GJ8A 1A1VA 1SNYA 2WKWA 2C5SA 1GZHB 1EHCA 1WS6A 4UEQA 3FWKA 1QIFA 2AEFA 2AFRA 1AF4A 1O89A 1R4MB 2HAEA 2RIRA 1KKUA 3OC6A 5G4LA 3GDHA 3WGHA 4LKRA 1QX4A 1WUKS 1GFIA 4KACA 1U0OC 4H18A 2H9AA 5I9BA 2A78A 2JPDA 3ZHTA 3SEQA 4E5KA 2EGHA 1G3QA 3LMKA 4FHZA 3RUIA 3UYKA 3ZVNA 4L2IB 3ON5A 2F4VB 4I8DA 1TQ4A 2DWOA 2AOUA 2IS2A 2EL7A 1NXPA 1WB6A 3QKSB 3PGXA 2IYRA 2QEQA 3HWWA 4NZOA 5AHXA 1UDXA 1JIJA 2PY6A 4FCCA 4FNGA 3GLIE 2R751 2YXPX 4F6RB 1IM5A 2GK3A 4ZO7A 3DO6A 1YVEI 3UOAB 5KYXA 3W5IA 2HA7A 1KYWA 1L8XA 3N86A 4HC4A 1ZN8A 3TOVA 2Q1YA 2CMKA 5DGTA 5K1ZA 1Z0DA 2I6TA 4CG1A 1BRMA 2RKOA 3GGCA 2R6GA 3E0XA 1G60A 3ER8A 1MNQA 2RH5A 5JSZB 5ELLA 3ADDA 1S4QA 2B5OA 4MDYA 3QPAA 3KTAB 1X7WB 3EGCA 2I2WA 3N59A 4ZDJA 2B3TA 1SWVA 5CDFE 1N7GA 4WKOA 4J0IA 4P80A 4LXYA 5CJ2A 3PIDA 5KYVA 3FVRA 4WCFC 1CUEA 5GONF 1C1XA 2CL7X 2OM6A 3CNHA 3DKPA 4K46A 4CR7A 5SICE 3DLHA 1OA1A 1D6SA 2FRDC 3KKQA 2JAQA 3A4NA 4DDWA 4FW9A 5KJ6A 1N32B 2BSXA 4C3UA 1BKSB 1KO4A 1Z83A 2E3JA 3Q4GA 1GUYA 1UKYA 3DLCA 1Y7LA 2V7GA 4HB2A 4JX8A 5I48A 2AUMA 3HRKA 4M89A 4RDIA 1E2DA 3C5WP 4TKVA 5IUKC 2I6SA 2DLDA 2HR1A 4IV8A 4KQ6A 2Z2JA 3GJ4A 1M2HA 2FMIA 4QXPA 4CEJB 2ARKA 3OPXA 1QU2A 2YOHA 5B1YA 4ZEWA 4IDBA 2QI9F 2VF4X 4LW8A 3DEFA 5KVAA 1C4KA 1OI7A 3EF3A 2W6PA 4Q39A 4KIWA 1V41E 1QIJA 2J5RA 1MQSA 3H2KA 3Q7RA 4YJ2F 5L45A 1YV9A 3BJZA 3FTFA 2JAOA 1M5UA 4KIFA 5EJ2A 4IAOA 1R4ZA 4W7HA 3JQBA 2ECOA 5EWLA 3TLJA 2VJPA 2CE2X 5F4BA 4N0QA 4X9XA 5K8TA 3E9YA 4LRUA 4K1LA 5HIJA 2WF7A 4UTVA 2NTEA 3Q6NA 4PBTA 3W06A 5AW2A 5KQLA 1GR1A 1IOVA 3N5KA 4NJOA 4EG7A 3SKXA 1KOFA 3G1UA 2FPPB 2AYYA 4ZGWA 3LFTA 3VC3A 4AAYA 5C5IA 1E2KA 4BQRA 1P6QA 1ESNA 1X3SA 3BMQA 2ZRFA 1KP9A 2XTAA 1FDIA 1UL1X 1YRLA 2WWWA 3HCFA 3WGOA 1K75A 2WDZA 4HXFB 4MQEB 5I7WA 4RMIA 3CVUA 1WY5A 2JK0A 2R11A 3A4IA 3E3NA 3HVJA 3O3OB 3R5SA 3R3JA 1RWBA 4IDEA 2P9JA 1KGDA 4D0RA 3R6LA 4YRRA 1FXWA 4CLDA 2VATA 1I30A 4GEGA 1G1AA 3COWA 4LBWA 5HCNA 4AY4A 3WMEA 4LWPA 3D6HA 3WNBA 1N0VC 3UV6A 2XZOA 2BBTA 2Y9MB 2DFNA 3IHLA 2IHNA 1Y7PA 1DAEA 5GJCA 3ZW9A 5MFZA 1W2WB 3FAKA 1IWBB 3TM4A 4ZHQF 2Q7DA 3VYUB 1LBQA 5GGXA 4JXKA 1WNFA 1Z08A 1RMYA 1TAQA 2VHXA 1YZLA 1XVIA 2Q3LA 3ZZ1A 1WPQA 3L8ZA 2CV0A 1W0KD 3W04A 3DAFA 4BNKA 1IZ7A 3BWMA 4OAQA 1DKOA 3KEGA 1QGYA 1KVQA 4BNFA 2PBRA 3CJTA 3MAJA 4K9NA 2JFFA 2OO5C 1YCGA 4JY7A 2FPRA 4M1OA 1ZVKA 3QVJA 3QKSA 4W1QA 2ET6A 5CA1F 1JDVA 3C3YA 1YUMA 2FZLA 4G1MB 4B0OA 1CS0B 7REQB 1A2QA 4ETIA 3FCCA 1MX1A 1YDFA 4XUGB 3MJCA 4YHBA 5E9QA 3RK0A 2WT4A 4U2EA 1LA2A 1Z8HA 2A9VA 2DPHA 3HKBA 4KWCA 4PQEA 4MVCA 5FB3A 4MV8A 2ROQA 5JO0A 1JIXA 4TRMA 1IQRA 4MVJD 4FFPA 4WBNB 3D8TA 4MCAA 4OBBA 2ZK7A 3FOAA 4L5YA 2GWRA 4LYAA 5BP7A 1NASA 3Q40A 4KN5A 1RLIA 1JMKC 1C7RA 3LL4A 4HAIA 4IFEA 3E03A 4AJ1A 2AFIB 2VXCA 3VHLB 2IH5A 4WHMA 4MR8B 3HEBA 1JECA 1Z38A 3SHFA 1PR5A 1E5DA 3CLHA 3DZ8A 5F3RA 4HDRA 1P60A 1YJAA 5ICEA 3BH0A 1SXGA 2FJPA 4YUAA 2JFHA 2IYVA 2O8EB 3HBAA 2QUHA 3GLKA 4BX0A 4D57A 4PN7A 1QRSA 3P2YA 3H9JA 2DULA 1JG3A 3EH2A 4OXKA 4G36A 2GESA 2GHRA 1EESA 2KS6A 4B40A 1I7DA 5CNMA 1O8CA 1G6Q1 1MG0A 1Z5GA 2CLLB 1MX9A 3DFZA 4OHZA 1FMLA 2CXUA 3BN3A 3CSDA 4FKBA 4ZQEA 3ZIAD 1LJLA 1UKCA 2GASA 4IEFB 1U5CA 4L9RA 1PW5A 5JSKA 4JBGA 3R7NA 2ZJ6A 2D54A 2DQZA 3AF2A 2XLCA 3HJNA 3NHJA 3HKEB 1CQPA 1P7ZA 4JIMA 1NXQA 3F1KA 4W8OA 5IDYA 1IWOA 4G01B 5PNTA 1QG2A 3A37A 1CULC 5BQOA 4K9QA 1DCTA 1YU9A 3PFKA 4MPPA 4CG0A 1FP4B 1Y0BA 3DFUA 2OY0A 4KXLA 4Q4JB 4ZV4A 5IULC 1JIQA 3ZE6A 2NPOA 4ZN6A 4RM2A 4DCMA 2XT6A 1N6IA 1E5XA 4H0FA 3OEWA 4IBOA 3H5TA 4NESA 4QYXA 3ZIAA 4AG6A 5AI8A 2Y92A 4AY2A 2BHTA 2ZEJA 3GLHE 3RS2A 1KY5A 3EXFA 5DK6A 1G7CA 3ICQB 4CHGA 4DDKA 4X93A 1TK9A 4Q9DA 5TQ2B 1XRSB 5B58C 3RADC 2VTBB 4I6EA 2JVKA 3H2YA 4ZDWA 1KKLA 2PA0A 1DEAA 2L19A 3L49A 1GLNA 1RRPA 1D1TA 2BGMA 4IMPA 4M3NA 4TL7A 5E1DA 2C8VA 4AN4A 3QW2A 1VXRA 2ZQ5A 5BUQA 3ZOKA 2ZWIA 1EFPB 2HIGA 2NNLD 1E1QD 2OBXA 2I54A 2CFRA 3RUFA 3PNYA 1X6VA 2PXCA 3STWA 1KMHB 2O52A 2ZRAA 1BO6A 2R4QA 5F33A 2V6IA 4NMMA 3KWMA 1U2SA 4Q21A 3ROEA 5EN4A 2NP7A 2GOYA 4LHSA 3ANTA 3IT2A 5LIRA 1HMYA 5LMUB 3BXEA 5LR6A 4R51A 4XSGA 1TM1E 2GERA 3UMVA 4BQFA 3LKDA 2IZOA 4Q9NA 1CZUA 2D2VA 3HQ4O 1KI8A 4W5JA 5JS6A 1XX6A 1CJKC 4BECA 1W7AA 4W1SA 1KQPA 1JGTA 5IEBA 1GV0A 1LKZA 1GPUA 1GHTA 1UMKA 2IYNA 4YONB 4FMBB 5FHQA 2R8RA 4LNAA 4C6HA 1U7WA 1LDYA 1HX7A 3MWDB 1TM2A 4C87A 4B7ZA 3JVVA 4H4DA 4ZQFA 2AI2A 1QQ6A 4KSYA 2YINC 4EHNA 2JCBA 3E05A 4QUJA 3PFCA 1OH7A 2CLKB 4JVOA 2F43B 5DLDA 1SCBA 5LZ2A 1JG7A 1OB2A 2X3YA 4ND4A 4G8CA 2IHKA 3KK0A 4FZVA 4GH5A 4PXAA 4EENA 4ZJPA 2RHWA 3SQNA 4MKFA 4DCNA 3I28A 4DIUA 3H4IA 2HV8A 2AFHB 3TK1A 1E60A 3HH8A 4Q7EA 5I3CA 1W8IA 2JARA 3OTQA 4OY3A 2C7OA 3AP1A 1XLTA 5I01A 3LCRA 1E2EA 1E8MA 4IMJB 4Y6SA 3ZK9A 1JP7A 4C7OA 3BMNA 3O92A 4B82A 1QHHA 3DAPA 2YWFA 1VG1A 1VCIA 1W4RA 4RVUA 4KVAA 3N87A 4RDCA 1SCQA 2YTZA 3LDUA 4MV7A 4WZ6A 1T6XA 3ZCUA 3ADKA 1VE5A 2DGDA 1J9EA 1JWBB 3IVGA 3FYUA 1U31A 3CPSA 4DYDA 3KR1A 4QECA 3DVLA 2ZWOA 4X65B 1ENOA 2OV8A 3OX1A 4F1KA 2QQFA 2J0UA 2ZTMA 4NU6A 2CZCA 1V2GA 4OVKA 1QC5A 3DBLB 2QP4A 2ZBQA 2HL6A 4HDSA 1RXUA 5HILA 5IMSA 1U8YA 4AF7A 2ZBRA 1BE0A 2XMBA 4WCFA 2AEMA 2VHQA 4U00A 1Z0UA 4G1CA 4I55B 5IASA 3H5IA 3PFBA 5KINB 1ZPDA 2PFSA 1E69A 4JUDX 2BHSA 2H2IA 2O5CA 3I42A 4PLVA 3ZHSA 3T5DA 4HXYA 1NC1A 1OC4A 1QOPB 1XMVA 2QMYA 3KQSA 4LOLA 4X1KA 2CXOA 4HXGA 4EPVA 2QBYA 2XZTA 4CU5A 4DJFC 3IAUA 5JJ5A 3TFOA 4PCVA 2Y1DA 4X00A 2GN9A 1PSWA 3MPUA 3Q2IA 2JJMA 4ACAA 3L4KA 4MRPA 1T0UA 2NUAB 5JMWA 2I65A 2ODWA 4FP9A 3WKBA 2CN1A 5KX5A 4AG5A 3H6KA 5D86A 5I47A 2OAP1 2BTOA 3INNA 2QM0A 2R62A 3PQ5A 2JLXA 1OAAA 4G97A 2XNJA 1Y6ZA 2KYRA 1MJFA 2ZRMA 1TF5A 1ZH0A 3FNIA 3HJCA 4P7KA 5TGTA 2Z04A 2FWAA 1FTNA 3RS7A 4A6EA 3SP1A 4BNVA 4ZYXA 1CUAA 4QG7A 1UODA 4XASA 5FBLB 4EG8A 2Y3IA 5LQCA 1DJOA 3T61A 2A4MA 4HAYA 4OXYA 1Q50A 5CG1A 5DRTA 4BQPA 4QULA 2WSSA 4RCYA 3ZTWA 3KKNA 4A6DA 4QQKA 3LF1A 3ZR4B 4A03A 4P3NA 2CVPA 4YAGA 1STOA 4O4JA 3QFSA 2VZ9A 5GTDA 5FTLA 2ZAYA 3V32A 2C5HA 4IEEA 4DIOA 1EZZA 1WDWB 1PJLA 3MAAC 2YJGA 4EA6A 1Z6XA 1WXFA 3DHNA 2G6TA 2R66A 1YE3A 4HLQB 4ECAA 4M7OA 5LQAA 3JR7A 1S9HA 2VVTA 2KQUA 5IJ0A 2PE5A 1DINA 1MZVA 1TD1A 3ERCA 3W3ZB 4OH7A 1I51A 4RWEA 4EY6A 4GLBA 4ZD6A 4O2RA 1PQUA 3E81A 1QCCA 1UAYA 3KXLA 1L5KA 3QSYA 1KMQA 1EMDA 3QPUA 5K2MA 4Z9BA 3V7NA 1TADA 4HY3A 3MLBA 4OI4A 4ENRA 2X7JA 3ZI0A 3SVLA 1WETA 3M3PA 5KHOC 4GVPA 5TJ9A 1F3LA 1P4GA 4TYYA 1YQEA 4G8JA 5AKEA 3ZEIA 2V7UA 5K20A 1ZP6A 3U1VA 3Q1KA 1QTQA 3JASA 3OOYA 3R7LA 1E9FA 5CDUA 1SXQA 1RD4A 5KJFA 3RYCB 3TQOA 4HAWA 1ZC4A 1REQB 4QPJC 5F78A 2EW1A 1KJWA 2R7KA 2MWMA 3AR5A 3ELYA 3E1KA 4PLFA 1CNFA 1QH9A 3NKLA 4HPJB 4RX1A 3ZDDA 5JWOA 1SQFA 3NMUF 1DBQA 3CZPA 3PNLA 5CVVA 3IBYA 4X95A 5HHTA 4ZOQI 4BKUA 4QTXA 4WFJA 4CTOA 2VDUE 3PB3A 3ABRB 3DAOA 3ITEA 4FE7A 1Z5WA 5B37A 1VJRA 4YCLA 4NOLA 4UM7A 5LP6B 2YV3A 1C9YA 1AN9A 1DFHA 3QVMA 2IP2A 3H2BA 3QNMA 1YDMA 1Y6FA 2IDJA 4MUHA 1PZNA 2I55A 3V8MA 3PQ3A 4ZIRB 3S29A 5JLJA 5FD8A 3U3ZA 2XB4A 3FTPA 3HYLA 4J94A 2QXYA 3H05A 4LZWA 5JQGA 2QL5A 2XI4A 2R6CA 2RB5A 2XZPA 2VCYA 4HQFA 1Y6JA 1L5GB 1W5EA 3RYIB 3WRYA 1MOZA 4B33A 1KDPA 3C1OA 1LX7A 2X8LA 2H8GA 1DIOB 5FT9A 5IDWA 3L84A 3I04M 1Y48E 3COZA 1HT2E 3JYLA 1P1HA 3SX4A 2PZMA 1ZEJA 2IYYA 3EEYA 3SKYA 3UOGA 1KOJA 2HCJB 4NZMA 1M2EA 1G7SA 4B76A 1LLDA 3IAEA 3ONWA 2EQAA 1DC6A 5DM4A 1E6EA 5J9FA 1YDGA 5CB6A 1IG0A 1CZNA 3TAHA 2HZBA 3F6RA 3JQ8A 1PUXA 2QZSA 3BRWD 1FS4A 5JDIA 3RU7A 3CNEA 3GAMA 3ICWA 4DZZA 2PGDA 4Y2YA 1ZAKA 4J1SA 5DT9A 1QBKC 2SKEA 3VU8A 2NUBA 4EG1A 4EMSA 3OIFA 5IHPA 3AW9A 5ALLA 1PNTA 1T10A 2BW0A 3FJ1A 2G9NA 1L7VC 3G0DA 2VOJA 4GSYA 4F45A 3OZSA 4WT7A 2B8WA 4J7AA 3CO0S 2A3NA 4KR6A 1P2VA 2JIMA 1TIPA 4N3NA 1Q6YA 2YN2A 4B4WA 3SMQA 3S2SA 3MB8A 4Q4LA 4XH9B 3JWGA 1XLTC 5E7QA 2FDXA 3IP5A 2W6JD 3NWJA 3F47A 1WU8A 5KYGA 1Z4OA 4FR0A 4UHCA 3KVOA 3QLUA 4D81A 1DRUA 2EFCB 3AYXB 3G17A 1TA0A 5HRUA 4P98A 1OXTA 2A57A 5T4EA 1PFGA 3O9MA 3NR2A 1X8LA 2NO6A 3RT9A 1EWQA 4RJJA 4IDDA 1TA4A 2QYHA 4C7MA 1Z0FA 5F5XA 4NR0A 1E89A 3O4RA 4YIHA 1W85A 3ROQA 2XPCA 3ACCA 4IYRA 3V1LA 2QXTA 1QOQB 3VH4A 3K2EA 4RL4A 2LP4Y 3DE3X 2ZSFA 3FHCB 4XD2A 4ZT4A 5IKOA 3WRWA 4B34A 1T3LA 2Z9DA 5LMZA 3B1JA 2FR1A 3E9EA 3UFXA 1LS6A 3RUDA 2Y0BA 2JGMA 1YRWA 4YJ2B 2ZYGA 4CIVA 2FPMA 4PHHA 2X0DA 2RAUA 2W6ID 3B9PA 5TQ0B 3T5CA 5IEJA 2GKGA 2PSFA 5B55A 1XEWY 2EJCA 5LOVA 2QP9X 3LX6A 3O21A 2AZMA 1I1QB 5IP5A 1M75A 3D6JA 4P0TA 5ES3A 5BOVA 1GRQA 1AA6A 1DV2A 2GYYA 1NURA 4HADA 5HDQA 3G2NA 3GMIA 2OAQ1 3NWPA 4INPA 3SYTA 1W1WA 2VTVA 3PC8A 2GTIA 2V54A 2X7XA 4XGIA 5EWMB 2WZQA 2YWEA 4CE6A 1N9GB 1BW9B 3SN6A 2BFCB 1ZOSA 1SRRA 3P32A 4G5YA 2WJAA 1DO2A 2Z8YM 4N5MA 5FAXA 3SDBA 4QRIA 4F9TA 4PG4A 4ESEA 3I1JA 4I14A 4MUIA 1GUZA 1Q19A 5CYGA 2EJTA 3D59A 3DP7A 4QUKA 4G5RA 4KMSA 4UNNA 5AI0A 1XQ6A 3VVBA 2IW3A 3O1HB 5K3AA 4DSAA 1NQUA 2OBFA 3Q6IA 3ZBQA 4G41A 2X8BA 1JQDA 4NBWA 4XPZA 3D2CA 3I9NA 3TMYA 2IF0A 2Q2QA 3H65A 4H7EA 4HVLA 5IJ9B 3KSAC 1B42A 3UCFA 1J2YA 2IXGA 1TM4E 4I19A 2P27A 3BXFA 4GOLD 1Y5IA 4YK7A 2JA1A 4XTRA 5IM4A 1E2QA 3PK0A 2ZJFA 3GQBA 2YWDA 1P77A 4LJ8A 1CUDA 4QUHA 1ZM9A 2P4QA 2PS1A 3NEYA 3NTQA 3NBZC 4OMDA 3HFGA 5KC9A 1CFJA 4E2WA 1E2PA 3IP7A 3WKAA 1ZNXA 4M0DA 3THWA 1E9RA 1XR3A 1UMDA 1ECPA 3VZPA 3D3WA 3JVEA 2P6MA 5ICCA 2JF0A 2RONA 3OA2A 4MUAA 4QXAA 4DTIA 4DUGA 4U0KA 1L6RA 3W6PA 3BB1A 2ZRLA 4XI9A 1YS7A 4P2GA 3UPDA 4JUAA 4RZ3A 1Y4DE 5JXWA 2NYVA 1GTG1 5CD1A 2PXXA 5ILOA 1GLVA 3JRNA 3HZOA 2Y93A 3H13A 4IL5A 3EFOB 2IYEA 3H1AA 4J49A 3WS7A 4F38A 3EA5A 4INJA 2BKUA 4TMXA 3RS5A 3O4JA 4K87A 5L40A 2MYNA 2NYUA 2H85A 4P9NA 4Q1DA 2GZ1A 4C04A 5JH7B 5TQ2A 1QKIA 2XH8A 3NOXA 4WK6A 4GIBA 1EYZA 2J3QA 4W6ZA 1Y3IA 2OL4A 4DUGD 4Q3OA 1ECCA 5ULLA 1P39A 4CF7A 1ZJ6A 3X1MA 2QRLA 5J4LA 1ORDA 3G49A 3EPPA 4II3A 2DBVO 5G0UA 2MTBA 3LHSA 2RG7A 4LJSA 1ISJA 2OFOA 4NF2A 4YV1A 3EJ6A 3RTAA 5JAPA 3IVCA 2ON6A 4N3GA 1KERA 1HA3A 5FV4A 4UPDA 1L5HB 3FIUA 2GBCA 4ERNA 3OH8A 3DPUA 3FWNA 4L0MA 1BE8A 2R7NA 3D8SA 4JYZA 4Q1EA 4LF7B 1JQEA 1MC4A 1OXUA 4OI0A 2VYQA 3EULA 5BT8A 1V7CA 2H57A 1D0IA 2KI5A 2WM2A 3NHKA 2A88A 3LRTA 4FYYA 1IULA 4JBNA 3N0WA 5D1NA 2PZFA 1ZJ4A 2A0FA 1BC5A 1K2WA 2ATVA 4M21A 3SSMA 1LDNA 2D2XA 3UK1A 4DA9A 1KOLA 4UOQA 2QDKA 2XE4A 2P75A 3E1GA 4GYKA 1RQ7A 3L6CA 2ZU6A 3OPYA 3ANNA 2WT8A 4PZUA 5F7JA 4NBSA 1H3FA 4NQRA 3UJ7A 3HVUA 1T8WA 3HB0A 4Q1AA 2I4IA 1CP2A 1KI9A 2ZTLA 4X60A 4ZRMA 3JQ7A 1V9LA 5DWDA 4A8PA 3SX0A 3DTVA 5B1DA 3DDNA 4BJHB 4CN8A 1RLMA 5BOSB 5EIBC 1BOFA 5K3FA 2O8EA 1U0JA 4PSVA 2QNIA 4I50F 4R7ZA 2JLVA 3N2KA 3T1NA 1G7TA 5KTMA 3VYSB 3DCJA 1RCFA 5LQMA 1H0KA 2QSJA 5G53C 2XCUA 1OOEA 3RK1A 3ZK8A 2HF9A 2VJMB 3D7KA 3UOWA 1W94A 4AVYA 1Q3KA 5I4BA 4PS0A 2QVGA 3WLTA 1PEAA 4FQ8A 2JHPA 3D3QA 1DBSA 1A9TA 2B69A 3ELBA 4UDNA 3KJGA 5CIWA 5HR5A 4JVNA 1MT3A 3OG9A 4EB0A 2H1WA 3AOEA 4Q4HA 2DMRA 2EFDB 4NOMA 1K8ZB 3H4MA 4F21A 5EIHA 4YMUA 3ND7A 3OJ0A 1R0RE 3GRKA 3LP5A 1ONPA 2GRJA 4KR9A 3SBEA 3I2JA 4KHZA 2NUTA 7YASA 2J6CA 1B6RA 1I2DA 4J76A 1TQHA 2W93A 3ZGOA 2FDCA 3ND8A 3SBOA 1Q21A 3X1ZA 2QMQA 1KQFA 2GJ9A 3GFFA 3NYIA 1SXPA 1RC0A 1GTZA 4WA8A 3CZCA 1WOMA 5D6OA 5BV7A 3FRIA 1U8AA 1NVVR 4K3UA 1CTQA 1RE1A 3F6EX 5LWHA 4OLBA 3OI7A 5HX7A 1N9KA 4M8IA 4NU8X 4EJ0A 3HLYA 4WTOA 3A1VA 4JC5A 3ILSA 4ARZB 3K5PA 2ODQA 3I1FA 2CFSA 1Y1KE 3I9JA 2XEDA 1GNQA 3ZLUA 4F46A 5JJLA 2JHGA 2NSLA 3CN9A 3DWGA 3S5JA 3ZQUA 2NU9B 1K7SN 1U9ZA 1VL2A 2R84A 4QFMA 3BE6A 1HV8A 1WJGA 2G40A 5JZSA 3V8RA 4M7PA 5BSTA 5GGYA 3DM5A 4DQXA 5BW8A 3RC7A 3AR2A 1PI3A 4OGKA 3F67A 5HKAA 4WY2A 4RIEA 4C07A 1CK4A 2P6PA 3WWYA 3KXPA 1RM4A 3N2YA 1Z6TA 1XL0A 3NHFA 1LI7A 1JBEA 1OGIA 3GARA 4W5QA 3WI7A 2Z2KA 3WWCA 2FNAA 4ZO9A 1OX5A 1E1YA 2WSIA 3QUAA 3FOCA 4HATA 4KV9A 4RD2A 3LK7A 2VO1A 3NEJA 3BICA 3K31A 1U1CA 3ONDA 4DT1A 5CT4A 1JVNA 1XZMA 1U1GA 4MVJP 4F6RA 1LSSA 3WVNA 3OFNA 5JJBA 2WD7A 2JAHA 1F9AA 2JJYA 2NT3A 1Q20A 3HNOA 2FYTA 2WAXA 4R16A 2GB4A 1TUBA 3DSRA 3R75A 1BS9A 1MTOA 1ZU4A 3PNOA 1N8SA 2DHCA 1JQBA 3AHEA 3DJYA 1WV1A 2IVFA 3ZDCA 3FPKA 1TK3A 521PA 3W0LB 1TJPB 2VNAA 4PPFA 5IYZF 1TL7C 5KAMA 3UAZA 3KJHA 1SB8A 2H6EA 3MWEA 1T1JA 4R2MA 5AJHA 5A2GA 1NRIA 5KU7A 4UMDA 3ECCA 5CH8A 4TTRA 3Q15C 4UZEA 5FXMA 1PNVA 1W88A 2ERXA 4MQ6A 4F3RA 1I5EA 2MYUA 4YJ2A 5HFAA 5JAHA 2DWCA 5DZSA 1GQYA 3QFTA 1ZICA 2PX2A 3K0EA 3ADPA 2J0VA 3Q12A 2FPLA 2VAPA 2XE6A 3X44A 3GNTA 1O94A 3CIFA 4BVBA 1Z37A 3VM6A 4P4NA 3ZS8A 1ND5A 2QZ4A 3I53A 1TEVA 1DKNA 3DXZA 4WUVA 5I9SA 4F9GA 4BJ1A 4BLQA 2DBRA 1JMVA 3A6ZA 1TE2A 5LJLA 1THMA 1ZD4A 1C8KA 5JQGB 3UH0A 4J2TA 2WVJA 2C77A 3EZ6A 1P0CA 2A0XA 3SZOA 1WLYA 5E8RA 3ZG6A 5SYAA 2CMGA 2YHIB 2ZXFA 3BCSA 3KRTA 4Z7JA 1YQWA 2H2HA 6NULA 1CEQA 2MSWA 3HSSA 4ILKA 1JTVA 2H4XA 4CKEB 3QPWA 3VZSA 4DCSA 2Q6TA 4F3KA 1OIXA 2SCUA 3FX2A 3T7IA 4E0BA 3F7TA 5BVGB 4GUDA 4YTEA 2VDWB 4WOKA 2OO5A 4LC0A 1VTKA 3FJYA 4QRHA 4YP7A 3V6MA 1UPUA 2W2VA 2I3BA 1USGA 4QJIA 3ZDYB 1F1BA 2WKQA 3FVVA 1EG2A 3R6WA 4V03A 3D2AA 3HWX1 2R25B 4W1RA 1TDJA 1AKMA 2EEPA 2JLRA 3JQ8B 4ZVPA 3TLKA 3LPMA 4ZI2A 3N0TA 1TUEA 1AS3A 1Z2NX 4YAUA 4HCJA 2WR8A 2JI6A 4DTCA 5KPDA 2OESA 1A76A 3GRFA 1MA3A 2I6UA 4IJUA 1V1MA 1L4UA 2ZYVX 3IV9A 3ORQA 1IRIA 2QRVA 4RGVA 2CCGA 3UM9A 4BDTA 5H81A 1P5HA 2VP0A 3P9RA 2FUG1 1XCMA 2ANBA 1GAEO 2I4LA 3ILVA 3J7TA 3MMZA 3PFNA 121PA 1RXIA 4LDJA 2BMEA 3JY6A 4UEJA 1NG1A 4AF8A 2XBLA 4QAQA 1RPNA 1L7EA 4JP8A 2JBWA 2DPXA 3WGTA 2WUGA 3WB1A 3LCUA 2OCYC 4Q15A 5K03A 1IYZA 3I2FA 2HGZA 4KHPB 1G19A 4I6GA 3FMPB 3KEQA 4XUEA 2X7HA 1ZR4A 3EH1A 2PZJA 2WV7A 3BEDA 4EW1A 2J87A 5JD6A 4ID3A 1I0IA 4LJRA 3E8MA 1U7TA 4K1XA 4CN9A 3UN1A 2JHCA 3E3LA 3K8QA 4CPDA 4DV1B 4FONA 4JK3A 1NR5A 3K8YA 3KTFA 2PX4A 3OT1A 3IUSA 3IHTA 4P86A 5LOVF 2C94A 1EKXA 1QAOA 4RS4A 2I22A 2X0RA 1AU9A 4B8YA 1M10A 4UTRA 3HR8A 3EY4A 2BP7B 1FYEA 4OHXA 3FYTA 4CHTA 4HBZA 5EJ8A 2FETA 3PWZA 1AKUA 2X6QA 1XIVA 3EWNA 3HBNA 1LTHR 4BNMA 4HP8A 4ISBA 1UWLA 1Z06A 4ZO6A 3DWEX 1OZHA 3VGJA 1ZXXA 4FEGA 4O4LA 4PGGA 1PJSA 2D0OB 3NS7A 5A02A 4DB2A 3H0KA 4G0XA 2BUAA 1XCBA 1T5SA 3DMPA 3RVBA 1NVKA 3CX4A 3PGLA 4WNAB 3NBYC 4J0JA 4RVGA 1ILWA 2OSBA 2VWPA 1E6KA 3KBOA 4ZQGA 3PSHA 5AVZA 3PFGA 3BDAA 1LBIA 2B6NA 4ZQHA 1DBVO 4YJFB 1XN4A 4EF6A 2F9LA 3RYCA 5JY6A 1WHSA 1LRLA 1SHKA 3ZVRA 3QHQA 3TW4A 3L6RA 5CVTA 4D98A 1NJ8A 2OCKA 2VUSA 3K4QA 1OJ7A 3P96A 1KYYA 3CE9A 2BGRA 3W4IA 5BUZA 5EAIA 4YDQA 1KAEA 2GMWA 3ETDA 3OEHA 5KJ1A 3CJRA 2I03A 3BBPA 2R4UA 1M66A 1U3CA 2C20A 1NQ5A 5DIZA 3SIWA 6LDHA 4OJQA 1MW9X 3A1SA 2GDZA 1ZD2P 5CXSA 4CM4A 2BEVB 5CJPA 3KXIA 5D5PA 1KQ3A 5AW7A 5DNYB 1C3OA 3NIGB 1RTKA 2C7PA 3QBJA 1XZEA 5J2TF 4JOCA 4LV5B 4MJLA 5REQB 2JK1A 4RGYA 1AMUA 4QQ8A 2YJ5A 1AKRA 3DDHA 4Q7LA 4F60A 1Z5UA 2R6HA 3BH6A 3UKOA 1W6UA 3D5QA 2BDUA 3TLYA 2XF2A 5BW5A 5IZ4A 4HDKA 3VC7A 1J0XO 3F74A 5E0OA 2ECQA 3FFBA 3KUKA 4Z2YA 1SPBS 4L74A 5KSOA 4V24A 1YVPA 4BLVA 3HFSA 5G3ZA 1DDGA 4LHEA 4LX8A 2SKDA 1MX5A 2PKCA 2FP4A 3EE6A 4YRMA 2XUZA 4DJJA 1E3MA 4AZ0A 1O03A 5LQNA 4MWEA 4QGGA 1XZNA 3E7WA 4X44A 4OBXA 2Z6VA 2BFDA 4B6PA 1GZUA 4I9FA 5DBIA 1QGDA 2A8YA 3QX7A 4HJXA 4Z7NB 1GA6A 1S2IA 4Q02A 4I46A 4Q4JA 4A8JA 4BVJA 1VJCA 1W0JA 3UJPA 1JALA 1H69A 2X13A 2Q5QA 4OLAA 4FDUA 4JBWA 1ULAA 1IK4A 2VG8A 5ILQA 2NNWB 3VKGA 3AHIA 4OFWA 1P45A 4C7VA 2C0PA 3OQJA 4OHVA 4R0NA 5KU1A 1XLUA 4HJRA 2NPIA 2NXJA 4J0HA 4AJPA 2ZLBA 2PX8A 4MRAA 3QHPA 3BM5A 2YVKA 4E88A 1PG0A 2WE8A 2AIRA 4HWGA 3OLWA 2O3UA 4YJHB 2VHWA 3U7HB 1FB5A 2Q9CA 4PW0A 3L7JA 3TR5A 4YR9A 1ZM4A 5EPUA 3BGOS 5C8DA 3T9CA 5K0BA 4H77A 2JIQA 2IS1A 4N0DA 1GPKA 2XMPA 3M6XA 2X4GA 4MNTA 3R9KA 1PEYA 1DX4A 2HZ7A 2O3RA 2ZAGA 4HGQA 3QA9A 8OHMA 1M2VA 4RD1A 1CY4A 1FRFS 1KAOA 3IKJA 3IR7A 2M6LA 5CCEA 1NZDA 3THSA 3V2HA 5BSWA 3W8EA 1UBOS 3MSCA 4N12A 1VA5A 2Q5FA 2W7TA 3C6XA 4KQ9A 4C4TA 1CF9A 1M33A 3JQBC 2I2AA 2VRCA 2GCOB 3D6TB 2GEBA 4LGYA 2HIAA 5DASA 3DR3A 1XEAA 4N4AA 3HGMA 5IYZA 2O7QA 4WASA 2CJFA 1F60A 2VPXA 3A36A 5ISMA 4ZVRA 2IX3A 1KZHA 3LX8A 4P4GA 2LCIA 1BDHA 1RI4A 4I5GA 3UKJA 2MYPA 2PLFA 2J7PA 5ECDA 2JHFA 3FNEA 5FTMA 4PZCA 2E9SA 3NGLA 4M0UA 3M81A 2X8JA 3GBPA 2HU7A 5J47A 1H0SA 3RSGA 4JQYA 2P9TA 5IDVA 1ZDMA 3ZCPA 1IVNA 3KOUA 2FPIB 1VGQA 2C58A 2XA2A 1T3TA 3GRUA 3OE4A 3TLAA 1NKTA 4PR0A 4JLMA 1VL1A 3PIRA 1H66A 2ZWPA 3UAWA 2BTQA 4MW5A 1N2BA 1ZK4A 3A6GA 2ZSHA 3L0PA 4Y8VA 5KYYA 1XVAA 3EEFA 1PD1A 3S5UA 5AJUA 1HSOA 2IVZA 3LFUA 4DRYA 1JR6A 1WHSB 4XWGA 3EZGA 3VNUA 2K7FA 1PYDA 3DB1A 4R54A 4LISA 1HLFA 2EP7A 1QFSA 1T0HB 3RRXA 5G02A 1N3LA 3RSHA 4K7JA 4K6CA 5M2QA 5D00A 1JT2A 1LFDB 3OWHA 1VLMA 2DZDA 5TMEA 2X22A 3RO7A 4ED9A 4ZYVA 4DIDA 3EUWA 2I4MA 4OD0A 5ITZA 1A72A 1CPYA 1HOTA 2B94A 3FTDA 1UP6A 4YACA 5JAQA 2WWVD 3VJKA 1NIPA 3SYMA 2H4FA 4Y2PA 3SEFA 1NVDA 4YCMA 1CD5A 2JKYA 5REQA 5LJIA 1K92A 4KGXA 4EG3A 3ME5A 4IZHA 3PA6A 3P0FA 1YOVA 2PT9A 2ZDQA 3I9LA 4XW2A 4AJJA 3I0NA 3OZUA 2BBOA 3VNAA 3ZXIA 4E21A 3EFEA 3TG8A 3U13A 4K81B 1ZS9A 2VWHA 4IXNA 3OTGA 2V97A 4HLUC 4NFLA 5I45A 1J5PA 3K94A 2HC9A 4CETA 3DJFA 4LCBA 3WIUA 4URXR 3SQXA 1UK7A 4U7TB 3GGJA 2MMCA 2P91A 2VHYA 4KKVA 1GKKA 2WZBA 4UM9D 2HJ9A 4S1NA 2GD6A 2YCBA 1WXHA 1ZR2A 1RVV1 1KSJA 1EA7A 1VMIA 5AVOA 1N0HA 4UCWA 1WVIA 3KJEA 4Z53A 2UU9B 3RTCA 4Y2JA 2OCBA 4FYMA 1G1MA 5KUTA 4MGZR 5IT5A 5CFOA 4ZCLA 4PTLA 1OWPA 1KY4A 4P34A 1ABFA 3O31A 1GDTA 1N0UA 4R2HA 2AZDA 3CXRA 1M34E 3I3SR 5TB5A 4DPMA 1XTQA 2R6DA 3GUVA 3PI7A 2VF2A 1KJJA 2VHTA 5CX1A 2YHSA 2HI0A 1DWQA 4AT1A 4DR4B 2GNAA 4NYIQ 1WCIA 3RTDA 3RVKA 5B6JA 4DLBA 4MS4A 3KB8A 4RPKA 1CY7A 2GQ0A 3JW8A 4Y2VA 3ROZA 4B73A 5B36A 3NW9A 1MABA 2RARA 1R9JA 4E09A 4O8CA 1YOBA 4JJEA 3E7FA 4MUEA 2GT1A 1U3UA 5IAOA 1PJ4A 1PZEA 3FCOA 4YFYA 5DBHX 3UMBA 3TCKA 4OIFA 3C3MA 4JLSA 1UXIA 3BGSA 3RS3A 1X7XB 2WJZB 1PJRA 2VP5A 3LT2A 1IXZA 4PIPA 3TG2A 2TS1A 3K6KA 2WT9A 1OYOA 4PQGA 1GM5A 1J49A 2OQIA 4B3IA 5CH3A 4PYJA 2A14A 4OUDA 1USWA 2W9XA 3BB3A 1IK6A 3C43A 4Q6WA 4UD6A 3GH3A 4ND5A 2VJBA 4D3ZA 5FLXA 1FFWA 2XUAA 2J4FA 1P8JA 4KQXA 4Q12A 3SIXA 3IJPA 5BWMA 2ZZNA 1F0KA 2ESRA 2DBQA 2PUVA 3GD5A 2JFWA 3Q3EA 4EMBA 3WDKA 1Q1AA 4JVSB 3MNFA 1ZM3A 3WXBA 3LV8A 2C1XA 3OLVA 3WOHA 1U3TA 1HDXA 4IO0A 4JB8A 1XVUA 3HMKA 4XDGA 4F3YA 4ZEVA 1NY5A 2EKDA 1XCPA 4TWBA 4R9UC 3IX7A 2QZZA 3DD1A 5HMLA 5J1TB 3TIVA 4PNPA 1YIAA 5HQJA 3HB7A 3CZ9A 2YV4A 4GP6A 5BURA 2IT1A 1L4LA 1GARA 3FUUA 4EPXA 1ZZEA 2ZVDA 2HXGA 3UG7A 1TW3A 4A2PA 4E2FA 1JZSA 4IVRA 2OCIA 1DUVG 2GPAA 4Q0MA 3RAPR 1MRZA 1XPRA 4IOLA 1RWPA 1VE6A 4N8EA 1S2MA 3PDHA 2QTWB 4KXNA 4Q3CA 4UD2A 1R10A 4RK4A 1VB5A 3FKSA 1I6KA 2EVWX 1O0SA 1G4AE 2H4HA 4EUKA 4V1CI 2VDOB 2EC5A 4M1ZA 1BMFD 3U62A 2O8VA 2AF4C 3OFND 4KPYA 4EEXA 3ORYA 3WGKA 4ZYZA 3D8HA 3HACA 2JKVA 3NHWA 1J2RA 1GIAA 3NT4A 1LWNA 1B6SA 1O9BA 3RWBA 1EK1A 4WLUA 4AUKA 1Z75A 4LZNA 2WG1A 4GI5A 3U3KA 1WEKA 5EA2A 2YJ6A 1ORWA 4GRDA 4XQ0A 2ILTA 5JMTA 5CDYA 3JAMA 1VKRA 3PUKA 3UT5B 5SZJA 1PK9A 3JCZA 1YZUA 3QKRA 4BNZA 4RJIA 3Q1LA 2OYRA 4X1YA 2YMQA 4HV4A 2RBKA 4ZTBA 1KZ9A 2PMEA 3UXMA 4F96A 4YDSA 2G7ZA 1YK0A 3VOTA 3G0OA 5A3RA 1NN0A 1PVVA 5CXQA 3OT1B 5HQ3A 1JR3D 3DV2A 4KXYA 5DTMA 1WDLA 3U5ZB 1G98A 4DAOA 4ITRC 1V4VA 2WU0A 5BNWA 3A25A 3LYUA 4B3FX 3NAZA 3PVZA 4XEUA 4FN4A 4RWZA 2PUWA 1JNYA 4KC0A 3UJDA 4LDQA 2GHTA 3FLMA 3I5UA 3PCRB 3DE4X 4XYGA 1PE0A 4QHYA 5DULA 4LSZA 1E4EB 1MTZA 1NDUA 2DTEA 3FVQA 3F5SA 4LWZA 2X0NA 3R3VA 2J6IA 3D2BA 4TLLB 2O7RA 1J9GA 4F5ZA 4DV3B 4PRZA 2VQEB 2Q2OA 4J6EA 1T25A 3SQDA 3F90A 3OHPA 4MRNA 2VHCA 3LGAA 3U1TA 4F8JA 4RS3A 3UJNA 5EMMA 1RXYA 3HMQA 4Q9KA 4TROA 4QBFA 4D1YA 1M67A 1ECJA 5BV0A 3GT7A 2FQ1A 4RV9A 4XJSA 4YJ3A 3IBFA 3UB4A 4J7CA 4Z0HO 5JD4A 2PU7A 3SJBA 4BUJA 1KHTA 1R8SA 1UM9A 3TS1A 1Q1ZA 3WMGA 3ZPXA 2XMRA 4EW3A 4R01A 3VDMA 2C4WA 1FQWA 3C87A 3MERA 1M6VB 4FOPA 1ZD3A 2G09A 2UZ0A 4EG6A 3NC1C 5D87A 1S01A 1EUDB 3K20A 2IWRA 3RRYA 1EDDA 4OOFA 1XGKA 1X7ZB 1P5FA 4MYRA 3VI4B 1JWLA 3M1IA 3R6GA 1UM8A 2CFIA 1IXRC 1JXQA 5DGDA 2DJ5A 4WVFA 4DLRA 4GPIB 3A3NA 4FHFA 4ZCQA 5FA6A 3W5JA 4QOJA 4X5OA 3RSLA 2O2JA 4GBED 3VPCA 2QAGB 4IXWA 2IEDA 2E18A 1L8QA 3IP6A 3HUEA 3MGBA 4FEYA 5E8JA 4BTEA 2ZULA 2UKDA 5JROA 2DERA 2XBMA 5TGZA 4YUVA 4P4UA 5EIXA 4C0SA 2C04A 2V65A 2XWPA 3P5SA 4KAAA 5AVTA 5K9ZA 4YMLA 3LG2A 2P9HA 4I99A 4RADA 1IBCA 1TM5E 1Z39A 1Y5LA 2ZJ1A 3S1AA 2EZUA 2GXUA 3C39A 3DBHB 3EVTA 1I33A 2P7IA 1MEOA 1ZOOA 3F9RA 1GWNA 4TV9A 5CK4A 5J5CA 1UJ4A 2WW8A 4FM9A 3H86A 4G85A 5A4KA 1Y3FE 2R60A 3O8BA 3R0IA 3ZQKA 1HYEA 3ACDA 3HP4A 4R3WA 4A0GA 1I10A 1NWCA 1T6ZA 1V4NA 4Y1RA 5EXXA 5CNJA 4DBVO 3U1BA 4CM3A 4A3SA 4DB4A 3DZGA 3WISA 4EO9A 1JKFA 1ZK2A 1XD9A 3NTRA 3R40A 4AUEA 5E1BA 4RVSA 3KJFA 5L3QB 2OENG 3D7MA 1Q7EA 4QWMA 2G9QA 3PRJA 2B82A 4CLOB 3PE4A 5C51B 1NBHA 3K6SA 3T3NA 2P2ZA 4IKOA 5HPYB 1LLCA 4G3XA 2Y71A 1O5OA 1EK5A 3MJHA 1JPJA 1DO0A 2GVNA 1H2HA 2QSZA 5C8YB 2IEZA 1EZ1A 2B9EA 4HWTA 3T1OA 1X1SA 3NGXA 4QOSA 3VH2A 2FSVC 1DC4A 3CR3C 4ME6A 3F73A 4DRZA 3I9KA 4YUWA 1BNCA 1RP1A 4BL5A 3E2PA 4A16A 5JS1A 2W6QA 5K0FA 3RD5A 3M5DA 3RSFA 1I2AA 2R2GA 2NVOA 3OEHD 5CCDA 4AO7A 4F12A 2Z43A 3A8TA 3KYCB 2ZAMA 1CUBA 4BS9A 3BZUA 2Z56A 2ERCA 2DHEA 4RESA 2YVAA 1VL6A 4I5EA 1NUTA 4B74A 4FYIA 2GCIA 3AWDA 4ZCTA 3AM4A 5FIUA 1SIUA 4FE3A 1N2HA 4NPCA 2V6MA 3BWXA 5HE9A 1UBLS 4I6JA 3JD3A 3N6XA 2QB5A 5JNTA 4I9GA 2W8BB 1HRDA 3AEKB 1RCUA 3DEYX 4G6ZA 3ZE9A 1FUIA 1PYGA 4IMIB 4JLPA 2Y66A 4EH1A 1D0SA 1XAGA 2RKWA 1ZHHA 1PW7A 5IVDA 1RYNA 4CIYA 1FY2A 3FHJA 3CY6A 1RJGA 4OUKX 4E12A 5AW6A 3MCVA 2REXB 4TWAA 1QH0A 4MW9A 5AK0A 5GJBA 3CKKA 2QQ0A 3ENNA 2QYSA 1XTJA 1RZ3A 2VBFA 3C5VA 1Z62A 4MI6A 1EX7A 3S7TA 4EJSA 4TQ9A 2PKXA 3CZ5A 4CCWA 1AHPA 1DLIA 1RPZA 2PWYA 4GQAA 1KAMA 5K8LA 5KEIA 3B48A 4CDRA 2XYVA 5JW6A 5J5VA 4ND8B 1Y3DE 1GPYA 3HU5A 2DETA 1C1DB 4FFRA 2G9RA 4L8WB 3AU9A 4QJ5A 3O73A 4J91A 4FQ5A 4OK3A 4BNGA 4CMIA 1DT5A 4FKMA 1GU7A 3WMFA 2D7CA 4X20B 2AOWA 3MMXA 1OLOA 3NJ4A 1EX1A 3NVMB 4XX0B 3COJA 3M5CA 5SYNA 2DY0A 2W90A 2EDAA 2Q1WA 1THTA 1IY1A 1YZVA 4US0R 3UMSA 4BLOA 3OIDA 1ZC3A 1TI7A 3RHSA 3RREA 1GNPA 2HX1A 4QU9A 3FPLA 2P2DA 3ZX5A 5F98A 5AHWA 1M2JA 4RPGA 4M49A 3W34A 3W8FA 2CE7A 4R7GA 3MJFA 4B4OA 4B4UA 1GZDA 1KIMA 2HPHA 4QRDA 2ZUCA 1ZOIA 2HWYA 4UU7A 3HO6A 1SXJC 1OTXA 3N2KB 4BN4A 2R5WA 4M1WA 1IJBA 1H23A 1VYHA 1N5MA 5HF8A 2PMWB 1OD6A 2DHQA 2PJUA 4ZYUA 3AP2A 5JAUA 3TJMA 4TS4A 3X2FA 4PGFA 3WHPA 3I62A 3BULA 1U0BB 3K0AB 4FD2A 1AUVA 2UUCB 3F97A 3GLVA 2O05A 2JLWA 1TCCA 4R9SA 4GXNA 5CJJA 3S2FA 3GI1A 4GF5A 5DX0A 2ZT8A 3FKQA 4B7UA 2C29D 3WLMA 2W2KB 1WKVA 2PYZA 3R3HA 4JP1A 3YASA 2W4MA 5JOQA 4ZHSA 1KQGA 2O8CA 3KS9A 2WQ6A 2PUGA 2ZSAA 4GL4A 4ABTA 2EBFX 1OFGA 2QRPA 4A1FA 4NCNA 2XRFA 2GBPA 3RVRA 4UAUA 1OGJA 4CMJA 1VG0B 3U31A 5KWVA 2COKA 1G2PA 3DMGA 4O5AA 3PEVA 1V16A 4KDRA 2Q0SA 3HB4X 3Q9UA 2WG2A 3RJMA 2UAGA 2X76A 3QNWA 1KSGA 3C4QA 2F8LA 2ZT6A 1NW7A 3WA7A 3ICPA 2BUBA 1P6UA 4G0ZA 1QIIA 3D64A 1U9CA 3EQ9A 1WXIA 2HD4A 2LZ0A 3T0FA 1USVA 4OYLA 3WHLA 4MPDA 1X1QA 1RQXA 4B6OA 2ZIUB 5CNIA 4D8XA 1OH5A 4V0RA 1XD2A 3OZCA 3BGWA 1DKUA 4C3OB 4JNKA 3E15A 1G2QA 4GO1A 2GARA 2XGOA 4F5WA 2PNFA 4C5BA 4R0MA 4EL5A 2B1IA 3I1YA 4X1YB 3GLGE 4TTTS 2OGUA 2BDTA 1UJCA 4L6IA 4RO0A 3KQKA 4P84A 1TJ5A 1M74A 1I36A 4HUJA 4EW2A 3CKLA 1GKLA 3DZFA 2XDWA 4FYHA 2Y05A 3L4SO 4HO1X 4R40A 4E1AA 4BJ5A 4E5UA 1JSRA 3A1TA 4G5HA 4LZLA 2QPLA 4HMOA 4OQNA 1RQLA 1FU4A 1TCBA 2XDQA 2I66A 2DQKA 4HFMA 5DHUA 4KREA 4KQJA 2O2CA 4KUHA 1XRLA 3U80A 3WZLA 1OXBB 2ZPTX 1KJNA 2V0CA 3LRPA 1G8MA 1UBJS 3C3WA 2H1OA 1NVVQ 3B6JA 4AURA 1ZMRA 1CETA 4MA4A 4MI3A 5HFJA 4C4ZA 4EMUA 3CZRA 3SF0A 3CF2A 1NR1A 3GB9A 3MF4A 4MB2A 1NW5A 1P9NA 3GPBA 1GJRA 3Q7QA 3NJRA 1NN1A 4UCXA 4X85A 1COWA 3CUVA 3VISA 1TECE 1X8KA 5E7MA 5KNCA 2L42A 5BMOA 2CBGA 1N6HA 3WSTA 1N2CB 1ULSA 3ASYA 4NPHA 1UMBB 2HV9A 2IYLD 4FJ0A 1MJ5A 1KL7A 3I92A 3PTLA 2O6HA 2CL6X 4N39A 4MS4B 3U81A 3G8YA 4O2AB 4HZUA 4K5QA 4EUNA 4CEIB 3QVVA 5FTNA 1B8VA 1E62A 1E9SA 2QM8A 1K7XB 2H7YA 3O03A 4XIFA 4JI1B 3WFZA 2CK3D 2Q2VA 2XCQA 3LC2O 4D4HA 3MOIA 4BKOA 1JJAA 4EB3A 3GG2A 2VUUA 1A7AA 3LUAA 4TS1A 4P0PB 3JQDA 2YWGA 4WBSA 4MITA 4B09A 2NU7A 2A94A 5H59A 3MTJA 4OU5A 1XZQA 1X19A 3WWEA 5A03A 5JQGF 2IPLA 4UUQA 3VPSA 5EERA 4HLUA 3FPAA 4MGHA 2WFMA 3F3MA 4L9WA 3H5AA 2FE1A 2VR1A 4GX5A 2XOEA 4RLQA 4B17A 2IOFA 3BWVA 1AVTA 3F6CA 1MFZA 2HMUA 3JS5A 3KDPA 1Q5PA 3A9VA 1C9JA 1NX6A 3AETB 1U0RA 3FR8A 3L7NA 2CNKA 2X0EA 2C7QA 1NYTA 3RYHB 3TX6A 4E11A 1ZVMA 1Y82A 3JYNA 1ELOA 3ND9A 4W1PA 4GM0A 4A0QA 5FWYA 3B1WA 4I1PA 1NU6A 4RHYA 3UT6A 5JHHB 4KIUA 4NAUA 3JQEA 2O6LA 3W1VA 3AF6A 2V45A 1SBQA 3STVA 2C57A 3EQ7A 3V2GA 5H02A 4YPVA 4U9HS 3GUZA 3NTUA 3SICE 3O8OA 5TF0A 4GBMA 3GGSA 3EGVA 2QTLA 3LT0A 1FNBA 2IU3A 2DFVA 5DKFA 4BV3A 1W59A 1XRJA 5CXUA 1Z4MA 2J67A 2HK9A 2PUHA 1HETA 2Y1WA 1XBTA 3V2UA 4AF6A 1G8PA 3MWYW 4YDRA 2D0PB 4F7DA 4C4PA 5ICSA 2QVBA 1JEQA 1ZW6A 2JGAA 3IOMA 3KZCA 4QARA 1F0NA 5FO0A 1XPOA 2O8CB 4DR6B 3ZDQA 1FTGA 4UM9B 4AKSA 4YUXA 2J7KA 3S2EA 3WWDA 3DLBA 1BDMA 1L1QA 2WM8A 2QUAA 3EBLA 5G40A 2ZRHA 4GI7A 2EDCA 3Q5EA 3DTTA 3F8SA 4KXXA 4QHSA 5KI6A 4BNTA 1NF8A 2WHPA 2IIPA 2JLBA 1B3RA 1J8MF 1WXQA 2I4TA 1U2GC 2KE5A 3V4OA 2BFOA 4RTOA 1J07A 3AX6A 2QORA 2E89A 4ZC1A 2EZ8A 2ZSJA 2D5CA 4KN9S 2GAIA 5U1PA 3ZU3A 4EJFA 2JB9A 5GAJA 1P2BA 5I7UA 3VO9A 4CFSA 1IJFA 4HRYA 3IEPA 2I8LA 1ZJWA 4GYYA 4E94A 3CRW1 2O2GA 1VSTA 2P9ZA 2FEWB 3MGCA 1S6YA 2I2CA 4P6VF 2G6BA 1P7VA 2RK4A 4WOCA 4OEHA 2PJZA 1BMQA 3BMOB 3GLIB 5K3CA 5A2QA 3PXCX 4KOAA 1HKUA 4IWYA 4EHJA 3H0EA 5DB4A 3TOCA 5EUQB 1US8B 4RVOA 3MTAA 2PFKA 5GZ6A 1BWQA 3KQVA 1ZYUA 2AMLA 2VF8A 5TR9A 3T7EA 4E5SA 2WWYA 3K0SA 4L7QA 5E2BA 3FPGA 4DS3A 3K1JA 3BCHA 4UBJA 1WQ1R 1T1RA 3LA6A 3B52X 1AQ6A 4NNJA 5AM2A 3VYVA 3L6DA 2A30A 1N34B 4C89A 1RVDA 1Y8ZA 5YASA 1FIUA 3CZQA 1Q14A 2K87A 3JVUA 5FFNA 1ILEA 3GWGA 1F5SA 5MF6A 1B76A 4V0QA 3L8EA 1C2TA 1ZSNA 3VHQA 2FZWA 4X8LA 3OQIB 1A2OA 4LMBA 5FBQB 5GM1A 1KR5A 3OEYA 4RAQA 1I3NA 3TBHA 1FW6A 1B6TA 1N2CA 1J1ZA 3K5IA 1UMBA 4OP1A 4CLRB 4RFLA 4A15A 3DL7A 4C0LA 4CKWB 4BP8A 2GN6A 3KKZA 1X1EA 4CEIA 2ZJAA 4YMSA 3A6HA 3EZFA 3KLNA 3IDZA 1QYIA 3UANA 2FUG6 4GXRA 2JD2A 2J6HA 4TTQA 4JVLA 3RUCA 5G0VA 2QTMA 4NCXA 4RL6A 1MORA 3RRMA 5TLSA 5THQA 4QLOA 4NENB 3RAFC 4WUTA 1QZXA 3A6DA 4DA6A 3SM9A 1ZLXA 2JCXA 4CG3A 4JYBA 1EQAA 1HO3A 3FI0A 4HB4A 1U4SA 4MAFA 3MJEA 4YJ3F 4NDNE 5E4FA 5EUMA 4PLZA 3LY9A 2GUWA 3UA3A 5JNWA 4F06A 2Z1DA 1MVOA 3DE0X 4RPCA 2VUTA 1KBQA 2X9NA 2V7QA 4DEVA 2F1OA 4XWOA 3IXLA 5KWIA 3TNLA 1L5ZA 5EFOA 1RAIA 5K6RA 2ZI3A 3AEZA 1YL6A 2GVZC 2TMDA 5DBEX 3KE8A 2W2KA 2ZR8A 1SQ5A 4FZ3A 3RGWS 3BILA 5BSUA 5GPBA 2A9QA 1Q0ZA 3O8CA 1PZMA 2R6JA 2UYYA 2XKAA 1O57A 2K6GA 3T5MA 5BN5A 1UK9A 2Q46A 3DZBA 1I4OA 3QRWA 4N0PA 1UXOA 4TMWA 3R3YA 5HCUA 4H60A 4N49A 4QBIA 2ECFA 3MCWA 4GZ5A 1YKGA 1GPDG 1XROA 1VBKA 2PFGA 2V6JA 3EQ2A 5SY4A 5T3UA 4E5PA 3UCEA 2P0EA 1KEUA 3LSTA 4Z99A 1HT0A 4MVJM 3I01A 1L4GA 3VR3D 1SELA 3OESA 1PBNA 1R2QA 1SBTA 3D8NA 1UXGA 3AZQA 3EY9A 3KQTA 5K4AA 3QF7A 1ADJA 1AUQA 1CT9A 1R7RA 3H9CA 1HE8B 3QBTA 4TMFA 3FUCA 3TEMA 2GO1A 7GPBA 3IODA 5EKSA 3V7WA 1EAMA 5EJEA 2NMVA 2OYSA 1K7CA 1F7VA 2N9UA 2AT1A 4G5GA 3A9UA 1Y4AE 4E30A 3LNTA 1Y6GA 1HY3A 1GD1O 1UZLA 1WW3A 3P9KA 2H4WA 4AFNA 2OVBA 4IFTA 3T5BA 1CJVC 1MBZA 1G9SA 1J33A 1JTEA 2Q0HA 2EG9A 1XJCA 5LDGA 1FQOA 3GPIA 1SY7A 3MGAA 2AX4A 3I4FA 3ZH9B 1Q1BA 3BF7A 3IR6A 1I5OA 4KQCA 2UXCB 4F7WA 1YDWA 3HBMA 3O9ZA 3WE7A 5CFNA 3WA6A 4Z3OA 1BOOA 4FXPA 4N8SA 1WB9A 3M6VA 3T7AA 1MW8X 1JG6A 3GDWA 4QBHA 1W2GA 1IPFA 1V6SA 2DWUA 3ER9A 2Q3HA 4RPLA 3Q8KA 3JZMA 3MD0A 3NDBB 1FFHA 1JSXA 4KAXA 4LF5B 3BWDD 4QYMA 3TZ6A 4BV9A 5JXGA 5JS7A 1BCRB 3FDFA 3HJRA 5KYNA 3LF2A 4JT9A 2MR6A 3MUNA 1BN7A 2IU0A 1Z15A 3ED1A 3LBFA 4RKFA 1UT5A 3AKDA 4JMLA 4X3CA 5EP3A 1G38A 2PYIA 2G82A 3LUGA 4GHWA 4IR7A 3MT9A 2I1WA 3R7DA 4BN5A 5LD2C 3PXXA 3AOGA 1I4LD 3P2JA 4UHFA 5C1OA 4MCJA 4PYIA 4RQBA 4Y7DA 1V5WA 3VSEA 1OLSA 1EUCA 4RLSA 3A4VA 2HNKA 3QEJA 3ZQJA 3NT2A 2XE7A 1Z8FA 2CFOA 3AQIA 3FMOB 3KTDA 3LOQA 1VIYA 3MMNA 2OPHA 4LYEA 3PHBE 4AMBA 4BYMA