1NWCA

Crystal structure of aspartate-semialdehyde dehydrogenase from haemophilus influenzae
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
371
structure length
356
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQLKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNCTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Capture of an Intermediate in the Catalytic Cycle of L-Aspartate-beta-Semialdehyde Dehydrogenase
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
molecule keywords Aspartate-semialdehyde dehydrogenase
total genus 116
structure length 356
sequence length 371
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1nwcA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nwcA01
4ZQHA 1A27A 1NFFA 1ZSYA 2PFGA 3CEAA 3N58A 2BRUA 5AYVA 2O3SA 5A9TA 1KC3A 4XA8A 4DGSA 1KBZA 1X7HA 1PWXA 5L9AA 4E2WA 1O89A 3AUAA 1U7TA 3L9WA 5JDCC 4L8VA 1IY8A 1U2DA 3G49A 2BELA 3Q3CA 5LDGA 4NBWA 3A28A 3KO8A 3AUSA 1GZ4A 2Z1NA 5JCJD 1ULUA 1TEHA 3I9NA 4YQYA 3SX2A 1DXYA 1LRKA 2BFOA 4R1NA 4BNJA 1B2LA 3KOUA 3G79A 4BKPA 5I7VA 1U3UA 3N74A 2JCVA 1X1EA 2VT3A 1OZAA 4FJ2A 3M6IA 1UUFA 4JBHA 1PWZA 4UEJA 5FI3A 5F5NA 2BLLA 1M6WA 4FPXA 2AEMA 4BGVA 2Z5LA 3EAGA 1Y8QB 2Q46A 3IQDB 5A5FA 2UDPA 3H9QA 2FR8A 4FW8A 5A9SB 4BV8A 1EQUA 4NK4A 4IGEA 1E3WB 1IUKA 1DHTA 4H16A 2VRCD 3RQSA 4ZN6A 3H9EO 4JX8A 4U7WA 2GN6A 4OOEA 1VSUA 4FFLA 3VKVA 3KSDO 3UXYA 2EW2A 1YQDA 2ZATA 3JYOA 3VPFA 3VH2A 2BFMA 3ZHZA 1VC2A 2POQX 4BNFA 1GQ2A 1HE3A 1UJMA 4JROA 3CPSA 1NR1A 3PIIA 2EJWA 3ZWVA 2Y1GA 3MJCA 1DB3A 3UW3A 3OECA 2PKQP 3ZW9A 1B3BA 3PYMA 4UVIA 4MKRA 5EQDA 3PJEA 2XXBA 4A5OA 2I99A 5T67A 1PGNA 3JQBA 4XDZA 1MX3A 1HSZA 5ER6A 4BVAA 1HDCA 3OETA 2X5JO 3OQ1A 4ID9A 3W8EA 3UHAA 5EINA 3UVEA 3QW2A 1E7QA 1PS0A 1ZK0A 3OIGA 3GY0A 4I1IA 1OI7A 1T4BA 2EHDA 3QVOA 3WIEA 1MFZA 3WGGA 1O94A 1P1IA 2Y0CA 1YJ8A 8LDHA 1YB4A 2PZMA 2Y93A 3A06A 4IJVA 2CVQA 4NFYA 3CZMA 3M2PA 3W4JA 5ADHA 2C2XA 5TSDA 4BKQA 3T4XA 1YQGA 1HZZA 3HNPA 1ENZA 1XELA 2W2LD 3LF1A 5C7OO 4NFHA 1BGVA 4HKTA 2JFHA 1GUFA 3WBBA 4LVUA 3LT1A 1E0DA 3KSUA 1SZJG 4JBGA 1KVUA 3E9QA 1B8VA 1GCUA 3EDMA 8ADHA 3GK3A 3E03A 4XX0A 3VPXA 1GL3A 4GMGA 3OF2A 4JJIA 1IHXA 3QVXA 2C0CA 2R2GA 1SAYA 4HFJA 4GSLA 1BVRA 1N92A 4IPTA 3VZPA 1HF3A 1HLPA 5B37A 1H94A 1ONPA 4RV9A 1E7WA 1BXGA 4WNIA 3ZI0A 2VZ8A 4G81A 5KOIA 2O48X 4RDIA 4D0SA 3LLSA 4DL9A 2G5CA 2HJRA 4DA9A 5BT9A 1HKUA 2O3UA 2HMWA 1SEPA 3WJ7A 3NTRA 1EK6A 4PIVA 3KBOA 4RPHA 1N1GA 4LN1A 1YDEA 2Y1OA 2DPGA 1DBVO 3TRIA 1R4NA 3WS7A 2GGSA 4MINA 1P44A 3VZRA 1YONA 3DMTC 3TZQA 1QR6A 5DF1A 3SLKA 2G17A 3DEYX 3C1AA 3TL3A 2AE2A 1Y9AA 1E3EA 4ZD6A 3HFSA 2H63A 2DBVO 2I3GA 3E82A 4IDGA 1R6DA 2P68A 2OHXA 2Y99A 3GH3A 1ZJYA 1CERA 4I9NA 3A9WA 3TF5A 1K0UA 3U4IA 4ALKA 4E5MA 3FTNA 4DIOA 3ZWPA 1WMAA 4DLAA 1R4MB 4IXWA 2XOXA 3QIVA 1MC4A 1PJQA 2RHCA 5JMPA 2EIHA 4YAGA 1LDYA 2A9FA 1O5IA 1ZZEA 3BTOA 3PXXA 4OL9A 4CM9A 1U2GA 2FHSA 5A03A 1PJ2A 2YFHA 9LDTA 1E6EA 1KEWA 2WD7A 1X7DA 3PFWO 1EE9A 4R01A 4RO0A 1P9LA 4G65A 3C1TA 3ORFA 2EERA 2FP4A 1XIVA 4FFOA 3WBFA 4BKRA 4BO6A 2IEBA 3DZGA 1PIWA 3H9GA 4OJNA 3S2FA 2VWQA 3GDFA 5JDIA 4U0JA 1NTOA 3LT4A 3PYLA 3WDSA 5C3MA 1TT5A 3D7LA 2I3AA 3A1NA 5IF3A 3WQRA 2VNSA 4FS3A 1QYWA 1E7SA 4DYDA 3U4CA 1NP3A 1T25A 3ZU5A 3PI7A 3D1LA 4KMSA 1P45A 1LLUA 2Y0DA 4JJGA 4B4OA 2A92A 1AXGA 1A7KA 1Z82A 2V6GA 4FR5A 4PLFA 2X4GA 4MP8A 4MVJE 4U6QA 2HMSA 3SJ7A 3K92A 1HYEA 1YBAA 1U4SA 1UDCA 1GEEA 4O5OA 1DRVA 1E5QA 3ETGA 1F06A 1IZ0A 3GT0A 4DPKA 3VZQA 1DDOA 2FY8A 2O4CA 4XYEA 1SB8A 1PS9A 1GV1A 2P91A 1G1AA 1I3LA 1WDMA 2JHGA 3NYWA 4LCJA 5KVCA 3JYQA 1YQXA 2P9GA 3AW9A 2UVDA 4GKVA 1NVGA 4J1QA 2PR2A 2HK7A 1J6UA 3CSDA 3F6YA 4CL3A 5TC4A 1K6JA 1QRRA 1ZMTA 2Z1MA 3W4IA 1I32A 4DMMA 4UEOA 3ZNOA 5IZCC 2G76A 3F4LA 3IJRA 3P19A 1KEPA 5HTOA 3AM4A 1AUPA 3HFGA 3Q9UA 4Y6RA 1U5CA 3RBZA 4B3JA 5JCJA 2BF7A 5G0SA 1HSOA 5JE8A 2I5PO 3VHRA 2D8AA 3KEQA 1ZJZA 3H4VA 1YBVA 3D5TA 4J16A 5I9MA 4CQLB 2AQIA 2IXBA 3I4CA 3JQEA 4FFRA 4GLOA 1UAYA 3PZRA 4PLTA 6LDHA 3AU8A 4N5LA 4R16A 2VQ3A 5AXDA 5CDSA 1YBMA 1ZEMA 4YTEA 1HDOA 3I9LA 5HBRA 1JWBB 4K6CA 4B7UA 4MVJP 4GWGA 2R00A 3M1LA 2CDCA 3WQQA 2YY7A 3R0IA 2H5LA 1HRDA 2ZB3A 1JKIA 1IYZA 2EW8A 2OO5A 1H6AA 2EP5A 5I7EA 5KKAA 4CLOB 4XZ3A 3F1LA 2G0TA 4RQUA 2ILTA 2ZYAA 4CV0A 1AXEA 1BDMA 4P22A 4B79A 4ZQFA 4ZQBA 1EBFA 1DFIA 3ANMA 1KY4A 3GFBA 3SVTA 3LU1A 1D8AA 4ZRNA 3FNFA 4ALMA 1PL6A 3OP4A 4R1SA 1NVMB 1VJTA 1DPGA 3ROQA 3FPCA 2A94A 2O3QA 3RWBA 1N1EA 4YCAA 1ISHA 1I3KA 2UV8A 4E4YA 5A06A 3ZWXA 1LLQA 1YB5A 2GCGA 4B4WA 4S3MA 3OICA 4Z0TA 2GN9A 4J7UA 2PGJA 2CSUA 3O38A 1QKIA 1NQAO 5H83A 3GDGA 2XF8A 4ALJA 4LK3A 4J1TA 1HDZA 1R66A 4WLOA 4NG5A 3K2EA 3U0BA 1MG0A 2BFPA 3GF4A 1A5ZA 1A71A 4BKOA 4UEKA 4EJMA 3WX0A 4YT8A 1ADBA 4PN3A 1WVGA 1IL0A 1BDBA 2D59A 2ZTVA 4E3ZA 3JQ6A 4XR4A 1NWHA 4CM8A 1VL6A 5CPBA 2CVZA 3WMWA 3AI2A 3P2OA 2CY0A 4AJ1A 4YRBA 4CUKA 1MC5A 1X1TA 3CMMA 1I5RA 4JN6B 1J0XO 3PQEA 3HQ4O 4QEDA 1QORA 1LDMA 1ZFNA 3E8XA 1WW8A 3HADA 3MEQA 1VLLA 5ENDA 1LU9A 5AXBA 3EUWA 4J2OA 4QO7A 2QQ5A 4R3WA 4JGBA 4D43A 3D3WA 3NT4A 4QT0A 5AOVA 4D44A 4TKMA 3TOXA 5L4NA 1GYRA 3GZ4A 2QRLA 5B4UA 4YDRA 5G2OA 2OMEA 3KYBA 2GN8A 3PWKA 4AG3A 1UZMA 2BD0A 1GZ6A 1P3DA 1AE1A 1TT5B 1XA0A 3E9NA 4QTZA 4D46A 5TIIA 4YJGA 3DTYA 4XCVA 4CV2A 4DQVA 3IS3A 4OKNA 1NBOA 5A9RA 3BMNB 2X1HA 2PWZA 4DXHA 2GRAA 4ROSA 4MIYA 2GPTA 3ZV5A 4XYMA 3KSZO 2WM3A 4CM9D 1IE3A 2Q1WA 3G0OA 1W4ZA 1LRLA 2X0JA 5T57A 2OUIA 4ALLA 3DL2A 3Q9NA 5T8KA 1ZW1A 2ZTUA 1FDTA 1B8UA 3PLRA 4XQCA 3WSWA 5B1YA 1KC1A 2D5AA 3JQGA 5BNFA 2OFPA 4IDCA 3FR7A 1DHRA 1BWSA 1T26A 3OJLA 3PDJA 3ABIA 3SXPA 5HS4A 3O4RA 4XYLA 2B5VA 1QXSA 4JP2A 4Z9XA 5TJHA 3WLEA 2JD2A 3GNTA 2H9IA 1AHIA 3BHIA 4DTIA 2JD1A 1R16A 3ETEA 2QHXA 5F1PA 5JC1A 4CMBA 2B36A 2BI7A 1F14A 1GY8A 1Z75A 2QIOA 1P74A 1RKXA 3GEDA 4NK5A 4BNKA 2X7HA 3JD4A 1RYEA 3I6IA 1Z74A 3ROKA 1BSVA 1V3TA 1Y1PA 5GZ1A 3ONEA 3ZV4A 1EQ2A 3HWRA 3JV7A 4XRGA 4IS3A 4Z6KA 1EBUA 4JK3A 5GZ6A 1NHGA 3D64A 3HN7A 3FWNA 4L4RA 4DBVO 2HQ1A 3ETDA 4BO5A 1FJHA 4EITA 2D1YA 3PJGA 4XB1A 1LLCA 1GYQA 3MJSA 5KJCA 4D3FA 2B37A 3AOEA 2Q1TA 2TMDA 1U8FO 2IZ0A 2O7SA 2QX7A 3WNVA 5JAQA 1P1JA 3DMYA 4FC6A 4XQGA 5L4LA 2PK3A 1Z45A 4DPMA 4WGGA 1AGNA 2W2LA 3GVIA 4OXNA 4E5KA 3TDKA 5JPIA 3INTA 4E21A 1E77A 4FFPA 2V6MA 5CAEA 4BHTA 3TFQA 4RZIA 2FMUA 3W8DA 1DEHA 1JWAB 1PJTA 3NDRA 3UUWA 2IYOA 3UAGA 4QFCA 1C0KA 1XR3A 1ML3A 1CQIA 1U4OA 2IZZA 3PQDA 5EQFA 4FGSA 4I9HA 2QYSA 1I0ZA 2NV6A 4QQRA 3FCOA 1V0JA 1D1SA 1D1TA 4UVGA 3DBLB 4EBFA 4J91A 5DOVA 1Z73A 3ITDA 1QG6A 4R51A 3ITKA 2YJZA 2WD7B 5IJZA 1KS9A 3IKVA 4Y98A 4Q3DA 1C3VA 2DTEA 2EXXA 2RCYA 3PEFA 4WJZA 4YRDA 5HM8A 5B4TA 3W6ZA 4FC7A 1JLLA 1H2HA 1TB4A 4WLNA 1E1LA 1JW9B 4PGFA 4OAQA 5B12A 3WGHA 5CEFA 3OM9A 1ZUD1 3JD1A 4KTVE 7ADHA 4XQEA 1Q1NA 5JYFA 1GUYA 1NASA 2J3IA 3D4PA 2PV7A 4PLYA 2Q4EA 4CM4A 1WNTA 1BXKA 1PL8A 4GX1A 3NUGA 4G2NA 4IDDA 2Y1FA 5T6BA 1HE2A 3AK4A 3C7DB 2HSDA 3ENKA 3ON5A 4IZHA 4BGEA 4IJKA 1JAYA 1R12A 4OOFA 3RKUA 1LDBA 3ZU3A 4TZTA 1N7GA 4W9NC 1GPDG 1LXCA 1RYDA 3DHYA 3IDSA 2PGDA 4HX5A 3B1JA 1FMCA 3D0OA 1MA0A 4FD3A 1E6UA 3DOJA 2ZJ1A 3QJ5A 3PRJA 3JCZA 2QZ9A 2YUTA 1OOEA 2EGHA 4R5HA 1U28A 2EJVA 1OBFO 3EZLA 1HDXA 3KYCB 3RU9A 3DR3A 2R00C 2BGLA 4ZU3A 5CDYA 5L53A 3PWSA 4XKJA 2HDHA 4YBZA 4BNIA 5CHEA 2D2IA 5K0ZA 1ZK1A 4RPGA 2ZB7A 4R68A 3SJUA 5J9GA 4II3A 1KYQA 4KQXA 3WTCA 2QYTA 5IDXA 1YWGO 4PLZA 1XQ6A 2AEJA 3QWFA 1DFHA 1DLJA 4K6FA 5T8KC 3DHEA 4YJGB 1J49A 3FRJA 2NVUA 3OMLA 4NBTA 3ENNA 2I67A 4DLLA 3K30A 3GVXA 1DC3A 4OXKA 5KJEA 4AL4A 1LX6A 1YXMA 4J0EA 4II2A 3G3EA 1EVIA 4LISA 2EKPA 2O50A 4E31A 4EJ6A 1ZBQA 2VWGA 3VTZA 1W73A 2Q99A 3T7EA 4LRTB 1XGKA 2WYUA 5T5QA 2V6FA 4U6SA 1R4MA 3H65A 5EJ2A 5THKA 4LGVA 2J5RA 4IMPA 1N5DA 1ENYA 1JU9A 1CJCA 1LNQA 4CM5A 5LDHA 1ARZA 3LSYA 3NTOA 2Q49A 3DZFA 1XQ1A 4FIZA 4B3HA 1PQWA 4BNVA 4IQ0A 3JQAA 1B16A 3L0DA 2QG4A 3MCVA 3MWEB 4XJTA 4AJ2A 1O95A 1GR0A 3E1KA 1LSOA 2X5OA 3ASVA 2V65A 3PJDA 4WCFA 4GAEA 1E3IA 1SNYA 3ONFA 4EJ0A 4KWHA 1YRLA 5ER9A 5U4QA 4U8GA 3EW7A 1LC3A 2PH3A 2GZ2A 4P38A 1WP4A 2I76A 1A4IA 1NWCA 4YPOA 1GEGA 3KM0A 3LQFA 4ONEA 1R0SA 2O23A 2X0RA 3LZ6A 4XIYA 2OP0A 1IPFA 3I3OA 5AQ1A 5EPOA 2E49A 4C7KA 1F17A 2YV1A 3JQFC 3TZKA 1HE4A 1KEVA 4TWRA 1FK8A 4W4TA 3RROA 4CJXA 4XB2A 3PQFA 3L07A 1DSSG 4OKIA 4BB5A 1C0PA 1HE5A 2NLOA 3W8FA 4UUPA 2E82A 3HHPA 4RPJA 4M8SA 2PGLA 1YL6A 4BV9A 5F5LA 2VHZA 2HUNA 3ZU4A 3U3XA 4RVGA 5BSEA 3TFOA 1JKJA 1N2SA 4Q3NA 1NR7A 4OIMA 1X15A 4IZIA 4KUHA 3QY9A 5H81A 3QWHA 1DIAA 1B14A 5TGDA 4PG7A 4IDAA 1YL7A 5G0WA 4M1QA 4W7IA 3JQ8B 2B4RO 2VOJA 4DYVA 5ITWA 1ZNQO 1LC0A 4BNXA 4MVJM 5J23A 3E48A 4W99A 4UULA 3ST7A 5IN5A 1JN0A 3ZV6A 1T1RA 1PJBA 1MV8A 2P4QA 4KUGA 1UXKA 4W82A 4YT2A 3RUDA 1C1DB 2J3KA 3RVDA 1PJCA 4CMGA 5BQFA 1CETA 1Q7GA 2PZKA 4O0LA 4O59O 4D45A 2FSSA 1PZEA 3V2HA 4Q3EA 1SBYA 1PZHA 4IQGA 3WB9A 1EDZA 1NPDA 3HDJA 5ITVA 5I7FA 3UOGA 1VJ0A 2C5AA 3SBOA 3OBBA 1YKFA 3TZCA 2HAEA 1EMDA 1VM6A 2DTDA 3G1TA 2ZK7A 1HEUA 2NTNA 3RU7A 2PKRA 1RM0A 2VZ9A 4B4UA 4DUPA 4CLOA 4OHUA 1LDGA 3FBGA 4Z0PA 2EKQA 4NBRA 3N7UA 3NT5A 3AY6A 4D42A 5KVVA 1DC6A 3EY4A 1EUCA 4RVSA 2YV3A 4BNYA 2FN7A 3HN2A 4BKUA 4E5NA 3L77A 2VHYA 2C20A 4B7CA 2Q2WA 3STHA 3I6QA 1O6ZA 1E1MA 2ZCVA 4DMLA 4XGIA 1A4UA 4NJMA 4QECA 3NGXA 4BMVA 4N7RA 1V3UA 3DOCA 3EZYA 4YWJA 3OA2A 1ZVMA 2O2YA 2QRJA 3NRCA 3E18A 3VPSA 5IAAA 1L1FA 4XEHA 2GYYA 1E3WA 2HLPA 4XYBA 4PZDA 3HE3A 4F46A 1F12A 2VYVD 3BAZA 1HDRA 5G0TA 3FPLA 1BVUA 1ZEJA 2FRDA 1DJQA 4IJWA 4NU5A 5L4SA 3DOOA 1NVTA 3ZDFA 4Q39A 3W4KA 4Q3CA 1DIRA 4YXFA 1VPDA 4PVCA 1LSJA 3K31A 3GG2A 2A35A 3B1KA 5AVOA 3DTTA 4NR0A 3UGKA 4F6CA 5KJ6A 4OQZA 2X9NA 1FDWA 4R1TA 4O63O 3JQBC 5ICMA 3UKOA 1ADGA 3PHHA 5CDGA 2P9EA 1MP0A 1Y6JA 3OH8A 1U7HA 3QP9A 1T4DA 3CE6A 5IXSA 4H7PA 4NHEA 4TROA 4NIMA 5CPFA 2OBNA 3AOGA 2Q1UA 1G6KA 4E5YA 2D4AA 3PHLA 4J90A 5FWNA 3U09A 3MZ0A 3EVNA 3NAQA 1P0FA 3OSUA 3RAJA 1KETA 2OOSA 3NX4A 3UCFA 3IC5A 3JD0A 1J5PA 5EIOA 3I9KA 4CLXA 4BNTA 5CEEA 1YE3A 1CIVA 4BNHA 3IIEA 3Q6IA 3Q1LA 4WCFC 1RJWA 5G4KA 4BS9A 2X86A 4MKZA 2ZKLA 3RUHA 1XSEA 4WEQA 3GHYA 3D3WB 3HB4X 5JBIA 4CQMD 4TSKA 2C7VA 1XHLA 2O3RA 4HNGA 5F1KA 4FFNA 3VH4A 1F8GA 1R15A 1SCUA 1IPEA 2NNLD 1MUUA 1Q0QA 4BIIA 3WGTA 1B3RA 4J4HA 4YAEA 4QSMA 2SCUA 1OMOA 3QSGA 2IE0A 3TWOA 4CR8A 2YQ5A 4PFJA 4WE3A 4ZRMA 2CF5A 4D3DA 3QE3A 2Q50A 4TMFA 1MFPA 2HMUA 1LJ8A 1YDWA 2C82A 3JD3A 4PRLA 4URFA 1P31A 3ZW8A 1D3AA 3HDQA 3DB2A 2GZ1A 2IDZA 2UUPA 3P7MA 2CUKA 2YZ7A 1NQTA 3WQSB 2Q4BA 3TZ6A 5EESA 3M1AA 3B70A 3AM3A 5CG1A 3INRA 4O6VA 2JD0A 4DIFA 3KRTA 5DDIP 1KVTA 3IOYA 3F9IA 3MOIA 1XLTA 4JXKA 1B0AA 3NTQA 3DBRB 4GI2A 4BO3A 1Y9EA 3RUCA 3FF4A 3SC4A 5DBFA 3FR8A 4YJHA 1GADO 1EEHA 3WIDA 3CXRA 1DAPA 3JQ8A 4PLCA 4DQUA 3GVHA 1IHYA 3IAHA 1E6WA 5JYEA 5G4LA 3RUFA 1RM3A 2OGUA 1AHHA 2GERA 3NDJA 4HADA 1H0KA 4Z9FA 4AJNA 4WNCA 3GAFA 5FEUA 1RPNA 3DQPA 4WASA 4LSWA 3Q2KA 2X9GA 1F0YA 4MVJI 3ICCA 4HY3A 3LT0A 2EGGA 4NQZA 2ET6A 3GLQA 4MJLA 3KVOA 3L4BC 1HWYA 2CDBA 3NJ8A 1R0LA 3IMFA 5A3VA 4A73A 1ZH8A 3KYCA 4OSPA 2E37A 1V6AA 3I9JA 3PWZA 3SEFA 2X0IA 1ONNA 3ZWMA 4YT5A 5JY1A 3ZNPA 2I6TA 3BA1A 3KYDA 3WGZA 6ADHA 3JYPA 1Y5MA 3VPGA 1F8FA 3KTDA 4FGWA 4JQCA 1C14A 1QV6A 2DM6A 4CMIB 1VI2A 4LVCA 3WGIA 3ADOA 3GVPA 4GGPA 2AQKA 1B8PA 3L6DA 2X0NA 4GH5A 3F5SA 2AMFA 2X58A 3H8VA 4F45A 4OM8A 1K3TA 2PD6A 3JQCA 4P4GA 3S2EA 4E6PA 2DQ4A 1XWFA 4IXTA 2VTEA 1A7AA 2CVOA 1WAMA 4FJ1A 1PJ3A 4E5PA 3HDYA 3D4OA 5C7LO 4YR9A 5IXYA 4PLGA 2YHUA 4GGOA 4I5DA 2DLDA 3RUAA 3GZNA 3RFTA 1BG6A 3ASUA 1I2ZA 2LDBA 2YHIB 3PHGA 4U0KA 1I33A 3GRKA 2DAPA 2WYVA 5K9ZA 4G5HA 4MVJH 3BTSA 5COBA 1YOVA 1XG5A 2WMDA 4OGWA 1QV7A 1VL0A 4E13A 1JKFA 4GSKA 4MOWA 2NACA 3GN1A 3TQHA 2J5KA 1O8CA 1LQUA 4R9SA 1SMKA 4HUJA 3D4NA 1GAEO 2NSDA 1LBEA 2DFVA 1N8KA 5IZCA 9LDBA 1HZJA 5C37A 1CQJA 3EMKA 2VHWA 1BXZA 1H2BA 4UVDA 5HWSA 4ND3A 1NAHA 2Y1DA 4BNLA 4YYZA 1PGJA 2W90A 3RC1A 2FSVA 1ISFA 2J3HA 4NZ9A 1PL7A 2VUSA 3PTZA 2BGKA 3W6UA 1ONOA 4IINA 5TT0A 5L7TA 1K89A 2WSBA 4MVJG 3RBVA 4CV1A 3ZWAA 4PG8A 1E7YA 3CIFA 2P5YA 3S2GA 1HL3A 4XIJA 1MGOA 5GZ3A 1MXFA 2IRWA 2WEKA 5JY6A 5JCXA 5KKCA 4CMJA 4UUMA 1VKNA 3DZHA 3GVCA 5TQVA 4NPCA 3U62A 5COQA 1Y8QA 3WWYA 3MTGA 3E6AA 3JQGB 1E3SA 3EYWA 3Q11A 3AI3A 3PK0A 4Y6PA 4XDYA 4WPGA 4OQYA 3FN4A 2FZEA 4RPLA 3D5QA 1EVZA 3PHJA 4W6ZA 1EVYA 1UZLA 2IEDA 3V1UA 1I10A 3MOGA 5DCUA 1U3TA 4CMHA 3LC7O 5TT1A 4IJUA 1UAGA 3BTUA 2PZLA 3NJ4A 4PCVA 2AQHA 3AY3A 3F46A 3VTFA 1B15A 4EUFA 3ROMA 2B35A 4OH1A 3VZSA 2PZJA 1UR5A 5TNXA 2P9CA 2NVUB 4QX6A 3PPIA 3I52A 4B8ZA 1PJ4A 1SOVA 3JQ7A 1HYGA 2EKLA 1TVEA 1XEAA 1H6CA 3LC1O 3OJOA 3V1TC 4J9VA 1C1DA 3R6DA 5G0UA 4D41A 1I36A 4CR6A 4OSOA 2YDXA 3RKRA 3GPIA 4R4JA 3V2GA 4CMEC 3LVFO 2FPPA 4D3SA 3F5QA 4TQGA 4HBGA 1Y8RA 3GUYA 1PU2A 3PJFA 1FF9A 3JQDA 4R1UA 1QYVA 1XU7A 2C7GA 1ZSVA 2J3JA 4Z3DA 3U4DA 1LLDA 4UVEA 4BNGA 4CQMA 2RH8A 5LC1A 1LDNA 1MXHA 2WE7A 3LF2A 4K26A 1DLIA 4IIUA 3GDOA 3K96A 5EERA 4ZQGA 3S55A 3AFNA 4I8XA 3NEPX 2NQTA 5MDHA 5IFLA 3GNQA 3R1IA 2DUWA 5DCYA 5TRTA 5BNTA 2WE8A 1A9YA 2Y1EA 4Z9YA 3JD2A 4HXYA 1BW9A 3VDQA 1QLJA 5KCZA 2HKIA 4J7XA 3OHSX 3RASA 1PQPA 3QA9A 5DNAA 1L7EA 4IGFA 2HJSA 1DOHA 1CWUA 1VRWA 4CODB 1UP6A 4R54A 1GPJA 3BMQB 4W9NA 3BMCB 4M49A 3GGGA 3WOHA 4GX5A 3E5RA 1EK5A 3C7AA 3I1JA 4KTTE 1XYGA 3BZUA 5JNLA 5A1TA 5C5IA 4U5QA 1DFGA 1LSUA 3SC6A 2RIRA 3T7CA 3V8BA 3WSVA 1SEVA 3RJ9A 5I9LA 3GRPA 1T24A 4YJFA 1OC2A 4AJHA 3OJFA 4BQRA 4RLSA 5DP1A 2RH4A 2NU8A 4Z0HO 5L7YA 3K73O 1HETA 1GZ3A 1O9BA 4XGKA 2HRZA 3HB5X 4FJ0A 5DULA 5EN4A 3ZHYA 4CLEA 4ZQEA 3KETA 2ZQYA 5TX7A 2VHVA 3WNQA 3OEWA 1JVSA 5A04A 5I7SA 4OMUA 4I9UA 3VVCA 1JTVA 1YL5A 1LA2A 5CEJA 3HUDA 4E33A 3I4FA 3QWBA 2B83A 4WOKA 5FI5A 5KTKA 5KVSA 1EFLA 4MKXA 1WDLA 1H9AA 2Y1CA 2AQ8A 3PHIA 3LYLA 3BMQA 1I01A 2R6JA 4B4VA 2YYYA 4XYGA 3UCEA 4HV4A 4YJDA 4NU6A 1QYXA 4IY1A 1WPQA 5GMOA 1DAOA 1YOVB 1I2CA 3GMSA 3TL2A 2VYVA 4CMEA 2P2SA 2D5CA 2FPGA 2YQ4A 1PX0A 5DBGA 5A4DA 2JJYA 1I2BA 3DBHA 4KUEA 5CP8A 1R0KA 4Q3BA 1ADCA 4EYEA 3NKLA 4Y67A 4AFNA 1B26A 4ZJUA 3EHEA 2HRBA 4GX0A 1W8DA 4FQ8A 1YJQA 4J4BA 1QYCA 3VDRA 3PFFA 4H15A 3L6OO 5A05A 3RC7A 1CRWG 2HMTA 4JLWA 3GAZA 3CTMA 4IDBA 1H9BA 2X8LA 2Y68A 3H9JA 4BO9A 3IP3A 2OXIA 3U9LA 3L4SO 2P5UA 1EUZA 1JA9A 2GD1O 1Y81A 5BSFA 4WLUA 2B4QA 1XU9A 3I5MA 3ZNQA 4ALNA 1C0LA 2X22A 2ZQZA 4IBOA 1UP4A 4CM1A 3IL2A 2VCYA 1DRUA 2CFCA 3K6JA 3PZBA 4Y9DA 1YGYA 1Q0LA 1T2DA 4RORA 1Y7TA 5JDCA 1WWKA 1PGPA 2EEZA 3TNLA 5JMWA 3FBTA 4FOSA 4X54A 3FHLA 4DBZA 1V9LA 1I3MA 2HK9A 4B7XA 3AM5A 3DFZA 3QV1A 3AWDA 3QWIA 2AHRA 4ZVVA 1ZK2A 1GDHA 2ZB4A 4YAKA 3U49A 4WLFA 3WFIA 2NQ8A 3V2UA 1W0CA 3QVWA 3FTPA 4OXYA 5CDUA 4J6FA 1VE9A 3C85A 5ENVA 3UF0A 3QWAA 1PZGA 4J1SA 3CMCO 1ZKMA 3PYXA 5C7IO 2H6EA 5ICSA 2DU8A 4P4NA 4PG4A 4JBIA 3INGA 1QYDA 1TI7A 3BYZA 1NXQA 1BRMA 1GUZA 3GN2A 1M6HA 2GF2A 4A2CA 3RC2A 1N9GA 2YFQA 4EUHA 3GC6A 2DBQA 3OA0A 4CM6A 3H5NA 1PR3A 5JC8A 1I30A 1RM5A 1I3NA 3GPDG 3BMOB 4ND2A 4A0SA 4CQLA 2Q3EA 4WKGA 1HT0A 1QLHA 2NM0A 4HFRA 5B4VA 4AJPA 4J2HA 4CLRB 4GPD1 2E4AA 5G0VA 1P77A 3KXDA 2GR9A 3BHJA 1LTHR 3K8ZA 1P1HA 3KHUA 4IDEA 4FBGA 1YO6A 2NU7A 3NDIA 1R37A 4JIGA 4AVYA 1GFSA 3GEMA 3ICPA 2NVWA 1M66A 3DAFA 4CPDA 3LLVA 2VWPA 1ZXLA 3HJAA 1R4NB 1P1FA 1UDBA 4QFDA 4J9UE 1RWBA 1L7DA 4R9RA 3ZHBA 4I08A 2Q2VA 4E12A 5A02A 1SB9A 4Q9NA 2CZCA 2FR0A 4RJTA 5L3ZA 3GQVA 2W98A 3GUCA 2Y67A 1T2EA 3DAPA 4CR7A 2AG5A 1BW9B 4RF3A 1YVEI 4YAJA 1KVRA 3DMTA 1H5QA 3KZVA 4CMAA 5TLSA 3EVTA 4BGIA 1E1NA 3MJTA 4KZPA 2XXJA 1HLDA 4FDAA 1GYPA 1X0VA 4BUCA 4XD2A 1P33A 3AI1A 4KDEA 4PLVA 1WDKA 2PKQO 1GV0A 1M75A 2OORA 2BMAA 1GU7A 3I83A 3B1FA 5AXCA 5G4KB 1PGQA 2DFDA 2EF1A 3RFVA 2BFAA 3ROPA 1PJLA 2WYWA 2B0JA 4YT4A 3F1KA 4EEXA 3DHNA 4UUOA 2H1SA 2AG8A 2Y05A 3OQBA 4UAGA 4D79A 2Q22A 4RQTA 2JCXA 4RF4A 3GGPA 1D7OA 2HU2A 4BNUA 1ZK4A 4WEOA 1PJSA 3EK2A 2JAPA 2JFGA 1LSSA 1FXSA 4BO2A 4L4XA 3E5MA 3S8MA 4ESOA 5JAMA 1HDGO 3VH3A 2Y0EA 3JQFA 4GL4A 4AJJA 1PSDA 4LRSB 3VAZA 2ZB8A 3O26A 3NGLA 4E2ZA 4K28A 2X23A 1P1RA 3H3JA 1OC4A 4YAIA 1MB4A 3DFUA 2J5QA 2OBYA 2XAAA 2DTXA 4ZHSA 3F4BA 4E2XA 1X0XA 4KOAA 2GSDA 2G1UA 1E3JA 2V6BA 3Q2IA 2PNFA 3WMXA 5TJ9A 4PLHA 4MPDA 1DIBA 2FPIA 1BMDA 2W2KA 3I9MA 4L73A 4P8RA 1KVQA 1HDYA 2TMGA 5JYDA 1DIGA 4XWYA 4BOYA 1M2WA 3K9QO 3MJ4A 2HK8A 4EEZA 3RC9A 2VHXA 2RAFA 5EMHA 1ISGA 1CEQA 4M55A 3FD8A 4GQAA 3WJAA 4ND4A 4RF2A 3JQAB 4XRRA 4CMKA 3LT2A 1NHWA 3ZHXA 3P2YA 4TRNA 3JYNA 2ZCUA 2NTJA 4CLHA 3ZZNA 3QQPA 5K6AA 4MO2A 2FR1A 2DBZA 3H2SA 1GD1O 4HWKA 3ZWWA 1IZ9A 3UH1A 2WTBA 4NDNE 3KB6A 5HS6A 4FOOA 2WDZA 1A9ZA 2QZZA 3O03A 3FSRA 4M86A 1YH3A 4MVJD 3OJ0A 3VC7A 5IDWA 5JDIC 3ZWNA 4ND5A 1XCBA 4I5GA 4GX2A 3RIHA 4GVLA 4DC1A 5GY7A 1UXIA 4CV3A 4FFMA 1K2WA 4IQ8A 2G82A 2GLXA 2O3JA 3G1UA 4RVHA 4YVFA 3ZGYA 2GN4A 3PLNA 1NQ5A 4AJIA 1V35A 5BNIA 1TXGA 3FNEA 1E5LA 3UCXA 4CL8A 4R5MA 2JCYA 4AJ4A 3PVZA 2OP1A 3JQ9A 4CQMB 1G0NA 1UH5A 2YHIA 3X2FA 3BTVA 3OJEA 2RBEA 5HRUA 3WR5A 5I9NA 1K5HA 1UZNA 4L0QA 1I8TA 5BR7A 5F3RA 1SO8A 3WICA 3VH1A 1KIFA 2AXQA 1RM4A 5A3JA 3WYEA 1NM5A 1E7RA 5KVQA 3LK7A 5EL0A 4TKLA 1FDSA 3DBVO 3DZBA 1NFRA 4BL5A 2BH9A 3DAGA 3WYBA 3I9OA 5I8ZA 4LCEA 5ILGA 4BMNA 4AICA 2W4QA 5BSGA 1XDWA 1PR9A 4E32A 3HG7A 4R41A 3GZNB 1Q7BA 2VWHA 3H3FA 3FI9A 4RL6A 4HNHA 4W7HA 4RDHA 2FWMX 1XKQA 5A9SA 5L95A 3ZWYA 2VT2A 1IB6A 3L9XA 3TN7A 5L7WA 2PY6A 1Q0HA 4GMFA 5JAZA 4INAA 4YJFB 1MLDA 5DP2A 4TZKA 4BMSA 2C07A 4A26A 4DQXA 2CMDA 1WZEA 2EWMA 3WTBA 4M54A 3WGYA 3FWZA 4IDFA 4FB5A 5CG2A 2O7QA 3RJ5A 3JTMA 3DBRA 1NYTA 3ZN2A 5T64A 4RCVA 2VZ0A 3CINA 1ISMA 1S6YA 4RVUA 5F21A 1ID1A 3S1LA 1TLTA 3H9UA 4CM8B 4ILKA 5L40A 1U3WA 1H93A 3WLFA 3TOZA 1Q7CA 1T2CA 2X6TA 3AFMA 4YEDA 2CNBA 1KVSA 1A72A 1ZSNA 4D0RA 4QUKA 4D7AA 2IXAA 3BIOA 3TPCA 4ALIA 1OFGA 4IM7A 5DN9A 4IMRA 4ZICA 2B69A 3K5PA 1E1KA 4XGNA 3AU9A 3DONA 1D4FA 2NUAA 4FCCA 1X13A 2V7PA 1DO8A 4AJOA 1E7MA 1CDOA 2AA3A 2EP7A 4PG5A 3DBHB 4E30A 4TRMA 1Y8RB 4IS2A 4I5FA 4PLWA 1U9JA 2Z95A 4DPLA 1BHSA 1SC6A 2HCTA 2C59A 5U1PA 2NU6A 2IYPA 4K1LA 2DUUA 3C1OA 3COSA 4CMIA 4J7CA 4NMHA 2OZPA 2DVMA 2BGMA 1ENOA 3VKUA 1C0IA 3WWZA 2AEFA 4CM4B 3PGXA 4Z3KA 5KWEA 3HZZA 4CMCA 4J0FA 3Q0EA 3JSAA 3JQ7B 1LRJA 1TA4A 5IN4A 4DC0A 5CDTA 3ZH2A 4R69A 3RCBA 1BXGB 1FDUA 2UYYA 3U4HA 2O3TA 4J1NA 1PQUA 3WXBA 3HDHA 3R3SA 3M2TA 3V1YA 3WG9A 3CZRA 4R3NA 3P5SA 1HXHA 2QW8A 4L9RA 1I24A 1ZMOA 2VNAA 2QRKA 5TS3A 1VJ1A 3DZIA 3UICA 1BTOA 4RZHA 1ISIA 3GA0A 3E9MA 2W2KB 1LEHA 3DWFA 2NU9A 2BHLA 3GFGA 1K6IA 3ADPA 1ENPA 2YV2A 4EGFA 5KJFA 3EC7A 2CF6A 2Y66A 2AE1A 3GMDA 3ZWOA 3KLMX 3DO5A 5JAIA 2VTDA 3NV9A 2VRBA 4NBUA 3EGOA 2FOIA 2EG9A 4FSHA 3ULKA 1U5AA 4JNKA 2RHRA 2VOEA 5DZSA 4DIBA 3QLJA 3DC2A 4PLPA 4WK6A 1GCOA 4M89A 3DZJA 5JO0A 5ES3A 3RI3A 4A27A 3H5AA 4MP6A 3JQAD 1AN9A 5KJ1A 2ZYDA 1UP7A 3AY7A 1NX6A 4M87A 3WFJA 4EW6A 2E48A 2ZTLA 3GOHA 4BGUA 2PTGA 2HMVA 5ILOA 4E2YA 2C54A 5JXWA 3CUKA 3MTJA 4EI2A 2YDYA 1EDOA 1CF2O 3G17A 3ONDA 2NWQA 2ZJ0A 4UREA 3F47A 4DWVA 2NVBA 4KP7A 2NADA 3OQ6A 2VUTA 4HFNA 4S1VA 2FZWA 4PG6A 4GLLA 4A7PA 4B8WA 1Y5RA 4PRKA 2BI8A 3R3JA 1ZIDA 5HA5A 3IUSA 3A14A 4CM3A 4RPKA 1WLYA 4L4SA 3FNHA 3FNGA 1WMBA 2VYNA 4K9DA 2X5KO 1NAIA 4KDFA 2LDXA 1PZFA 4HFMA 3RSHA 1T1SA 1JDJA 4ND1A 5BSHA 2JFFA 1DIHA 2A4KA 5FYDA 5KIAA 5TF4A 3RFXA 4ZGWA 3QVTA 3K2BA 3X2EA 4XJSA 4WUVA 3AUUA 3C7CB 5AXAA 1EZ4A 1Q2XA 2DKNA 2PA3A 1MG5A 3RD5A 1GTMA 3CKYA 3L4BA 3LC2O 4CUZA 3HSKA 1U1IA 2CD9A 2DPHA 2DC1A 4XQ9A 5FF9A 3T4EA 5M6DA 3B6ZA 4PZCA 4YB8A 1B7GO 4YRAA 1EUDA 3WGQA 5MGBA 5DBIA 2AW5A 4Y6SA 3AOEC 4NJMB 1EE2A 1KEUA 3OEYA 5F1OA 3DBLA 3I23A 4CLDA 4L75A 4AJKA 2F1KA 4NH4A 1E92A 4UVHA 1IULA 3H2ZA 1VKOA 1SOWA 4QO8A 4WOJA 4YA6A 4MIEA 1ZK3A 3GHHA 3ZCXA 3GGOA 4OO3A 3A4VA 5DCWA 3H7AA 2PD4A 1U3VA 4B3IA 2I9PA 3RUEA 3ANNA 2CDAA 4BO8A 4TRRA 2UUOA 2IZ1A 1O0SA 3IUPA 4KQWA 2EV9A 5JW6A 5IZ4A 4TVOA 4ITUA 4DLBA 2VRCA 2D0IA 2JL1A 1WZIA 1PS8A 5THQA 1E3LA 1ZCJA 2I66A 4OYRA 3KLPX 1PTJA 1PEDA 1M76A 1UXHA 1UXJA 2GUGA 3BMNA 3GEGA 4TVBA 3ZWBA 1Z6ZA 3PDUA 5JSFA 3KUXA 4N5NA 3DZKA 4C4OA 2VUUA 4P4LA 4I5EA 1C1XA 1ADFA 5JFOA 3O9ZA 4N18A 4NI5A 2GASA 1TT7A 4A10A 3PP8A 3VOSA 1V3VA 4N5MA 2C29D 3AUTA 4RLHA 5JYAA 3PIDA 4RVFA 2YW9A 2D3TA 2XPCA 3BMCA 4EUEA 1OAAA 2I65A 4GWKA 2J6IA 2IODA 5I8WA 3JQ9C 4DVJA 4J3FA 1JAXA 5KNLA 1G0OA 4LW8A 4MDHA 4MVJF 5U9CA 4C7JA 4AJLA 4BO0A 7MDHA 3DXFA 4BB6A 5IG2A 4BNMA 4DREA 4YQZA 4NBVA 3V5NA 4WECA 3TJRA 1DRWA 3CH6A 4CUJA 1P1KA 2Q2QA 3ZNNA 1PGOA 4GBJA 4NFSA 1DC5A 3L6EA 4TRJA 1S7CA 1K6XA 5K6AC 4AJEA 5JS6A 2UAGA 5H82A 1ORRA 4KWIA 2ZIZA 4UUNA 1M67A 2Q1SA 4BNZA 4WLVA 2P4HX 3BMOA 1HTBA 4EDFA 5JO9A 4BO7A 2WD8A 1P0CA 3GG9A 3SLGA 4FN4A 1KERA 2J8ZA 2Q45A 1C1XB 4CM7A 2GDZA 3UFXA 1NPTO 1LDEA 4J4TA 2GNAA 3RBXA 1QSGA 1ZO8A 2JKVA 1CYDA 3C3XA 1H6DA 3WGOA 3RUIA 2C5EA 1NPYA 3D3EA 5FFFA 4A03A 4H3VA 1FDVA 3IP1A 4WCDA 4MVJA 4O1MA 2O4UX 1LUAA 3MWDB 1IOLA 2VN8A 3IJPA 3ZWCA 4PVDA 4HP8A 2JAHA 4YJHB 4MP3A 3QRWA 4JCOA 3OFSA 1JVBA 1T2AA 2ZYGA 4RF5A 4WCFB 4J49A 3VVBA 1WXDA 1YS4A 3H5RA 5DOZA 3AJRA 2HO5A 1YB1A 4JP3A 1KY5A 2JHFA 2GZ3A 5LCXA 3F3SA 3O8QB 2NTVA 1Z7EA 3OIDA 1N7HA 4BNWA 1GQQA 4BO4A 3GNSA 1HYHA 1NNUA 2DT5A 4RVDA 2X9VA 4ZA2A 4GVXA 2OL4A 1GQYA 2ZTMA 2PD3A 1W6UA 4LSMA 2B5WA 4YACA 1U8XX 5L51A 1Z7BA 4WLEA 3ZV3A 3PGJA 1X14A 3KYDB 3MJVA 4DRYA 1DC4A 3C8MA 5DT9A 5JLAA 5T73A 3TZHA 4Y8VA 5L45A 1LQTA 3W1VA 3KEOA 3B20A 3WYCA 4BQPA 1H6BA 3VPHA 1V8BA 1QMGA 3S2IA 4MIOA 1NQOA 2E6UX 2PLAA 4E0BA 5A5EA 4NNJA 3U5TA 4N54A 1X7GA 4L76A 1VL8A 2F00A 1ISJA 5COAA 2W8ZA 4BNNA 1LI4A 4IIVA 4J43A 1NFQA 3JYLA 4RGBA 1ULSA 1VSVA 4L74A 3UN1A 1KOLA 4JJFA 2WJPA 1DJNA 3MJEA 3OIFA 1JQBA 4NJOA 1T2FA 3LDHA 1SPXA 1UXGA 2GO1A 1N9GB 4LMRA 4EZBA 3ANLA 2O2SA 3BHMA 2DBRA 3O8QA 4QXMA 4LMPA 3H6KA 4F6LA 4GKBA 4XR9A 1QP8A 2BKAA 1EFKA 3DDNA 3IKTA 1ZXBA 3KV3O 1J4AA 3QHAA 2VYND 3TSCA 3ZU2A 5IDQA 4CLRA 1UDAA 2PH5A 4BO1A 4Q3AA 2B4TO 3BXXA 4PZEA 5IDYA 3NT2A 3GR6A 3QVSA 4IUYA 4F3YA 5CFZA 2WWRA 1EVJA 3C24A 2C2YA
chains in the Genus database with same CATH superfamily
1X1CA 2P6UA 2XKBA 2JIPA 1IG3A 3CEAA 2W6MA 4COKA 1PQYA 1EK1A 3RYFA 1LV7A 4DGSA 4IIFA 3VZDA 2LIVA 4E2WA 3IUJA 3AUAA 1U7TA 4RTKA 4JFRA 3BRSA 4LHYA 3Q3CA 3G49A 3IQWA 4B43A 4D4HA 5MFZA 3WYDA 2B8TA 1T8WA 3A28A 1J0CA 2HX1A 2CVFA 3AUSA 4NXMB 1KMMA 3ABZA 5JD4A 1WF3A 4R1NA 2BFOA 4C6RA 2WF7A 1B2LA 3G79A 5KHAA 2QT1A 1QPGA 3LBHA 1X1EA 4JJKA 5JATA 2VT3A 1NUQA 1K66A 4W1QA 4JBHA 3HL4A 3KWFA 1U2EA 5F5NA 3LGAA 2BLLA 4DSUA 4BGVA 4EA6A 2ON6A 2Q46A 1QO9A 3ZU6A 1OB5A 2G88A 1U1DA 2ERCA 1OTHA 3BIWA 3NHYA 3KU4A 2PRSA 2QE7A 2BFDB 3A9CA 4GR4A 4INJA 4KAFA 4G36A 3RU2A 3Q15C 1CR6A 3S1AB 5FEMA 1YZ3A 1QB7A 4WV3A 1KKLA 1GRNA 5H68A 3O84A 3Q0IA 4ZN6A 3H9EO 2QE6A 4U7WA 2GN6A 4OOEA 2C3YA 4IGKA 2GETA 3TAXA 1RRFA 1YQDA 3GAAA 4ZAVA 3GFTA 4C6TB 3ZHZA 1MA3A 4UATA 3I61A 2BEVA 2XJ9A 4IH9A 4QOIA 4CWAA 4JROA 3ZS8A 2A5FA 4AZSA 4TZ6A 2I80A 3BK2A 4C3OB 2D2FA 2H1FA 2HBZA 2X2EA 3V4SA 2WLTA 4WKNA 4K9LA 4AKTA 4QM7A 1ZHFA 1SJ9A 3PHBE 3U7RA 3BERA 3LS2A 2GJ4A 3WKEA 2C95A 1PGNA 1N6IA 3JATA 4XDZA 1TE2A 4F6RB 1V4VA 2NG1A 4LXTA 4ID9A 3V6MA 2B30A 4JQYA 3GLHA 4KYVA 3RK1A 1E7QA 5MN4A 3OIGA 1JEDA 4L2IB 3QVOA 3WIEA 4JJZA 1JWLA 1MFZA 3VPCA 3WGGA 5DM70 2XADA 5AW5A 3KE9A 4IV8A 4ZYWA 1DQZA 5D3MA 2BYTA 2FG5A 2PX0A 2O5EA 2CVQA 1RJGA 4NFYA 4YP6A 4FI3F 1SC1A 1NN1A 3W4JA 1B93A 2VEOA 3U3MA 1YB6A 4BAGA 2ZANA 1YQGA 2IELA 3H05A 2GBLA 4HX9A 3VI4B 2HJ9A 2Q3DA 1ZM3A 1XELA 3W2FA 3ZHVA 5BSUA 4NFHA 5ALGA 4BTVA 5BQ3A 3FB4A 5KOJB 3RHZA 3VC3A 1GHTA 3WBBA 1YHYA 1E0DA 1GCGA 1WCYA 2Y8EA 1JSLA 4TM7A 1K8XB 2C83A 3ZXYA 4AZVA 2O1XA 1X42A 5LIRA 5DM4A 1TKBA 4XX0A 4ACAA 2TSYB 4L6IA 1ACMA 3OF2A 1XXHA 5LLSA 2ES4A 5ALHA 4Z9AA 1I7SB 4J0QA 1PYDA 4NCAA 3SZ3A 2IKQA 3QVXA 1F1JA 3TFWA 2C0CA 2BY4A 2NSHA 3TG8A 2H5EA 2WVJA 1N92A 2I1LA 2X8BA 3EZ2A 1DAIA 4ERXA 1HF3A 5P8WA 2GNOA 1H94A 4XVRA 2ZYHA 4HL6A 1PBTA 2ISQA 2ZR7A 2XYVA 3ZI0A 3NOQA 4QBFA 3VKHA 3DZDA 3K1AA 4H7IA 1NJ2A 3WKCA 3TNDA 4BN0A 2G5CA 3L8EA 4QLAA 2SHKA 4DYHA 5EKSA 1R18A 1WUHS 1DAHA 1L3BA 1QPBA 1N4DA 2HMWA 1G1MA 2WHPA 1RAEA 2CK3D 2XUHA 4PIVA 4IWXA 4YJ3F 2LZ0A 1WB5A 4MGZR 4OA8A 4RL4A 3EIWA 1QF7A 4N3GA 3OM8A 1JBQA 1D9XA 3CH7A 2ZZMA 1N1GA 4DM3A 5GIPE 1JDPA 2PLFA 3BJRA 3JWGA 2DPGA 4HF7A 1R4NA 1QIKA 3KBBA 2ZBUA 3ILHA 5CNMA 4MINA 3MTEA 4B6OA 4AY2A 2QLTA 2Q9BA 3VZRA 2HHHB 1CY8A 1NBEA 2Y9MB 3RRNA 5DF1A 4OQEA 3SFZA 5TMEA 4KQ1A 2GPJA 3DEYX 3JSXA 2BBTA 3TL3A 4MS1B 1S2DA 1E4OA 2G63A 2A67A 2Q1YA 2BAGA 3ZE2B 3OZXA 4HVLA 4IDGA 4LDJA 5EWLB 4MCIA 5BR8B 5BSTA 2Y99A 3GA5A 4LSZA 3Q8MA 2Q5FA 3A9WA 4I9NA 4DLPA 4URWR 1KI4A 2KS6A 4E5MA 2OM2A 1OY1A 2ZVJA 1E1CB 4TT3A 1TCBA 3UFBA 2RHLA 1JJIA 3K15A 4N5HX 4DNXA 4DSNA 4F1KA 1PFYA 2UZ1A 1R4MB 2XOXA 1E69A 2AJLI 2XODA 1MC4A 2RHCA 3C5EA 3QIVA 3R23A 1O94C 5JMPA 4B85A 4YAGA 1KR5A 1CS4C 2W37A 1Z4PX 3HJNA 1M6VA 3P9QA 4KRYA 4CM9A 4WJLA 1ZS9A 3U3OA 4BBJA 4TM8A 1JHVA 1KEWA 3B8HA 1J25A 1Z4LA 4LJSA 4KVFA 1EE9A 1JMKC 2W93A 1EPUA 3HCFA 2PDAA 2XTNA 4FEGA 1OA1A 1MAHA 3N8HA 2X0DA 3ZV6A 3IVGA 3DSRA 3V6LA 1N2IA 3IEVA 1L3CA 1U0RA 3FI0A 3JS5A 4BKRA 4BO6A 4ZFNA 4PC7A 5JAOA 2NUTB 2P69A 2ETVA 3H9GA 4OJNA 1QH9A 1V3QE 2VWQA 5HQJA 4QGGA 4YRJA 3R7LA 2PX2A 4ZYXA 1DEXA 2ZRJA 4YHBA 2NOAA 1NTOA 3X1ZA 2O59A 5KTPA 1WD7A 3QMVA 3AVVA 1SA0A 4JI2B 2JGFA 3D7LA 1JIJA 2IDMA 2B9EA 4KYUA 1FPMA 1XL1A 4TL6A 2IT1A 2VPQA 4H3HB 4JLPA 3S7TA 5JQWA 1Y42X 2BTQA 4TTTS 1T25A 1QHHB 3DZ4B 2YWDA 1FP4B 2GRUA 1BJKA 1IU9A 3MTIA 3ZU5A 4EQ6B 1P45A 4B4OA 2WJZB 2BGIA 4BFWA 1XB2A 2ZJZA 1P5FA 3OU6A 2I87A 2JGIA 4OAOA 5E6SB 5NULA 3X0DA 4Z8YA 2LWIA 5DBOA 4FR5A 4PLFA 1QOQB 4UNQA 3SJ7A 4AF6A 2FI1A 4IZ6A 2I7DA 1IBCA 2AG6A 4FMDB 3GFQA 3LCCA 2RGWA 1DRVA 1KSHA 3FBWA 3GIWA 1JI3A 1RJ9B 1JMVA 4RAQA 4X24A 2N46A 2OKCA 4MCJA 2IZ5A 1P73A 3R3WA 1HOTA 2ISCA 2Z9DA 3QJGA 2AZ4A 1S7GA 2QTLA 1PS9A 1D4ZA 1GV1A 2DHDA 5E3JA 5CB4B 2P2ZA 4GOKA 1WDMA 1I3LA 3KVNA 4IHJB 4LCJA 2ATIA 2WPNA 1PNRA 3WHIA 3AW9A 3PENA 3T5BA 4AB1A 4KBYA 1NVGA 4G4JA 2AN5A 2Q9UA 5JZVA 1UDXA 1J6UA 3B12A 4FNAA 4BP1A 1ANKA 3W5JA 1RPZA 4B7AA 3OQHA 1ZMTA 2WWVD 1C7RA 4HGPA 2B2CA 3W4IA 4DMMA 3E9DA 1CUJA 3K9LA 2WOOA 4EJSA 4QIHA 1CQJB 1LBTA 2H2FA 1KEPA 1ACJA 1T5DX 1LTKA 5BURA 2WICA 3MT9A 2ORIA 1RWXA 4QWMA 3B6JA 4B3RB 3DE2X 5JCJA 5K8UA 3MD0A 1MAWA 3CB2A 5B2ZA 1QFYA 1CJBA 4UNNA 2I5PO 3VHRA 4ZHQA 5F9HA 4M8NE 1K7CA 3A6LA 4K9KA 5DN6A 1A50B 3SQOA 4B76A 1D4OA 2GEBA 2IXBA 1WA5A 1Y34E 1XQVA 3N7AA 621PA 2P90A 4GLOA 2WWYA 4A6XA 1KNXA 1UAYA 5LP6B 4PLTA 1IXKA 4Y6QA 4KOEC 1GAJA 3GJTA 4Z1MA 2A9OA 3L8HA 3B3QA 3I58A 4LNHA 3H11A 1U2DC 4R0MA 2H0RA 1ZGJA 3ZI4A 1RWNA 2A0FA 1NVUQ 2FX2A 2OBXA 3CUVA 1ORHA 5C1BA 5HBRA 2D7JA 3HB1A 3N9IA 1JWBB 4Y2TA 1EFAA 3Q3EA 1NOJA 1UKVY 1NW8A 3CY6A 1QVRA 2K7ZA 3COYA 4GQIA 1XRSB 4PSCA 1MX9A 4MV8A 4ZAXA 4L4YA 1DX4A 3KJEA 5F64A 3WQQA 3KK0A 3O82A 2H5LA 4RTOA 1QOZA 2ZB3A 4L5CA 2EW8A 1ABFA 2FFBA 2GM9A 3A3PA 3K3PA 4HEJA 4OXQA 4TV8F 2FPKA 3LTEA 4MW9A 1TM2A 3KS9A 2G0TA 4PGMA 4TMVA 5KKAA 3WYFA 2AEEA 3F6RA 1I80A 3NVAA 2PMDA 1U99A 3CCBA 4B79A 4B3GA 1XWIA 4XXHA 3W6NA 3QYAA 3VTAA 1HO3A 4RGVA 3TLEA 1BQEA 3BOSA 3ICWA 4GIBA 1RXSA 1XXHB 2O6HA 1PN3A 4KI0A 5ULLA 2DKFA 1Z39A 1WKVA 4ALMA 5CDHA 4PRZA 1KK2A 3NETA 3GCDA 2ZSEA 5AKXA 3WB1A 3GEBA 4QOGA 4D9FA 2ZJ6A 5C34B 4EPXA 2Q3HA 1DPGA 4GOOD 3FPCA 2A94A 1EP9A 1Z0FA 2FWPA 1AS0A 1N1EA 3UWDA 1I3KA 2UV8A 2FTKE 2V3WA 5F78A 4GUAA 4B4WA 1JEEA 4S3MA 2VDLB 1Q3HA 3OICA 3Q72A 2PANA 3IDFA 2GN9A 3DEKA 3LX5A 3PS9A 3UENA 2HA3A 1BN6A 3HU1A 1SCAA 2ATEA 3GA7A 4ITRC 3TTTA 2EL9A 1JHRA 5IX8A 1EU1A 3B3FA 4JSYA 2MYPA 4FYXA 1C30A 1K7SN 2XF8A 1U94A 1W5FA 1U6IA 4JA2A 1PT7A 4ALJA 4ZCTA 5DX8A 1R66A 2XWPA 3Q88A 4PWYA 4WLOA 3C4QA 3K2EA 1FC0A 3OOHA 3ZLVA 2J3DA 2CC2A 3U61B 4XGRA 2B3DA 2WSYB 3EFHA 1A5ZA 1A71A 3RHFA 2C4NA 1SFRA 1C3XA 1PAUA 4ARSA 5H59A 3HB7A 4EJMA 1ZN2A 1BDBA 1NMZA 1B8NA 2ZTVA 1GU0A 1ZVQA 1NW9B 2IWHA 4UFOA 4QNRA 5FA8A 1DPFA 1GLGA 4XR4A 2IOYA 1EQAA 2Z3WA 4IHQA 2Z8YM 4JP8A 1FFDA 1X1SA 3NO4A 5AJWA 2VI5A 4EB0A 3M4YA 2JGJA 4KL8S 5BRNA 3W5HA 1C9KA 1VYHA 1X1TA 1AY0A 4EHIA 3ZQJA 3CMMA 2YJTD 5FQOA 1TX4B 3B9BA 5EJGA 4X64B 3P5BA 5J4LA 2QU7A 4K8OA 1LDMA 4G1VA 4QBTA 3S6JA 4H35A 1CUFA 1C7FA 4DMHA 5I51A 3ED5A 1YR9A 3FLAA 3GZTB 5ENDA 1J97A 3EUWA 1A9XB 2MYTA 3KHTA 1S3GA 3BXOA 4WFKA 4ERNA 2PX8A 1QGYA 3A6JA 3D3WA 4D44A 4QT0A 4Q1AA 4XD7A 5AOVA 2EKZA 3DTVA 2KI5A 2V45A 3O4GA 1NC3A 3F78A 1GYRA 2ZIVB 3CV3A 3IWBB 2WT4A 4I4IA 4Y2GA 4F5DA 2PX6A 4EA9A 3KQPA 4MJ3A 2FQ1A 2GN8A 2OGWA 3WBJA 4AG3A 2CL5A 3MELA 4D5GA 1UZMA 1W4CA 4OYYA 4W5TA 2GXAA 1ZUNB 1GZ6A 1QG0A 1QIGA 2Q0QA 5ED0A 3N0VA 5BV0A 1NDHA 1V41E 3EF0A 1XTKA 3UK1A 3RAEC 4RZXA 4CDMA 1N78A 4IH4A 4UMDA 1XAGA 1QONA 1XPJA 2QMHA 3IS3A 4K2AA 3TSZA 1NBOA 4DQVA 1KWGA 2OTCA 1GTG1 4DSTA 3DT9A 4DXHA 1ND6A 4JLAA 4DCNA 2HHJA 3CT6A 2A5GA 1K7XB 1ZCAA 4FKZA 1L5WA 3AEYA 3KFVA 3PR1A 4AW9A 3GUZA 4KLRA 3DEIA 2XMZA 4N8DA 1O97C 1Y4DE 4MR7B 3G0OA 1FFYA 1Y3CE 3L6RA 4G01B 1XROA 2HSEA 3Q9NA 1LS6A 3OIWA 1T15A 2HL6A 5DNDA 5T8KA 1FDTA 4N82A 3PLRA 4QXQA 4NOJA 5A5DA 5CM9C 4ND8B 2ZRHA 4K6GA 2MHCA 3WSWA 2C5GA 2FUEA 3N2NA 4P6VF 4Y9TA 1KC1A 1NT2A 2D5AA 3JQGA 5KTOA 2VCHA 1G7CA 5EIAA 3HJFA 5K3EA 5IWAB 1Y37A 4A15A 3OJLA 4XH9B 3ABIA 3N76A 3O4RA 1TZCA 4IHJA 4RM2A 1C9YA 1GTZA 5CUQA 5TJHA 3TECE 1Y82A 4KV9A 3GGSA 1AHIA 4J0IA 5TGTA 1LF0A 3BHIA 4GYJA 4LJ8A 4TLAA 2OFFA 4M9SA 3NBXX 1TLLA 1Z06A 1UFQA 5JRDS 1WX1A 1DUIA 4XOIA 3ZK8A 1JIKA 4FFBA 5E95A 3IELA 4LAFA 2QIOA 3GEDA 3IO5A 4ZVOA 3SZOA 1UPFA 2ZP1A 1QAOA 4HQ0A 1XMQB 4F8YA 1NI4A 2UYGA 3UYKA 3D8UA 3I6IA 5CURA 3T6KA 1BSVA 1RWMA 1V3TA 5GZ1A 2Z04A 3ONEA 4JEMA 2B5OA 1TZMA 4XRGA 1DAMA 4IS3A 1J21A 2VF4X 3WWDA 5LYJF 4WOBA 1Z4JA 1PD1A 4JK3A 2NX2A 3D64A 1YR2A 3EQ2A 3HN7A 2XXAA 3MGKA 3TOVA 1XLWA 4Q4HB 5AK4A 4BO5A 1U0TA 3DCNA 4DQLA 4EITA 1KJNA 2C7PA 2HQSA 2QRGA 4R31A 3R0ZA 5F7JA 3BWMA 4HQNA 4NE9A 5LA6F 1KEEA 2ZRAA 4OHCA 2GVDC 2LXNA 1GYQA 3K1ZA 2VH2A 3DOFA 1AG9A 2TMDA 1F2TA 2IZ0A 1CJUC 2LV8A 1JR3E 3GV0A 3ZHRA 3GGDA 4RKEA 5JAQA 1P2FA 5E2BA 3PUHA 1JEAA 3BWEA 3TV1A 4X3CA 3P94A 1N75A 3B9PA 5JPIA 4E21A 4LV8B 1DG9A 4RD1A 2OAEA 4KEAA 5CAEA 4YJ2B 4JB8A 3I76A 1JDBB 1QQBA 4ZARA 1M34E 4KO8A 3ZVRA 1ORTA 2HTEA 1MB0A 2GOYA 3RM3A 4DKXA 4URVR 3W8DA 1RMYA 3UUWA 2CUNA 2GK7A 2OUKA 3U48A 3EGVA 3EN0A 4GQBA 3ROTA 3C3WA 4RK0A 1C0KA 3D6AA 5H16A 4UCXA 5KBYA 5JXHA 4DRXA 1YV9A 4PAMA 1TDJA 2NV6A 3D6VA 4QQRA 3FCOA 1P61B 1V0JA 5CLIA 1SQGA 2OK7A 4KQJA 3HCBA 4UVGA 4G23A 4BMPB 1EX9A 1XAHA 2GSWA 4J91A 2F9MA 1Z73A 3OPYB 4Q1DA 2KMLA 2YQZA 1QIFA 3EFOB 4WFJA 1IFXA 1J90A 2AC7A 3LA8A 4WACA 2YWJA 1DAKA 1C3VA 1GGVA 5IJZA 4YRDA 3HXTA 3PEFA 3A2NA 3HJBA 5KX5A 4BX2A 1UQUA 3AR8A 1NP7A 4IVRA 3UOAB 4GM1A 4PGFA 3AESB 3CC8A 3KFLA 3OM9A 1R0XA 2TS1A 2P11A 1P6XA 3JY6A 3JD1A 1WUYA 5BOVA 2V5AA 4G0UA 4TLBA 1DKUA 3FCEA 4R8KA 4XQEA 1HRKA 5JYFA 2RKWA 1L7XA 1NASA 2VJBA 1E63A 3D4PA 1DWQA 4PLYA 2JI4A 4UUQA 4GX1A 6YASA 2IZ6A 4NMMA 4FMDF 1TCAA 5T6BA 1GFZA 2J0UA 3CZCA 1DCFA 4TWZA 1ECGA 5PNTA 4YRMA 4LZZA 1H8HA 4QL3A 1XEWX 1LDBA 1HDEA 4ARAA 3WV4A 1T5HX 4W9NC 1RYDA 4RIHA 1Z0DA 2LR0A 1USWA 1D0SA 4YONB 3WVNA 3W7BA 2I1VB 2W71A 3MBKA 1TA9A 2OCBA 1T5TA 1Z7GA 2ZRDA 3DUFA 4LTDA 3UAOA 4ESHA 5C1PA 1MA0A 3CLSD 3QUCA 4P54A 1GRCA 2VIIA 4B74A 4B6RA 3PRJA 5ECWA 4IVPA 1HG1A 1OWNA 3SIWA 1VMDA 3KQUA 1OOEA 1YC5A 2D54A 5E2IA 4TQ9A 4YRPA 3VKFA 3F5MA 3EIXA 2JH8A 3KEFA 1U28A 2TRSB 4CEJA 2MSNA 3EOBI 1JALA 4J94A 4BASA 1HDXA 1NG9A 1M6NA 3B85A 3HP1A 3CQ9A 2I8AA 4ZALA 1TCUA 1OZFA 2OB1A 3PNLA 5KWIA 1EFPB 1SQ5A 2AFIB 1HC7A 2XSZD 3HCOA 5JCOA 1GZDA 3KFXA 1JLLB 5BW6B 4EENA 3AILA 3MMXA 5AUNB 2VHJA 2GBIA 2F48A 5J9GA 3SJUA 5KO2A 1W59A 2L69A 4G5YA 1DUVG 2SICE 4MV1A 4QYIB 4EPWA 2IOQA 3QWFA 1ZIXA 2BN4A 2IKSA 1DLJA 4KQ9A 4K6FA 1JXMA 4KWTA 5A3SA 1OJ7A 5JCZA 3IX7A 4UOQA 3LP6A 2ZCJA 4XCQA 3DFFA 1EZZA 3ENNA 2I67A 3JW8A 2GFHA 3D6TB 3GELA 3O94A 2W2OA 4JJEA 3GDWA 3GVXA 4QXPA 4DLLA 5CA1A 1H2AS 5KJEA 1AS2A 4AL4A 1IONA 1JAHA 1YXMA 2X41A 2BR3A 1R8SA 1RRKA 3U81A 1SOMA 1AUQA 3DV0B 1UPCA 3HS3A 4JXZA 5JG7A 4LISA 4XDHA 5IULC 1UEIA 3ANTA 3C70A 1K6EA 3VTZA 4GPAA 3TNFA 1DJOA 3BFVA 4LRTB 1XGKA 1UMBA 1NU8A 2W2PA 1XLUA 1ZU4A 2R1ZA 3OPYI 4U6SA 1UJ6A 1RYBA 2A30A 3RS7A 4Q1BA 5LQJA 1FBTA 1KI7A 2CLLB 1WETA 4TYYA 2G07A 2RBKA 4QOHA 3CNEA 1JLRA 4HQRA 3WIVA 3QVMA 1AO3A 3FYSA 1QCCA 2FMIA 1CJCA 3I2GA 5TE9A 3F5DA 4CM5A 1NGSA 1MN6A 1SUIA 2J7KA 3B82A 4RA6B 4PEVA 1FNSA 4PNZA 1YR7A 1XQ1A 2VDWB 5ED4A 2N1MA 2PSJA 3QMMA 2PUCA 4DA4A 1NNI1 1PQWA 5E1MA 4AX8A 3HWSA 4IQ0A 3H2HA 2RHWA 1B16A 1ETUA 2QG4A 1N8SA 1UXOA 3ORHA 3TINA 1K5DA 2XVZA 3T7SA 4IIBA 3CO0S 1GR0A 4OMCA 2OG1A 4WCFA 1P4JA 1CUBA 1E3IA 1ZRNA 1OXMA 3ONFA 4OV6B 4KWHA 2AJ8A 3FZEA 5ER9A 1DV1A 3B36A 4KQHA 2I9KA 2IYQA 3PXCX 1LC3A 5E8JA 3ZX4A 3EOZA 4EA7A 3AG5A 4TKZA 1A4IA 5JJBA 3LKZA 2AI3A 3H1PA 4RUKA 3REGA 2G9QA 1UM8A 3AIKA 2Q5CA 3KJHA 4HQFA 3MCAA 4MA0A 1X7XA 3FKSA 2X0RA 3CZ5A 3GJSA 4XIYA 3QW4B 5B1EA 1IPFA 2E4YA 2ZIGA 3I3OA 4LXUA 5EPOA 2C7QA 4BTLA 1IJEA 2XDYA 3MS7A 1WQ3A 1YF3A 4N0PA 1YFKA 3HRIA 4K7JA 4NFLA 1DKLA 1G5QA 1CY7A 2QMYA 1FK8A 3FPEA 4CQNA 3OX4A 2IIVA 3U1BA 4XB2A 3PQFA 4OKIA 1F6DA 1C0PA 1ZGZA 3D4IA 2IIBA 3O4JA 3PFNA 1Y7HA 4JC0A 4MMZB 4QBKA 4H6XA 4V02A 3RW9A 3ZCQA 1TEZA 1QPZA 1U4NA 4PXAA 2MMGA 2IUEA 2PGLA 1C7ZA 3KQTA 2V55B 4LE2A 2XE4A 3U3XA 3ZU4A 4ZHQF 3B3GA 2YCBA 3EG5A 1JKJA 2GHRA 3TLMA 3DDOA 1RZRD 3BGIA 4EB3A 5FL7D 4CCAA 3GJ5A 4D9BA 1DIAA 3L4JA 4KACA 2QU8A 2FWBA 3Q5EA 1YL7A 4ECAA 5G0WA 1JR6A 3ZCVA 3JQ8B 1MX1A 2B4RO 1L4LA 4B83A 3STYA 4DJDC 3QLEA 5A4AA 1TYZA 1OWMA 2VYQA 1VBMA 4RMJA 4MRRA 4D74A 3BJEA 2CXQA 4Y9DA 3SPXA 4BNXA 4X1YA 4Y1EA 3DL7A 3TZEA 4I4TB 4FTWA 3UB3A 4QULA 2H1CA 3ST7A 1DTEA 1XU4A 5B1HA 3QNWA 3VPDA 1MTOA 2P2YA 5LYYA 4EARA 3MSCA 1YDFA 3O1IC 2QSUA 1ZJ4A 1MV8A 4I5GA 2H1WA 5DRTA 5C5EA 3DDUA 4I55B 2QJRA 4BNDB 3G0HA 3ORRA 2OCYC 3N6RA 3T1HB 3FVRA 2ZEJA 3M33A 4R98A 4NCBA 1BWQA 3L1JA 1Q7GA 2F3UA 1PDVA 3LXUX 5AT1A 3WL6A 5ARDA 4XLZA 4EF6A 3ZY6A 1EFCA 2OCAA 2ID9A 4JELA 3V2HA 1ULZA 3M6FA 4N9QA 3V8EA 5L6LB 4A16A 3V4RA 3SQLA 2WSMA 2N42A 1EDZA 1YKSA 1KRXA 2DJ5A 1S3IA 1SUDA 2G0AA 5I7FA 2PN1A 1T5LA 1Y5NA 3OBBA 1YKFA 1POWA 3TZCA 4BN5A 2HAEA 3MXTA 5FNZA 4C2AA 3OEED 3T3NA 2C4HA 2J0UB 4TTPA 4GP9A 1JQKA 4MYSA 5AWFC 3L8DA 5JVDB 2B7CA 5FLYA 1G21E 4ISBA 3RU7A 1RI1A 2ZJ4A 3PUXA 4PWZA 1GUDA 2H29A 2VSFA 1C8LA 4TXMA 3O4VA 4X00A 3DJFA 2EKQA 2V9ZA 2AI1A 4RH3A 4FIDA 5IBPA 5EUBA 4NBRA 5ELLA 4Z7NB 3AY6A 3QITA 2BKLA 1K7FB 2RGBA 1LD3A 3EY4A 5IXJA 3FVTA 1EUCA 3V8RA 3HN2A 3C3MA 4ZOQI 2BR4A 5I9BA 2C20A 5AKYA 1G20E 2XQGA 2P6OA 2ZRNA 3NGMA 3CX3A 3NOXA 1W0KA 1O6ZA 3NBFA 4ZVQA 4DMLA 3L18A 1SRQA 3NGXA 5EUQB 1JPUA 1XHFA 1F4VA 1V3UA 4PYQA 4R2JA 4YS6A 5BNWA 1ZVMA 3OA2A 2O2YA 4X71A 1WVMA 1ZM4A 2QRJA 1FEZA 4Z7QB 4RDXA 3A3YA 3QPDA 5FADA 5GQSA 1L1FA 5JZSA 1TIKA 1E3WA 5FTNA 4EAAA 4RYDA 4QJIA 5M04A 1XCJA 3DLCA 3HE3A 5E9AA 1FSSA 2AOUA 3WNCA 4ZIRB 1CUWA 3A6EA 4IICA 3IV9A 5HE9A 5I01A 2FRDA 4B3MB 4TMXA 5L4SA 3ZHSA 2WMOB 1IEWA 1Y3FE 4YXFA 1FL9A 4WKBA 1L4MA 1KGDA 2I0FA 3B1KA 3DTTA 2J5XA 3AKCA 3OE7A 3BD9A 4ESVA 4O63O 3JQBC 1MOZA 1AF7A 1ADGA 4NF2A 2VBGA 3OH8A 1AT1A 1Z37A 3VU9B 4EPTA 1M5RA 2JGLA 3SQXA 4KODA 4L51A 3TX2A 3CE6A 5IXSA 4NHEA 5AVUA 3KKEA 3I8OA 1YJXA 4NIMA 4CNBA 2G40A 5KOIA 3THYB 1VL5A 2Q1UA 4RLFA 4DW8A 1N5JA 2D4AA 4E5YA 1OCEA 3HBJA 3EVNA 5AMXA 3RAJA 5FOXA 2WWTA 3E9ZA 1Q14A 3NX4A 4HSGA 1TU0A 3IC5A 2H0QA 3JD0A 3KPJA 2OVBA 3K9CA 1GA4A 4I2NA 4BNTA 4C7OB 3HO8A 2HT6A 3PXEA 3QYJA 4CDRA 4BS9A 4UC0A 2RGXA 2X86A 3I32A 1CUIA 4MAFA 4DA7A 2OHFA 3EXHB 5A0VA 1RRGA 1XQ9A 1SCBA 4DABA 2ZKLA 3LGXA 3C48A 1TW2A 4IFBA 8ABPA 1RQ7A 3ILVA 4ZKEA 2H00A 4TSKA 2C7VA 1TEVA 2ZSKA 1GNLA 4HNGA 5F1KA 4M6WA 3VH4A 1R15A 1S2IA 3LHIA 2I7XA 2BSQA 2JGAA 3ZWQA 4REOA 1L5FA 2NNLD 2ZXUA 1MUUA 2COUA 4X65B 1PUJA 1IJKA 3ZH9B 4BIIA 4L57A 3ZW7A 1KH1A 5CBPA 5KYXB 2J3EA 4N5DA 4C4PA 5LQMA 5E6RA 2E21A 5B3KA 3QSGA 5BWBA 4GNRA 1JQAA 4FYKA 2VSNA 3TWOA 3S8EA 3IIJA 2YQ5A 3L8GA 4DLNA 3WNZA 5CITA 4ZRMA 2RGNC 4DR3B 4U4AA 4D3DA 2GILA 1SHLA 4NU8X 2W6CX 1E4YA 4U7PB 2FPMA 3JWPA 5TARA 2C82A 4AZWA 4AS1A 3ACDA 2BWJA 3BSYA 1CZNA 2AOTA 2GS9A 3DMRA 4E7OA 3P7MA 4GM0A 4HCJA 4GZMA 3WQSB 2CUKA 4NULA 4TX1A 1QGZA 2YINC 4X91A 3TZ6A 1RXUA 3KB2A 4YLEA 5GP1A 3SDZA 3KZNA 2BM9A 2OCKA 1NXVA 2RG1A 4PQEA 5CG1A 5AW0A 2R9VA 2W6JA 1G8AA 2G9ZA 3CIOA 4RESA 5K8JB 2JD0A 1M73E 3HVRA 2FN9A 3CPEA 3MT0A 4DJAA 5J2TB 3PPVA 4DCCA 1YZQA 1AKTA 1JEYB 5MGNA 1RVDA 1IHUA 4JXKA 4B32A 2XNJA 2J4DA 2OCDA 3DBRB 1Y9EA 3GUHA 5DVZA 3RUCA 1EX7A 2OC9A 4YJHA 4X90A 1IIRA 1GADO 1EEHA 1JPNA 2BZ0A 2WJ4A 3CXRA 3AR4A 3L1VA 3L7YA 4PLCA 3WLRA 4D96A 5K3BA 4RZSA 1E6WA 1ZPDA 4B80A 3RUFA 1VI5A 1MJFA 1AHHA 4S0XA 4F96A 1FW6A 3LSTA 4Z9FA 4WNCA 5KTRA 1E1CA 3DQPA 1G3QA 3I12A 2XQIA 3P96A 1OH7A 4NCHA 1HYBA 1VZ3A 3K1TA 1M7BA 2IW1A 2JFVA 5D6OA 4MVJI 3DJYA 2PIAA 3ICCA 3LT0A 3L7AA 4NQZA 4UZFA 4ZZ1A 4I2VA 4KYIB 2O8NA 2DT8A 5DFAA 4MJLA 2H18A 3ABSB 5CYOA 3KVOA 5TEVA 2XUFA 1IWBB 3LBIA 5DIFA 1CR1A 2QNIA 4OJTA 5ADVA 4I8IA 1VPLA 5JADA 1U0FA 3PC8C 3GAMA 4GMHA 1DU4A 1R0LA 2YHSA 3IMFA 5FIUA 3TD2A 2JLVA 2D1SA 4WWHA 5PGMA 2REOA 2E37A 1SD5A 5FULA 2Z8ZA 4ZPJA 1GG2A 2BOVA 1KH3A 1ONNA 1T4CB 2XKAA 4G1UC 4MWBA 3ZWMA 5JY1A 1XMIA 2Z43A 3EEYA 3VBCA 3VVMA 5BN1A 3J81k 5T6MA 5SICE 3WGZA 1YI1A 3WADA 6ADHA 3B7PA 4P98A 3BIFA 1IY2A 1C9MA 2YNMA 5IARA 3P0HA 1JV2B 4LVCA 5LQDA 4JBLA 4JBYA 2QMZA 1XZAA 1K5PA 2QTZA 3ADOA 1D2MA 3GVPA 4GGPA 3PL1A 3FCSB 4TVKA 1ZH6A 3SZGA 3L6DA 4N12A 5ITVA 5JCPA 4MRAA 4ZEOA 1D04A 3KL4A 3SXUB 3TR0A 5E7JA 3VR1A 3TW8A 3F5SA 2AMFA 2X58A 3V9PA 3OD5A 4JDPA 4F45A 3OPVA 4OM8A 2PD6A 3WDKA 3MAJA 3NBMA 3WYGA 2DQ4A 3L05A 1DZ3A 1DO2A 1T91A 1DKMA 3FRIA 3K0CA 4ML3A 2PS0A 4JT8A 3DLTA 3VC1A 4WXPA 1A8UA 5EKTA 2RK3A 4FJ1A 2G7ZA 5C7LO 3B9RA 5JWHA 5IXYA 3FYUB 1WQ1R 2FWIA 1KDPA 4KO2S 4UNIA 1XD9A 2RGYA 3NCTA 3P26A 2ONJA 1NOIA 3RUAA 4MITA 3RFTA 2RB4A 1KDYA 1KU0A 1G8KA 1N6LA 1KS2A 1VIYA 1W30A 1Y1LA 2LDBA 2OLEA 3CNBA 3BBPA 3E4DA 4HWPA 4N0EA 4OYLA 3ZD7A 1KQPA 5J1SB 2PWPA 1U7UA 4CGYA 3LD9A 4DR6B 5G41A 3BWBA 4C4SA 2PSFA 1TQ8A 4ER7A 4HAYA 4UBIA 1B6RA 5JRZA 1XA3A 2ZS8A 1S3FA 3CF4A 4R9SA 4BTEA 1E3DA 2GA8A 4X3OA 1WU8A 1WMEA 1GL6A 4JUDX 1YJAA 1GUAA 1LBEA 4KGZA 1MENA 4NL4H 1AZWA 1HZJA 1CQJA 2ENWA 1KJ8A 3MTAA 2P9QA 1RLTA 1JLHA 4QUDA 5DEIA 1RWPA 4BLTA 4E70A 1T34A 1BXZA 1QHSA 4DG9A 3MHTA 1H2BA 3NZEA 4ND3A 1CJMA 2Y1DA 4M8IA 4ZP1A 4YYZA 4HDCA 1B8OA 2BGUA 2QP9X 2O14A 2HSWA 2FSVA 1VGRA 3PX7A 1OBVA 1PL7A 1VCOA 2WVHA 2RGUA 4KPGA 1T8UA 5DLPA 1KTVA 4ZXFA 4IINA 5TT0A 5L7TA 4JLSA 5CGQB 3H87A 2NV2B 5SY6A 3CIFA 1Z22A 1FFCA 1FXWF 1HL3A 4XIJA 1MXFA 2XUZA 2ZPAA 1A8SA 1G7TA 2XVYA 3VU1A 5JY6A 5EJ6A 4C1BA 3WB0A 1TJ4A 4UUMA 4ASUD 1CE8A 4U6NA 3TTUA 3R8CA 3GVCA 1II9A 5TQVA 3L7CA 3MTGA 3S8YA 3TX6A 2EYUA 3QUTA 3Q11A 3PK0A 1XDUA 3O74A 4F9EA 4XDYA 3TAHA 3TTVA 1I4WA 2Q0XA 3WLOA 4OQYA 13PKA 1KFCB 1T1EA 2IY7A 1EVZA 3PHJA 4C76A 3EDRA 1UZLA 2EDCA 4LZLA 4EZEA 2OV8A 1A7UA 2IY8A 2HCJB 5CA0F 2QM3A 2DWPA 3R44A 3ZJUA 1T4MA 3QOFA 3A4YA 3ZDDA 1MV5A 3FCXA 2B4YA 2PZLA 2FW1A 3EP6B 1KJZA 2JLQA 1Y8AA 1KXZA 1YQUA 4PCVA 2QZ4A 1MIOA 3V00A 1RP1A 2PO7A 3AR9A 4O0MA 3ERCA 3HXOA 3NVDA 3QBEA 5B30A 5DTEA 1Y8CA 4ZVKA 2RH9B 2XOKA 2ZYRA 3VZSA 2PZJA 1UR5A 1ZP6A 4NQRA 1KFJB 2P9CA 3CUTA 1KP3A 2NVUB 1W29A 1KL7A 1KO1A 2XITA 3I52A 1CR0A 1JQ5A 3JQ7A 3KKMA 5ALQA 3LC1O 1H6CA 3WLPA 4D41A 3WAJA 1I36A 1NMEA 4CR6A 4IIJF 5I48A 3KWMA 4O8ZA 1JEQB 1RQLA 3AJ8A 3A1DA 4H77A 4QM6A 3UGQA 2A1UA 4D3SA 1KDRA 5ITZB 1TJNA 3A10A 3JQDA 4UBJA 4EAQA 1U90A 2C7GA 2PUAA 3THSA 5J5CA 1SIUA 2DECA 1ORDA 1PR4A 2LNDA 4FM9A 4BNGA 1HORA 5FO1A 1BVYF 3SGLA 3COWA 4MRMB 1JG6A 1PWYE 4I6JA 5FL7A 4DLZA 1OB2A 1P0PA 1BXRA 4P4SA 2Z2IA 3AQIA 1RQRA 1E8MA 1XALA 3RS9A 5DTQA 3NEPX 2IYAA 2NQTA 2EU8A 2AX3A 3GNQA 2GN2A 4E51A 5DCYA 3HO1A 3W9SA 1NQWA 2Y1EA 3AJAA 1JJFA 2GZHA 3JD2A 5FNVB 1R74A 3DMNA 2I4IA 2X14A 1V1RB 3OLXA 1J2YA 4AO6A 3LBFA 5MFPA 4XLLA 1DMRA 4IGFA 3DLHA 1CWUA 2CXXA 2X8AA 3GPBA 2H54A 2JZNA 2RC6A 3PXAA 1VRWA 4BU1A 5JI3E 4YCNA 3QX3A 1KYYA 3PVCA 1TM7E 2P3QA 4R54A 4LBVA 2FZ4A 3C6ZA 2IYSA 4D6XA 5EGNA 4HLQB 4KU4A 3BMCB 5KYKA 3PSHA 4KQKA 3FWYA 3AHHA 4MQMA 3GGGA 4RA9B 4RFSB 3WOHA 3I1JA 2F62A 1D03A 1XYGA 3NHFA 4F60A 2NZUG 4MICA 5BMVB 3UJ6A 5A1TA 3S1SA 3F96A 3BCHA 5CYGA 2DPLA 2RIRA 1D0IA 2PH1A 3SC6A 3WL8A 3ZJ5A 5HKKD 4DDWA 1H05A 1SEVA 3G88A 5LQNA 5I9LA 2Q5JA 1HLGA 1K6MA 3KR9A 4PINA 1BMFA 4L08A 5E6RB 3VYRB 5EJ4A 5KSZA 1XQXA 1ZD1A 2QE7D 1DP4A 3PCTA 3NH9A 4E5SA 1U5BB 3KT6A 1YS6A 2HBRA 3M5CA 2EKDA 1KMNA 4GC9A 5EAIA 2ALJA 1T9DA 3T5MA 1HETA 2R8EA 1WF6A 4NESA 1ULTA 2NYVA 3FFXA 3L0IB 4XGKA 2XDWA 4BLQA 2ZFUA 3EXEA 1YUBA 4FJ0A 4V0OA 1ZBDA 1IK4A 3KETA 4X3PA 5EJ9A 5TX7A 4TXLA 1E0JA 1PFGA 3QOWA 1S02A 1B43A 2IEAA 4BX9A 1YZVA 2PFKA 4OMUA 4ZO7A 3VVCA 4YQFA 1H8EA 2PEYA 4NEGA 2BLNA 1CFJA 5EMNA 3SKYA 1GP2A 3IP8A 3K09C 3PNKA 3I4FA 3QWBA 5FI5A 2WTXA 1Q0RA 4L8FA 5KVSA 4JR2A 4B87A 3W5DA 1SBHA 1WDLA 2Y0BA 4DDHA 2AQ8A 1DT5A 3EH2A 3DM5A 2XRZA 2BTEA 3SM3A 3GP8A 1V8FA 1ZN9A 1BN7A 2WINI 3LCJA 2YYYA 4XYGA 3W7AA 1OV6A 4YJDA 3RT9A 4I5IA 1IXSB 4IY1A 1QRUA 1JPJA 1WPQA 3FX2A 3H4TA 1HL7A 1A04A 2BEUA 3JR3A 3P2EA 3SLRA 4U2FA 3GMSA 4CMEA 3VDXA 2D5CA 4TV9A 1HH4A 5DMHA 3ZD8A 3PL5A 5DBGA 3DZ6B 2JJMA 2JJYA 2YOHA 3P0EA 2OPHA 1L4KA 3WKDA 3H7IA 4KUEA 5CTJA 3MT8A 3ZWKA 7REQB 5AW4A 3GBVA 2HSJA 4TL9A 4U1RA 2DKOA 2HRBA 2QVLA 4GX0A 1NY6A 4EMTA 4J4BA 2DG2A 3GLVA 3RIMA 1XPRA 4H15A 1OWOA 3L6OO 3J81A