1NWCA

Crystal structure of aspartate-semialdehyde dehydrogenase from haemophilus influenzae
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
371
structure length
356
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQLKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNCTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title Capture of an Intermediate in the Catalytic Cycle of L-Aspartate-beta-Semialdehyde Dehydrogenase
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
total genus 116
structure length 356
sequence length 371
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1nwcA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nwcA01
4UEOA 5L7YA 5T6BA 4Z9FA 3RI3A 4AJNA 5A1TA 3RWBA 1E3JA 4CM5A 3KLMX 5JAIA 3QVSA 2Q2QA 2E49A 1L7DA 2GF2A 4F46A 1Z6ZA 3LLVA 1VRWA 2EGHA 3S2EA 1V35A 4I5GA 2P9EA 4NQZA 3MJEA 4L4SA 1U7TA 3PYXA 1XU9A 2DFDA 4DVJA 4Y6RA 4N5MA 4WLNA 1XQ1A 4AJPA 2VUSA 1C1DB 1ZJYA 4ALIA 1LLUA 3VTFA 3VTZA 3WJ7A 4D43A 4R9SA 4CLEA 1UXJA 3R6DA 1JLLA 4OAQA 5TF4A 2AMFA 2HLPA 3OFSA 3R0IA 2NQTA 3UGKA 2NM0A 5GY7A 2C5EA 5IF3A 5ICMA 4EITA 1ZK4A 3KRTA 3G3EA 3Q3CA 2Q50A 3HUDA 4NBUA 4QTZA 3T4XA 4CJXA 1F12A 1ARZA 2H1SA 1KETA 4OO3A 5IN5A 4UVDA 1R0LA 5ITVA 1S6YA 5A5FA 2AA3A 5F1KA 2HMSA 5C7OO 3OM9A 1DDOA 1ZSNA 3CTMA 2YW9A 5IXSA 3L9WA 2HJSA 3ZDFA 1PS8A 4K9DA 1DBVO 2YQ4A 4YJFB 5DBIA 2D4AA 5L9AA 4PLYA 2NU9A 1WVGA 4BQPA 2QX7A 3ZHXA 1DC3A 3DWFA 3S2GA 3JQEA 5DP1A 3B6ZA 4IXWA 2B35A 1U5CA 3V2UA 1NTOA 4R1NA 4U0KA 5L40A 3ZWXA 1C0IA 3EDMA 4RVUA 3ZWOA 2OORA 2O7QA 4XCVA 4HKTA 2VWHA 1BDBA 2DKNA 4FQ8A 4GVLA 3KYDA 3WYEA 4BNNA 1ZSYA 2VYVD 2ZQZA 3KTDA 3H65A 5L4LA 1FDSA 3WXBA 2H63A 2GDZA 3O8QA 4J4TA 1DHTA 5I7EA 1I33A 5TJ9A 4XJTA 4WCFC 3PHHA 4RDIA 4UUOA 1DOHA 4RF4A 1QG6A 1UDBA 4RJTA 1ISIA 4M89A 4PLZA 1EVIA 3D4PA 3F1LA 5B37A 3AY6A 3ZWBA 4BNHA 1Y8QA 1LEHA 3TNLA 1W73A 2Y1GA 1H6AA 3DOOA 4CLOB 4ZA2A 2WYVA 5KVVA 3X2FA 5KKCA 1LC0A 4K6CA 4YBZA 1F8FA 2NNLD 4Y67A 1Q7GA 1DJQA 4LVCA 1BMDA 4HX5A 1FJHA 4DWVA 3PEFA 3TJRA 3HDQA 3VKVA 4OMUA 3WLFA 4E21A 1GYRA 1EUZA 3DHEA 5L51A 2ZYGA 1YONA 1R0KA 5B4UA 3I9MA 1FDWA 2HMWA 2HAEA 1A7KA 4LW8A 4YR9A 2JHFA 3VPXA 2Q1UA 3HDHA 4CLHA 3UCEA 2JCXA 2WD7A 3H3JA 1I10A 4QFCA 1U3TA 1NR1A 3KSDO 2H6EA 2JHGA 4PN3A 1P45A 1HZJA 4J9UE 1UXIA 3ADPA 3RBZA 1LRJA 1PWZA 4Q3DA 4U8GA 5CDTA 2IEDA 3RASA 1P1HA 2RH8A 2X8LA 3U4DA 1U2DA 4MOWA 5KVCA 1GAEO 1J49A 4NU6A 3H9JA 5JSFA 4B7CA 3R3JA 4UEKA 4M86A 3C1OA 3DQPA 4JROA 2QYSA 2X0RA 4IXTA 4PG6A 2Q99A 4P22A 5I7FA 1M6WA 1Q7CA 4FCCA 3D5TA 3D7LA 1O0SA 3I1JA 2NVBA 5JDCA 2PD6A 4J49A 4UREA 5CEJA 3ETDA 2H5LA 1QP8A 2G17A 2HCTA 1WLYA 3NGLA 4CQMA 4AL4A 2C20A 5MDHA 1G0NA 3ONFA 2B0JA 2EKQA 2YV3A 1JU9A 4PVDA 1NBOA 2BLLA 3I6QA 2ZKLA 3DBHB 4FFPA 3RJ5A 4A27A 2Q22A 1T1RA 3KYCB 1CIVA 1LRLA 2PKQP 1QV7A 3I83A 3VH1A 1C1XB 2Y1OA 2NACA 1R15A 4EGFA 1BXKA 2DVMA 4YWJA 1MGOA 5JPIA 3FR8A 3LYLA 2HSDA 4DA9A 3G1TA 1BSVA 1LQTA 2IODA 3AWDA 1T4BA 4IZHA 1ENOA 4NBWA 4LRSB 4ZQEA 2AE1A 2VOEA 1NHWA 2YFQA 1P33A 4CUKA 3OJFA 4YQZA 1Q0HA 3QE3A 1LSJA 2Y67A 3GGPA 1RM4A 5CHEA 1ZMOA 1V9LA 2O48X 4ND3A 2QRLA 3TQHA 2DBQA 4TVBA 2Y05A 3HADA 3GVCA 2IRWA 3RUIA 5FWNA 2NVWA 3WBFA 2DFVA 1JQBA 3L07A 4W7IA 4CM6A 5BSHA 5TS3A 3MOGA 4IM7A 4YVFA 2RHRA 3T7CA 4CLOA 3Q9NA 3ZH2A 1EMDA 1N5DA 3UCFA 1U28A 3DMTC 4RPKA 2DBVO 3ICPA 4BNXA 3V1YA 1SOWA 3R3SA 1GYQA 4XD2A 3DOCA 4IDEA 3BAZA 3BMCA 3MCVA 3RD5A 5KVQA 2F1KA 3VDQA 7ADHA 2DPHA 4AJIA 1H0KA 1MA0A 4NNJA 3PHIA 4MPDA 3RFTA 1S7CA 2GASA 5L7TA 3GA0A 4D45A 4E3ZA 3S8MA 4E2XA 3JQGB 3SLKA 2Q45A 3TL3A 1X7DA 2X9NA 4NPCA 4ONEA 4JX8A 1XR3A 1TLTA 1NPYA 3PJFA 1X14A 1CF2O 2D1YA 4ZD6A 2FPGA 4R1UA 3RCBA 4LGVA 2P2SA 1EZ4A 1E3LA 2BGLA 1SZJG 1P44A 3A14A 4PLWA 3DHNA 4P4NA 4CUZA 2I3GA 1HDXA 4RQTA 1Y1PA 1LA2A 3C3XA 2VHWA 1NWCA 3PWKA 1LX6A 4YJHB 4BNZA 3HQ4O 3K8ZA 3ROMA 3M2TA 2RCYA 4J16A 1CJCA 1GU7A 3KZVA 3ZU5A 2E37A 4H3VA 2QYTA 4L73A 3SLGA 3DZHA 1RYDA 3PFWO 1GTMA 3CMCO 4DYVA 2EGGA 4L76A 1GPJA 2OXIA 4CR6A 4RVDA 4IJVA 4WK6A 3LK7A 4G5HA 3ZWCA 3TSCA 4WJZA 1B2LA 4XQGA 1Z45A 3F47A 3GNSA 1O8CA 1R4NB 5HS4A 4K26A 3QHAA 4DBVO 1HXHA 5I9MA 4L8VA 1DIAA 4LISA 3F3SA 3ORFA 4IINA 3I3OA 4CLRB 3L4BC 4YQYA 2EEZA 3ETEA 4XIJA 3H7AA 3SJ7A 3I4CA 1QKIA 4OYRA 1ENYA 4YT8A 5AVOA 3JQAB 1NVMB 3DTTA 2EF1A 3P19A 2XF8A 4D7AA 2GCGA 1C0PA 1VSUA 1AN9A 4BS9A 3WNQA 3DAGA 2HK8A 3OEWA 3OQ1A 3RIHA 5HS6A 2X9GA 1J6UA 3QRWA 3KETA 4XB1A 1XKQA 5IAAA 3WGZA 2P91A 2O7SA 3X2EA 2V7PA 8ADHA 5A03A 2R00C 3BTUA 1G6KA 3RBVA 5T8KC 2EHDA 2WDZA 3ZHZA 4IDAA 4YAKA 1GYPA 2XPCA 1NHGA 2AQ8A 3JQ8A 1DEHA 4ND1A 4BL5A 4RGBA 2NADA 4AJHA 1X7HA 4AJEA 1YL7A 3C1TA 4GWGA 3TOXA 3GN2A 3I9JA 3AI1A 1TA4A 2GZ1A 2Z95A 4ZQFA 1VJ1A 3FNFA 4XR9A 3MEQA 2WE8A 1ZK3A 4OKIA 2Q46A 4AJJA 4YAGA 2UUPA 4H16A 4WPGA 2Y1CA 2C2YA 2FWMX 3DZIA 2EKLA 2GN9A 4R01A 3PQEA 3OP4A 3JCZA 1P1JA 1RM5A 2QQ5A 4G2NA 4FJ1A 1RKXA 2Z1NA 1OFGA 3JQ7B 1YS4A 1Q2XA 5F1PA 4UEJA 4BNYA 3HZZA 3H3FA 1E6WA 1PJ4A 1TT5B 1YJQA 1KY4A 1M66A 1N2SA 2DQ4A 2EP7A 4BKOA 3CZRA 4BO6A 5A9RA 1UP7A 2W2LA 4J90A 4BO8A 4YJHA 5JDIC 3G17A 3DAFA 3AFNA 4BVAA 4WCDA 2VZ0A 3TOZA 1O9BA 4KUHA 1LC3A 1E0DA 2PK3A 3G49A 2CF6A 3AJRA 3DBRB 3HFSA 5G0TA 3L9XA 5JMWA 2CFCA 2AEFA 4EYEA 2X5KO 1ISGA 2PLAA 4XGNA 1ISFA 1U8XX 2FSVA 4YEDA 3ASUA 5BNFA 1ADCA 3SC6A 1JDJA 3TWOA 5JMPA 1C0KA 4BMNA 3AU8A 3M2PA 3WSVA 1GPDG 1YQGA 4R1SA 1OAAA 3RFVA 3VPSA 4O59O 2A4KA 2EXXA 2PD3A 3I9LA 3L0DA 1NR7A 2A9FA 4OL9A 1ZUD1 1HE5A 2WYWA 1T2EA 1XWFA 2WYUA 2CVZA 3VPGA 1B26A 1ZMTA 3ZU2A 4CMEA 4YRDA 4DLBA 3KXDA 3DFUA 5A02A 3H4VA 3PQDA 4BGVA 3WGGA 3PYLA 1H9BA 4NJMB 4XRRA 3LLSA 2P9CA 3JQAA 1P77A 4BB6A 1YB5A 4BNUA 3JQBA 3JQCA 4PG4A 3C85A 1XSEA 5K0ZA 1NFFA 3GNQA 4L4XA 4OOFA 1X7GA 1JAXA 1NM5A 1V3UA 1HDZA 4O63O 1P1KA 3RKRA 1NPDA 4FR5A 3PDJA 4CM8B 3WYBA 3S2FA 1JVBA 4GMFA 4NH4A 3H5AA 3D4NA 1HSZA 4CLXA 4BNMA 1PIWA 4XQ9A 4NJOA 1EBUA 3AUSA 3QWHA 2D2IA 2WE7A 5DOVA 4NBVA 1LI4A 2EP5A 1PZGA 1KVQA 3E1KA 3BMQB 3H9GA 2J5KA 3EGOA 1KS9A 4YRBA 1FXSA 1PJQA 1KEWA 4M87A 4ZJUA 4CQLA 2FR0A 4DQVA 1T24A 1UH5A 2AE2A 2ZK7A 2PR2A 4IMPA 3H5NA 3TF5A 3FF4A 1IB6A 2NLOA 3FBTA 1P3DA 1LDMA 1TEHA 3TZCA 2DPGA 1R37A 3RVDA 1HDOA 4KDEA 4BO7A 1YWGO 2DC1A 2NTVA 3LT2A 1CRWG 1L1FA 3I5MA 4LN1A 1ZFNA 4B79A 4RCVA 2CY0A 4E5PA 5C37A 1H6BA 4R3NA 1NWHA 5A5EA 5I8WA 1DIHA 4IQ0A 2VWPA 1A7AA 1XGKA 3RC9A 4FFNA 2Y68A 4JLWA 5FF9A 1PEDA 4U7WA 3H5RA 4LMPA 2D0IA 4IDBA 5BNIA 2GLXA 5KJ1A 4XKJA 1NAIA 1Y5MA 1DFGA 2HRBA 4URFA 2A35A 2O4CA 2Y0CA 3LF2A 2IZZA 1Z74A 3H8VA 3PXXA 4FD3A 5DBFA 1GY8A 3OQ6A 3WOHA 2IDZA 4R3WA 3BMNB 1ADBA 1FF9A 4XGIA 5CP8A 5G2OA 1R66A 4CR7A 3P7MA 4GKBA 5EMHA 4W99A 1I2CA 3DZJA 4BIIA 1XEAA 3IMFA 4OGWA 3ITKA 3INRA 1EE9A 4RDHA 5FFFA 2Y1DA 3GZ4A 4QO7A 2E48A 1U8FO 4WASA 2WTBA 1Y6JA 1WPQA 5EL0A 4PG7A 4J91A 4NIMA 4QEDA 2IXAA 3INGA 4WEOA 4D41A 4L4RA 2X5OA 3LT1A 4NJMA 1E3EA 3ZV5A 1K6XA 2YFHA 1XYGA 3NT2A 3DONA 1PX0A 3RUFA 4EJ0A 2O2SA 3Q6IA 2GSDA 3GVIA 3I4FA 5C7LO 1PS9A 1NASA 4CQMD 4E30A 2YUTA 1KEPA 3OA2A 2LDXA 1PGOA 2AHRA 4GAEA 4WOKA 1QYCA 2HQ1A 4WCFA 2V6MA 3LDHA 3TPCA 1QXSA 4LMRA 3WQSB 4CMCA 4WNCA 1ADFA 4F3YA 4IQGA 2SCUA 2PD4A 2GUGA 2P5YA 3TDKA 4AFNA 2JL1A 4O1MA 1E3WA 3CKYA 4MO2A 2Y93A 1UZLA 3E8XA 2E4AA 3NGXA 1LXCA 3Q1LA 4Y6PA 4DPKA 5DZSA 3DEYX 1X1TA 1WNTA 1DFHA 4MKXA 4GKVA 4FS3A 3BMQA 4XYBA 3JYNA 3W8DA 4IJUA 1HYGA 2B37A 3JV7A 2IZ1A 4WLOA 1N9GB 4BNKA 4NK4A 4GX2A 1KOLA 3NT5A 2JKVA 1MXHA 4P4LA 5KVSA 1J0XO 1VLLA 2D5CA 1Z75A 4JNKA 3U62A 8LDHA 4RZIA 3IIEA 1CEQA 1H93A 4RPLA 3ZWYA 3E18A 1UXGA 4E5NA 3DO5A 3I9OA 3UXYA 4GGPA 4UVIA 1R16A 3RKUA 3UCXA 3BTSA 2P9GA 3G1UA 4KWIA 4E13A 3AW9A 2O2YA 3UN1A 3MZ0A 3U49A 2PGDA 4I9HA 2AG8A 4Z3DA 2X0IA 1GD1O 2I66A 2PA3A 3ENNA 3GLQA 3QA9A 3GY0A 1C14A 3D3WA 3MJSA 5G4KB 4ILKA 3WLEA 4BKPA 4YT2A 3DR3A 5IFLA 4R1TA 1JKFA 1XDWA 1NYTA 2EG9A 4LCJA 1EQUA 1E7MA 1PS0A 5DCUA 4DUPA 4W9NC 2NVUB 1ZNQO 1O89A 1DLIA 5LC1A 3AUUA 3OHSX 3BMNA 4E12A 3BTOA 1NQTA 2DU8A 2V65A 4BO5A 3JD2A 5CDSA 4YXFA 4N18A 4EZBA 4IGEA 1ZEMA 2WMDA 4MVJF 4GGOA 4CMIA 4DGSA 4O0LA 4ALLA 2C7GA 1U2GA 1Y5RA 5LDHA 3HB5X 2AQHA 2QG4A 3ZU3A 2HU2A 2D5AA 1LRKA 4EJMA 3VZRA 2EWMA 4A5OA 4CM4A 3I6IA 3IC5A 5IDWA 1MFPA 2C7VA 5EPOA 2BFAA 4XRGA 1IOLA 1FMCA 4CMJA 4W4TA 1WMAA 3P5SA 3OF2A 3WIDA 2O3UA 5ILOA 3SVTA 1K89A 3ICCA 5AQ1A 2HMVA 3ONDA 1HSOA 1ID1A 3NV9A 4N5LA 1B8VA 2VZ9A 2OO5A 3BMOB 3M1LA 4PZCA 4XR4A 2I3AA 3W4IA 2HK7A 3K2BA 3GGGA 1AXGA 3E6AA 4YT5A 5IG2A 3RC1A 1NVGA 3ROKA 2OP0A 3FHLA 2X0NA 4MVJP 4CM9D 4TRRA 3WIEA 4IMRA 1ZK0A 3LT0A 3SC4A 3NX4A 4FC6A 1ISMA 3NUGA 5JCXA 1HTBA 1FDUA 4AJKA 2J3JA 4TMFA 5FI3A 2Q1WA 1CQJA 1GCOA 4D42A 3DMTA 3ZCXA 5AOVA 2OUIA 1T2CA 1HDCA 2X6TA 1CWUA 1N9GA 5F3RA 2GN8A 1ZIDA 2BI8A 3OBBA 1R4MA 4J2OA 4BKQA 3U5TA 3PRJA 4QUKA 4R16A 3WWYA 2GERA 4E5YA 4IZIA 4IJKA 1QV6A 3T4EA 2FN7A 2JFHA 3DFZA 4XJSA 3RUAA 2BGMA 1KERA 2X9VA 1PR9A 1H94A 3I9NA 1RM0A 1DXYA 1I3KA 4CL8A 3JD0A 3H6KA 4P38A 1IZ9A 4NI5A 2C07A 5JC8A 1H6CA 1IPFA 4KP7A 3OH8A 2DUWA 3LT4A 3DMYA 1K5HA 5IDYA 2DUUA 3SBOA 4R5HA 4XYEA 2XOXA 2G76A 3FBGA 4BO4A 1LLDA 3BZUA 4R4JA 4Y8VA 1UAYA 5F5LA 3U4HA 2W2KB 4FJ0A 3FRJA 3FSRA 1VKNA 4TWRA 1KVUA 4W6ZA 3IUSA 4B4WA 2GZ3A 3FPCA 3AUAA 4J1NA 3GC6A 1C1DA 5CG2A 3IJRA 1WWKA 1E3SA 1ADGA 1MUUA 2VRCA 1IYZA 4HFNA 5DT9A 4DMMA 1F14A 5JLAA 3KEQA 5JC1A 3S1LA 4BKUA 1HDRA 2BHLA 3UHAA 2OZPA 1CERA 2VWQA 3GDOA 3U4IA 2NU6A 1B0AA 2JCVA 1HRDA 3JYQA 3U0BA 3VAZA 3S55A 4E2YA 2D8AA 1LDBA 1SEVA 1E1NA 3Q2IA 4FFRA 1IY8A 1P1RA 1DLJA 3JD3A 4JQCA 3L4BA 4RLSA 3WICA 3STHA 4YJFA 1DC4A 4NFYA 4OSOA 2VQ3A 2ZQYA 3OJ0A 4FW8A 3AY3A 1YQXA 3H2ZA 4DC1A 1PL6A 1QRRA 4LVUA 4GWKA 4EEXA 3U3XA 5JCJA 1SNYA 4RPHA 5CEFA 2GYYA 1W8DA 5KJEA 3IS3A 1DRUA 4HXYA 2Y99A 1LDNA 3FWNA 3WTBA 1JA9A 4S1VA 2OBYA 3OICA 4ZGWA 4ZN6A 2R00A 4BNLA 4TQGA 2PV7A 3W4KA 5T8KA 2CZCA 4CMKA 2VTDA 4DIFA 3QW2A 4HP8A 3D64A 2DAPA 4J3FA 4XYGA 2JJYA 5JFOA 1XG5A 3WNVA 4W7HA 3UUWA 2EJVA 1HDYA 3ZGYA 3O38A 3ITDA 1UXKA 2AQIA 3JYPA 4E31A 1RJWA 1XA0A 4J0EA 5DCWA 1AHIA 1E1KA 1LLQA 1Q0QA 1W0CA 3OIGA 3IAHA 3QP9A 2ZYAA 4I5EA 3PZBA 1WZEA 2FPIA 1P9LA 2FSSA 3WGHA 4PLHA 4IS2A 5CG1A 3ZV6A 4Z6KA 4ITUA 4TKLA 1LDYA 1SO8A 3Q2KA 4QXMA 4YRAA 3GRPA 3OEYA 5TX7A 3IDSA 4HBGA 3IUPA 1BVUA 2NV6A 2FR1A 1N1GA 3E9NA 2X23A 1PGPA 1WP4A 4EBFA 2YZ7A 2O4UX 3WJAA 3LU1A 1PJTA 2QW8A 4FPXA 3H9EO 2W2KA 4Q3AA 1WMBA 4KQXA 3PJDA 1DIBA 4ROSA 1SBYA 1HLDA 4K28A 5KNLA 4RVHA 1UDAA 3EAGA 5CEEA 3WB9A 2EW2A 1K2WA 3LSYA 4CODB 3C7DB 3GVXA 4MVJG 4FGWA 4NG5A 2JD2A 3ZNQA 5JO0A 1LUAA 1NFRA 3PHLA 5IZCC 1E7SA 2GZ2A 1EEHA 2WSBA 2YHIB 4QT0A 2EW8A 3ZWPA 2VYNA 5BQFA 2I5PO 2ZTMA 1ZBQA 1LSUA 1KVTA 5T73A 3PJGA 4OQYA 4CM7A 1ISJA 4KOAA 4J0FA 4IIUA 1KBZA 1TVEA 3E5MA 4PIVA 1JKIA 1YXMA 3JQ9C 5KJCA 2IYOA 3Q0EA 3D3EA 4RQUA 4WLFA 1K6JA 4BMVA 1YVEI 2FPPA 2PZLA 4QSMA 4BNFA 4KQWA 4RVSA 4DXHA 1ZCJA 4CLDA 1YH3A 3KM0A 3QVOA 4UUMA 4FOSA 3QWAA 1VI2A 5J9GA 4Q3NA 3U4CA 1BGVA 1BXGB 3D4OA 1I24A 2CF5A 5AXCA 1YBMA 1ZJZA 3V2GA 3ST7A 1AXEA 2FP4A 5U9CA 1E77A 5KKAA 4XEHA 3DBHA 1WZIA 5AXBA 5ICSA 4R5MA 3DOJA 3KYCA 3GFBA 3N74A 4WLUA 1ZKMA 1C1XA 4GLLA 4DLAA 3FD8A 1KEUA 2HRZA 2A94A 1HE2A 1M67A 3O03A 4CMHA 1X0XA 4J1SA 1QR6A 3HN2A 1IHXA 3JD4A 1GZ3A 2OL4A 5K6AC 1W6UA 2UDPA 2Q4EA 5CDUA 4PG8A 3H9QA 3KV3O 1YE3A 2D3TA 3WMWA 4EJ6A 1DAPA 5EJ2A 4BQRA 2P4HX 3RUHA 3ZNOA 4YYZA 3ZW9A 1PR3A 2VCYA 2FRDA 4BNVA 4EI2A 4MP3A 3B1JA 2Y1EA 3EK2A 1T2AA 4MIEA 1SMKA 1D8AA 2O50A 3CUKA 3PVZA 4E6PA 4QO8A 4DMLA 1OBFO 2PWZA 4UVGA 4E33A 4DQUA 5B12A 1O94A 2Y1FA 1U3UA 1R12A 1U3WA 3WG9A 2VNSA 2JD0A 1E7QA 1BG6A 5T64A 3VOSA 1XELA 1BXZA 4C4OA 4EUHA 1MP0A 3DZGA 1GQYA 4CM1A 3NJ4A 1X0VA 1KC1A 4JK3A 3QY9A 3DHYA 1MB4A 1E5QA 4I5FA 3GVPA 4OOEA 3A9WA 3HFGA 4NDNE 5KOIA 3GPIA 3C1AA 3KEOA 3JQGA 4JP2A 4MP8A 4EDFA 5ENDA 2P4QA 5G0UA 3DAPA 3WGIA 3G0OA 4GMGA 4A03A 4XB2A 1LU9A 2G0TA 3GUCA 4HUJA 4AJ2A 1ENPA 4OQZA 4AJ4A 4PRLA 1I36A 4PCVA 4UUPA 3GZNB 4EUEA 3JQFC 1SEPA 1UDCA 3VZPA 1B15A 2YJZA 2ZTLA 3VH3A 2ZIZA 4TRJA 2ZB8A 4WE3A 2X86A 4M54A 9LDTA 4RF5A 3ZV3A 3WFJA 4DL9A 2VNAA 5AYVA 5F5NA 3DZKA 5EIOA 1PJLA 3GQVA 2GN4A 1HE3A 4BKRA 1PZEA 3PQFA 4F6LA 3V1TC 3ENKA 5TT1A 4LK3A 1PTJA 4D3SA 3ZHYA 4A73A 3INTA 4H15A 2W8ZA 4WLEA 1SB8A 5GZ3A 1N1EA 4XGKA 4XA8A 3UAGA 3ADOA 2PKQO 2DT5A 2O3RA 3ANLA 3ZHBA 2GPTA 4G81A 2IE0A 5MGBA 1MLDA 3VH2A 1R4NA 4ND2A 2Y0EA 1DSSG 3WGYA 1HKUA 1D1SA 2I9PA 1EK6A 1QORA 3KB6A 4B3HA 4QECA 4CLRA 3ZW8A 4BGUA 3CMMA 4I1IA 2VHVA 1YQDA 5EINA 1V3VA 1XLTA 1ULUA 3LC7O 2FZWA 1MXFA 2X0JA 3VZSA 4S3MA 3K92A 5JYFA 5TQVA 1KY5A 2J3KA 1NPTO 1E1LA 3DBVO 5B4VA 4Y9DA 1DAOA 1VM6A 3EW7A 5BSGA 1D4FA 2PY6A 3WMXA 1PL7A 4FDAA 1LBEA 2C2XA 1YOVB 1BW9B 5DNAA 1UP6A 2I6TA 5CPFA 5DOZA 5A9SB 5AXDA 1QYWA 5F21A 4E2ZA 4BO9A 2HMTA 2XXJA 3ZNNA 4E2WA 4YB8A 4RF2A 4O6VA 2Q4BA 4BNGA 1P74A 2BFPA 3M1AA 4DBZA 3GUYA 4L9RA 4YJDA 3C8MA 2AEJA 3PHJA 4Z9XA 3WGQA 2CVQA 1I3MA 1MG5A 4AVYA 1TI7A 4OKNA 2DBZA 5I8ZA 4N54A 1B8UA 1EK5A 3SEFA 3D1LA 3PDUA 4J7XA 3H2SA 1VPDA 3BA1A 2YY7A 2OP1A 3JSAA 4W9NA 3QWFA 3A1NA 1B7GO 2ZB4A 2FOIA 2VZ8A 4JJFA 1ZXBA 1OI7A 1LSOA 1R6DA 3JQ7A 1N7GA 3HHPA 1B3BA 3PP8A 4N7RA 4X54A 5H83A 1EVYA 2UYYA 5I9LA 4BHTA 1XQ6A 3KSZO 1TT5A 4XYMA 4YTEA 1D1TA 3IJPA 3L6DA 1RM3A 4NBTA 2LDBA 4DIBA 4XYLA 5JXWA 4XDZA 1K3TA 4HV4A 1F0YA 2XXBA 4MVJH 2JAPA 2PZJA 2RHCA 3GG9A 3PFFA 4OXYA 2Q49A 2DM6A 3DBRA 1GZ6A 3QVXA 4YACA 4U0JA 2E82A 1JW9B 2ZTVA 1Z82A 1J5PA 1ZW1A 4UVHA 4BMSA 4AG3A 1K0UA 2C0CA 2HMUA 4B4OA 4E4YA 4YJGB 3ROPA 4QFDA 5KCZA 1KIFA 3FNHA 5DP2A 4BGEA 2AEMA 3GNTA 4BOYA 3EMKA 1A5ZA 1OC2A 1G1AA 4YDRA 3PLNA 1H5QA 3B1FA 1JWAB 4K6FA 3ROQA 4AJLA 3B70A 1HYHA 4TROA 5KWEA 3VDRA 1IL0A 2VRBA 2TMGA 4GPD1 4NHEA 1HWYA 3D0OA 4BO2A 5JAMA 3U9LA 3HDJA 5CPBA 3SXPA 5B1YA 5L7WA 2RBEA 4R69A 3K30A 4HFRA 2O3JA 4B8WA 1GUZA 1YDEA 1O95A 4I9UA 2VTEA 1VJTA 3F6YA 3G79A 5L95A 3ZNPA 1GFSA 3VVBA 4ZHSA 4B4UA 1X13A 1H9AA 4W82A 2Q1TA 2C82A 5GZ1A 5JNLA 4CM8A 1DRWA 4GX1A 2VUTA 3VKUA 2HO5A 1DO8A 1BW9A 1QYDA 2ZTUA 3OJLA 1LJ8A 5A9SA 3VH4A 5CDGA 4CV1A 1ZZEA 1QSGA 5F1OA 1LTHR 2R6JA 2CVOA 2X58A 3SJUA 3F5QA 2O23A 4PLFA 1PZHA 3WYCA 3ZZNA 4YPOA 1D7OA 1N8KA 3F46A 1EFKA 2FR8A 4RVGA 4C7KA 4XQCA 5TJHA 4XWYA 2GR9A 2BFOA 3GDFA 1WDKA 4PLVA 4AJOA 4BO0A 2BRUA 2NQ8A 1NAHA 1ZSVA 4WLVA 3GMDA 5A4DA 2X7HA 2J3IA 2J5RA 1JN0A 2HUNA 3B1KA 3DXFA 4RZHA 3IP1A 3E48A 5L4SA 1E7RA 1YL5A 3TRIA 2AG5A 4J9VA 1ONOA 3NAQA 3CIFA 2UUOA 4ALJA 1OC4A 1GL3A 3E82A 2TMDA 5DBGA 3GT0A 5THQA 2CD9A 2X5JO 3FR7A 1ENZA 1MG0A 4DPMA 4BNJA 3JQ6A 3KBOA 4YCAA 1AUPA 1UUFA 2V6BA 3O8QB 2BKAA 4A7PA 2IYPA 3NRCA 4E0BA 1ZEJA 3RSHA 3BIOA 1TB4A 1H2BA 4ID9A 2I76A 3A06A 1U7HA 3ANMA 2YDXA 3TZKA 3E5RA 4WOJA 4KUEA 1HDGO 2QRJA 3GF4A 1MV8A 1YB1A 5EN4A 4N5NA 5A3VA 1PJSA 4PLTA 4BV8A 4MKZA 2PH5A 1EFLA 3NDIA 1HZZA 3ONEA 2CDCA 4II3A 3I52A 4YJGA 1M2WA 3GH3A 4DRYA 3IKVA 4F6CA 3JYLA 4CV0A 2PZKA 3U09A 1K6IA 2X4GA 1YL6A 5C7IO 4Q3CA 3ASVA 2I99A 4O5OA 3I23A 2DTDA 3B20A 5L53A 3CPSA 4KTTE 2E6UX 4MDHA 1GEEA 1PGQA 2UAGA 3PWZA 3DL2A 2JD1A 4MVJA 4R68A 4UAGA 4D3FA 2CSUA 3GDGA 4RV9A 1VL0A 3C24A 4BNWA 2PFGA 4WECA 2BH9A 3PIDA 1U3VA 5L3ZA 3A28A 4JJGA 1NFQA 3OIFA 3WR5A 4NZ9A 2WD7B 1M75A 1D3AA 2ZJ1A 3FNEA 4JIGA 1IUKA 1JAYA 3BHMA 1AE1A 3KLPX 5ER9A 2JAHA 4KWHA 1ONPA 4Q39A 3W8EA 1TT7A 1YGYA 2ZJ0A 4L75A 1Z7EA 1QLHA 4BUCA 1U4SA 4TRNA 4RF3A 3GFGA 1B3RA 4NMHA 5TT0A 3F1KA 1BVRA 3I9KA 5IXYA 4GSLA 4MVJE 3QLJA 1Q7BA 2R2GA 3NT4A 2EJWA 2C54A 5JY6A 5IDQA 2CUKA 4J1QA 2O3TA 2WWRA 2FMUA 2J3HA 1CYDA 3FN4A 4FIZA 4Q3BA 2HJRA 3OIDA 3E03A 4CV3A 4YAEA 1J4AA 4U5QA 4ZRMA 4YAJA 4CQMB 1HEUA 1PJBA 3HB4X 2VN8A 2OMEA 4U6QA 1SC6A 3OECA 5K9ZA 5ILGA 2HDHA 3H9UA 1WW8A 2RIRA 5H82A 3VPHA 2QZZA 5I7SA 3PI7A 5DF1A 5M6DA 1VC2A 1F06A 4TZKA 4IGFA 5IZCA 1DJNA 4DLLA 4PG5A 4OIMA 1EVZA 4PLPA 3AOEC 1IZ0A 1A9YA 4NFHA 3AI2A 3GR6A 2BMAA 3EC7A 3OJEA 2BELA 3WQQA 3HNPA 4NFSA 5G4KA 3IKTA 4IS3A 4JP3A 2G82A 1KYQA 3C7CB 3JYOA 2POQX 2BI7A 4JCOA 3GRKA 3JQ9A 4JN6B 3AU9A 2B5WA 3OJOA 2ZYDA 2NVUA 3ZWAA 5A05A 3LVFO 4KUGA 4GLOA 3GEGA 4D0SA 1JWBB 1B16A 2JCYA 5I9NA 5DDIP 1NP3A 2QIOA 4J4HA 1X1EA 2AQKA 5ENVA 2J6IA 1PGNA 3UOGA 5IN4A 5A06A 2Z1MA 4WGGA 4DQXA 4QX6A 3FNGA 2IZ0A 3CH6A 3DC2A 4QQRA 3ZWVA 3EHEA 3QJ5A 4FBGA 5KIAA 1EE2A 4BNTA 3AM5A 3GG2A 3BMCB 3RU9A 3UKOA 3V8BA 5ES3A 4J43A 4BGIA 1E7WA 1I8TA 2W2LD 4RPGA 3WQRA 5GMOA 4IUYA 2OOSA 5I7VA 1T2DA 1Y8RB 4KDFA 4I8XA 5BT9A 3OA0A 5JAZA 2B83A 1SAYA 4RLHA 4A26A 3FI9A 4Q3EA 3W6UA 3GOHA 3HG7A 5COQA 4HFJA 4IY1A 3ZWMA 4BO1A 5K6AA 4JXKA 3V5NA 5JE8A 2B4RO 3BMOA 3OMLA 1P1FA 2HK9A 2QRKA 3QSGA 2NUAA 1ZK2A 1HYEA 1M76A 3TZ6A 5BNTA 3RC7A 3KUXA 3CXRA 4HNHA 4NR0A 4GX5A 3FCOA 4CV2A 1NXQA 4Y98A 5BSFA 3ANNA 1KVSA 3BHIA 1NQ5A 5IZ4A 3WX0A 2EERA 3IOYA 4GX0A 4JJIA 2PTGA 2YV2A 4D46A 1EUDA 4U6SA 4FOOA 1MC5A 3BTVA 3EZYA 2YDYA 4RO0A 3PJEA 4WKGA 4ZQHA 2BGKA 5G4LA 3HWRA 3MJVA 1PWXA 4Z0PA 3RROA 5U1PA 4EUFA 3GPDG 1QYVA 4CMAA 4Z3KA 4ESOA 3NDRA 3CINA 5FI5A 4DC0A 4CL3A 3AK4A 4TZTA 2YYYA 1JTVA 3TN7A 3JQAD 1GV1A 3LQFA 2VHZA 3ABIA 4XQEA 5CAEA 4KMSA 3O4RA 1DRVA 4FJ2A 5HTOA 3E9MA 1HL3A 2V6FA 4PFJA 4C7JA 1I32A 5H81A 3VZQA 1XHLA 5C3MA 3QVTA 1PJ3A 3K6JA 1U1IA 4II2A 1A9ZA 5TC4A 2XAAA 3LZ6A 5BSEA 2ZCUA 2J5QA 4A10A 3N7UA 4RVFA 4JBGA 3BYZA 3UICA 1U9JA 3JTMA 4D0RA 1I2ZA 3ZI0A 3Q11A 1DPGA 1N92A 3RQSA 3JQFA 2QHXA 4J7UA 6LDHA 4OXNA 3UFXA 2F00A 4NU5A 4P8RA 4HWKA 3TZHA 3D5QA 1CETA 5JYAA 2UVDA 2Y0DA 1DB3A 1PJ2A 4FN4A 4J4BA 5COAA 2H9IA 2VHXA 2WM3A 1EDOA 5JDIA 1ISHA 3NKLA 5JYEA 1JKJA 1Y9EA 4MINA 4FB5A 1IPEA 4A0SA 3SX2A 5IJZA 3PZRA 1PGJA 4CR8A 4MIYA 2EIHA 1PSDA 4BB5A 1E1MA 3JQ8B 4IQ8A 1HETA 2P5UA 4XIYA 1P0CA 1RWBA 4AICA 1UP4A 5CFZA 2A92A 2O3SA 4ZRNA 1PJCA 4TKMA 3MJTA 3RAJA 3WGTA 1O6ZA 4NBRA 4ZQBA 2VUUA 5LDGA 3OSUA 4CM3A 3FTNA 3ON5A 4ALNA 4YAIA 3QVWA 3GHYA 1Y8RA 4J6FA 1UAGA 2DLDA 4LRTB 2ZCVA 1AHHA 3IQDB 4I5DA 4OXKA 3AFMA 1B8PA 1T25A 2DTEA 4BV9A 1DHRA 1LDGA 4OM8A 4L74A 4B7UA 1Z7BA 5DCYA 1YB4A 1PZFA 4TRMA 3L6OO 3PGJA 3ULKA 3HSKA 4XZ3A 3CE6A 4JBIA 5FYDA 1A72A 3C7AA 5HWSA 1Q1NA 1E6EA 1GADO 2VOJA 1YBVA 1HE4A 2PKRA 1VSVA 5EERA 4BO3A 3WSWA 3KYBA 3WDSA 4E5KA 1ONNA 4R54A 1ZH8A 4Z0HO 1G0OA 3DB2A 1OOEA 3HJAA 1YKFA 3AI3A 2W98A 4I08A 3ZN2A 3F5SA 3CSDA 4GVXA 4IIVA 2BD0A 4DTIA 3QWBA 2C59A 1LNQA 2OFPA 3KO8A 4GL4A 4ZICA 3DTYA 3W8FA 2I67A 4AJ1A 1VKOA 3O9ZA 3R1IA 4BNIA 4FFLA 4E5MA 3F4BA 4PRKA 1SOVA 2ILTA 1BDMA 4HNGA 5EQFA 4CM9A 3NTQA 3AOGA 4H7PA 3NTOA 3GN1A 4FSHA 2B4QA 1GZ4A 2EKPA 4LSWA 4R51A 4IDGA 1F8GA 2PGLA 1IULA 2ET6A 4YT4A 1E6UA 2BF7A 5B4TA 1C0LA 5JDCC 4OJNA 1NQOA 3L4SO 1U5AA 3MWDB 3QWIA 2VYVA 2X22A 1SCUA 1ORRA 1T4DA 2GGSA 3PWSA 2PNFA 1WDLA 3L77A 1DFIA 2ZB7A 2B5VA 1GQ2A 2J8ZA 3LF1A 2NSDA 3GGOA 5KJ6A 1QYXA 1Z73A 3QIVA 5LCXA 4GI2A 1NNUA 5AXAA 3ZWNA 2WEKA 3NEPX 4MJLA 3P2YA 3GVHA 1Y81A 3E9QA 3ZWWA 5C5IA 3QV1A 5JY1A 2P68A 1IHYA 2CDBA 4PGFA 1CDOA 3HN7A 3MJ4A 4UVEA 2DBRA 2DTXA 1GCUA 2VT2A 2YHIA 3KSUA 2IEBA 3RJ9A 4A2CA 1GQQA 3F4LA 1VE9A 5J23A 4DREA 3NYWA 4DIOA 2OHXA 1BRMA 2NTJA 4FFMA 4EW6A 2Q3EA 5ER6A 4EEZA 2VWGA 4FFOA 1Y7TA 1DC5A 2Q2VA 4HY3A 5G0VA 3PK0A 5KTKA 4WUVA 1V3TA 1E7YA 3PPIA 4KZPA 3VHRA 1SPXA 3UW3A 5COBA 2ZATA 1GV0A 3K73O 3W1VA 1DC6A 4CQLB 5T67A 4J2HA 4IPTA 3GAFA 2GO1A 4YA6A 2B4TO 3NTRA 1VL6A 3MTJA 5G0WA 3GAZA 2YQ5A 2VT3A 1BXGA 3IL2A 3COSA 2Q1SA 4PLCA 4RPJA 3OETA 1OMOA 4P4GA 4D79A 4FGSA 1PQUA 1I3LA 3EZLA 1PL8A 5TSDA 3AM3A 1I3NA 3K5PA 1V6AA 1XCBA 1DIRA 2W90A 1P0FA 1NVTA 3RC2A 4PZEA 5BR7A 1CQIA 3GMSA 1R0SA 1UZMA 1XIVA 4IDDA 1E3IA 4CMBA 2QZ9A 4MVJD 2RAFA 3AUTA 3AY7A 1YBAA 3ZV4A 3DDNA 4XX0A 1AGNA 1KEVA 4RORA 2AXQA 1PQPA 3DBLB 4MVJM 2WJPA 3WBBA 1BWSA 4IJWA 3M6IA 3P2OA 4JGBA 4TVOA 3GHHA 4PLGA 3MJCA 3LC2O 5JYDA 2O3QA 4I9NA 1H2HA 5T5QA 1XU7A 3RUDA 3VC7A 4D3DA 1YJ8A 1H6DA 4GBJA 3PGXA 2OGUA 3V2HA 3Q9UA 1RYEA 1I01A 3WWZA 5HBRA 1BTOA 4CUJA 2AW5A 1V0JA 1GR0A 2B36A 5T57A 1A4IA 4GQAA 1T2FA 1LDEA 1FDTA 1I2BA 5L45A 3CZMA 1T1SA 1I5RA 4M55A 2YHUA 4UULA 1PU2A 4HFMA 4DPLA 4Z0TA 1OZAA 1ZVMA 1I30A 5ITWA 1ML3A 4HADA 5U4QA 3FWZA 1WDMA 2YV1A 5A04A 1ULSA 3EUWA 4WCFB 5HA5A 1HF3A 2FY8A 3W6ZA 5JBIA 4M1QA 3UVEA 2PZMA 4RL6A 3ZU4A 3KOUA 1U4OA 3RFXA 3TZQA 5G0SA 5HRUA 3K2EA 4MIOA 4M8SA 1E3WB 6ADHA 4KTVE 4ALKA 3PTZA 4G65A 3RUCA 1MX3A 3KHUA 5JS6A 3GZNA 2X1HA 2VHYA 4B7XA 5IDXA 2D59A 5JW6A 1YRLA 3GEMA 3ETGA 3PLRA 1GUFA 4WEQA 4E32A 4NK5A 3V1UA 5ADHA 3HDYA 4IBOA 4B3JA 3TFOA 1C3VA 1WAMA 3EVTA 3N58A 5DN9A 3RBXA 4OHUA 1A71A 1LLCA 2ZB3A 7MDHA 4ND4A 2WD8A 5TGDA 1IE3A 1ZXLA 2CDAA 1UR5A 1FK8A 4TSKA 3NDJA 1P1IA 4WNIA 5EQDA 4DYDA 1MC4A 3EY4A 5DULA 4F45A 3MOIA 2C29D 3OQBA 5JO9A 4B3IA 1EBFA 2BFMA 3KVOA 3VPFA 1JVSA 2VRCD 3UF0A 5HM8A 2FHSA 3D3WB 3EVNA 2B69A 2G5CA 1P31A 1O5IA 2FZEA 4ZVVA 2Q2WA 4OH1A 3GK3A 1L7EA 4J7CA 1LQUA 3K31A 1TXGA 2NWQA 3DBLA 3L6EA 2JFFA 5THKA 4ND5A 5KJFA 3K96A 3UH1A 4UUNA 4MKRA 4OSPA 3F9IA 3LC1O 2I65A 3TL2A 4PVCA 1EDZA 1LSSA 1PQWA 3PIIA 4Q9NA 4ZU3A 3HE3A 1GEGA 1NQAO 4J1TA 2NU8A 1Q0LA 3QQPA 1HT0A 3EYWA 1BHSA 1B14A 4CMIB 2CNBA 1ZK1A 4IDFA 2UV8A 1KC3A 3WFIA 4R41A 4FC7A 3CEAA 5JCJD 2NTNA 1X15A 2GNAA 2JFGA 4CM4B 3JD1A 2IXBA 3FPLA 1YOVA 3O26A 2G1UA 1DIGA 1UZNA 4K1LA 4ALMA 3RU7A 2Z5LA 3DZBA 3NJ8A 1UJMA 3TFQA 3VVCA 1YDWA 1E5LA 5EESA 2RH4A 2V6GA 3IP3A 3MWEB 3AOEA 4B4VA 1UXHA 1NX6A 1HLPA 4GH5A 2GN6A 1I0ZA 3PHGA 2OBNA 4Z9YA 1E92A 4Y6SA 2C5AA 1FDVA 1WXDA 5A9TA 5A3JA 2HKIA 4XDYA 3JQDA 5JAQA 1KVRA 4M49A 4CMEC 4LCEA 1N7HA 4LSMA 5L4NA 3WTCA 1QLJA 4CMGA 1GUYA 4ZQGA 3BXXA 4MVJI 3A4VA 4R9RA 4CPDA 5GZ6A 1SB9A 5TLSA 3K9QO 3WS7A 4D44A 3W4JA 3FTPA 2GRAA 2Y66A 1F17A 3KYDB 1GDHA 3JQBC 4L0QA 4INAA 1T26A 1M6HA 3MTGA 1R4MB 1EUCA 1A4UA 5TRTA 5FEUA 1V8BA 4JBHA 1W4ZA 1ZO8A 3PYMA 1EQ2A 1VJ0A 4MP6A 1RPNA 2W4QA 3BHJA 3S2IA 9LDBA 3DZFA 2PH3A 4IDCA 3WGOA 3GEDA 1VL8A 2PGJA 1YO6A 2EV9A 1Y9AA 4PZDA 5CDYA 3AM4A 1Y8QB 1A27A 1QMGA 1EVJA 3RUEA 2GD1O 2NU7A 4GSKA 2VYND 5TNXA 4B8ZA 5TIIA 1MFZA 3T7EA 2CMDA
chains in the Genus database with same CATH superfamily
2P0AA 3TTVA 4UEOA 4F1WA 2AG1A 1I7SB 3A27A 2O2IA 1H8EA 5L7YA 4RMIA 4QWMA 2GBIA 3V4ZA 5JJ5A 2YNMD 1H2EA 3RWBA 1YZNA 4CM5A 3AHFA 5J59A 5JAIA 2Q2QA 2WFMA 4A92A 3TGPA 2PV0A 2GF2A 1X1QA 3OHPA 4HD8A 3LLVA 2F1OA 3EARA 4Q82A 1V35A 3KBBA 1D2RA 2P9EA 5AH0A 4NCBA 4XI9A 2D1RA 4L4SA 2XGOA 3FWKA 3PYXA 1XU9A 3LP6A 4PAGA 3V34A 4QU5A 1XQ1A 3TOVA 5DBHX 2P0YA 3PXAA 1OSNA 1LPPA 1JQDA 4L3VA 2VQ6A 4KH0A 3SNHA 3VTFA 3NHYA 3P4YA 1E9DA 5IJ0A 2DWUA 1KF0A 2ZRBA 3L02A 3ESQA 3R6DA 1JLLA 5LJLA 3OLZA 3Q15C 2TMYA 2QW1A 2NM0A 4LJ7A 3LHFA 3W6OA 2QMZA 3MXTA 3WWCA 1XL0A 2R6CA 2NU6B 3OQOA 2DCMA 5JQGF 1ZCAA 2F43B 3L1KA 3H0EA 2XRZA 3KT6A 3H13A 3KRTA 1P4RA 2W71A 3T4XA 4NBUA 1XNQB 5GJVC 2V0NA 4AS3A 4AZ3B 4YCSA 4TTJA 1I7LA 1KETA 3WBKA 5ITVA 1GN8A 1R0LA 1WXXA 4ZT3A 2XUJA 4TN1A 2AA3A 3TRKA 2C96A 2HMSA 2KBEA 1D2MA 3CTMA 4DB4A 3L9WA 3ZDFA 1PS8A 4K9DA 1A8QA 2VSNA 3BQNB 1UPXA 2CFOA 3WLQA 1G8JA 2VIIA 4QTUB 3ZHXA 2QUZA 3EA4A 3DWFA 3EVDA 3QOXA 3NTUA 4UBKA 5HE9A 1TADA 3RFUA 2ALJA 3U0VA 1BE0A 3JATB 2B35A 4IXWA 3WK7A 4DAOA 1SHKA 4R1NA 1RDFA 1GWNA 3LWDA 4U0KA 4BUJA 5CMLA 3SQMA 3TM4A 2H85A 1C29B 4M1SA 3ZWXA 2CJXA 4P6VF 3QNUA 1DKQA 3T1QA 4FQ8A 1BEEA 3KYDA 2P11A 5HK8A 1GTSA 3LXXA 2HWWA 2ZQZA 1N5RA 1TM3E 1JDUA 1W85A 5J1TB 4HAVA 1FDSA 4TL6A 3ZPXA 1ZHFA 1WU8A 3QLTA 2G9NA 3WXBA 5J2UF 2H63A 2GDZA 1XK7A 1I4EB 4WNYA 3A3YA 3L8ZA 5KHOC 3OT5A 3C6BA 3PHHA 4M9UA 2GD0A 2NZUG 4TMYA 3A4IA 4RETA 4E15A 2G40A 4RJJA 1KXZA 3E22A 2OPHA 3LBFA 4HH0A 3ZYCA 1W36D 3FCUB 1Z28A 2QY9A 4M89A 1UMCB 4KN8A 1LI7A 3J7TA 4RZ2A 2DG2A 1AGYA 1JMKC 1KGDA 1OILA 1Z9BA 2F4VB 3AY6A 3ZWBA 4BNHA 3PGKA 2AOUB 2D8MA 5HF6A 1YE8A 5C1DA 2SECE 3G59A 2H7YA 1QHYA 2P6NA 3OM1A 2ZTHA 3T9CA 4CLOB 4RTLA 2CNOA 2JGDB 3G8AA 3BX1A 4FXPA 3ZBPA 4DT1B 2VXOA 1SQSA 3MRSA 5AR1A 1COWD 1XRLA 4Y67A 1Q7GA 2J9YB 5FWYA 4BZWA 5CTAA 3QXGA 4K9KA 4DWVA 1TM5E 3F9CA 1MRZA 1ST2A 1Q74A 2WP8J 3L05A 3WLFA 1C7JA 4E21A 1I7QB 4K8OA 2J0EA 2QAIA 4NCKA 5L51A 4LF7B 4IIGA 1I4TD 1OXMA 1R6TA 1W5EA 3Q10A 5EZ6B 1OV4A 4OPMA 4B32A 3H3XA 2FQYA 5H3LA 1ZKDA 1MOZA 3MSCA 2E0IA 3CVYA 3GJ6A 3R44A 3EXG1 2GQ0A 2Q1UA 5AUQA 4R8KA 2X5XA 3JVIA 1EGQA 4UD2A 4LQ4A 4R7TA 4CLHA 2V1UA 2ZWIA 3AKZA 2VDMB 4KXMA 1CUGA 4UBLA 10MHA 4NPHA 4B82A 1NYLA 4F56A 1ORWA 2GDJA 2RKOA 5A71A 3KSDO 4HB0A 2E55A 3VPBA 4F2PA 1FX0A 1K1EA 2BE9A 2HT1A 2VSFA 4LXUA 1UXIA 3MWEB 4XEUA 5MFPA 4U8GA 3ESCA 5CDTA 2ZRMA 4AMUA 3EGEA 1CZKA 1U2DA 5KVCA 4RIEA 3OZGA 1J49A 3TO5A 3KQMA 4NU6A 4W9MC 3SXJA 4B7CA 4P82A 3E5HA 5LP6C 1D4ZA 1M5TA 3KPYA 4OD0A 3NNSA 2X0RA 2Q99A 4D0GA 5I7FA 4KACA 4U2BA 1M6WA 2C8LA 1Q7CA 2LWIA 4H77A 4U4AA 3D7LA 5LMUB 2I1VB 2B7BA 4CF7A 2C4TA 3H0WB 1O0SA 3FFBA 2NVBA 3LBHA 4BX3A 5YASA 4TTVA 4J49A 3CSUA 1JFFA 2ZRCA 5CEJA 1I6MA 3R4VA 4QBFA 5I9TA 1WLYA 3WLHA 3F6BX 1ZQ9A 4RVOA 5D51S 4DNOA 5K4GA 3GDWA 4TS3A 2YV3A 2H1LA 4TQAA 4PVDA 3U9TA 1NBOA 1NYQA 2ES4A 3SS7X 3BH6A 3OZIA 4FFPA 3RJ5A 4OHXA 5HKKA 2PT9A 3T4UA 1JL3A 3UXMA 2JIOA 1Y1TA 3GGCA 4AKIA 3G2QA 2WJJA 2E1RA 1CIVA 1LRLA 2PKQP 1QV7A 2FG5A 3KYCB 3VH1A 1C1XB 5L3SB 4DV7B 3IEVA 5CBPA 2F90A 2DVMA 4WJKB 2QPTA 4N0EA 4TVSA 2CLDX 2QMOA 1B0PA 2VZLA 1GIAA 1MABB 2WT8A 2ZXEA 1CS0A 3C6MA 1LQTA 2IODA 3G1TA 3HP1A 3K5WA 3MFQA 3MRTA 4CT5A 2ECQA 2G1JA 3D1JA 3OJFA 3O5AA 4YQZA 1DEOA 5AVKA 4IOLA 3NH9A 2JIDA 4LHVA 5F64A 1B42A 4PWZA 1ZMOA 1V9LA 1NBAA 4PHTA 2DBQA 3QYJA 2ZSFA 1VMDA 1HURA 3IMGA 1ODJA 3HADA 4YP7A 2XTZA 3IQEA 4FZJA 1NW9B 1EPUA 4H3KB 5CLFA 2NVWA 1E2NA 1MB9A 2HO4A 4LNUA 3U1TA 4CF4A 5U4XA 4EKDA 1JQBA 1GILA 5EXDA 1ZY2A 1JE0A 3MOGA 1TYCA 1OBCA 4IR7A 1TK2A 2FW7A 3KKNA 3QE4A 4U7HA 3T7CA 3LTNC 3Q9NA 4J3JA 3O21A 1EMDA 3RFCA 4EQ6A 3U7HB 1V8OA 1OUMA 4HEJA 2H4ZA 4H7IA 3DMTC 4ITRC 3CW8X 4OQEA 5EKXA 5LKAA 4P31A 1SOWA 3CJTA 4DLPA 4TOIA 2CMGA 3ZZ1A 1MAVA 1S89A 4TYYA 1N32B 3ROEA 1V39A 1ZRNA 2OECA 4FR0A 1FNMA 3UJ6A 5HYVA 2RI6A 2P65A 5M34A 3IEIA 1TX4B 2B82A 3BMCA 2GZDA 3EASA 3MCVA 1KRHA 4HZGA 2NT4A 2X8JB 3CPJB 2DPHA 2VYCA 2WUDA 3E7WA 3PUKA 4HGPA 4AJIA 5IFLA 5C9ZA 3CPHA 5DLPA 5LYYA 5LXTA 1A8PA 1QGAA 1SN7A 1TAHA 2Q1YA 2X4DA 5ALYA 4QPPA 3D6MA 1X7DA 4MUAA 1LTKA 3EPHA 3B8EA 4EFMA 3SDSA 2V98A 1G8MA 2YVLA 1X14A 2ZWMA 1JIVA 3AUKA 1F4LA 1YOBA 5EZ5A 4ZD6A 3RLFA 2FPGA 2ZIEA 1WB4A 3OIWA 3M49A 5K8IA 3AL0C 1EZ4A 3BAFA 4UNIA 2E6KA 4RHFA 1YRHA 5EA2A 3G2KA 1L4FA 4C7OB 4UHEA 3SY8A 2BGLA 1FUEA 2A4MA 1SZJG 2BOVA 4P35A 4PLWA 4B43A 5KYUB 1G7RA 1ORHA 1X2BA 5FWDA 2EL9A 2VRNA 4CUZA 3QFRA 2HLDA 1Z29A 1T8WA 2X19A 2JLVA 1C3OA 2PZEA 1KKMA 1Y1PA 1U2EA 3SK0A 2EX4A 3DOHA 1IVYA 3P45A 3C3XA 3VC2A 2VHWA 2F55A 2GXQA 3ZJUA 4QJBA 1DTWB 1L5RA 4J16A 3ZEAA 2H48A 3RG8A 1ZL2A 1GU7A 4MPJA 4ENQA 4RJLA 6ABPA 3AF1A 3FROA 4GKAA 4D9EA 4U8HA 4H3VA 4LC0A 1EXMA 2FLWA 2QYTA 5K3OA 4N0PA 3DZHA 4YPFA 2IKSA 4X63A 2C2HA 1VG0B 4L76A 4MX8A 4WRRA 1GPJA 3D6JA 1FQWA 4HRAA 4KYIB 5H4HA 5JZVA 3PQ5A 3RODA 4DJ5X 4RVDA 4BBZA 3PCRB 5C2JB 3CZCA 1F38A 1DDGA 1VJCA 3REGA 1M0WA 3PD7A 1LI5A 1HQKA 1XVIA 3AJAA 4XQGA 1QGUB 1N5KA 2ZZKA 4ARAA 1L7MA 5C5CA 3CH5A 4LK2A 2YRXA 4DBLC 1QH0A 2P9ZA 4YHBA 4C6RA 2BN4A 1UBMS 3QHAA 3M4XA 3A6DA 2JGAA 1DIAA 3IIKA 3NHUA 3CVUA 3I04A 1N8TA 3M9WA 4WV3A 1TOAA 4IINA 4E94A 2G06A 1I4DD 1E2MA 4YQYA 1I1QB 1AQYA 2A58A 3W2EA 2OD9A 3VO2A 4BX9A 5LQKA 3ZJVA 2D54A 3H7AA 1QKIA 2WHRA 4RIIA 1JHYA 3GB9A 5AO9A 4YT8A 1DBQA 1RWVA 4XGQA 1J42A 5K0CA 3P19A 1W52X 1XAJA 1R88A 5FBRB 2P6MA 1VSUA 2K6GA 4IIHA 2H08A 4V02A 1KRWA 1WKVA 1E8NA 3OKPA 3E2IA 4EVIA 4N1AA 3LG2A 3RIHA 5HS6A 3V7NA 3WNDA 3QRWA 1CUCA 4XB1A 2D00A 2R8OA 1FFHA 3UOAB 3ZBTA 2HYDA 5TY0A 1RHUA 4Q7QA 2V7PA 3EBLA 5JD5A 4P7JA 5B3KA 3PITA 1T3SA 2DE0X 1G6KA 3PSHA 4QT4A 4M0PA 5IM5A 3WLSA 2FKNA 5DGTA 1IRXA 3W9YA 4IDAA 4HAOA 2CLFB 2XPCA 1W5AA 4C5BA 3LIIA 1GNPA 1Y6RA 2E21A 4Y0VA 1OGIA 1AS2A 4BL5A 3UTCA 3HB9A 3MWKA 5LZ2A 2PLNA 4MQLA 1DXOA 3GN2A 3LKDA 3CCFA 1KFJB 3FVVA 4ETWA 4RW0A 2PQ0A 3EVZA 1UBRS 2OV8A 2BFEA 2ZDHA 3W3AH 4NBKA 1NW4A 2GZ1A 3P2MA 1RAEA 2Z95A 1QIDA 1XK6A 4ZQFA 4D98A 1RBQA 4XR9A 4TYMA 2FSHA 4YQFA 2I4IA 4AJJA 2A0UA 3OQVA 3VHXB 2OQVA 1RHQA 2OWDA 4H16A 1KI6B 2WWVD 4WPGA 2Y1CA 4Y18A 3MBIA 2Q5CA 1A2KC 1W7AA 5E4FA 5ITSA 4PIPA 1OB5A 4R01A 2ORWA 3OP4A 4PQYA 3THWB 4WFKA 4RZ3A 4D96A 5BSWA 3P0EA 3SM3A 2JANA 4G2NA 4L4ZA 4EPRA 4WACA 4QLBA 4ERNA 1GA6A 1YS4A 1JDNA 1NUHA 3CYFA 3DL0A 5IK2A 2HM7A 4FYKA 4G0NA 2VYFA 3HCOA 5KTYA 1DNPA 1UJCA 3NJRA 4WCVA 1TT5B 4RKQA 4ZVSA 2RCNA 1EJBA 3EZ9A 1DINA 4IMIB 4OK3A 1IQRA 1Z0JA 4EG3A 4PXAA 2W2LA 4CEIA 5ALQA 1T1GA 2C03A 1H8ED 2V97A 4IVRA 4BVAA 2ODTX 3EGWA 1OT3A 5HIAA 3TOZA 1O5OA 2MSLA 3LVBA 2M6KA 1E0DA 3SMVA 3G49A 3AJRA 3LY9A 2MT9A 4G5QA 3FGOA 5F33A 1L5LA 4P93A 2W2OA 2AOTB 1U0HC 3KZNA 4C29A 3EPBB 1XKXA 1Q19A 1V43A 5FNVB 3M70A 2FWNA 4NMWA 4X3OA 5D3KA 3I8OA 3SC6A 3O8CA 5C80A 1JDJA 1E2GA 1KYZA 5JMPA 2XMBA 4BMNA 1EG7A 1PFVA 3AU8A 3IHWA 2OWEA 3A9CA 4JT9A 4UZSA 5CH8A 3SJCA 3V2IA 1GTRA 4O59O 3HXMA 4ARIA 3AR6A 2A4KA 3DFMA 4BFZA 4UXIA 3L0DA 2OG2A 2AR9A 2OZKA 2PL9A 2XV1A 4OUDA 3NH6A 3UMBA 4D26A 2WYWA 1G17A 1XWFA 2YFKA 2JZNA 2WYUA 4DLBA 4DB2A 3KXDA 5EKDA 2HU8A 1SGWA 2CE2X 3PQDA 1GM5A 1EEXB 2CJWB 2R4QA 5G41A 1VGRA 3PYLA 1EX9A 1LBHA 1AZSC 1Z56C 2MSWA 1H9BA 4NJMB 5EJFA 3ZHOA 1SXQA 3LLSA 3JQAA 4OXQA 2FWJA 2WVJA 1YNOA 2QXTA 3FOFC 2UZ4A 1PEKE 2ZJFA 4BB6A 3CX3A 1ECBA 2IHYA 3PKIA 1OT5A 3QTTA 4DSUA 2Y0PA 5C8XA 2OCXA 3ECCA 3GJRA 1U9YA 4UM7A 1UIRA 2Z9BA 3BGVA 1V1MB 1NFFA 3GNQA 1XEWY 1X87A 4R1PA 4A8JA 1NM5A 1V3UA 1FFWA 5LN1A 3RKRA 3E23A 1DOZA 2PJZA 3DLAA 3E0QA 3UBMA 2DH6A 4HTFB 2NYRA 4CM8B 4WXEA 3JARA 3WYBA 1M2VA 1X8XA 3BD9A 1E63A 4JY7A 3DOUA 4LJKA 1I80A 1RYBA 4BMOB 3RR2A 4KPUB 1AF7A 2SCUB 3EF3A 4NH4A 3H5AA 4A36A 3D4NA 3FCYA 3F3KA 2REOA 2ZT6A 4C4ZA 2DEUA 4ZQCB 2OSVA 3T35A 1K4YA 4YALA 5TQ2A 1ZN2A 4LXGA 4DJJA 3F67A 1EBUA 3AUSA 5D7NA 2C5LA 4YCMA 4ZZ2A 3H1FA 2HDNB 2X1MA 3HDTA 3S3TA 4CEJA 1KI3A 2I6QA 2XF2A 3E1KA 2IW1A 3BMQB 5KYWA 4DG8A 1E1RA 1TRKA 3EGOA 5FTMA 3FDXA 1OAOA 4RD4A 1Y1RA 1RYNA 1FXSA 1O6FA 2Y6UA 1KH1A 3KK0A 4HLUA 2E4YA 4NNOA 4OIFA 1RXYA 1PJQA 2JB9A 1KEWA 3M3HA 4M87A 4GXRA 2FR0A 3PPXA 4DHWA 1UH5A 2X5NA 4Q9AA 4X71A 3V97A 2B1GA 4Q9HA 5AVRA 5HZGA 3NVAA 4IMPA 3HTXA 1X3SA 1IB6A 4DCTA 1UPBA 1JMYA 1L7AA 2OGWA 1LDMA 1TEHA 1UBNA 4XFKA 4Y1EA 1QFXA 2UYGA 5JNUA 2C7RA 2DPGA 1O94C 2GD6A 5FL7D 4EG8A 3PC7A 3RVDA 2BAGA 3ENVA 1ZGCA 5AKZA 1SD2A 2DC1A 2NTVA 3S2UA 2IYTA 1BS1A 1H3NA 2QTNA 1U2TA 2EX1A 4LN1A 1Z4MA 4RJIA 4LFCB 3T54A 4E5PA 3OPYA 3ZVKA 3OZVA 5I8WA 1JZTA 3VRHA 2E4XA 2W42A 4IQ0A 3T3EA 3BL8A 1NUSA 3BSFA 1B00A 4FI3F 3PPWA 4ADSG 4EG6A 1X70A 3WKDA 3LKVA 3TNJA 4U7WA 4E09A 4LMPA 1HUQA 4JGGA 2WTMA 3DXXA 2XUHA 3W3AA 2Q0SA 4ER0A 5KHLB 4LFBB 2X13A 1Y5MA 3W5AA 1T3ZA 3DT9A 2HU7A 3JY6A 5D2CA 3H8VA 4HN9A 4OQDA 3PHCA 1HX7A 4M1MA 3CT6A 1FVHA 4LA4A 4JXZA 1E4OA 1K7EB 2AFHB 5K7SA 5CP8A 1L8QA 3BMNB 5AVZA 4XGIA 1B23P 2QQFA 1R66A 2E3JA 1CPYA 3AFGA 3ORYA 3MINB 1MKYA 4L72A 5EGSA 4JP8A 5EMHA 3TL6A 1UFRA 3KQWA 3CG0A 1CQWA 5IBPA 3TQRA 2R86A 2VH1A 3QZUA 2XRYA 4MZXA 1A8SA 1JSRA 4CKEA 2FWAA 3QV2A 1MT3A 1EE9A 1NOJA 4RDHA 2Y1DA 2REQB 4ACBA 5JJIA 1GA4A 3WYDA 3GJYA 1KJIA 3AHGA 1D2EA 1RWPA 5EL0A 5ICCA 4YRGA 4QPZA 5ADUS 4F5EA 1XX6A 4L4RA 2GA9A 3X1KA 3AL3A 4W8GA 3UJBA 3RVNA 3HCFA 4UASA 4EJ0A 4EUNA 3FSEA 1ZWLA 1XOIA 1NN1A 3D9QX 1FYWA 5C7LO 1MTZA 2FSIA 3GRCA 5FOWA 2AFVA 5E3IA 4M0MA 3HB1A 1KIAA 2AOWA 4Q02A 1WDWB 2X8AA 3GGSA 2P35A 2QRMA 2AHRA 3HCNA 1KORA 4TT3D 2G1PA 3I53A 4WN9A 1QXSA 4Q7MB 3Q6MA 2BEVB 1X92A 1NUPA 5JUWA 1RKUA 3C2QA 3DMHA 5EMMA 4YRFA 2Y0BA 4F3YA 1T9BA 3KQYA 4PWYA 4KH1A 2PD4A 3EP4B 1FP6A 3TIIA 4BASA 2Z3VA 4QDJA 3CKYA 4JEIA 2Z0MA 2E4AA 4DVGA 3AXSA 2RIPA 1XZNA 4NXNB 1X7ZB 1XJQA 1YR1A 3H4MA 3EP8B 5DZSA 3JVEA 4FT4A 4TYQA 3KSAC 3NAMA 4I50A 5CCXA 1SBNE 3EGDB 4UATA 4BIMA 2ZJAA 1XLTC 1SKQA 3V8VA 3TQQA 3CX8A 3CY6A 1HYGA 4IJUA 1CIPA 4OMDA 3T7IA 2VBFA 2Q07A 4M8NE 3RIXA 3T1TA 3I2KA 3NT5A 2W93A 1MXHA 3GJTA 1EX6A 2J9XB 1E3TA 5KVSA 3DWEX 1J0XO 1HTTA 1KDTA 2B3DA 2OGZA 1NKTA 2VHJA 3NYQA 1H0SA 4JNKA 8LDHA 2XOKD 3L06A 4OU5A 4RPLA 3WSTA 3ZWDA 4A5OA 1JB9A 1OQAA 1UXGA 1XD8A 2PMFA 1FW8A 4M0UA 4GGPA 1R4ZA 2RHBA 4UVIA 3W5DA 1R16A 4DEVA 3AF0A 2P30A 5DHTA 3QEOA 4P33A 4CQLB 4E13A 1Y1SA 3IT2A 3K4HA 1YZGA 4Q9DA 1HR0B 1AKEA 3K6RA 3M1IA 1M34A 4WBNF 3SYNA 1OFTA 3BJRA 2AG8A 4Z3DA 4N3CA 1OXKB 1Q1BA 3GY0A 1C14A 3D7SA 2Z1DA 3MJSA 4PBRA 1PD1A 3NHKA 3DR3A 1S3GA 1RQXA 2W9XA 1W29A 4KX3A 1NYTA 3R8CA 1NJ8A 4JVSB 2OZEA 1E99A 4IDNA 5CB4B 4MYDA 4DUPA 1KFCB 1DIOB 1QE0A 2NW6A 5H68A 2Q27A 3VYTB 1KMNA 2CBGA 1Y3AA 1ZNQO 5A6SA 1T9ZA 3H1PA 2WKQA 3KSBC 1XE3A 1JLSA 1NQTA 3I6MA 4S35A 1ND6A 2V65A 3WK4A 2CXHA 3GJXC 3USCS 1QFYA 4ZAZA 3F97A 4YXFA 4N18A 1EP3B 3WLKX 3GRVA 5EY5B 3AIKA 1RQLA 4EZBA 2AC4A 2VTVA 1Q3TA 4JAVC 4CMIA 3FLAA 2WKSA 1P4AA 3M83A 3T99A 4ZTZB 3HB5X 2AQHA 1SKBA 1U7ZA 2CLKB 5IM4F 4RQBA 4LXQA 1CUHA 4G4SO 4C7VA 3UV3A 4B2PA 4MJXA 2HLDD 3EOZA 5K45A 4JR2A 2ZP1A 2R0QC 3I6IA 3K70C 3KB1A 5IEJA 4JLOA 4XRGA 5EXSA 3EF0A 3L5KA 2WHXA 4CMJA 5DK6A 3Q3GE 4FW9A 3IQGX 3HYSA 1ADJA 3SVTA 1H2YA 4ZOQI 5AQ1A 1BOFA 2JDIA 4MA0A 3MHTA 2BH2A 1ID1A 3NV9A 4CNBA 1G2QA 1B8VA 2WINI 1RBZA 1JNXX 2OO5A 2WWHA 3BMOB 3DJYA 1MOQA 4C0XA 3KTAA 2O8FA 1MIOA 5BSVA 1GXSA 2ISSD 4R1OA 3IB6A 5GM1A 2Y9MB 2HBQA 1W5TA 5EJ6A 1EB8A 3E6AA 1BX3A 4MI3A 4TYNA 2X77A 2ZGVA 3L7AA 1J20A 4ER3A 5IG2A 3ROKA 5KWSA 1IEQA 1XPUA 3W90A 4JBLA 1PFWA 2F3PA 4TRRA 3UT5B 4IMRA 4CKZA 3NX4A 1BVHA 3P2KA 3NUGA 4V0OA 3WE7A 2G4CA 1SBHA 1HQCA 3BFJA 4D9JA 4U9UA 4ABYA 4AJKA 1YFKA 4ZVLA 5JCXA 3RYFB 3KGDA 1RJEA 5E7JA 2NO6A 1TTQB 1O95C 3WIVA 1T2CA 1TYEB 5FOXA 1QIHA 3RK0A 3STWA 2DH5A 4HZUA 4B71A 1CWUA 5F3RA 5BW6B 4AQ7A 3OKCA 4J2OA 2CLSA 2RHGB 3DV0B 1TUBB 3LRXA 4JB8A 4H7DA 4BP1A 3PRJA 1CJTC 4HPJB 2GEFA 1TC2A 3PUIA 4QUKA 2R84A 3T0FA 1A8HA 5J2UA 3ZQJA 2XLCA 4IJKA 2DUMA 1MO3A 1QV6A 3LCCA 2FN7A 3T4EA 1UFKA 1A8IA 3TR6A 3DFZA 3UGJA 2Z56A 1KBOA 2BGMA 1G8AA 2X9VA 3OLWA 4MAMA 3H05A 5E9QA 1Z0ZA 4DZTA 2G9ZA 1H94A 3I9NA 2FXVA 2XVMA 4IKOA 1W94A 4RA9A 2AOVA 1YIDA 1FE8A 1DXYA 4E1VA 1I3KA 1QNFA 4WXPA 4RACA 4ZTBA 1M1NA 2VJOA 1Z34A 3HJUA 4P38A 3VR5A 2R1VB 2QMYA 4NI5A 5E4YA 4X97A 1RBMA 2ZSBA 1H6CA 1IPFA 2UZ0A 2DUWA 3DMYA 1PL0A 9ABPA 1S2NA 2IUYA 1Z4NA 4AMYA 1UQUA 2BRUC 4G25A 4IX9A 4R2LA 4RV4A 4YMVA 1LLDA 3U4HA 4KNYA 2W2KB 3DWIA 3K35A 4QFMA 4FJ0A 1L8OA 4KN9S 1XEFA 3PL1A 2I8LA 3GRYA 2H54A 4MNTA 1NSTA 1FRZA 4X7RA 2OA0A 2C2OA 3LPNA 4YUAA 1FP4B 3A04A 2XUZA 1ODIA 2WT9A 4QARA 5HMLA 4B4WA 1ZIPA 1AC5A 1SHZA 2QF7A 3IDZA 3HL0A 4JQZA 1M1YE 4LUCA 5JCOA 4KFTA 3GC6A 2K7ZA 3MUFA 1NMQA 1QNLA 1PYGA 3FYCA 1IXYA 2R1UA 3IJRA 2ZI9A 1PRYA 1WWKA 1ZPDA 3HPQA 4KREA 1EESA 2VRCA 1IEWA 3JASB 1XHEA 5JD6A 1SUDA 4HFNA 5DT9A 3I4LA 3CKKA 4DSAA 1PNQA 3DEHA 4PZ9A 1KJ9A 2O7NA 4Q47A 5GGYA 3ZLUA 5A0VA 1GPBA 4CNQA 5E7IA 4BKUA 3U4AA 5CCBA 2H7XA 5EXTA 2OZPA 5CIWA 2VWQA 3GDOA 3UHAA 3CX4A 1V7QA 3ZLVA 1E2FA 4OHOA 3AC0A 1O97D 2HIMA 5D1HA 4LYYA 3U61B 2GZMA 4R2IA 4TV9B 2R5FA 4WVFA 5KINB 4FFRA 1ESZA 1IY8A 4F84A 2GT1A 2ETVA 4S1TA 3CPEA 4Y2JA 4YJFA 1AGPA 2VQ3A 1XRMA 1X1DA 2H5EA 2C9ZA 4Y1GA 4HDRB 3H18A 4FW8A 1VLVA 3WYAA 2GAIA 4F3NA 1TO6A 1C7EA 1YQXA 4JLVA 4WY8A 3VNQA 1QRRA 3HFRA 4OGFA 4WA8A 4Q4AA 3VHQA 2H31A 3ZD9A 1T4GA 2J9ZB 3KLOA 5JCJA 4KU4A 3DZ6B 3THSA 1YRBA 3H5TA 4V0ME 2IYXA 2NIPA 1JPNA 2JFWA 1DRUA 1YMVA 3DEIA 2RGAA 3GZJA 3HH8A 3ZOZA 5CCEA 2O59A 1JA9A 1OB2A 2R00A 1LK7A 4KQMA 5ALRA 4BNLA 1N0IA 4KXUA 4AF7A 2PV7A 4HYEA 3GLUA 4O02B 3UMGA 3W4KA 2OESA 2QD1A 1UWLA 3CB2A 3QW2A 4HP8A 3WMGA 1EXVA 2P9JA 2DAPA 3P0JA 4H6VA 2BUCA 1K68A 2FA9A 3LQ4A 4F9GA 3GP8A 3MILA 1XG5A 4M53A 2APJA 4W7HA 3WNVA 4A2QA 3UUWA 5CFPA 1HDYA 4RZXA 3P32A 4DV4B 5DGIA 4TT8A 1E5XA 4E31A 1L5ZA 1RJWA 2VDRB 4J0EA 3MS7A 1Q0QA 1O8BA 4Q4JB 4DR3B 3U4QA 2CJFA 1PVVA 2OK8A 1BJRE 3IAHA 1GRQA 2R9VA 4M7WA 2JA1A 4NESA 5LB2A 4I5EA 1XZDA 1XRRA 4FYWA 4KNVA 3KXKA 5HX7A 2YC4C 4TKLA 1MC8A 3V6MA 1LDYA 1BWRA 5DX8A 2JKZA 4I4TB 4DDUA 3GRPA 3I58A 3TI7A 3I8XA 1FW6A 2WPDD 3KVYA 3IT0A 2A30A 1F5SA 1IBCA 1SCUB 3L7DA 1J22A 3V8EA 1Z3IX 3IUPA 1BVUA 3A05A 4FLMA 1TW2A 2J7KA 1PGPA 4D5EA 2YZ7A 1DO0A 4EBFA 1PJTA 4W5JA 1WMDA 1VJ5A 5HF8A 3IX7A 4MARA 1QHHB 3H1TA 1WEKA 3K9WA 1S2DA 1VG1A 2PYZA 3UATA 1QK5A 3OFNA 4O2LA 2DP4E 4ROSA 3RSCA 5KNLA 1IHPA 4CCYB 4RVHA 1FUYB 3D0QA 5BT8A 2F3RA 5CEEA 1XTSA 1V47A 2EW2A 2Z04A 3LSYA 2VEDA 1RI2A 3C7DB 4HB2A 4J6EA 1JJIA 4TM7A 2JD2A 1N2XA 4A2PA 4JVMA 2VSXA 3K0HA 1A50B 4TV8F 5B7QA 2GZ2A 1EEHA 2GO7A 2WSBA 3C14C 2EW8A 2VYNA 1PKXA 2P7IA 3FYUA 1ZBQA 3II6X 2AS0A 1WUIS 1JDVA 1ABBA 5FBWB 5T73A 4PHGA 5G3ZA 2CVPA 4YASA 1P2UA 5HKAA 1A69A 5LOVF 3ED1A 4TXLA 3K9LA 4P7KA 5CURA 1WMFA 1MB3A 3VJKA 1FXUA 1Q6ZA 1SBIA 2PDAA 2UZ3A 2JLBA 1PUIA 2NZJA 4KE9A 4WBXC 4WY2A 5H0IA 3SKXA 1U0FA 5KJCA 2IYOA 3Q0EA 5KQMA 4PQFA 1I7CB 1YVEI 4EYSA 4YCCA 2O9JA 3GUVA 2PZLA 1XTZA 4ZHQB 4RMHA 2Q4OA 1ZCJA 1VZ3A 3B36A 5FUXA 3KT3A 1TCAA 3W3AD 2IXEA 4LBZA 4EPYA 3EG9B 5HUHA 3ZG6A 1JA1A 1BGVA 1JAZA 1BXGB 3R3XA 2ZYIA 5EJEA 1QE5A 5AXCA 3IUQA 2DXIA 2VPXA 1R5JA 5FPYA 3AKDA 3TKYA 2GCEA 1A2OA 1PK9A 4DGQA 5D86A 3QXXA 5JANA 1QU3A 2FP4A 1DOAA 2I2AA 2VT7A 4LKRA 3IP5A 1WZIA 3P9YA 4R5MA 5AVYA 1J8DA 5MFZA 4K0KB 2COEA 2A9OA 2YZNA 4JR0A 3URKA 1SVIA 2YRFA 1W19A 4ZAYA 3SX0A 4DLAA 1BDIA 4JELA 1KEUA 1J9EA 3R5JA 3RRYA 3O03A 1K8RA 1NJFA 2VDVE 4ZKDA 4LRXA 2WR8A 5IH7A 4P34A 1IHXA 1B6TA 1XPOA 5K6AC 4AZ0A 4YXWA 2Q4EA 3RJMA 1OH8A 3FTQA 3EBOA 3H9QA 3KV3O 1CE8A 1ZUNA 2N1MA 3WMWA 4EJ6A 4YQEA 5MN4A 1XNJA 3DULA 2BSAA 2P4HX 2BMVA 4QODA 4EK9A 1BOOA 3NCHA 4G1CA 1RZ3A 3ZW9A 4BNVA 4UDNA 4EI2A 2BTQB 2Q6VA 1KZYC 2X7XA 3HDVA 3QLVA 2P62A 4MP3A 1DMSA 2Y1EA 5ELLA 3CLSD 4QYTA 5NLLA 2B6NA 3FB1A 3LPDA 2ILVA 1ZVKA 3LW8A 3OOHA 3PUWA 3R5XA 4HDNB 3ZXYA 5KSPA 1WUJS 1XQYA 5LFAA 2IP2A 1QHSA 1M1XB 2KE5A 2XDWA 4DJAA 1OBFO 2FN9A 1LVGA 4JFRA 2P2LA 4UVGA 1GQFA 1NU6A 1ZBDA 1LBQA 1THZA 1Y1KE 2CXXA 1Z6AA 3WMRA 2IV7A 1IY0A 3MTAA 4V1CA 4MWBA 4C43A 5HXAA 1A2BA 3C3KA 4OFBA 1RP7A 3C3EA 5DWQA 4C06A 2WG0A 1EFRD 4EUHA 3K6SA 3ICVA 4DV6B 2EDCA 1GQYA 1QTNA 3I32A 3K05A 1NLZA 5AIAA 4CM1A 3ROZA 2X0DA 3W6NA 3TD6A 2P1DA 4JK3A 2WU0A 1KA9H 3STYA 3QY9A 4YECA 3LRPA 1MB4A 1E5QA 2QDKA 4F5ZA 2ZIGA 3PU6A 5BRNA 1FYDA 1F6DA 3A9WA 5CFOA 4IRMA 1G2IA 2FJUA 4GXQA 4NZMA 3K0EA 4C0BA 3BT7A 3KEOA 4H4CA 4OXRA 4YJ2F 3RSQA 5G0UA 5LMCA 3WGIA 5DK4A 5G3YA 5F9FA 2ZPTX 3K32A 2H57A 3OFKA 4ZVKA 4A0GA 3GUCA 1ENPA 2IITA 4AJ4A 1I36A 2RB4A 4PCVA 1C4OA 4EUEA 2QG9A 2C61A 1FFAA 1UOOA 3VZPA 4CKBA 5EWLB 1FP2A 4H0CA 2YJZA 4Q6BA 2ZJ4A 2CLEB 3TMKA 2Y4OA 1AU9A 2QE7A 1EHCA 4QUIA 1WBDA 1E94E 2BEJA 3COZA 3NMUF 3WFJA 4DL9A 2HHCA 5J2TF 1U1CA 2V58A 3W2FA 4B4KA 4K9OA 1PDOA 4WW0A 3FCXA 3N3AC 3DZKA 4WSOA 3Q41A 3GCGA 3ZJTA 1BCRA 1JXQA 1PZEA 4GNKA 4R2JA 4CF3A 4F6LA 3V1TC 3ENKA 4Y2QA 4EKGA 3E27A 4LK3A 1E3DA 4JODA 2DLNA 5TARA 3TCKA 1IJBA 3TAXA 4XOIA 1EHYA 4GT1A 2PQ2A 4I3GA 2W8ZA 3IHLA 4KE8A 4UNNA 1KSGA 4BFCA 4WLEA 1DQYA 1X80A 2OV1A 4N39A 4DADA 1ECFA 2O3RA 3ANLA 3CNBA 3OZXA 5EMNA 2IE0A 1WZCA 5AW3A 5JTUA 3VH2A 5MGBA 1P62B 1MW8X 4JB3A 2HMAA 2IVZA 2Y0EA 3LHDA 4GOOD 2FU5C 3MG9A 4BEWA 3TD2A 4EATA 2I9PA 3KB6A 4BRZA 5TPZD 4CLRA 1IPHA 1ZNYA 4X3PA 1KKUA 4EO7A 5JS1A 4GI3A 4BGUA 3VC3A 1E2PA 3H0KA 3RTBA 4A1FA 2PCLA 1JXMA 1LPAB 4CTKA 4EA9A 5EINA 2Y2VA 4E7PA 1AG9A 3Q98A 3FVWA 3PNMA 3DLHA 4QM6A 2JDID 4G9GA 3L8CA 2X0JA 3GZTB 2D5LA 4FP9A 3HXTA 3UMRA 1EUQA 3LKBA 5H16A 2LZ0A 4UCFA 1ZJJA 3GLTA 1L3CA 2ACWA 3LDFA 4X41A 1V5FA 1XLUA 4O33A 4AROA 5B4VA 3QF7A 2W6MA 3MCWA 2QIPA 5ALNA 2DBYA 4I8DA 1VKHA 2Q2NA 2ZUWA 4O2AB 4OF4A 2PY6A 4DJTA 1OYWA 1PL7A 4FDAA 1EWKA 3V8PA 3O83A 4EJSB 3HBAA 1NI4A 3SE0A 3E58A 1BW9B 1R8XA 2OCAA 3T7KA 1YIOA 4AJ9A 4IEFB 4JFAA 1EP9A 5LKRA 1E8DA 4CIDA 4DABA 3CEMA 2P2NA 2NO5A 2O8CA 3B5IA 4ZC1A 2E87A 1HT2E 4OI4A 4BDTA 4K05A 2Q4BA 1JEQA 5EHGA 3UYKA 4BATA 4FILA 3QW4B 4C20A 2IHNA 2BFPA 3I3SR 4EKYA 2BGJA 1XZCA 1C30B 5GV7A 4EFNA 4EG7A 1LFAA 5EJ4A 3NLLA 3UAOA 2P0EA 4BRSA 1GA1A 1I3MA 1Z3CA 4TWBA 5KOJA 2D74A 3M89A 5LUAA 3C1UA 3SEFA 5CFLA 4J7XA 3H2SA 4EVQA 1VPDA 2GEJA 3BA1A 3EIHA 2YY7A 3RGWS 3E84A 4B3DA 5AVUA 3A26A 1W6RA 2GLTA 2VTKA 2P90A 1Y5NA 5F76A 4N8EA 4JJFA 5E0OA 4YCNA 3U7FB 5IARA 1RRCA 2NVOA 5JT1A 4X6XA 1ZGAA 1T3LA 1R6DA 1UJNA 1N7GA 2R7AA 3HHPA 4MRPA 4WKNA 3DFIA 3S99A 1OTHA 4AU1A 1PE0A 3MUEA 4ZOEA 2IEAA 4DUGA 3FSGA 4BHTA 3VU9A 1II9A 6NULA 4X94A 1MENA 1D1TA 1WY7A 4L0MA 5FFMA 4F4UA 2B2CA 3HHEA 4DIBA 3OLQA 3BZWA 1SKMA 2W6OA 3O1LA 4N5DA 1EUCB 2EKBA 2YH2A 1W36C 5DHFA 1K3TA 2O8BA 4HV4A 2C8JA 4YCBA 1N6LA 3NBUA 2PZJA 3ZDYB 4CG2A 1NC1A 3QXHA 3FDJA 3IAFA 3PFFA 4OSEA 4B6JA 3ZD6A 3MYYA 4OXYA 4BFSA 2VP9A 3F0TA 3DBRA 3LXRA 3LYAA 3AHCA 1E6LA 2GRJA 1GZ6A 3QVXA 3M6WA 1J5PA 3G8YA 1S2MA 2WD9A 2WM9B 3OAAD 1TPZA 5E1BA 4DIMA 5JWOA 3AONB 1K0UA 3CQ9A 4R8VA 3T9FA 4YJGB 3ROPA 5GONB 3AEQA 4QFDA 1VE5A 2W2XA 2MMCA 2NU7B 1M8FA 1BRTA 1UDWA 4HVAA 1K0FA 4MDEA 3FNHA 5DP2A 2C88A 2IWHA 4L95C 1A5ZA 3J80A 3EEFA 3L84A 4UEWA 1RWWA 4L8FA 5AKKA 3B1FA 1Z37A 1UBFA 1USGA 4R31A 2PT6A 4K6FA 3FCAA 4PBTA 4BN0A 4KOEC 4TROA 3S5JA 4BX8A 4FX2A 1IL0A 2ATCA 2TMGA 3L0ZA 3LBNA 4PO8A 5C8ZA 5LNK1 4NHEA 4LIPD 3GDHA 2A0XA 1UJ6A 3C7KA 4JQOA 2QX9A 1ZOLA 2Y9PB 1BE8A 4PTZA 1WB9A 1VHQA 1RWOA 2AC7A 1Z16A 2B20A 1VLQA 2O3JA 1B0ZA 2ERYA 4MS4A 5GAJA 1N6OA 2CLLB 3RVQA 3TQCA 2E4VA 4I9UA 1SIBE 4P3YA 5FAKA 3N53A 1TKAA 3A6PC 3R9WA 1VYVA 5EHNA 1GFSA 5IJ0B 4ZHSA 3P27A 3DMFA 2I6SA 3LLUA 1X13A 1Q7EA 3TFWA 1JLLB 3OPMA 4RNDB 2G9QA 2PAAA 1BMQA 3FGNA