1NWHA

Crystal structure of aspartate semialdehyde dehydrogenase from haemophilus influenzae as a tetrahedral hemithioacetal reaction intermediate at 2.0 a
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
371
structure length
355
Chain Sequence
MKNVGFIGWRGMVGSVLMDRMSQENDFENLNPVFFTTSQLKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLMAIGGLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDNFGAALGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate-semialdehyde dehydrogenase
publication title Capture of an Intermediate in the Catalytic Cycle of L-Aspartate-beta-Semialdehyde Dehydrogenase
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Oxidoreductase
total genus 113
structure length 355
sequence length 371
chains with identical sequence B
ec nomenclature ec 1.2.1.11: Aspartate-semialdehyde dehydrogenase.
pdb deposition date 2003-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain
A PF02774 Semialdhyde_dhC Semialdehyde dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1nwhA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1nwhA01
4YJFA 4YJGB 4YTEA 4I9HA 1CYDA 1OZAA 1PWZA 2AQ8A 1ID1A 1XA0A 3OSUA 1E1NA 4DXHA 4EEZA 2G5CA 3TN7A 1OOEA 3U4IA 3JQAB 1ZEMA 1W8DA 1XIVA 3TQHA 1TXGA 1VI2A 4RVSA 3B70A 1F14A 2IEBA 3PHGA 1WWKA 1PZGA 1JW9B 3K5PA 1ONOA 5CHEA 3KXDA 2Y0DA 5EESA 4RORA 3GH3A 4IJWA 2GASA 4RPKA 3DBRA 1GUZA 3WYBA 3KYDA 1LSJA 3RVDA 1PJ2A 2B36A 4JN6B 4FSHA 4NPCA 1Y7TA 4MKZA 2X22A 5A02A 3FI9A 3MJVA 4O59O 5I9MA 4IMPA 3IDSA 1SMKA 1PIWA 1NVTA 3C1TA 1CWUA 3DFZA 4W7IA 4U5QA 3WG9A 5JE8A 5KJCA 4QTZA 2OP1A 3ZWWA 5KKAA 1ULUA 3NTOA 2Q4BA 3LF1A 1LTHR 3ONDA 3BHJA 4BNKA 1R4NB 1YDEA 2DFVA 3SJUA 5DBIA 4PIVA 5IDWA 2PD3A 2PKQP 2BGMA 3FWZA 3PK0A 3AUAA 1O0SA 3ST7A 3ZV6A 4PRLA 5AXAA 4WGGA 4BNXA 2E37A 1HT0A 2UAGA 2B4TO 1ISHA 2YW9A 1XHLA 3G49A 3MWEB 4I9NA 2GCGA 5AQ1A 3K96A 4CMJA 3ADPA 2YV3A 4RVGA 1H93A 1ISFA 5I7FA 4LMRA 1PJSA 3G17A 4BL5A 4DA9A 3MJSA 1U8XX 2YDYA 2RCYA 2G17A 3DMTC 1PJQA 4L73A 4BO1A 2Z5LA 3SEFA 3QE3A 3EMKA 2O4CA 5I7EA 1PWXA 3DXFA 3TJRA 2BD0A 3EAGA 4XZ3A 2VOJA 1MB4A 3CZMA 4GWGA 5JS6A 2VZ9A 2OO5A 4CMBA 1HYEA 1YQXA 1P45A 3TZ6A 3EW7A 3WGYA 2A4KA 1PS9A 2PZJA 3KEQA 5F5LA 2HO5A 2A35A 4KWIA 2JKVA 4I8XA 3UW3A 4P22A 3HN2A 1HLDA 4ROSA 2ILTA 3RC7A 1NR1A 3I23A 3AI3A 5IDXA 1BRMA 5F1PA 3VPSA 2EP7A 2R00C 2NSDA 1YGYA 1ZK0A 2OGUA 4B4OA 5JC1A 4HXYA 3C3XA 3OJOA 3KZVA 4OIMA 2D5AA 2I9PA 3C85A 4IDFA 2CD9A 1C3VA 4QQRA 4BHTA 1GV1A 3RROA 5AVOA 3QVWA 4ZJUA 3WR5A 4U7WA 2YUTA 3GZNA 5GY7A 1BDMA 1E3SA 4R01A 3GVXA 4MVJF 4RL6A 4NJMA 3DFUA 3E03A 4J0EA 1DXYA 1K5HA 3TFQA 3FR8A 1JDJA 4BO6A 1IZ9A 4D3FA 1CQJA 1C1DB 1EE2A 4YJFB 1C0KA 5I8ZA 4QO7A 3T4EA 2J5RA 4JGBA 3WOHA 5JAIA 1T4BA 2RH8A 5C3MA 1RJWA 4L4XA 2ZB3A 1YOVB 4UEKA 1W4ZA 2B69A 1LLDA 4BUCA 3NUGA 1H6CA 4DIBA 4B3HA 4WCDA 2GSDA 1UXIA 1SOVA 4Q3AA 1ONPA 1VKOA 1KVRA 1MA0A 4RPLA 3NYWA 4CQMD 3ORFA 5JPIA 5B4TA 1ZW1A 4H16A 3ZWPA 1EQUA 1I3LA 1TT5B 4I5DA 1JKFA 1E3LA 1DJQA 4J7UA 1BW9B 2JD1A 1F06A 5CDTA 1U9JA 1JVBA 5ITWA 2PKRA 2AEJA 4WK6A 2DFDA 2JCXA 4R69A 4OXYA 1H0KA 1R16A 3GFGA 3WLEA 3BTOA 4DBZA 4BNVA 4Q3CA 1R12A 4FPXA 4XD2A 3KB6A 1I01A 3DBVO 3I4CA 2OZPA 4CJXA 4NBRA 2O7QA 2D4AA 2EKPA 1WDLA 5GZ6A 4J49A 2DTEA 4IUYA 1V3TA 4RZIA 4EI2A 2G0TA 3AOGA 1LLCA 1KERA 4IMRA 2ZCVA 4BNGA 2IE0A 3PLRA 4IXTA 2EF1A 4CM3A 3R0IA 3IJPA 2GF2A 3S2GA 4NBVA 3UCXA 3TOZA 4IBOA 1DLJA 5C37A 3FNFA 3GGPA 5JCJA 1H9AA 2CUKA 2FN7A 3OECA 4LGVA 1C0IA 4N5MA 3O8QB 4PFJA 4AJOA 3D3EA 1KS9A 3BZUA 2X9VA 1YKFA 4OKIA 3GOHA 1EUZA 3HB5X 3AUUA 3DZKA 4FC7A 1VL8A 1AGNA 1Y6JA 3FN4A 3U5TA 3IIEA 4AL4A 1P1HA 2WE7A 2X5OA 3OBBA 2Y1FA 1C1XA 4Z9FA 3MOIA 4BV8A 4AJPA 4CM9A 2YY7A 1J0XO 2A92A 4ALIA 4J6FA 4BO0A 4AICA 2JJYA 3BMCB 3H9EO 3GZ4A 1YH3A 4P8RA 4BNHA 2CVOA 5G0WA 5HWSA 1QV7A 4AJEA 3OQ1A 5BSFA 3DONA 4DGSA 5EN4A 2IXBA 5L7TA 1LSUA 4NI5A 4IPTA 3AM3A 3RI3A 1O6ZA 4DTIA 1P33A 1X1TA 3QLJA 1NFQA 4M89A 5FI3A 4F6CA 5IF3A 4E5NA 3GVCA 1A71A 3TZCA 1LC3A 1DLIA 1Y81A 3I3OA 2O3JA 4E6PA 3H9QA 2GNAA 3TF5A 3GGOA 4NJMB 3AY7A 3IKVA 1N1EA 4XJTA 4WLUA 3JQCA 1J49A 5H83A 1Q7GA 3WB9A 1FMCA 5A06A 3RUCA 3RASA 2EEZA 1QP8A 4D45A 2NNLD 3NTRA 4Y6RA 1LQUA 1WDMA 3PJDA 3UGKA 3K9QO 1DEHA 4R41A 4WLVA 1AHHA 4WOKA 3ROMA 4A5OA 1HDYA 3DZGA 1ISGA 1I3KA 3WYCA 3H9JA 2NU8A 3RKRA 1E77A 4XX0A 4LRTB 2GR9A 2FP4A 3KSDO 5TJ9A 3TWOA 3CUKA 3HDHA 4UUMA 5JDCC 5AXBA 1NM5A 5DNAA 2QRLA 5JAQA 2PV7A 4CLOB 4ND3A 8LDHA 3IL2A 3Q1LA 1FJHA 3ETEA 1PS0A 3D64A 4Z9YA 1X1EA 1PR9A 4GMFA 5CDUA 2DQ4A 1CF2O 4BO9A 4BKQA 1IE3A 2JCYA 4L4RA 3TZKA 5L3ZA 2WYUA 4XIJA 1IZ0A 4EUHA 1U2GA 4ND4A 1QMGA 3EZLA 2W8ZA 5CPBA 3WQSB 2P91A 1DHRA 3K73O 2O50A 2UUOA 4F3YA 1ULSA 4QSMA 3DMTA 4CLEA 2WDZA 4UVEA 4CQLA 3QIVA 5JAMA 4UUPA 1O94A 3FBTA 5DZSA 3IS3A 3I9MA 1U4OA 2DPHA 1MXHA 3LF2A 5JFOA 3TDKA 3ZWBA 3WSVA 5GMOA 1B7GO 1WP4A 3DOOA 3GDOA 2X58A 2AE2A 5A5EA 5B4VA 3KO8A 2ZTLA 2NTNA 5DCWA 2Q1WA 4EZBA 4QFDA 4NU5A 3ZU2A 1I32A 2VCYA 3ZU5A 3HB4X 2OBNA 4WNIA 1SPXA 1T2CA 5EIOA 1UUFA 2LDBA 3RC9A 1I2ZA 5IXYA 3V2UA 4IJUA 3OFSA 1AE1A 1EK5A 2OBYA 2R00A 4WCFB 1N2SA 3IMFA 3VZRA 1KY5A 4E3ZA 4MVJH 4DBVO 3EGOA 4ZICA 1WW8A 4JBIA 3RJ9A 1B0AA 1EZ4A 5JYAA 4RDIA 2WTBA 2I5PO 3KSUA 2GZ2A 1SB8A 3G3EA 4MVJD 5MGBA 1WZEA 4BNIA 2ZIZA 2QYSA 3S2FA 3GG9A 2JL1A 3TRIA 4Q9NA 2HJRA 2CY0A 1E6EA 5KCZA 4JCOA 3U62A 1VPDA 2X5JO 4LN1A 4ND5A 3X2EA 3RSHA 4GLOA 3AU8A 2WJPA 3RBZA 2Y93A 1FDSA 4R16A 5L45A 2P4QA 5T64A 3DEYX 4PZEA 1LDBA 4W4TA 4QT0A 4IDCA 1DRWA 1NHGA 3GF4A 1A9ZA 5U4QA 3PFWO 1ZBQA 4HBGA 3PDJA 3AU9A 3UICA 4BGUA 2ZK7A 5TGDA 3ZWAA 3DOCA 2B37A 1P1KA 1GZ3A 1NX6A 3KYBA 4M49A 3BMQB 3FR7A 1G1AA 3NJ4A 9LDTA 4I9UA 5KVQA 2HUNA 2OORA 3AM4A 1CJCA 3VH3A 1B16A 3OQ6A 4RF4A 1LQTA 3GC6A 1TEHA 4XQEA 4YJHB 3QVOA 4E31A 1GY8A 1M76A 2DC1A 4CM7A 2JAPA 2HJSA 3D3WA 3TOXA 2PGLA 5H81A 1LBEA 1WNTA 4F45A 3GNQA 3LC1O 1X7DA 1HL3A 4RF2A 1JKIA 4FJ1A 3WGIA 4E12A 5JW6A 4J1TA 1GCOA 4FFMA 2X23A 3IAHA 3OA2A 2BKAA 3WMXA 3ZZNA 3B1FA 4WE3A 1E5LA 3VKVA 4YT4A 3BHMA 5JLAA 4J4HA 4LSMA 2JAHA 1PL6A 4GAEA 1WVGA 1YWGO 1ADCA 1NAIA 2FR1A 3V5NA 3SC6A 1I8TA 1YL6A 4MP3A 2F1KA 4MIYA 3FCOA 4UEOA 5TS3A 1P1JA 1SNYA 3R3SA 2J3KA 4UUNA 2HK8A 4I08A 1XQ1A 1HDOA 4NH4A 3DZFA 2ZJ1A 1S6YA 4GL4A 5IJZA 3GQVA 2QRKA 1ZVMA 2JD2A 2FSVA 3WFIA 1UXKA 4NBWA 4BQRA 4F6LA 4DC0A 3HSKA 3DAGA 3PYLA 4MDHA 1VJ0A 2PZMA 3ZV5A 1GTMA 2ZYDA 3ICPA 4FCCA 4L4SA 3OEWA 2V7PA 1C14A 4KUGA 1YS4A 3V2HA 4YRBA 1VM6A 3E48A 1R15A 3VVCA 1IOLA 4D43A 2ZYGA 4XB2A 3FSRA 4OSOA 1RPNA 3DDNA 4CM5A 3KRTA 2B83A 3Q9UA 4WECA 5IFLA 3A1NA 7ADHA 4UVIA 5JNLA 2GO1A 3RFTA 3AOEC 1SB9A 1N9GA 5DBGA 5G0VA 4YQYA 1ORRA 1QYXA 2VT3A 3IQDB 2Q1TA 5TNXA 2VYND 3KSZO 5LC1A 5ENDA 1YJQA 4PLCA 1DPGA 4RF3A 1DFIA 2J8ZA 4E13A 2ZCUA 3E9QA 2RHRA 1A27A 1ZK4A 3U4CA 2NQTA 3LT4A 4JIGA 4PLZA 3QP9A 4RVDA 5EQDA 1HEUA 1P77A 4QUKA 4BO5A 3E82A 3AI2A 4EJ6A 4DQXA 4DQUA 4ZD6A 1GR0A 1I2BA 4R1UA 3WNQA 5A03A 1R0KA 3C8MA 1DO8A 3FNGA 4LISA 1DC5A 3HJAA 3T4XA 2W2LD 4E2WA 2AQIA 3KBOA 4BNZA 4R5MA 2EHDA 3JV7A 2VUSA 3DR3A 1ZSNA 2BGLA 5AXDA 1U8FO 1UDCA 1H6DA 2HQ1A 1ZZEA 5L53A 4OGWA 3QWFA 1GV0A 3GNTA 3JD2A 4AJIA 1HDZA 3NEPX 3FD8A 5JY6A 1MG0A 1OC4A 3GN1A 4GSKA 1H2BA 4XQGA 3DBHB 5G0SA 4E5MA 4GX1A 3WQQA 4OQYA 2Y1EA 4KQXA 4RO0A 2VUTA 4BNTA 4CM8B 3BXXA 1KC1A 3PXXA 5T5QA 3RFXA 5BSGA 4J1NA 4Z9XA 3VTFA 4BKPA 4J0FA 4BKOA 3ZI0A 3MTGA 1C0LA 4D42A 3D7LA 4ALLA 5DF1A 2C0CA 1VKNA 4D79A 4XYBA 5CEEA 1CDOA 4PN3A 4DPLA 4JBGA 4Q39A 3AW9A 1VC2A 2ZB4A 1EUCA 3M6IA 4CM6A 2VWGA 2Y68A 2Y1CA 1BXGB 4BB5A 1GPDG 1P44A 3DZHA 3RKUA 5TIIA 5DN9A 4N54A 3VVBA 1DAPA 3RBVA 2X1HA 3ANMA 3GT0A 2CSUA 3GY0A 4CLRA 4ZQBA 4NJOA 3D5TA 3ZV3A 3KETA 2JHFA 1PQWA 2EXXA 1NWCA 1NYTA 3U3XA 4Z0HO 4JXKA 3LT2A 4LCJA 5COBA 1V6AA 1KEUA 2VWQA 1LSSA 1TI7A 1PS8A 2VRCD 4G2NA 3LC7O 1YQGA 1U5CA 1Y8QB 4AJHA 3JQAD 3UOGA 1A9YA 1B26A 2Y66A 4RVFA 4CMIA 1LA2A 2PTGA 2H9IA 3ZCXA 1HSZA 3VPGA 2OP0A 3GVHA 3STHA 5CDGA 3FPLA 4A10A 4JP3A 4W7HA 3UUWA 4BKRA 3INGA 3AJRA 2RAFA 3VKUA 1HRDA 1JQBA 3GGGA 3EUWA 1DDOA 4FFLA 2C29D 4YA6A 5TF4A 3ADOA 4NFSA 4NQZA 1UP4A 5U1PA 4Z3KA 1LI4A 4BNFA 2CDCA 5HA5A 2PLAA 5LCXA 3HADA 3M1AA 4NFYA 4WLOA 3ROQA 4BV9A 1T2AA 4DIFA 3CH6A 4L0QA 3JD4A 4LSWA 4BMSA 2G76A 2OOSA 4IINA 2CFCA 5KKCA 4AJ4A 2PD4A 4G81A 4GSLA 2PGDA 4CUJA 4KTTE 4KUEA 3T7CA 2C54A 3BMNA 5ILOA 4O1MA 3W6UA 3MJTA 4J1QA 1ZKMA 4A0SA 2WMDA 4YACA 1XDWA 5HS6A 4II2A 2ZTMA 2Q46A 3Q0EA 1W6UA 1ZK3A 2YFHA 2ZYAA 5TC4A 3GN2A 4YEDA 4B4UA 2D59A 5G4KB 3ETGA 1XG5A 2FRDA 3K30A 4NK5A 3HN7A 3ZNOA 4CR7A 3JQBC 3F46A 4Z6KA 1JLLA 1Y8RA 3LYLA 1HZJA 2D2IA 3KEOA 5C7OO 3JQGB 2Q45A 2C2YA 4K28A 4BQPA 5CAEA 2GRAA 1DFHA 3W8DA 4A27A 1I2CA 3F9IA 3RCBA 3JYOA 2DU8A 1OI7A 4U6QA 4NMHA 3CPSA 1U4SA 1ENYA 4BO2A 1I5RA 3VH2A 3PI7A 2P5UA 3V8BA 3C7CB 2UYYA 4KZPA 2P5YA 3JQ8B 1GUYA 3GAFA 3ENKA 1GPJA 4TVOA 1PZEA 4R1NA 2O3RA 4OYRA 1CEQA 3ENNA 1D7OA 3GUCA 3H9GA 3UAGA 2J3HA 3L6EA 1XYGA 4ID9A 3SLGA 4W82A 1E3JA 1E7WA 4OAQA 2POQX 1Z73A 2TMDA 2VOEA 5A04A 2WD7B 1B15A 2J6IA 4INAA 3TL3A 1QV6A 2HRZA 1W73A 1GL3A 1E3WA 4UAGA 1MC4A 2HKIA 1J5PA 1WXDA 3JD0A 3L9XA 2D5CA 5CP8A 4R1SA 2QZZA 1Z7EA 2IEDA 4S3MA 4BO7A 3ITDA 3AM5A 4L76A 5J23A 3VPHA 1S7CA 1HE2A 2BELA 3UXYA 5KNLA 3K6JA 2WSBA 4Y8VA 1PJ4A 4KUHA 4L74A 4CQMA 1A4UA 1HDRA 1WZIA 4GX2A 1RKXA 2B5WA 3RIHA 1BSVA 1ZSVA 3EVNA 3VPFA 1NWHA 3WQRA 5I7VA 4BIIA 5L95A 5B1YA 3KTDA 1Z75A 3D0OA 4GLLA 4NHEA 5HRUA 3HWRA 2EP5A 3NV9A 4K9DA 1B8UA 4ND2A 5L4LA 4C4OA 4P4NA 1I3NA 3AOEA 4B3JA 5KWEA 3DZIA 1I24A 1KETA 5AOVA 1KY4A 3F6YA 2BH9A 1LDYA 3ASUA 1HDGO 3ONFA 2A9FA 3M1LA 3KLPX 3CKYA 3ABIA 3WGZA 2HU2A 4XWYA 1T4DA 1V0JA 3KUXA 3JQDA 5BNIA 4GMGA 2GN9A 3LVFO 5A05A 2YHIA 3F4BA 4W6ZA 1FK8A 5IN5A 2D0IA 3I6QA 3DBLA 4RGBA 5JDCA 4E0BA 1EVYA 3CSDA 1M6WA 1IHXA 3C7DB 4BS9A 3U4HA 4HNHA 5CEJA 4ZQEA 1KEWA 3CINA 1NR7A 2NVUA 5EQFA 1TB4A 4CL3A 4FFOA 4PG7A 1HYHA 4E21A 4TQGA 3RU7A 3ETDA 2YQ5A 2ZQZA 5CPFA 5THKA 7MDHA 4WEQA 5ICSA 3B6ZA 4BB6A 4CV3A 1Q2XA 4OOFA 1E0DA 4YT5A 1Q0QA 2ZKLA 3DBRB 3QJ5A 5I7SA 4ILKA 2Y99A 2NV6A 2PNFA 3KYDB 2E4AA 3MJCA 5U9CA 5A9SA 2X5KO 3GK3A 4XA8A 2X86A 5B37A 1QYVA 2LDXA 3C1OA 4WOJA 2Y05A 4TROA 1EVJA 1V35A 3VOSA 2FOIA 1T26A 3UVEA 4XQ9A 3FRJA 4WPGA 1LDMA 1EEHA 1PL7A 5B12A 2IYOA 3NTQA 3JD1A 2Y67A 5KIAA 3ZWCA 3WGTA 1I3MA 4GH5A 2HMSA 2O2SA 3I9JA 1P1FA 2O3SA 4GWKA 1E3EA 1DSSG 1M75A 3ON5A 4BO3A 1ZSYA 2RH4A 4YB8A 2AQHA 2OMEA 2FR8A 1TT7A 4BKUA 2X8LA 1PJTA 4BNLA 1NQOA 3HFSA 4FBGA 4MVJG 4KOAA 3RC1A 4UUOA 3Q6IA 4B7CA 3X2FA 1Q0LA 3PGJA 4JLWA 1VRWA 3G1UA 2IZ1A 1AHIA 1HE3A 3HDYA 3B1KA 4XDZA 1KVUA 1X7GA 4JX8A 4O6VA 2VHXA 4XQCA 3V1YA 1V3UA 5A5FA 5F1KA 1EVZA 1YONA 4YAJA 1XQ6A 1Z82A 4TKMA 1HTBA 4J2HA 1ZJYA 3ITKA 5B4UA 3P7MA 1MV8A 2PR2A 4J7CA 4R9RA 4JJFA 3UHAA 5L4SA 2Q2WA 2Q1SA 3RUAA 5JAZA 2C5EA 3BAZA 1U3WA 4RQTA 4P4LA 5BR7A 4ZQFA 1ML3A 1R66A 2OL4A 5DT9A 3WDSA 4GQAA 3QWBA 3L6OO 4E32A 3IKTA 3JQ7A 3DHEA 3NT4A 3H5NA 4M1QA 4RZHA 4BO4A 3I9NA 4HFJA 3OF2A 1K89A 4FDAA 3OQBA 3BIOA 3G79A 3L4BC 1LJ8A 4Q3BA 4BNWA 3INTA 2HMUA 4MJLA 4KQWA 4U0KA 3CE6A 4CM1A 1LEHA 1YXMA 3GZNB 1DIRA 2Y1GA 2OXIA 1PJBA 2PWZA 4YJDA 2P9EA 2AW5A 3OIFA 3ZW8A 1E1LA 1OBFO 2BI8A 2VT2A 4JBHA 3FBGA 5HM8A 4YT2A 3PHHA 3M2TA 1GUFA 2Z1NA 2ZQYA 3GMSA 4M8SA 2VN8A 1PU2A 4HFMA 2GD1O 3A9WA 4E2ZA 4N18A 2AHRA 2D3TA 4B4VA 1N92A 4I1IA 4J9UE 4J4TA 1XWFA 3JQBA 2J5KA 3MJEA 5G0UA 2WEKA 4MVJE 1BDBA 1BGVA 1T1RA 3VDRA 5KVSA 2GGSA 2HK7A 1IPEA 2YQ4A 1D1TA 1YB1A 1CQIA 1QKIA 3K8ZA 1MX3A 1WPQA 1ZNQO 1M67A 3OHSX 2E6UX 3W4IA 4CODB 4Y9DA 2J3JA 1K0UA 3WBBA 1KBZA 3PQDA 4M87A 2DUUA 3HDJA 5JO9A 1LXCA 2C82A 3OIDA 1P31A 4LCEA 1R4MA 1OFGA 4U8GA 2VWHA 3L6DA 4MVJA 4OJNA 4WLFA 5T57A 1U5AA 2EW8A 4AVYA 4DLLA 4DVJA 3PYXA 1ZH8A 1Q1NA 1JU9A 1YVEI 2EGGA 2I66A 4MVJM 3H7AA 1B8PA 1R0LA 2GERA 3BMOA 1SAYA 4AG3A 2G82A 3OJEA 2C2XA 5M6DA 4TVBA 5JMWA 2PZLA 4NNJA 5A3JA 4R54A 4Q3EA 1YO6A 5F3RA 1UZNA 1PSDA 4QO8A 5IDYA 4CMCA 1LLQA 4HP8A 5HTOA 1EBFA 3JQ9C 3VDQA 1F17A 1OAAA 4EGFA 2Q2QA 2J3IA 3E5RA 1JVSA 2H5LA 3OEYA 4TRJA 4B7XA 5JCXA 3UN1A 4URFA 3HDQA 4GX5A 4XR4A 1MG5A 3N74A 4OXKA 1J4AA 1LC0A 3PWKA 1KEPA 2CDAA 2JFFA 3H4VA 1C1XB 1G0NA 1LDNA 4RF5A 5C7LO 1J6UA 1ZFNA 4UVGA 1KOLA 2I3GA 1T1SA 2DBQA 4D0RA 3SLKA 1LDGA 3OICA 2V65A 2IRWA 4OSPA 4XR9A 2OHXA 2FWMX 4YVFA 2X0NA 3WX0A 4YDRA 3NT2A 4MVJP 3NGLA 1GZ4A 4W99A 3OH8A 3QSGA 3WMWA 4PVCA 2PH5A 3IOYA 4PCVA 4DYDA 1A72A 1DIAA 2CNBA 3HHPA 4G5HA 2HCTA 3SC4A 3P19A 3TNLA 4D41A 4YRAA 5FEUA 2HLPA 3E18A 2P68A 2FZEA 1PL8A 4LMPA 2VNSA 3KLMX 3UF0A 3HE3A 4Z0TA 4HFRA 1GYQA 5ENVA 1P9LA 4ZRMA 5BQFA 2E49A 3FNEA 3GR6A 1FDTA 4QFCA 5THQA 3RFVA 2W2KA 5BSHA 2WE8A 4PZCA 5CDSA 1TLTA 1AUPA 3GEMA 1B8VA 3LQFA 4PLPA 5GZ3A 1ONNA 1UAGA 4PG5A 1VE9A 3WSWA 1UZMA 3COSA 4R5HA 4TRNA 4XRGA 3RUDA 1X13A 1XR3A 4GKVA 3UCFA 3WJ7A 2X6TA 3BTUA 1U1IA 4RDHA 1LNQA 4E2YA 2C7VA 5T67A 4NIMA 1OC2A 2EKQA 3H2SA 3AFMA 3PP8A 1V9LA 2C59A 2PZKA 3PJFA 4IY1A 1I33A 2IODA 3P5SA 2FR0A 5TT0A 1F0YA 4J7XA 3S2EA 1Q7BA 3I52A 1DC4A 3IUSA 2ET6A 4MKRA 1YJ8A 1ADBA 3EK2A 1F8FA 1GEEA 2P4HX 5C5IA 3UH1A 1ARZA 4N5LA 2X7HA 3GPDG 3PWSA 4GX0A 4XGNA 3UCEA 1DC3A 3ZGYA 5I8WA 3TSCA 2Z95A 3CEAA 2O4UX 2EIHA 4ZRNA 1RM4A 3B1JA 2VQ3A 2VYNA 3VC7A 2VTDA 3DQPA 4YQZA 4CR8A 5F21A 2O7SA 1UDBA 1WLYA 2PA3A 5IXSA 2EJVA 2ZATA 1EMDA 3ZNNA 1HETA 4BNMA 4M55A 4PLFA 1X15A 2IYPA 3QWHA 3QVTA 4GVXA 3ROPA 1D1SA 4FFNA 5T73A 1IL0A 5K6AC 1UXGA 2NADA 4CQLB 4YRDA 2YFQA 5EJ2A 1CERA 1G0OA 3RBXA 1VL6A 4D44A 4FC6A 2PK3A 2EW2A 3IC5A 3RUEA 1DC6A 2FSSA 3NGXA 4JP2A 1NQAO 4N5NA 4ALJA 1T2FA 4IGEA 3WIEA 2W2LA 1U28A 5TX7A 1H6AA 3BTSA 1A7AA 4B4WA 4J4BA 4NR0A 1E5QA 1ISMA 4TWRA 1E3IA 3L77A 1D3AA 4PLWA 2TMGA 2Z1MA 1E7MA 4FOSA 3VTZA 1JTVA 4R9SA 5IG2A 6LDHA 5HS4A 4Q3NA 1E7QA 3HQ4O 4PZDA 4BMNA 1BTOA 4BNUA 1SEVA 1ZJZA 2O2YA 3L07A 1LUAA 1A7KA 5BNFA 3KYCA 3LSYA 3BTVA 3DO5A 3GDGA 2V6GA 4F46A 4W9NC 4EUEA 1ENOA 1KVTA 1SOWA 5CDYA 3L4BA 3ANNA 1I10A 4KP7A 3O9ZA 1ZUD1 4J3FA 4PLVA 1RWBA 4EEXA 2GN6A 1ZMTA 3I5MA 2Y0CA 5CG1A 4RVUA 2C07A 1ISIA 5DOVA 3VHRA 2QX7A 2PKQO 4TSKA 4XYEA 3WTCA 4WLEA 3PYMA 5A4DA 1GU7A 4TRRA 3WFJA 4EW6A 3PHIA 4MP6A 3IP3A 1V3VA 3R3JA 1EVIA 4FS3A 4YJGA 3Q2IA 3RUIA 2W2KB 4UULA 2EV9A 3QQPA 1HE5A 4D0SA 1HSOA 3ULKA 1CIVA 3QA9A 3HUDA 1NPYA 1HZZA 2VRCA 3WWYA 2IXAA 4QX6A 3JQAA 4AFNA 1MGOA 1Y5MA 4YBZA 4ZU3A 5A3VA 3S2IA 1IY8A 4IJVA 3EZYA 1UP6A 4IZHA 5AYVA 5DP1A 1YL7A 5ILGA 4D7AA 4XB1A 4R51A 1QYCA 4DLBA 4HX5A 4J16A 1GYPA 2R2GA 5COAA 4XRRA 3D3WB 3EDMA 5L51A 1LU9A 2UV8A 3L9WA 4DPMA 1GDHA 2UVDA 3QY9A 4EDFA 3PQFA 3QWIA 4K6CA 4LRSB 4K6FA 5JMPA 2XAAA 1ZXLA 2VHZA 1ZEJA 4ALNA 2YDXA 1QLHA 2UUPA 2QIOA 2RHCA 4RJTA 5JC8A 3FTNA 4M54A 1XU9A 3JSAA 1L7EA 1R4NA 4HV4A 3FNHA 4PLYA 1U2DA 3NDJA 1IYZA 2FHSA 3RAJA 2JD0A 3H8VA 5LDGA 4NBTA 4JJGA 4WUVA 4D3SA 1SEPA 1QSGA 1ZO8A 3QRWA 4FFPA 4CMEC 3U9LA 3LC2O 2QYTA 3DAFA 2P2SA 3E1KA 3DC2A 3F3SA 3JQ9A 1B14A 1DB3A 2HMWA 2AG8A 3GDFA 1H9BA 3RUHA 4IXWA 5F1OA 4NDNE 4IM7A 1LDEA 1WAMA 1GZ6A 3JQEA 4GGOA 3SBOA 3GHYA 1QXSA 3AK4A 3F47A 2QHXA 2XXJA 1PQPA 4K26A 1Q0HA 1XEAA 9LDBA 1N7GA 4LK3A 1VJ1A 3P2YA 3Q9NA 2JFGA 3A06A 5COQA 1YBVA 1NBOA 4CV1A 2VHYA 1GQ2A 5BT9A 2BI7A 3Q3CA 4BGVA 4FFRA 1H94A 3D4NA 1KC3A 2X0RA 1XLTA 3ZHZA 3QV1A 3FTPA 4WCFC 1N9GB 2QQ5A 5IZ4A 2DLDA 1XU7A 3I4FA 2E48A 4MIEA 1YE3A 1XKQA 2VHVA 2BHLA 5FI5A 1VL0A 1NTOA 5JBIA 3GHHA 1HF3A 1P0FA 3MTJA 1PZHA 1B3RA 1UR5A 4M86A 2GYYA 2GUGA 2CZCA 1P1IA 4HFNA 1XELA 3LLSA 3PHLA 4G65A 3IUPA 4ZVVA 5T8KC 2QW8A 4MIOA 3PWZA 1C1DA 2ZTUA 3ZHBA 1UAYA 3PRJA 3UKOA 2OUIA 1VSUA 1PGQA 3GEGA 4CR6A 2HDHA 1DIGA 1M6HA 1K2WA 2NM0A 5EL0A 4CMHA 3PJEA 1YOVA 4KMSA 4E2XA 5JYEA 1GYRA 2PFGA 2DKNA 1DAOA 1X0XA 2F00A 3SX2A 2YV2A 3A14A 5FFFA 2NTJA 1E6WA 2AA3A 4YCAA 3KV3O 1P0CA 1P3DA 3HG7A 1Z45A 2EGHA 4RV9A 1Y1PA 1TT5A 1H6BA 2CF6A 1E7YA 1BW9A 2Q4EA 1KVQA 3A28A 1WDKA 3DHNA 4KTVE 4A26A 2WYWA 3PJGA 4WEOA 4DYVA 8ADHA 2NU7A 4KWHA 4Z3DA 2VTEA 3JD3A 2VYVD 3VAZA 3F4LA 2HAEA 2Q50A 3S8MA 1CRWG 5EPOA 3AY3A 4PG4A 1GAEO 4N7RA 4A03A 3PQEA 3K2BA 2NTVA 3NKLA 4CMKA 2AQKA 2RBEA 4S1VA 1K3TA 4PRKA 2DBRA 4ZGWA 1BVRA 1OMOA 4CLRB 2XOXA 1XCBA 5K6AA 3Q11A 5CEFA 3AY6A 1TVEA 4E5KA 1UDAA 3A4VA 3V1UA 3O03A 4DRYA 5BNTA 1D8AA 2O23A 1EE9A 4TMFA 4I5EA 2C20A 3FF4A 1P1RA 3OA0A 4Q3DA 4CMIB 4DMLA 2JCVA 1MLDA 3KOUA 4NZ9A 2VRBA 3WBFA 4YWJA 1HWYA 4EYEA 5JO0A 5A1TA 5KVCA 1JAYA 1O5IA 4D46A 3TZHA 2BF7A 1PZFA 5DDIP 2B5VA 3O8QA 1DRVA 1ADFA 2YZ7A 5KOIA 3ZHYA 1U7TA 3KHUA 2CVQA 4TRMA 3U09A 1K6JA 1PGJA 4XGKA 1HDXA 4NBUA 4OKNA 1PX0A 2V6MA 1KIFA 3INRA 3ONEA 1BVUA 4GVLA 1IPFA 4W9NA 3OIGA 2VZ0A 4P38A 1SCUA 4O0LA 2I76A 4H3VA 3BMCA 1EFLA 1K6XA 1GQQA 4L8VA 4X54A 1FF9A 5A9TA 4A73A 1LLUA 1FXSA 3W6ZA 2ZTVA 3H3FA 4FIZA 1WMAA 2DVMA 2PY6A 4B79A 3MWDB 5C7IO 3H6KA 5FF9A 2FMUA 4IQ8A 3HZZA 3JYQA 2GZ1A 4PLGA 4JROA 5KVVA 1UZLA 5ES3A 3DTYA 3OMLA 4DREA 3LT0A 4BMVA 2I67A 4GBJA 3BMNB 4LVCA 2Q2VA 4CV2A 2H6EA 3PHJA 4RLSA 4PVDA 1BMDA 1JWAB 1V8BA 2I6TA 2Y1DA 1LSOA 3I1JA 1Q7CA 4FW8A 2R6JA 3AUTA 1YRLA 1QR6A 3NRCA 2GZ3A 1QYDA 2GLXA 1ZIDA 1HKUA 2DBZA 1HYGA 2HMTA 3ANLA 3RUFA 2Q1UA 4CMGA 1Y8RB 3PGXA 3F1KA 3OJ0A 4J2OA 4FJ0A 3PTZA 1PJ3A 2IZ0A 4BNJA 5AXCA 1O89A 3MZ0A 2A94A 3RD5A 1GADO 1PGNA 2X0JA 1O9BA 4GGPA 4O63O 2CMDA 3G0OA 1Z7BA 3FHLA 4HKTA 3GG2A 4CV0A 1F8GA 3ZU3A 4C7JA 4R4JA 1JA9A 2DUWA 2YJZA 2P9CA 4HY3A 1IB6A 3F1LA 4RPJA 1UP7A 4UVHA 5DULA 3CXRA 4ZHSA 4E4YA 4OO3A 3U0BA 4CLOA 4XKJA 5TSDA 4B3IA 4TZKA 4AJ2A 5IZCC 1HXHA 5ITVA 1W0CA 1GD1O 3RC2A 4CLXA 1LRJA 2J5QA 4RPHA 1CETA 1SO8A 5ER9A 3B20A 3U4DA 3HNPA 5FWNA 4IIVA 5G4LA 2GN4A 4PG8A 4CMEA 4DQVA 2DTDA 4I5GA 2BFAA 1E3WB 4OHUA 2X0IA 4PLHA 1PEDA 1N1GA 4R3WA 5EERA 3JCZA 4MP8A 5KJEA 3LZ6A 2HRBA 1GCUA 3HFGA 1O8CA 1ZCJA 4JQCA 3S1LA 4U6SA 1EDZA 3WWZA 3MJ4A 3CMMA 2FPIA 3JYPA 2XPCA 5H82A 2BRUA 1E6UA 2XXBA 2BFOA 5TRTA 3JQFA 1DBVO 4CQMB 2W98A 1RM5A 3RU9A 3WS7A 3D5QA 3I6IA 3H2ZA 4FOOA 3LK7A 3SJ7A 3JYNA 2YYYA 2Y0EA 2EG9A 4JJIA 1WMBA 3PVZA 3DTTA 3ZU4A 3D1LA 2DM6A 3W4KA 3WGQA 4WCFA 4E30A 3GUYA 5KTKA 1X7HA 4MO2A 3ZWMA 1BG6A 2WD8A 3QW2A 3I9KA 3OETA 4ND1A 2X4GA 5ADHA 2EKLA 4E5YA 1M2WA 1MUUA 1PR3A 2YHIB 5KJFA 5L7WA 1QYWA 1MFZA 5I9NA 3P2OA 3PZRA 2HMVA 3DBLB 4IQGA 3GFBA 3OP4A 3FPCA 3TZQA 4R1TA 5T8KA 1UJMA 3CMCO 2NVUB 3K92A 4MINA 4DMMA 1AN9A 3JYLA 3O38A 2NU9A 3E9MA 4P4GA 4J90A 3CTMA 3E8XA 4GI2A 2BFMA 3VH1A 1PJLA 2D8AA 4XIYA 1K6IA 5JCJD 2IDZA 3WXBA 5JYDA 5DP2A 3BMQA 1NQ5A 5A9SB 1BXKA 2VUUA 3PIDA 4BVAA 1Y5RA 1YQDA 3DHYA 1LRLA 2X9NA 3WICA 4ESOA 2SCUA 2E82A 3DMYA 5L9AA 3NX4A 2PGJA 2NVWA 1XGKA 2BFPA 4YJHA 1BWSA 4DL9A 1HLPA 4K1LA 4RLHA 4CM9D 4TKLA 5HBRA 4FN4A 3ZH2A 3WTBA 2Y1OA 1NP3A 2GDZA 1IUKA 3PPIA 5ER6A 3VZQA 3H9UA 4BOYA 3U49A 3LU1A 2B4RO 4WLNA 5K0ZA 1MP0A 2B4QA 3EHEA 4NK4A 3VZSA 5JDIC 3QWAA 4RVHA 4XDYA 3DL2A 4GKBA 1NVMB 4FR5A 2IZZA 3VPXA 4R3NA 1ISJA 4YAKA 3DZJA 3ZNPA 1L7DA 3ASVA 3ZWYA 1NAHA 2NVBA 4JNKA 3R1IA 3UFXA 1E1MA 3GAZA 1IHYA 2Q3EA 4ZQHA 3H65A 5TQVA 1H5QA 3WNVA 1ENZA 4OOEA 2OFPA 4GPD1 1YB4A 3PIIA 1Z6ZA 3LDHA 4BGEA 4CLHA 1SZJG 3ZWVA 5G0TA 4ITUA 1M66A 1NASA 4CM4A 1ENPA 3O4RA 4Y67A 2Q22A 3ZWOA 1GEGA 2NU6A 5EMHA 4OM8A 3MOGA 3BA1A 3EVTA 4BNYA 4YR9A 1DIHA 4TZTA 1ADGA 1T2DA 4H15A 3JQ7B 2NWQA 1EBUA 3WLFA 3ZHXA 4WNCA 3QVXA 4PGFA 3ZN2A 4QECA 2P9GA 3OM9A 1Z74A 4J1SA 4XYGA 4IS2A 4WKGA 1QG6A 3EC7A 3ZWXA 2V6BA 3VH4A 1GQYA 2X9GA 4KDEA 1KEVA 3O26A 4R68A 4YT8A 4ZA2A 3H5RA 1L1FA 1Y9AA 4OH1A 3N58A 4J9VA 3GMDA 4CL8A 1DHTA 1D4FA 1P74A 2CF5A 1R6DA 2VHWA 3GA0A 3C1AA 1NNUA 2FY8A 4IJKA 3ZWNA 3VZPA 4A7PA 1NXQA 3NT5A 2DTXA 4IDGA 4CPDA 2FZWA 1MFPA 4E33A 3DOJA 4DWVA 4Y98A 2V6FA 5J9GA 1O95A 3Q2KA 3RQSA 4IGFA 4OQZA 4YAGA 3PDUA 3TFOA 4CUKA 5IDQA 3GRPA 3V1TC 4LW8A 4XJSA 4BGIA 3BHIA 4AJ1A 4J43A 4QXMA 2VZ8A 3W4JA 4O5OA 1EQ2A 2WM3A 2EJWA 1R0SA 2DPGA 1U3TA 4LVUA 3ZNQA 3D4OA 2BLLA 2C5AA 3GEDA 4MKXA 3ZW9A 1N7HA 1UXHA 3S55A 3ZDFA 3QVSA 3ICCA 1JAXA 2C7GA 5DOZA 3IP1A 1AXGA 4EBFA 1SBYA 3BYZA 3TL2A 4PLTA 5TJHA 2Q99A 2NACA 1I36A 2H63A 2I65A 1RM0A 1TA4A 2HK9A 4KDFA 3T7EA 3PZBA 4EUFA 2WWRA 3OJFA 1GFSA 3DBHA 3WGGA 1R4MB 1N5DA 3M2PA 5G2OA 4CM8A 2BMAA 5L7YA 4D3DA 1IULA 5IZCA 1F12A 1ZK2A 4RPGA 1E92A 3BMOB 2FPPA 2QG4A 3DZBA 3NDRA 4WASA 5DCYA 5IAAA 3I9LA 3EY4A 4J91A 4JK3A 3MCVA 1BXGA 5LDHA 3L0DA 1I30A 1VLLA 3NJ8A 4FGSA 2W90A 4BNNA 2O48X 1B3BA 1E1KA 1YL5A 4DPKA 1YDWA 2PH3A 4HUJA 2B35A 4CLDA 1EUDA 4YYZA 2VNAA 2AMFA 2O3QA 4ZN6A 1RYDA 1NFFA 3PFFA 3L4SO 4L75A 1T24A 4FB5A 1G6KA 4I5FA 1KYQA 2ZJ0A 4MOWA 5DBFA 4CM4B 1Y8QA 2CVZA 2QRJA 5DCUA 5MDHA 3DWFA 1T2EA 2UDPA 4OL9A 2Q49A 5F5NA 3WGHA 5EINA 4IQ0A 4MVJI 4IDBA 4PG6A 2GPTA 1HE4A 4EITA 2DBVO 3DAPA 1PJCA 2AEFA 2JHGA 3F5SA 1JN0A 5JSFA 1EFKA 5JY1A 1E7SA 4Z0PA 5JYFA 1DFGA 1Y9EA 4FGWA 4YAEA 3OJLA 3AWDA 3F5QA 2YV1A 1PGPA 3E9NA 1NVGA 3GNSA 4ALKA 4XCVA 1NPDA 4RCVA 1XSEA 5L4NA 5K9ZA 1T25A 5KJ1A 1UXJA 3MEQA 4IDAA 2DAPA 4AJKA 3AI1A 2RIRA 1NFRA 1NHWA 3GLQA 2QZ9A 3JQ6A 1QLJA 4FJ2A 3E6AA 3JTMA 4IDEA 4EJ0A 4Y6SA 1QRRA 3W8FA 3E5MA 2AEMA 3C7AA 3FWNA 4IZIA 1N8KA 2CDBA 1NQTA 3K31A 3WYEA 4DC1A 3WJAA 4OMUA 1FDWA 2PD6A 5ICMA 1U3VA 2AG5A 4E5PA 1YBAA 3GVPA 4ONEA 1NPTO 1U3UA 3H3JA 5JXWA 1DIBA 4XEHA 3GVIA 4NU6A 1SC6A 1PTJA 2O3UA 4RQUA 1QORA 1YB5A 2YHUA 4IIUA 1EK6A 1JKJA 4IDDA 4B8ZA 3K2EA 4EJMA 1UH5A 3GRKA 4CMAA 1PGOA 4HNGA 1X0VA 4FQ8A 5I9LA 3C24A 1VSVA 1FDUA 3LLVA 2NUAA 1E7RA 2I3AA 4H7PA 4UEJA 1YBMA 3W8EA 2NLOA 5G4KA 3SXPA 4XGIA 2BGKA 2D1YA 2I99A 1BXZA 1ZMOA 3ZV4A 3AFNA 4A2CA 3JQGA 1DOHA 1RYEA 2AXQA 5CG2A 1VJTA 4UVDA 1PQUA 4YPOA 2H1SA 3G1TA 4OXNA 2WYVA 3WIDA 5JDIA 1R37A 3R6DA 4AJJA 3JQ8A 4UREA 1H2HA 1RM3A 1A4IA 1BHSA 5T6BA 5TT1A 3RWBA 4U0JA 3QHAA 4HWKA 4Y6PA 1LRKA 3KM0A 1I0ZA 4QEDA 5KJ6A 5CFZA 4YAIA 4C7KA 4YXFA 4XYMA 3PLNA 1ZXBA 1EDOA 4XYLA 3EYWA 2WD7A 5A9RA 4B8WA 2EWMA 5GZ1A 4FD3A 2G1UA 2GN8A 3GPIA 3D4PA 3W1VA 3DB2A 5TLSA 4NG5A 1AXEA 1C0PA 4CUZA 3AUSA 3JQFC 1MXFA 5FYDA 1DJNA 1HDCA 1MC5A 1U7HA 2JFHA 3N7UA 1B2LA 2FPGA 4ALMA 5L40A 2ZB8A 1JWBB 2O3TA 3WGOA 3SVTA 2HSDA 3CZRA 4NFHA 6ADHA 3I9OA 4IS3A 2EERA 1A5ZA 4BO8A 4DUPA 3KYCB 2NQ8A 3PEFA 1KVSA 4AJNA 4WJZA 1X14A 3V2GA 2VYVA 3I83A 4DLAA 1ZK1A 3ROKA 3TPCA 2VWPA 1FDVA 5BSEA 3LT1A 2B0JA 2DT5A 3CIFA 2ZB7A 3IJRA 3H5AA 3NAQA 4MPDA 2W4QA 3NDIA 4II3A 1DRUA 4AJLA 4HADA 4DIOA 2XF8A 3RJ5A 3KVOA 4L9RA 5IN4A 4ZQGA 1LX6A 2AE1A 4B7UA
chains in the Genus database with same CATH superfamily
4YJGB 4YTEA 2XNKA 5BUSA 1CYDA 1NMYA 4IZ6A 1I80A 5DT2A 3IDZA 5JEEA 4RPCA 1NYRA 2PMKA 5BMVF 5B6JA 4YCNA 1NOIA 1JDVA 1W4AA 4EEZA 3ZLUA 1C9YA 4JEUA 2ZRDA 1W8DA 1XIVA 2ZRCA 1IQ0A 3TQHA 4ABYA 1VI2A 2WNHA 4QQNA 4Y2TA 2IEBA 1FRVA 3FNBA 3PHGA 1E63A 4PE5B 1JW9B 3NANA 1Y5LA 2IVFA 2QTHA 1M2VA 3M34A 3HNOA 1TK2A 2R87A 2BFBA 3UA3A 1FW6A 1JHXA 1FFDA 3TLXA 3GLUA 3KYDA 2FEPA 3RVDA 3EY9A 5LP6C 2X2FA 5AICA 1GUDA 1Y7TA 5LBIA 4US1R 4EVQA 3FDZB 3B78A 4KBYA 1QGZA 2P75A 4DDTA 3RG8A 1W4RA 2WLTA 2K6GA 2Q3HA 3IOCA 3LPAA 4RHCA 3IDSA 1SMKA 2WR8A 5I9MA 3WLRA 1QAOA 3DFZA 5DE3A 5NULA 2A3RA 2G06A 3IPCA 2Z9DA 4Y0VA 2WFLB 5KKAA 3ZYZA 3LF1A 1L6RA 4D6PA 1LTHR 2Z6QA 4CN8A 1NW5A 4PIVA 1JYFA 2HBRA 5IDWA 3ZXIA 1K7YA 5TY0A 4AG6A 1PQYA 2R6DA 1XAHA 1KJQA 4MB0A 3THOA 5EIFA 4BNXA 4ESHA 3OOSA 1ISHA 2WILA 1B93A 1XHLA 3SZRA 1H05A 4XASA 2WIAA 5LDDC 3R8XA 1RQGA 3ADPA 4Z0NA 5LQDA 3ISTA 2Z2ZA 4LKRA 5TMDA 4JVLA 1H93A 2PGOA 5I7FA 2IH2A 2JBWA 2QXUA 4BQEA 5HK8A 4L73A 1QZTA 1UWCA 5FEMA 4PAOA 3QE3A 5IHPA 3EMKA 3PFIA 1PWXA 4FFBB 4QUAA 3N5KA 4HYTA 4HEA6 2Y1XA 4V39A 5DISB 1L7NA 3EAGA 4LRWA 2NZVG 2PS3A 3PX3A 3RVRA 3CZMA 3N0TA 4G8CA 4GWGA 3U61B 3RVPA 4RQBA 5GOTA 2EFJA 3G6WA 3TZ6A 3PD0A 5KQLA 3WGYA 1YR8A 1F7VA 2PZJA 3AR4A 3I09A 3KEQA 3TB4A 1M2HA 1GLNA 5JS8A 1W19A 3UW3A 5ARCA 4UHHA 4C05A 1FIUA 4FGJA 4IOKA 5C18A 2ZBEA 4MVYA 3ZBQA 2A5JA 2HF9A 3AI3A 5ALVA 3B85A 1GILA 1PR1A 5F1PA 3GIDA 3A1EA 1YGYA 1ZK0A 3VI3B 3T95A 1XJ0A 3V00A 4B4OA 1CY6A 4NBLA 3SDBA 1II9A 5DNYB 2GZRA 3FOZA 3A6PC 3GLHE 2JI8A 3C3XA 3NC1C 2DWPA 1PJ8A 2GHIA 3LCJA 3QMVA 3QE2A 4RMJA 5FB3A 1X1CA 3PQCA 2I9PA 3BE6A 2GT1A 4PYOA 3QX3A 1SOMA 2CD9A 4ZMRA 1C3VA 5ECGC 4BHTA 3R0JA 2DX7A 1R9JA 1SUFA 4YJ2A 4ZJUA 1KOJA 2NV2B 3LLUA 4DIEA 3HUFA 4XI9A 2YUTA 5GY7A 4ZJYA 4Z54A 1E3SA 1UM9A 4R01A 3TVDA 1Y1KE 3GVXA 4G1CA 4RL6A 5L3SB 3E03A 1MDBA 4QGHA 1DRKA 2WJWA 1DXYA 3TFQA 4DRXA 4MWSA 1IZ9A 5EYPA 2BPOA 1CQJA 3TRDA 3RAGA 1EE2A 3DEKA 1JA1A 4BMDA 2Q7OE 1G6OA 3RQIA 4KQ2A 2J5RA 4L27A 1T5DX 1Q15A 721PA 1QX3A 3FA2A 3LUPA 5H4GA 1UKAA 2ZB3A 1KORA 4YRKA 2IHBA 2QT1A 1G8FA 1W4ZA 4UEKA 2AVNA 1Q0UA 5C8YB 3LXMA 1H6CA 4HBZA 4B3HA 4WCDA 2W22A 2WFMA 4KAXA 1PZMA 1TK3A 1UXIA 1SOVA 1ZH6A 5K09A 1VKOA 1ZOOA 4NABA 4RPLA 2B2XA 2XAUA 3MRSA 1TAGA 3KOYA 4I50B 5FL3A 3RT9A 3EPJA 4OX9B 2BFBB 3SC2A 1XZPA 3E3MA 5DI9A 4ODIA 1WPRA 4Q7LA 1YMVA 2CLLB 4BNDB 4EFMA 2JD1A 2R86A 3P94A 4MDFA 4H35A 2X0DA 2BBWA 4V0NA 2NU7B 5ITWA 2WWXA 2C3PA 4BUJA 2XA1A 2O5CA 4MWBA 4UOQA 3U56A 1R16A 3ZE7A 3BTOA 4F1WA 1OWNA 1FXUA 1COZA 1EDDA 4TKVA 1ETHA 1R12A 1QO0D 4D9IA 2I3ZA 1TM5E 3W6OA 3NCTA 4H7IA 2I7CA 2QF7A 3TK1A 4TXNA 2JKZA 1PDWA 2WSSA 2X4IA 2YYZA 3A1FA 4ZVQA 2O2GA 1WDLA 3WJAA 3P0HA 3HCRA 4FOTA 4IUYA 4N40A 1MEOA 5HX7A 3AEQB 4RZIA 5IJ9A 2R60A 3AOGA 4J6EA 1U3GA 2JEYA 1YQWA 1YR3A 2ZCVA 5FULA 4AN1A 4B6SA 1D04A 2PSEA 3GJZA 3KZXA 4CM3A 1OTYA 3R0IA 5HRCA 1C2TA 3VQTA 3FOWA 5EXTA 1SBNE 2ECFA 4NBVA 3SSOA 4P7BA 2AF4C 4X44A 3TOZA 5L3VA 4KJZA 4WMLA 2FSVC 4BFUA 2JJMA 2JLQA 4ERNA 3Q98A 5CB6A 4K05A 1XA3A 2AFHB 3KLOA 5JXGA 4ABTA 3LPDA 5A2GA 5HKBA 3DOHA 3DEFA 4ZVMA 3KX2A 1Z63A 4PO8A 5TLSA 2QXTA 5DSZA 4L3OA 1EUZA 3HB5X 3U5TA 3BWVA 3KKNA 1AGNA 1S8OA 1Y6JA 2QM3A 2XWJI 4JDUA 5CVJA 3IIEA 3TR6A 4HDAA 1RQXA 2X5OA 1OT5A 3EAQA 5BVGA 3DDOA 1L4GA 4EUNA 1NOKA 4AJPA 1J0XO 4ALIA 3QBTA 1JQAA 4A92A 3RYIB 1GZDA 5AK6A 4J6FA 2PANA 1E79D 1A9SA 4U4AA 3D8HA 3P27A 1SCUB 4RD2A 3GUHA 4KR3A 4C0HA 4DCVA 3BCSA 3BMCB 2JFQA 3GZ4A 3V33A 2CVOA 1FS6A 1R0CA 1FQKA 1KXJA 4AJEA 3ANYB 4Y2YA 3MRXA 3QYPA 4EFDA 4QBTA 3N07A 1SELA 3DT9A 2HCFA 4H1UA 2IUYA 4EA9A 4JP8A 1AQIA 4NI5A 5G53C 4LF5B 4UBOA 4XD7A 5SZJA 1A97A 2HDWA 2HO4A 3QU2A 2CFOA 4R3UC 2JIBA 4OBXA 2NPIA 5FI3A 3DMFA 3VO1A 2KQUA 3BZWA 1WJGA 3GVCA 5DJ5A 1A71A 2XCIA 3TZCA 1ES9A 2G0NA 2FAXA 2R4QA 3D54D 2B0CA 3SBDA 2GNAA 3TF5A 1V47A 4DT1A 2I54A 3IXLA 2NO1A 4KZKA 4DSNA 1PUJA 5F7JA 1GKLA 3ICVA 3CEJA 4Z7OB 1X38A 4OHWA 1W76A 5H83A 4ZREA 4D9NA 9MHTA 1CQJB 1BS1A 1DARA 1H0SA 3R3YA 3ZQKA 3RUCA 2QY6A 1WPGA 2HY7A 4KAAA 2QBYA 2CLSA 3OQPA 5C32A 3NTRA 1K7XB 1NVVR 1QAQA 1CUXA 3C2QA 2DECA 3PQ5A 4B3GA 3K9QO 1GRVA 1L4EA 3BE8A 1X86B 1PCXA 3RDPA 1WSAA 3DZGA 3WC4A 4TL6A 3R3HA 3RKRA 5A5GA 2VJYA 1GCIA 4LRTB 2GBIA 2FP4A 4M8IA 3WMRA 1GCGA 3LL4A 1GL7A 1PJZA 4NENB 3SC2B 2WHQA 3HDHA 4DUGA 5JDCC 3T7IA 4CIAA 3EP6B 4GPIB 4AF6A 4B84A 3EWNA 4QUGA 4ZANA 4MVCA 3TLGA 2PV7A 3CNOA 1JT9A 3WGLA 2O06A 4HB2A 3ZUPA 4CLOB 3GL9A 8LDHA 4LJ9A 2CFTA 2VCHA 1DXHA 3ETEA 3LY8A 1TCVA 2CNWD 1KA9H 2X6QA 3LHDA 1X1EA 3B9PA 5FTWA 2DQ4A 1CF2O 1MABA 1NMZA 2E21A 3MC1A 4F12A 5CDUA 4P83A 2YJ3A 2CL6X 4P5EA 3TZKA 3EGCA 1P29A 2WYUA 3HFRA 1MB3A 2DH5A 1LBSA 2XGMA 3GYGA 5FTNA 5IJAA 3NASA 4OTZA 2Y0BA 4HD8A 4UW9A 3CVVA 3EX7C 5GV8A 3DLIA 1QMGA 4Z7JA 2W8ZA 4MKIA 2OCGA 2VP2A 1J2UA 1TYCA 4MAMA 3G8YA 2ZS9A 3ND5A 4BJ6A 1DHRA 3K73O 1GGEA 1UBMS 2BP7B 3AY0A 4QSMA 2ODTX 5HFJA 1QIIA 2JBHA 5JAMA 1Z68A 3TECE 2EKZA 3FBTA 3KU4A 5KOYA 1PZXA 2EVWX 2W6ID 3I9MA 4PAMA 3U26A 4YRGA 1PWYE 2FPIB 5JFOA 2LKCA 1GSHA 2GEJA 4KPUA 1WP4A 3DOOA 4FT4A 3BOSA 5FBZA 4C6TB 5A5EA 1JMYA 1NXTA 4V0QA 1DJMA 4EZEA 1BOOA 2NTNA 4L4YA 4OA8A 5DCWA 4EZBA 1OX4A 4LDNA 5CGQB 2P8SA 4NU5A 3ZBPA 2Q7DA 2VCYA 5MHTA 3NTUA 2ADOA 2AKEA 4CEJA 4GZ3A 4DEXA 1GTG1 2LDBA 3R20A 5L3QA 1I2ZA 5GJWC 3V2UA 2PRIA 3OFSA 3L8EA 1AE1A 3OE7D 2ATVA 2OBYA 5DK6A 2O6HA 3ZVMA 3ED1A 1P2FA 3AF2A 1U02A 3EA4A 4AM8A 3IMFA 5D5PA 2QNBA 3VZRA 3D6TB 1JBQA 4E3ZA 2UZ1A 3EGOA 4ZICA 3KHSA 1AD2A 1EVKA 4PZYA 1HQYE 1RLUA 5ERYA 5J5VA 1RW4A 3S4YA 4PYJA 1EZ4A 2CZGA 1FX0A 2GCPA 3OKPA 4QVGA 3RU2A 5TXGA 4JLVA 2WTBA 5KOJB 2R8ZA 3EG9A 2DYKA 2P4UA 4RKQA 2GZ2A 3NP7A 3CUVA 3G3EA 4EPRA 5MGBA 4B2PA 1FRQA 1A50B 1P3Y1 1OBCA 2PX0A 4KW7A 4MPPA 1NKSA 1NBEA 1B0UA 3TRIA 1BAPA 1STOA 3N2KB 1E6EA 5KCZA 1XI2A 2X5JO 3GELA 1F8YA 4ND5A 3RSHA 5JD5A 1Y3DE 2UXBB 2RGXA 4Q9HA 4R0NA 1FFGA 2BM9A 4WHMA 3SQLA 4RK1A 2NU9B 4LV8B 4UTZA 3FZYA 2JK1A 3EFBA 4IDCA 1BN6A 3A58B 1N6NA 2XUGA 1KHTA 3LX5A 1MPXA 3PFWO 1BD3A 1YJCA 2W93A 3O93A 3PDJA 2B25A 4HBGA 2ZK7A 4AB1A 5HIKA 3CNBA 5JPCA 2MIIA 5GTDA 4M49A 1IN5A 1PG5A 1PN3A 3FR7A 1G1AA 2RHDA 1AIPA 3KYBA 3NJ4A 4G09A 2ZU6A 4M7OA 4S2UA 4IYRA 5DHQA 5FD8A 2SECE 4B2IA 5ISMA 4HN2A 1UEXC 1T0PA 3UENA 4F4IA 2B20A 2PS1A 3STVA 4H4DA 1RAAA 1T0UA 3I2IA 4YJHB 1QPZA 1FRNA 3QFHA 1R3DA 1ESEA 4E31A 1M5RA 4O25A 2HJSA 1NGSA 2JIZA 5K3CA 4UU7A 4DDWA 3CVOA 5IABA 1Y9JA 3LTEA 4HMPA 3LC1O 2NTYC 4GECA 3UY4A 4F5DA 2FP4B 2CMKA 4RF2A 1JKIA 1MOSA 3U7EB 3RRXA 1NLYA 3BERA 2WA2A 3FPFA 2ZUBA 1SQ6A 4LBWA 5JW6A 5IAKA 5FOTA 3GBPA 5IJ0B 3SF8A 2IXDA 4WN9A 2CFRA 4M0PA 2O52A 3WMXA 3B1FA 4WE3A 3ZZNA 4YT4A 3AP2A 1K97A 2FRXA 3DXZA 4C1NA 3L0BA 5BW8A 2JAHA 4FUQA 1P9OA 3BBLA 4DAOA 3JVVA 6Q21A 2O8BB 3HR8A 1YWGO 1H3NA 3IOMA 3V5NA 1D0IA 3HKDA 4H6VA 3EZNA 5EE3A 3W7BA 3A04A 1YL6A 1XAGA 1G98A 2F1KA 3UFXB 3KQKA 2XA9A 5AKKA 4BQOA 4EFKA 2R1ZA 2A9QA 1P1JA 2Q3CA 5JCOC 1XCOA 2O05A 1XMOB 2VSNA 2J3KA 3PQ6A 4UUNA 2HK8A 3QKUA 4UBIA 3VJLA 1VE6A 1EFCA 1YS6A 4NH4A 2IBSA 1L1QA 2GN2A 4QGBA 3GEBA 2ZJ1A 4I66A 2FN3A 1PLKA 2QRKA 1OKKA 2V7XA 1EUYA 1E20A 2VBCA 2ZB2A 4PWZA 2JD2A 3AFGA 3IX7A 2OD7A 3EXEB 4UPDA 2ZAMA 1VQ1A 4F4JA 3A10A 4DC0A 3HSKA 5F2OA 1I4TD 1OLSB 2HJHA 3PYLA 1T9KA 2PX4A 3PB3A 1SFRA 4PCUA 3PFNA 3TTSA 4C5BA 1P19A 1GTMA 2HLDA 3L4EA 4HLUA 3AHDA 5KHAA 2OG2A 2YNMA 1MOQA 3V2HA 3TV1A 3M4JA 4DMRA 4HTFA 5BORA 3D6MA 1H8ED 3HPQA 4YRBA 1VM6A 3BL5A 4KXQA 1CQZA 1QF6A 1IOLA 4QA9A 1RJEA 5BN3B 3H8JA 1NJSA 4AMZA 2Z58A 2I55A 3DDNA 1P4AA 1IOVA 3H17A 2R1TA 4LXXA 2BZ0A 3EBLA 5K0NA 5FQNA 2IKSA 1N1DA 2YJ6A 3K6KA 2AJDA 5JNLA 3O21A 2G83A 2OBMA 1M83A 1NN1A 4LNHA 1SCNE 1M1YA 2PUHA 4BLQA 2BSAA 5LA6F 1B6RA 3A0UA 3KB8A 1A9TA 1YNOA 2A5FA 2AYXA 2XODA 2IW3A 4FKMA 2VYND 5DRYA 5LC1A 5ENDA 3I2HA 4B1FA 5I7HA 3G0IA 5E4FA 3B6JA 2DHEA 2J8ZA 1YIDA 2ATXA 4XUEA 4Q66C 1K5GA 3LLMA 2B34A 3E9QA 2RHRA 3N87A 3U4CA 2NQTA 3C74A 3LFUA 4G6ZA 5FPTA 4RVDA 2IHJA 5IT0A 2A5GA 4N5IX 2EJCA 2P35A 4QUKA 4BO5A 3IAM6 1N8NA 2C3OA 3AI2A 1G5RA 1PP4A 4ZAXA 4A2PA 3WLPA 4ZD6A 3B53X 4R1UA 1SG6A 1T1GA 3IO3A 2CLKB 4NY1A 5A03A 1E2LA 1DX9A 3FNGA 1DO8A 4TLAA 1OYOA 5DM2A 4GHWA 5DYTA 1JE0A 1MEEA 1DC5A 5E6SB 3HJAA 3OPYA 2QRZA 4OYYA 4UFNA 4ZT5A 2IP4A 3PR2B 4FFDA 2SNIE 2AQIA 3KBOA 3N0XA 4PHTA 3AXTA 5AK4A 5DNVA 2O57A 1KZ9A 5GQSA 5BYBA 5KTRA 3RVQA 4R8SA 1L4NA 4MH0R 1UBSB 5AXDA 3KWFA 2BHNA 3ES9A 4FOLA 2G1JA 2QLFA 5HF5A 1QB8A 3BK7A 3MJDA 1H6DA 2HQ1A 1ZZEA 1ECLA 4MNTA 4UD6A 4YJ3F 1MIHA 1C30B 1DI0A 3QWFA 1MVLA 5AVVA 2FSHA 3QPCA 3UGQA 2W6NA 2GBPA 3BXZA 4MYTA 3T12A 3GNTA 3VC1A 3JD2A 5ICCA 1VMDA 1QRDA 1OC4A 3GN1A 5G0SA 3DBHB 4EB3A 3C70A 5IC4A 4A1OA 3WQQA 1RXWA 1XJQA 2VUTA 5EQTA 3QUSA 1RPTA 4JKYA 1AA9A 2N46A 1U9CA 1T3GA 4J1NA 3OZEA 4I46A 3OEED 4JZYA 4MI6A 3S5UA 3ZI0A 1CR0A 4KLNA 3D7LA 1WB4A 5J58A 1XVLA 5DF1A 2QP3A 5CEEA 3CX8A 1Y4ZA 4XYBA 4INOA 2QEQA 2QD4A 5ANRB 3RSLA 3OPXA 2WYHA 2A58A 1VC2A 4G07A 2H1WA 3GWZA 5KAPA 2VWGA 3IQEA 4DFDA 2Y1CA 1UBHS 2FMIA 221PA 3DZHA 3RKUA 2W8BA 4G5FA 5DN9A 1H2XA 4HDOB 1DAPA 1LZLA 1M6NA 4LXIA 4RD3A 4CE6A 4FWTA 1YB6A 3KVVA 5FBKA 3A8TA 1K3FA 4OHBA 1NYTA 3U3XA 4Z0HO 2IUSA 4ZYTA 4Z4GA 3LT2A 4TZ6A 3OZBA 3I0NA 1JPNA 1E2UA 1N9KA 3PA8A 1HO3A 4TV8B 4WVFA 4E4RA 4YRZA 1RRPA 1TI7A 1PS8A 3RC3A 1EG2A 4DNPA 1O9HA 1TZ2A 1W4CA 2VRCD 3KUDA 4UOZA 1U5CA 1HT3A 1UZUA 3GV0A 3OPVA 1XEWX 2ETVA 2P3SA 2Y66A 4IJMA 3OTQA 4JT8A 1X9HA 4CMIA 4D9HA 1YR6A 2PTGA 3FVVA 4HAWA 3V8QA 2D6FA 3GWGA 3KPVA 4PZLA 1IXKA 4LWZA 3U3OA 1OASA 1AUQA 2GEKA 2B8TA 1EM8B 3D7NA 2QMOA 3CCCA 2EKBA 1IY1A 2HIGA 1Y8CA 3GJYA 2VNKA 5JS7A 2ZT6A 2VSYA 4IWYA 4BKRA 1OYVA 2AG6A 5DXFA 2FPKA 2I6SA 5AJUA 2RAFA 4TYQA 1EK1A 3EUWA 3FIUA 1O08A 2AMVA 3HI6A 3N3AC 3IAEA 4JBWA 1QFJA 3MF4A 2CMFA 1CXZA 1KZYC 3GP5A 3NHWA 4H4EA 4K6HA 2WKSA 4LZOA 1KI9A 1O58A 4P0TA 5HA5A 4AIRA 5B7GA 3HADA 1G41A 1M1YB 3IEIA 2X3FA 1OAOC 2SHKA 3M1AA 3NUZA 3EARA 3QVUA 1RS0A 4LOIA 3EPAB 2XITA 4NFYA 4NEQA 1T9BA 2DPLA 3HXLA 5NLLA 4BV9A 1YFKA 3SQMA 2QUIA 1XF1A 3L41A 3QKSA 4L0QA 3JD4A 3WOVA 4D99A 1TJ5A 1JQ5A 4ENSA 4U7DA 3VR2A 3GLGA 2XJ4A 2BHSA 2GPYA 4JMPA 2MSEB 4TYMA 3T1NA 2WD9A 4LYDA 1FRZA 2JEZA 3ONVA 1EVEA 5HIJA 2LRHA 2BFDA 5C51B 1EJ2A 1CE8A 3QI7A 4U9HS 4AJ4A 2PD4A 1EXNA 3CJTA 3D9QX 4KTTE 3BDAA 4KCGA 3QVGB 1IC6A 3EC1A 3FPAA 1YSCA 1PKXA 3NKVA 3VNQA 4TYYA 1KI3A 3DNMA 3MCTA 1BQ4A 3LY5A 3T5MA 2F4NA 4A0SA 3FETA 4YAOA 1CX9B 4WZBE 1XDWA 4YACA 4D9MA 4G67A 1ZK3A 1UKVY 2ZYAA 1QVRA 3FMIA 4RY9A 4YEDA 1XTTA 2B6NA 4E1AA 5EFOA 2VXOA 3NBFA 1XG5A 3ZNOA 1V71A 4NZZA 3JQBC 3F46A 2H0RA 2DWUA 1TQ6A 2WT4A 5CDFA 4BDSA 1QYIA 3HR7A 4UDYX 1HZJA 3KEOA 5DU2A 5HVNA 4H9GA 3R7AA 1JNXX 3M6MD 4ZI2A 1E2MA 1DFHA 1KI2A 1SCQA 1F2TB 1SWVA 2J9GA 4OHYA 3REFA 3BFKA 3JYOA 4Q01A 4ZC8A 1A9XB 3SHFA 1ACLA 4D4GA 1IIBA 4NMHA 4KBFA 1GT6A 1U4SA 3HK2A 2J3QA 2GYUA 1YGPA 3K7EA 3KZCA 3OKAA 1I5RA 1Z33A 3V7UA 1TCBA 3PI7A 4EARA 4YRNA 5IMSA 3RJMA 1JJVA 3JQ8B 1Y4DE 5DIZA 3ENKA 1GPJA 4WCVA 1PZEA 3O3CA 4ZO8A 3WNZA 5IUJC 1KJNA 3CFYA 1D7OA 1T9GS 4D8XA 4ZI7A 2RKOA 1UODA 3SVZA 3GUCA 1T15A 1XJCA 3D3NA 3U3DA 1C41A 1SBZA 4JB2A 4D1YA 4CTOA 1GARA 3L6EA 2AC4A 4NE7A 4HZUA 1PFWA 1E3JA 1E7WA 5AKHA 1KGSA 2DOKA 3OTOB 3GH1A 3N2GB 1IBRA 1Z73A 2VOEA 2MWMA 2WQZA 2ERCA 1RRCA 2XZPA 3TL3A 1O94C 2V98A 2DPYA 3B1VA 2WF9A 1ZKDA 4HAXA 1E3WA 4R8LA 5KZMB 2E85A 1NVKA 2QG6A 4YMTA 3Q12A 1J5PA 2JASA 5K8VA 1BCSB 3E9DA 5K3FB 5HIMA 5GPBA 2D5CA 4R1SA 3V42A 1JKMA 4HXEB 3ZVKA 2DPXA 3FBWA 4IV5A 2R96A 3WKCA 1A2BA 2IEDA 1DDGA 2FLKA 4M1OA 5J23A 2J5XA 1EJ0A 1RLIA 3TJMA 3E9CA 2ADMA 3EZFA 3ZDQA 1HTWA 2VPWA 2ZYTX 2ZP1A 4PRZA 4QJBA 4ZIRA 4LF4B 2UXCB 1HA3A 4IHJF 1PV1A 1N5LA 4GOMD 1RKXA 3M82A 2B5WA 4MR7A 4TWAA 3RIHA 3VPFA 1Y4UA 3NO4A 5CYOA 4QPCA 4WACA 1GFIA 4XWGA 4NJEB 5F33A 1Z75A 2GUWA 3DSRA 1ZN9A 4WXEA 3TUZC 1QCDA 1DC8A 1VB3A 1B8UA 4ND2A 4ETWA 5L4LA 4C4OA 4KMMA 5AFSA 4P4NA 1I3NA 3R3VA 2QRNA 3AOEA 1I24A 1KETA 5AOVA 5ELMA 1KZHA 3KTAA 4R7ZA 5FBHA 2IK8A 5ABPA 2GESA 1LDYA 5AVKA 2ZJAA 1HFJA 2VSQA 1AQUA 3BWDD 3E9ZA 2AMLA 3HUEA 1OH6A 1G2QA 3PC4A 4U3JB 2ZJOA 3PCRB 4RY8A 1OI4A 3WIVA 3WGZA 1E9EA 1RTKA 2HU2A 3EMDA 3F5MA 2BFEB 3Q7EA 2JAWA 4M98A 4EFLA 1EDBA 4AO7A 1AKVA 2RGEA 4I1SA 4P53A 2QSYA 3BFJA 3BXGA 3F4BA 4W6ZA 2FSUA 1A8UA 2JI4A 3VR5A 3DL0A 5LIPA 3U5ZB 4LVNA 3WNBA 1XMXA 3A6LA 4HWSA 3DBLA 4E0BA 4EW1A 1M34B 1M6WA 2JJ2A 1G3IA 1OTXA 4MQBA 4XSVA 5CEJA 3G1WA 1Z6GA 3RTGA 3CINA 1CE8B 3EF1A 4BUZA 4KVFA 4IIYA 1DAHA 4FFOA 4MWZA 3B2QA 2Q6LA 2Y77A 4E21A 3F6RA 3CH4B 3ETDA 5CPFA 4GSYA 4NYJR 3MINA 4AYTA 1VE5A 2ZJBA 2VK2A 2UYCA 4XE5A 5EJAA 5ICSA 3U31A 1HTTA 3MAAC 3ZC3A 3ZKAA 1SPBS 1NJ5A 1RACA 3WBJA 1UMCB 3DBRB 2KLBA 2D13A 3QJ5A 2AF3C 4BFCA 5LLDA 3MJCA 2E4AA 1XCLA 4TXHA 3LUJA 5EWMB 4A36A 4JL8A 1D09A 4UUBA 2ZRBA 3S70A 4UFOA 5LMCA 4JYZA 2QTNA 3C1OA 4D8TA 4G8DA 3FGZA 4TROA 4UTVA 5IKMA 3LRTA 5J5CA 3HKEA 2XQFA 3IP9A 3G2OA 4C0AC 1I94B 4DWWA 1K5PA 4G1MB 3PPXA 3UVEA 1MW9X 1SKQA 2HPZA 1RI3A 1LDMA 2Q0QA 4DB4A 2IYOA 2XNDA 3M6LA 3KSAC 1UMDB 1UBGA 2OCXA 5AT1A 4P3NA 2KYRA 4GH5A 2EAUA 1Q0ZA 1KZGB 1NMEA 3RS2A 4CHGA 1P1FA 2ZE7A 4NFLA 4BAGA 1G20B 1SU4A 4HDCA 4JBXA 4RM3A 5CYGA 1E3EA 3U40A 5T4EA 2W00A 4JOCA 3FAZA 1L5HA 1ZSYA 2FQXA 2H29A 2RH4A 4M0CA 1FMTA 2FR8A 3UC9A 2UVPA 3PF8A 2PVCA 4GZMA 5EEHA 1PJTA 4AIIA 4BNLA 5FPKA 4I4CA 2P1ZA 2VUIB 4MVJG 1QF7A 2DUNA 2YHBA 1RU3A 4N82A 1VKHA 3JY6A 2JCSA 4HRAA 4L9WA 3EP9B 1BNCA 3HXPA 4P3KA 4ER0A 4ER6A 1NJ6A 1VRWA 3G1UA 2IZ1A 3CPJB 1JB9A 4M46A 2REQA 4TLMB 2LKDA 3HDYA 4F2PA 3B1KA 4XDZA 4GI3A 1QONA 2GM4A 2CZQA 2VHXA 3ITNA 4RHEA 4YP0A 4JT9A 4EPWA 3AHFA 1V3UA 3CZAA 3KKEA 1IJBA 3NALA 3G5TA 4RGVA 1EVZA 2FZ4A 2AD5A 2D2EA 3BD9A 3A9UA 3EZ6A 3G88A 3G8DA 3MCZA 4LXGA 5EIBC 4P32A 2I6FA 3F4KA 4J2HA 1ZJYA 1WOMA 2PR2A 4PFSA 3VSAA 5BN5B 1SG9A 2QSUA 5L4SA 4BV2A 3MS7A 3RUAA 4POOA 3ELDA 2FXVA 2ZRPA 4F91B 2CLHB 4PBRA 2OL4A 3WDSA 4EUKA 4JEIA 4D0GA 1DE0A 2WFAA 3SGLA 2VJPA 1XLUA 5REQA 4E32A 1TJ3A 3D2BA 3HUTA 1A8QA 4FZ3A 1VECA 3DHEA 4MR7B 1H4SA 2DERA 2WWWA 1HURA 4OQXA 4Z86A 3TBHA 1GPH1 2O8DA 5ALRA 3NOOA 3E61A 5LZ8A 2RHTA 1I0LA 4UHFA 3I9NA 4GYYA 4UMEA 4FEYA 3JQQA 3VMFA 2YWEA 3N0RA 1I9CA 3BILA 3G79A 4FZVA 3GGJA 3P0EA 1LJ8A 2IJGX 3QLVA 4KRYA 4B44A 3MHTA 2HMUA 4U0KA 4GMKA 3W79A 2B7LA 3CE6A 3MJRA 1H65A 1OI3A 4GDFA 1YXMA 1L7RA 4YJDA 1KU0A 3EDYA 2NO4A 2FSPA 2PX2A 4MLZA 1Z4QA 2RK3A 1JIXA 4NE2A 5KMGB 1ZHHA 4FZJA 1XMVA 2OD9A 4LHWA 4JUBA 3STTA 4EAAA 3QGMA 3K1AB 5HF6A 4YT2A 1BJRE 3PHHA 1ZD4A 1GUFA 4ZKEA 1DAIA 9ATCA 1VXOA 1J7KA 2FWIA 4B6PA 3DXXA 4TV9A 1ZGCA 3SXJA 2A0XA 2CMGA 2QPAA 1YMUA 2C77A 3CZ4A 3T0FA 1PU2A 2QAGC 1NLMA 2TRSB 4RJIA 4HFMA 4RGQA 2GD1O 2ST1A 3LVRE 3TXXA 4BZQA 2JGLA 2XKJE 4IG4A 1RJGA 4NARA 3QA3E 5DM4A 4Z49A 3OFND 1R6UA 3AUKA 2IYTA 3IBCA 3O9VA 3R5HA 4WH0A 1JG6A 1N92A 2ZIFA 4QKQA 4J4TA 4E07A 3F6BX 4J16C 1XRSB 2WEKA 1BDBA 3TLBA 1FMFA 2PXAA 4OHOA 3EXG1 1R9MA 3G7UA 1XZFA 2ESRA 4B3XA 4F5EA 1P2DA 1SXJA 3F9CA 4HGZA 4BLRA 1WETA 1L5SA 4QPPA 5F3DA 1WPQA 4RLQA 1CZLA 4ZHQA 2E6UX 4O29A 4TLBA 3B7GA 1K0UA 2DH6A 2PUAA 5E0KB 4MA5A 3PNBA 1SWWA 2ETXA 3U7FB 3NNNA 3NXSA 3PQDA 5E7IA 2PQMA 5JO9A 4AKGA 3OIDA 5AUPB 3QM1A 4LCEA 3ELBA 1NU6A 3V7WA 3ZY5A 5F98A 1TM1E 4NPHA 4WLFA 3M3PA 4UTXA 1U5AA 2EW8A 2R79A 5DYWA 4AVYA 3PYXA 2VJCA 4ZDIA 2C58A 1Q1EA 3VU0A 2OB2A 3W5IA 1MTOA 2OV8A 3QKRA 4DG5A 1H23A 1JHDA 2YWXA 5A4KA 2H65A 3EVBA 3HI4A 2NG1A 3TB6A 3QFSA 1YJ5A 4Q3EA 1DKUA 3E3LA 2PBRA 2HBZA 5JZOA 2GWHA 1L8AA 4MS3B 4YREA 5CT5A 2VSXA 4HP8A 1QGYA 3E8MA 5KYWB 1V45E 2OILA 3FYSA 3KR2A 4N3AA 4ZGBA 4AULA 5A0VA 1BQEA 1Y4SA 1H0RA 3JQ9C 4LK2A 1F17A 4C0BA 2J3IA 4TRJA 4B7XA 1W0KA 3UN1A 1B6GA 1GM5A 4XR4A 3KWLA 4LRQA 8OHMA 3KVRA 3W3AA 5CK4A 4BFSA 5I6DA 3NAGA 5K45A 4Y2RA 3I8OA 4KC0A 1HQDA 1J4AA 3T5PA 2NXEA 4BCBA 1KEPA 2WKWA 2Z2XA 2JFFA 1SD2A 1C1XB 2CFSA 3A6FA 1T6NA 3G85A 2HWXA 3GARA 3CNQS 3O92A 5M29A 1BXRB 1Z07A 4ZEOA 4RZ3A 4PC7A 2BUAA 2R6R1 4ZCIA 2V65A 1KK1A 4CU2A 1NXSA 2WMOB 1H2AS 1J90A 1VYTA 2X0NA 2BEWA 2PXXA 1JZTA 2CUTA 1WXHA 4RU1A 5T4BA 4NU8X 3NT2A 4CFYA 2YHSA 4MVJP 1RQ2A 4NCNA 2O8DB 3K15A 1ZUWA 3QSGA 1FU4A 2HRQA 1KBOA 2PH5A 3NNSA 2QJFA 4K9KA 4BEVA 1KK0A 4A0FA 2D00A 5EHQA 2ENUA 4PS1A 1W52X 4XSGA 3RVKA 3C14C 3ZTWA 5EJ9A 3SZLA 5JHGB 1UKCA 3IO5A 1DO2A 4Q12A 3UJ3X 3WLMA 2Z8YM 4YRAA 2HLPA 1T9AA 2IEGA 3QLUA 3HBMA 2ZTSA 4LMPA 4ZDJA 2H4ZA 2HPVA 4M7RA 3R3UA 1E1YA 1YVUA 3FNEA 3GR6A 1YB2A 3VHXB 2ZE8A 3JATB 5JPDA 3RFVA 2W2KA 5BSHA 5AO9A 3G2IA 4PZCA 3OPNA 1NT4A 1TLTA 4PLPA 1AUPA 2R4UA 4S1PA 4KREA 4AKIA 3FZQA 1P1CA 1SHJA 1RWMA 2C9OA 2QUBA 3COSA 3I05A 4AZVA 5F4ZA 4OMFG 3DHVA 2RDMA 3RUDA 5EXDA 2CK3D 3OT1A 1ODCA 3UCFA 4M1YA 3ZWDA 1PVVA 4YCBA 1FB5A 1LNQA 5T67A 2PIDA 3ZCRA 4NIMA 3OQIB 1E0SA 1MX1A 1OHHD 1PHPA 2EKQA 1HE1C 2QTCA 3H2SA 1P4JA 4KN8A 5EMLA 1CRZA 3NHLA 2GZSA 3FX2A 4MB6A 1CNFA 3GUVA 1EU1A 3L43A 5A6SB 3H5LA 1F0YA 2O5RA 1C80A 1DC4A 2PMBA 4UNNA 1I1OA 4R2XA 1Y1QA 1CZOA 1ADBA 1BE6A 1JU3A 3MQ2A 4KO8A 2WIDA 4LYFA 1RYYA 1Z62A 1ARZA 4MMZB 4N5LA 3HM9A 2RHJA 1T2UA 3QNUA 2WY2D 4FB4A 3KQWA 5IULC 2CBXA 1CZKA 4GR5A 2BFCB 3GLIA 2JLVA 3CSUA 2V03A 2ZRJA 2CCKA 3P0FA 5BW4A 2Z95A 1WBBA 1OXSC 4PYRA 4FYVA 1RI1A 4E5SA 2EIHA 1E4EB 2E4UA 4NMWA 1FP7A 1YJXA 5KVVA 4A15A 1KAEA 3CLUD 3V2IA 3WRXA 3VC7A 2YVQA 1F20A 5K7SA 1SR8A 1Z2OX 1WLYA 2HU5A 3GI1A 4V1CB 4GNRA 4KV7A 1MNAA 4FYPA 1EMDA 2XB4A 2YWRA 1HETA 1C4XA 4FFWA 4QAJA 1XPRA 2IYPA 3AHJA 3A2KA 1WUTA 3GA5A 1KYZA 3ROPA 4MRVA 4F1KA 4QM7A 3NWJA 2CWDA 1VLJA 2A2ZA 1IL0A 1L7OA 3CQ9A 1BE8A 3AR6A 1J39A 1UXGA 3S2YA 2NADA 3I9V1 4YRDA 4CQLB 1O0BA 1RKVA 5EJ2A 1CERA 1G0OA 3CGGA 4ERXA 5KQMA 3HP1A 2VHUA 4D44A 1RWNA 2ZJ8A 3IC5A 4HYYA 1D6MA 3RUEA 3SEAA 4D96A 5C0OE 5I4KA 1ZN2A 4HS9A 4WIAA 4ALJA 5M7EA 1JG3A 2W2LA 3WLJA 5C52B 1HQKA 3FZNA 4B4WA 4MZXA 1Q0RA 5IVDA 4KE7A 3VR6A 2WPDD 1E3IA 3L77A 1DBSA 2TMGA 3EPKA 1I7BB 3Q2OA 10MHA 3WKDA 1V16B 1KFJB 1E7MA 4KGXA 3VAAA 3OLVA 3ZLTA 1KP3A 3EXFB 3EG5A 4X7BA 3PXBA 4J03A 4R9SA 1SK9A 5C80A 1G7RA 5HS4A 3QXGA 4DCPA 5IG2A 2JIPA 2ZBDA 3GAAA 4PZDA 5JJ5A 2PUCA 1ZJZA 3LV8A 4JB0A 3EWSA 1A7KA 4TL8A 1GGNA 1M2GA 1NUSA 2R11A 4TN1A 4REQA 1NURA 5BWNA 3DS8A 3LUDA 3NM5A 4JJ8A 3R7SA 5HIAA 4F46A 4W9NC 2NZJA 1W30A 2WKQA 2ZWIA 1TOAA 1KVTA 4HCJA 3TAHA 1IVSA 1TZBA 2HBQA 3FCSB 5FYQA 3ANNA 2H06A 2EFCB 3FWPA 4B40A 4H1WA 1I10A 1UWLA 4KP7A 1R8SA 3RTDA 4W5RA 1OAKA 1RYHA 2QUZA 1YZKA 4EEXA 5CW1A 2YASA 5JSUA 1GHTA 4LJ5A 1NUHA 5EOVA 1LPPA 3AF4A 4C6RA 1QMHA 2PU5A 4R1OA 3C3MA 2V1XA 1T0IA 3BJEA 2OTCA 2QX7A 3IOEA 3VHRA 3PPYA 2FW8A 4UHCA 3KKZA 4YCDA 5H68A 2O2EA 2YN4A 5A4DA 3WFJA 4EW6A 2WTMA 1V3VA 3SNHA 1IMOA 1F48A 5BO5A 2GCIA 3RUIA 3G9UA 1Z3CA 3UT6A 1C8KA 2W2KB 3QOWA 2IUTA 2J07A 4NYMQ 4C0WA 3C39A 1HSOA 3ULKA 3QA9A 5EXEA 3HUDA 3OWOA 3TS1A 4KSYA 4CDRA 4B33A 2C4VA 3JQAA 3FY4A 1ZESA 4TKUB 5A3VA 1PEKE 1DUIA 4YBZA 3OM0A 5A0FA 4IJVA 1N2CA 4TT3D 5AYVA 3WZ2A 4DLBA 5EP1A 5K0FA 2CNNA 3DW1X 4O4IA 4LWOA 3BCUA 1QE3A 4QJ5A 2RBGA 3ZKWB 5FP0A 2AI1A 3WMFA 2YC4C 2WQ6A 1AH2A 2JGRA 5C8YF 1RXIA 4KXNA 4NCHA 5COAA 3T38A 2DWOA 1U3DA 1ZD1A 5L51A 1L4MA 2UV8A 2J4FA 2QLBA 4COOA 3FUUA 5JH7B 1PT5A 1MQ8B 2H5JA 3JRNA 1URPA 2D1TA 1GUAA 4GQBA 2IDJA 2WM9B 3QWIA 1J70A 4LRSB 3L8GA 4PPGA 3A6JA 1ZXLA 1KAOA 2X1VA 1DCKA 2YDXA 3NHFA 2P2ZA 2H7XA 4JFRA 2R48A 4RD4A 4DQKA 3HXMA 2DXIA 421PA 1XU9A 1O6BA 4EG3A 1AGXA 4N0EA 1L7EA 3L93A 3Q9LA 3FNHA 4P08A 2BTOA 4PLYA 5HMLA 1M6VA 3B6MA 3AIIA 2FGJA 1QC5A 3PRYA 5TVGA 3MRTA 1UT6A 4DS3A 5JYCA