1NWMX

Gat domain of human gga1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
112
structure length
105
Chain Sequence
LRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the GAT domain of human GGA1: a syntaxin amino-terminal domain fold in an endosomal trafficking adaptor.
pubmed doi rcsb
molecule keywords ADP-ribosylation factor binding protein GGA1
molecule tags Protein transport
source organism Homo sapiens
total genus 44
structure length 105
sequence length 112
ec nomenclature
pdb deposition date 2003-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03127 GAT GAT domain
X PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1nwmX00
1WRDA 2N2NA 1WR6A 1NAFA 1O3XA 1NWMX 1YD8G 1OXZA 1X79A 2N9DA
chains in the Genus database with same CATH superfamily
2VKHA 5JRCB 1D0YA 4YY3T 4HFIA 3PUWF 4ADZA 2QRXA 4ZS2A 4Q25A 3RYCE 2XQ9A 2UXDT 2YEVC 3VKGA 4JEHB 5E0OA 5IHYA 3T1HT 2IHR1 3NKZA 3KBUA 3CQXC 2WP9A 4JI7T 5FY0A 1MIWA 4UIGA 3VR8A 4B3TT 3N9OA 2DCFA 4P0BA 4HWIB 5JDHA 1HF8A 3A5XA 2LOSA 3EHZA 4I50E 4TNWA 2OA5A 4ZEYA 1Z8UA 2L8KA 5FVKA 1IZNB 2I6HA 3C51A 2K9AA 2KWIB 5L4HA 4IDQA 3SS1A 2N1GA 2NW7A 4LFBT 2XQAA 4JI1T 3AEFA 5JDGA 4AKRB 1G73A 2YN6A 1YKEB 5LA6E 2WAUA 2WMOA 2VASA 1M62A 4QH4A 5HEUA 2XAHB 2IMLA 3PV0F 5L3DB 4JBWF 4YHJA 3ZMTB 2W62A 4CXYA 4DIDB 1J1JA 4MLKA 2CBJA 5JQGE 1VRBA 2V7LA 3B57A 2RPAA 1XWMA 3FB2A 2NWBA 5FVLA 1KFYA 2YDSA 3EDVA 4JUYA 1U4QA 1J5ET 5EK4A 3N2KE 2VK9A 2YOEA 2PTFA 3HR0A 3PUYF 5KMGP 3TLSA 2V7IA 3E22E 3ETVA 5LHGB 4TUYE 1KF6A 5AQJB 3N9LA 5LMNT 3O1HA 5JR9A 3M3ZB 4IGUA 3FZMB 2CA5A 3RYFE 4QH1A 4QXHB 2MBGA 3RC3A 3LDQB 1T72A 5ABEA 4DR3T 3RYIE 3VRBA 3UT5E 2H3RA 5J0ZA 5LJNA 1FIOA 2XUEA 3LG7A 2LM2A 1N32T 2K3WA 2WY2A 2X51A 3RIFA 3LFMA 4U2ZA 5FNVE 3LK3B 1IJ5A 4Z91A 4DV0T 3C4ZA 4ISTA 4DV6T 2BG9C 1XDOA 3AEBA 2LKHA 4YTMA 4X1IE 1ZP0A 5AQFB 4JV5T 5L3GB 3EAMA 2C5JA 4IT4A 4AXPA 4U7YA 4OYJA 4HWHA 4EYUA 2J4GA 4U33A 4B6XA 2W66A 4LF5T 2R6GF 1XDPA 4JI0T 3P4PA 4HWFA 2X67A 2V7JA 5F8PA 5HXSA 4JI6T 2WCAA 2X0HA 3LK42 4H9QC 4ZZBA 5L3CB 3FXEB 2L3LA 3NVOA 3TLUA 4XBFB 5HEHA 3D0TA 4UVAB 2IAKA 4A56A 3O1IA 2LEHA 5AQTB 2W00A 4EOZB 2WU2A 2E5VA 3RX6A 3F57A 5HEOA 4ZI3C 5AQUB 3PDYA 3ZN0B 2V6YB 4CI1B 2DL1A 1IBLT 5LP6E 5LBMA 1IJ6A 4HN9A 2ZLYA 4A5XA 1XMQT 3CMLA 5L3EB 2V7KA 2WQYA 2UUBT 5L47A 3OYZA 2WDQA 4G63A 2CCQA 1W09A 3AB3B 2WWVA 1HNWT 4TV9E 4AKIA 4HFVA 2E9XB 3MXZA 2QGSA 3ZYMA 2P9BA 4YSZA 4TZ4C 1EZ3A 4CXWA 4IE5A 4ZI3D 3ZYLA 3UUNA 1D1AA 5F3JA 2WS3A 4E7SA 4XZCA 1D0ZA 4HWDA 2N2NA 4HFEA 3JAEA 2FJAA 1YKHB 4YLHA 5HEGA 5JTGA 3MACA 1ZV4X 1KNZA 1US7B 4LF7T 2VKDA 4DBQA 4HE8A 5FKYA 3R6NA 3RIUA 3RPUA 2ZMAA 3T1YT 3RYHE 1OEDB 2D0TA 2CE7A 3QOFA 2Q9QC 2V1DB 1R8IA 1HX8A 3J7Yq 2B76A 4EB6E 5LHHB 3P7IA 4YHHT 3EABA 2VKJA 2LSGA 4HTEA 5DQWA 1IAPA 2NW8A 1XNQT 1SA0E 5CFBA 3NWIA 1H7CA 4LMJA 3NZPA 4KX6A 3RLFF 5F5WA 1WYBA 4YSXA 2XQ7A 4A98A 4X5TA 5J2UE 5LGTB 2ZM2A 3TLTA 4AKLA 2H88A 4B3ST 5AQHB 1CHUA 3ZMSB 2BZBA 3ZSTA 4AIUA 2RP4A 3K1SA 1YQ4A 3AA7B 3QK6A 4IDPA 1ZOYA 4ILAA 2CHNA 3NBXX 4U2YA 5FXXA 3U78A 1WR0A 2K48A 4AKGA 4UXNB 4LF9T 3P4SA 4QWNB 2V7MA 4I55E 2UXBT 5JDMA 1WCRA 4C91A 2Y8DA 4COFA 4DV3T 3UU3A 4U7IA 3AE2A 1MIYA 3AE7A 3RI5A 4EGWA 1WYCA 2V6XA 4CI2B 1OWAA 3LK2B 3AAAB 3SRZA 4CXXA 3L09A 3PUXF 5ETWA 2LRLA 4WYVA 4E7ZA 1NAFA 3N9QA 5FY1A 3I9WA 3IBPA 2XAGB 2LE8A 4OK0A 2IDOB 1S94A 3ANWB 3JADA 1HR0T 4QH5A 4IE0A 5C3JA 2IUBA 1IBMT 2XHEB 4IE7A 3Q5EA 3FZKB 4UR9A 4KHZF 1D0XA 5A1LA 5L3BB 2BS4A 3I0OA 4TWFA 4WNKA 3HKEE 4DV2T 3E08A 4KBMB 3LSVA 5LCYA 5LGNB 3ZYKA 4DR6T 4EYYR 1SHZC 5FL1A 3A8YC 1HG2A 2AE9A 3HA4A 4JI4T 5JDQA 3PUGA 5AQQB 3GMIA 2CXDA 3K8PC 3AVSA 5DQVA 4YT0A 1GQEA 3Q9DA 2F4VT 3LBXB 2OLTA 4LF6T 4NUUA 2OV9A 2KZ7B 3PU3A 4JI2T 4LFCT 2I59A 1FEWA 1W9RA 3RKOA 2VVNA 2A2FX 4P0AA 2E9XC 1KNPA 3L8RA 4UELA 4AQYT 1D1BA 4BJMA 4U74A 2XM2A 1W0AA 4ILBA 3EDUA 3IHRA 2A72A 2XQ8A 2LSIA 2UU9T 2EHOA 1O3XA 2WZIA 3AA1B 2PJQA 5HXRA 1OEDC 3PJAJ 4KP3C 3ONXA 2JMHA 5HAXA 5AQPB 2KXPB 2V5DA 5C2TA 1WR6A 2K24A 4PK6A 4EIWA 2IIUA 4WBOA 2W4XA 5BMVE 4YSYA 2E9XD 3JAFA 2Z6EA 2ODUA 3KVAA 4ZS3A 3WAKA 2BS3A 4QXBB 3Q2MA 3E0ZA 3JC6D 2DWKA 1N36T 4AQFA 5CA0E 3Q5DA 5CB4E 4TV8E 4QX7B 3IF8B 4PK5A 3UQ4A 5FP3A 2XM1A 2EHOB 2KLQA 3UU6A 2GK9A 3AXJA 5EZYE 3RRCA 4I43B 4GIWA 3KV5A 2LSYA 4X62T 4DR2T 2NP9A 2FJEA 2DI4A 2J1DG 5JDNA 1VCSA 3MJXA 4JLEA 4JYAT 2NTXA 3FBLA 4DNDA 4O4HE 3AE1A 1UX4A 5KXJA 2CLYC 1OXZA 1FMVA 2QYWA 3M65A 3C4WA 3TLVA 4AI6A 2MYSA 2X9XA 1HTJF 1AJ3A 2CHOA 1FMWA 3V5UA 3EUHA 5FXZA 4ZXLA 2VQFT 2XQ6A 3ABVA 3AXJB 2LSKA 2M6IA 3CQGB 3BQKA 2CWOA 2X0YA 3UUMA 2WB5A 5JR9B 3HKCE 2E2AA 2CEAA 1QSDA 1L0VA 1KEYA 2LHRA 2JRKA 4TWDA 3ZJ2A 4IDOA 2X9WA 3WAJA 1BR1A 3ZEFB 2YINA 2LSJA 3O1JA 3GN5A 3VHLA 3PTRB 4JI3T 1YQ3A 1XMOT 3RRWA 4ERRA 2QA7A 4IHJE 2NR4A 3C64A 3KV9A 3TLWA 4M1PA 2D2SA 3GWHA 3CPZA 3O9XA 1J5WA 5HXCA 4U31A 4X64T 1FJGT 2B1EA 5JREA 4K0KT 2X9HA 2ZM6T 4IREA 4HEAA 3ZMVB 1E7PA 3BQLA 5H6QB 2CXFA 3JCFA 2NTYA 3FBZA 2C0SA 3OTOT 3MA9A 5AQOB 3AE6A 2VKOA 3P4RA 3ZC0A 4GK5E 1CUNA 3SOLA 2J47A 4O4LE 2Y6XA 3VU7H 4O4JE 3B5MA 1MMGA 2BBHA 2DWGA 2ODVA 3HL6A 3UULA 3I0QA 5JDFA 3IEEA 3ZCIA 3RC8A 1UGOA 3BQIA 1Y64B 4TX5A 2JPFA 5IYZE 5EK2A 2BKOA 5FYMA 5L3FB 5LGUB 2W2UA 2DNXA 5AQLB 3AE8A 2LJLA 2X9YA 2KWHA 4NPPA 1WRDA 4TWHA 3HKBE 3OYXA 5LYJE 4HWCA 1NEKA 2H7VC 2IW5B 1HS7A 3DP7A 2IC6A 3LJCA 3NRYA 4X65T 3PURA 3AVRA 5FXVA 4EZ4A 3RGLA 4UVBB 4UV9B 3PUZF 3KBTA 4PFOA 1ZHCA 2LOPA 3UU5A 3ZPOA 4ILUA 5LNKA 2I0MA 4GOUA 4GKJT 4WZXA 4BAYB 3AAIA 4PJNA 4C90A 3ZN1B 4ZZCA 1B7TA 1Z0PA 4QHOA 5FY7A 2A3DA 5HWYA 1KK7A 2AXDS 4PAGA 3AAEB 3J9X1 3OBVE 5KX5E 2UXXB 2LT3A 4HFDA 5ADXL 5ABFA 1BR0A 2G0UA 3AE5A 1D1CA 1JNZA 2HPJA 2BG9A 4ISSA 3ONLC 2BKNA 3ZC1A 1WLXA 2J62A 1X9BA 5H6RB 5LG4A 2KNDA 4A97A 4QX8B 4IE6A 3ZT7A 3CKDA 4Z8XA 5J2TE 2XZEA 2FUPA 3N9PA 4J2CA 2EHOD 4IDNA 5LOVE 5CGMA 4UF0A 3C50A 2X0LB 4JEUB 1T98A 2XSAA 2VWAA 1I6ZA 3TKLB 4H9NC 3HKDE 3ZJ1A 5AQVB 4PJLA 4AKHA 2D0UA 4U72A 4EEBA 1N33T 5ABFB 2VL0A 4U3CA 1SE7A 5JRCA 5JR9C 3NZQA 3F2EA 3ZCJA 4ZI2D 5ABHA 2HPLA 2FBWA 3RQUA 5LXTE 3AEAA 2WWUA 1YW0A 2CBIA 4LMLA 2V5CA 4MALA 2XASB 4X1KE 2IC9A 2X66A 5L2LA 3B13A 2V26A 2M67A 2HN1A 1X79A 5EK3A 2UXNB 4X66T 3SFDA 3L3PA 2XPKA 5AQSB 5AFUL 3G06A 1XZYA 5HXEA 4FJOA 1LVKA 1T8BA 1HX1B 3AEGA 1UCUA 3AE4A 2D5UA 2MPKA 4PJJA 3V5SA 3N2GE 2VB6A 4GYRA 2HN2A 3VKHA 5LBQB 5DJQC 4DV7T 3OVUA 2H89A 5HCJA 1MNDA 2WDVA 5M4YA 4EZHA 5LMUT 1T7SA 2WZHA 2Q9QA 5J1GA 2MOZA 1LKXA 4HGAA 3N5LA 2VURA 2FJBA 2E8IA 4L5GA 1QUUA 3C4XA 2RA1A 2WBLA 4YFSA 4DVDA 3JC6C 3PUQA 2UUCT 4HFBA 4CN4A 3KINB 3RKGA 5L4EA 2XAJB 3P4WA 5AQNB 5HEJA 2KMFA 5KDMC 2FJDA 2CRBA 3DJBA 2W61A 4NUVA 4AQGA 3UFGA 4O8SA 1MIVA 2V8SV 2ZM0A 3ZT6A 5HXHA 2YDQA 3QUJA 2C5IT 1HG5A 2LM9A 3ZSSA 2Q9QB 2YK0A 4DV5T 1XNRT 3CQCB 3MZKB 4O2AE 4DUZT 2C5KT 2LHNA 4CI3B 3NRXA 5JVDE 4EXTA 4JI8T 2YKSA 5C8YE 3H3AA 2K5BB 4BA9A 5CJ5A 1ZKEA 2YU1A 3ESLA 2UUAT 3A7MA 4HFCA 4QKNA 4GYSA 2JIWA 4Z90A 3RIUC 4I4TE 4UVCB 2DLRA 5AQIB 4YJ3E 5FXWA 1UK5A 1VCTA 3R84B 4LMKA 4V1Av 5HYAA 2QVAA 3I9YA 3ZMZB 1BR2A 1LVFA 4ANJA 3UU8A 3UQ7A 2XY8B 3RIAA 2VQET 4BJNA 4B3RT 4JI5T 1V9DA 2BVMA 1MNEA 5AQRB 5ABGA 2ACZA 4YTNA 2BDEA 3QC9A 3AE9A 2W63A 4GKKT 5JH7E 2KINB 3MK7C 3FZLB 4UV8B 1BR4A 2W67A 2LRKA 2PFVA 4H9OC 4F8HA 2XJ7A 4CZZB 2WDRA 3AECA 3AE3A 5LJMA 3ZT5A 2NW9A 2LLYA 3UFEA 2XAFB 5CA1E 4PK4A 4LF4T 4B3MT 4K0UA 3L39A 3KFWX 4IDZA 2JQHA 2V6YA 3UUXB 4WBNE 3RF1A 4DR1T 2E5LT 2Y48B 2NOXA 3CK6A 2WMNA 3T8OA 4GK0E 3P8CD 3N9NA 4FI5A 3BK9A 3EI0A 4OYKA 4PFPA 4H9PC 3FZFB 3ZMUB 4F6RC 3FZHB 2ACXA 3CWZB 4X1YE 1N34T 2XSBA 4ZOLE 4MBQA 1YXRA 2ES0A 2JJ9A 5AQMB 3U3IA 2E9XA 3WI3A 2VL8A 4TNVA 1HFAA 2JQQA 2BVLA 1DU2A 3KV6A 3N9MA 1HCIA 3PU8A 4DMVA 3P50A 1S35A 4MHCA 4H63H 2A9UA 4DV1T 3S4UA 3DTOA 3OPCA 4I0UA 3O4XE 3KDSE 4ILCA 3PJAA 3SWHA 5GONE 3UTKA 1OEDA 3X1DA 2JQKA 2XQ4A 3PUVF 3KVBA 3ZLIA 3K3NA 4ZI7E 3FXDB 3Q5XA 4IL4A 2LKGA 2CPTA 4AISA 3GN5B 4P09A 3RQWA 4NXNT 2D9DA 1OEDE 3SFEA 4EAHA 4P1NA 2YDRA 3OKQA 1ZEEA 4WW0A 1U5PA 2L9QA 4YJ2E 4H63V 2W0GA 5DABA 5HWXA 3K3OA 1SUMB 4DR5T 3AA6B 4IIJE 5LB7B 4LF8T 3AEEA 4H9RC 4CN1A 1Y01A 3CIRA 4IL9A 2KSRA 3H3MA 4OFZA 3CX7B 4CQIA 3PUSA 4NIQA 3W15B 2BKPA 3ONJA 3VR9A 1MMAA 3HI2A 5HCMA 3K3QC 3PUAA 1W0BA 1I94T 3PE0A 3QB5A 3ZKRA 1IBKT 1UURA 1NWMX 4O2BE 2CXLA 3CX8B 3H37A 1UX5A 2EHOC 1QLBA 4DUYT 4LFAT 3I1AA 2UXCT 2SPCA 4L9IA 5JDLA 1YD8G 5AQGB 2MAWA 1G8XA 2XQYA 5IWAT 3VRAA 1E2AA 4KHPT 1JNRA 3P4QA 4EV6A 3F31A 2BBJA 4XAXB 3AEDA 2BS2A 4YTPA 5BR8T 1MMNA 4KMCA 4YXDA 2PG8A 4CN6A 3QNUA 3ETUA 4O4IE 2Q9QD 2KT9A 2MTQA 4G2AA 4ZI2C 1UUSA 4DO0A 3GA8A 2JMKA 2BG9E 3ANWA 4ZHQE 3RHWA 3UUBA 5LHIB 2HHHT 4DR4T 3UU4A 3RH3A 4AQFC 2M6BA 4DBRA 4HFHA 2PBIA 4EEDA 3IA3A 3CVRA 5AQKB 2H7OA 2X68A 3EVYA 1LRZA 1M7KA 2CM0A 2XTLA 2CLYB 3MKDA 1E1HB 5TAOA 4L0RA 4PW8A 3KV4A 1VOMA 5IUXA 2ZM8A 5LG3A 2N9DA 4PNIA 3Q5WA 4H9SE 2HH7A 1MMDA 2CMRA 2WU5A 2BG9B 1HNXT 4ASKA 4X20E 4UEMA 1WFDA 2WSSV 2VVSA 3N2OA 3LBXA 2CWYA 2WM9A 5FMNA 3OJAA 1NENA 2JQ9A 4QXCB 4MFRA 4DMWA 3CX6B 4HKAA 4NXMT 4OHFA 4KI0F 4UF0B 2XQ3A 4KUMB 4TN7B 1KNRA 2YU2A 4PJMA 4IE4A 5FL0A 4N78D 1HNZT 4DV4T 3AA0B 2XAQB 4DR7T 2DHRA 3FHNA 3C98B 3QB5K 4OX9T 2XQ5A
chains in the Genus database with same CATH topology
2VKHA 4I4TE 4UVCB 3KV9A 4AKLA 5JRCB 2DLRA 1D0YA 4M1PA 2D2SA 3GWHA 4YJ3E 3CPZA 3O9XA 5FXWA 5HXCA 4ADZA 3R84B 3ZMSB 2B1EA 5JREA 2X9HA 2BZBA 4V1Av 4ZS2A 5HYAA 4HEAA 3RYCE 3ZMVB 3BQLA 3I9YA 5H6QB 2YEVC 2CXFA 3VKGA 3ZMZB 2NTYA 3FBZA 1BR2A 2RP4A 4JEHB 2C0SA 5E0OA 1LVFA 3MA9A 5IHYA 4ANJA 2VKOA 3AA7B 3QK6A 3ZC0A 3KBUA 4GK5E 3CQXC 1CUNA 3SOLA 3NBXX 4O4LE 4BJNA 2Y6XA 5FXXA 3VU7H 4O4JE 3U78A 1MMGA 1V9DA 2BVMA 2K48A 5FY0A 1MNEA 4AKGA 4UXNB 2DWGA 1MIWA 4QWNB 4UIGA 2V7MA 2ODVA 3HL6A 3N9OA 3UULA 2BDEA 3I0QA 2DCFA 3QC9A 4P0BA 4I55E 5JDFA 3IEEA 3ZCIA 1HF8A 2W63A 5JDHA 5JDMA 4C91A 2Y8DA 3RC8A 5JH7E 3A5XA 2LOSA 1MIYA 2KINB 4I50E 3MK7C 2OA5A 1BR4A 1WYCA 3BQIA 4UV8B 1Y64B 2L8KA 4TX5A 2JPFA 1IZNB 1OWAA 5IYZE 4CI2B 3C51A 5EK2A 2PFVA 2K9AA 5FYMA 3LK2B 3AAAB 2KWIB 4H9OC 3SRZA 5L3FB 5LGUB 4CZZB 4CXXA 3SS1A 2DNXA 3L09A 2N1GA 2NW7A 5LJMA 2LJLA 2X9YA 2NW9A 5ETWA 2KWHA 3UFEA 1WRDA 4E7ZA 1NAFA 3HKBE 2XAFB 3OYXA 4PK4A 3N9QA 5CA1E 5FY1A 5LYJE 2H7VC 4K0UA 5JDGA 3I9WA 3KFWX 4IDZA 4AKRB 3IBPA 2XAGB 1G73A 2LE8A 4OK0A 2IW5B 1HS7A 3UUXB 1S94A 4WBNE 3ANWB 1YKEB 3DP7A 5LA6E 2WAUA 2WMOA 2VASA 2Y48B 2IC6A 2NOXA 3LJCA 3NRYA 2XAHB 3PURA 3AVRA 5FXVA 2WMNA 3T8OA 4GK0E 5L3DB 3P8CD 4EZ4A 4IE0A 3N9NA 4YHJA 4FI5A 4UVBB 3ZMTB 3BK9A 4UV9B 2W62A 4CXYA 2XHEB 4IE7A 4OYKA 3KBTA 4PFPA 4H9PC 4PFOA 1ZHCA 4MLKA 3ZMUB 5JQGE 2LOPA 4F6RC 1VRBA 1D0XA 2V7LA 3B57A 2ACXA 5A1LA 3ZPOA 3CWZB 5L3BB 4ILUA 4X1YE 5LNKA 4GOUA 3FB2A 3I0OA 4ZOLE 4BAYB 3AAIA 2ES0A 4MBQA 2JJ9A 4PJNA 3U3IA 2E9XA 4WNKA 4C90A 3ZN1B 2NWBA 3HKEE 3WI3A 1B7TA 2VL8A 1Z0PA 3EDVA 3E08A 4JUYA 1U4QA 4KBMB 1HFAA 2JQQA 2BVLA 4QHOA 5FY7A 2A3DA 5HWYA 1KK7A 5LCYA 5LGNB 4PAGA 3AAEB 3KV6A 5EK4A 3N9MA 3ZYKA 4EYYR 3J9X1 3N2KE 1HCIA 1SHZC 2VK9A 3OBVE 1HG2A 3PU8A 4DMVA 5KX5E 2UXXB 3HA4A 3HR0A 2LT3A 5JDQA 5ADXL 1S35A 3PUGA 5KMGP 3GMIA 2CXDA 3K8PC 4MHCA 1BR0A 2V7IA 2G0UA 3AVSA 4H63H 1D1CA 5DQVA 2HPJA 3E22E 3ETVA 3Q9DA 3LBXB 3S4UA 5LHGB 4ISSA 4TUYE 3DTOA 3O4XE 3KDSE 4NUUA 3N9LA 3SWHA 3ZC1A 5GONE 3O1HA 1WLXA 2KZ7B 3PU3A 5JR9A 3UTKA 4IGUA 5H6RB 2I59A 1FEWA 5LG4A 2KNDA 3KVBA 3ZLIA 2CA5A 3K3NA 3RKOA 4ZI7E 3RYFE 3FXDB 4QXHB 3Q5XA 2MBGA 2A2FX 4QX8B 3RC3A 4IE6A 4P0AA 2E9XC 3GN5B 3CKDA 3RYIE 4P09A 4Z8XA 5J2TE 3UT5E 4UELA 4EAHA 3N9PA 1D1BA 4J2CA 4BJMA 2H3RA 2EHOD 4U74A 3OKQA 5LOVE 1ZEEA 5LJNA 4UF0A 3C50A 2X0LB 4WW0A 1FIOA 1U5PA 2L9QA 4JEUB 1T98A 4H63V 4YJ2E 2W0GA 2XUEA 3LG7A 2VWAA 3EDUA 5DABA 2X51A 5HWXA 3K3OA 3IHRA 3LFMA 2A72A 5FNVE 2LSIA 3LK3B 1IJ5A 3TKLB 2EHOA 4H9NC 3AA6B 3C4ZA 3HKDE 4ISTA 1O3XA 4IIJE 3ZJ1A 4PJLA 4AKHA 2D0UA 3AA1B 4U72A 2PJQA 4H9RC 4X1IE 5JRCA 5L3GB 5HXRA 5JR9C 3NZQA 2C5JA 4AXPA 4KP3C 3ONXA 2JMHA 3F2EA 4OYJA 5HAXA 4OFZA 3CX7B 3ZCJA 4CQIA 2KXPB 4EYUA 4ZI2D 2HPLA 3PUSA 4B6XA 5LXTE 1WR6A 2K24A 4PK6A 3W15B 4EIWA 4WBOA 2WWUA 5BMVE 1YW0A 1MMAA 3HI2A 2E9XD 2X67A 3K3QC 2V7JA 2Z6EA 3PUAA 5F8PA 5HXSA 2ODUA 4MALA 2XASB 4X1KE 3PE0A 2IC9A 2X66A 1NWMX 4O2BE 2CXLA 3LK42 5L2LA 3KVAA 3B13A 4H9QC 4ZS3A 3WAKA 2V26A 5L3CB 3FXEB 3CX8B 2M67A 2L3LA 4QXBB 4XBFB 3H37A 1X79A 3Q2MA 5EK3A 3D0TA 3E0ZA 2DWKA 3JC6D 2UXNB 4UVAB 2IAKA 4A56A 1UX5A 2EHOC 4AQFA 3I1AA 3O1IA 5CA0E 2SPCA 2LEHA 5CB4E 3L3PA 4TV8E 4L9IA 5JDLA 4QX7B 1YD8G 2XQYA 1G8XA 3IF8B 4PK5A 5AFUL 2W00A 5FP3A 4EOZB 5HXEA 4FJOA 2EHOB 1LVKA 1UCUA 2KLQA 3RX6A 3F57A 4ZI3C 2D5UA 2GK9A 4PJJA 3V5SA 3N2GE 5EZYE 2VB6A 4GYRA 4I43B 3F31A 3RRCA 3PDYA 4GIWA 4XAXB 3ZN0B 3KV5A 1MMNA 3VKHA 2LSYA 4KMCA 2PG8A 5LBQB 5DJQC 2NP9A 4CI1B 2DI4A 5LBMA 5LP6E 3ETUA 1MNDA 2J1DG 4O4IE 1IJ6A 4HN9A 2Q9QD 2KT9A 2MTQA 5JDNA 4G2AA 2ZLYA 4ZI2C 3CMLA 3MJXA 4DO0A 5L3EB 2V7KA 3GA8A 2JMKA 4JLEA 5M4YA 3OYZA 3ANWA 4EZHA 4G63A 4ZHQE 2CCQA 2Q9QA 5J1GA 5LHIB 2MOZA 2NTXA 1LKXA 4HGAA 3RH3A 3N5LA 3AB3B 3FBLA 4AQFC 4DBRA 4TV9E 4AKIA 4DNDA 2PBIA 4O4HE 4HFVA 1UX4A 2E9XB 2CLYC 2E8IA 4L5GA 3CVRA 1QUUA 2H7OA 2X68A 3MXZA 2QGSA 3EVYA 1OXZA 3ZYMA 1FMVA 1LRZA 2RA1A 2WBLA 2P9BA 3C4XA 4YFSA 3JC6C 4DVDA 2CM0A 1EZ3A 2XTLA 3M65A 4TZ4C 4CXWA 3C4WA 3PUQA 2CLYB 4IE5A 3MKDA 4AI6A 4ZI3D 3KINB 1E1HB 2MYSA 3ZYLA 2X9XA 3UUNA 1HTJF 1D1AA 5TAOA 4L0RA 5F3JA 1AJ3A 4PW8A 1FMWA 3KV4A 1VOMA 3V5UA 3EUHA 4XZCA 4E7SA 5FXZA 2XAJB 2ZM8A 1D0ZA 2N9DA 2LSKA 3Q5WA 4H9SE 4GYSA 4PNIA 2HH7A 1MMDA 2N2NA 3CQGB 2CMRA 2KMFA 3BQKA 5KDMC 1YKHB 2CWOA 4YLHA 3MACA 4ASKA 1ZV4X 1KNZA 1US7B 2VKDA 3DJBA 4DBQA 4HE8A 4X20E 4UEMA 3R6NA 3RPUA 2ZMAA 2W61A 4NUVA 3RYHE 3UUMA 2WSSV 4AQGA 3HKCE 5JR9B 4O8SA 2D0TA 1MIVA 2CE7A 2ZM0A 2CEAA 2Q9QC 1QSDA 3N2OA 5HXHA 2V1DB 3QUJA 2C5IT 3LBXA 2CWYA 2WM9A 5FMNA 3OJAA 1HG5A 2LM9A 4QXCB 4MFRA 1HX8A 3J7Yq 4DMWA 2Q9QB 2YK0A 4EB6E 5LHHB 3CX6B 2LHRA 3CQCB 2JRKA 3MZKB 3P7IA 4O2AE 4HKAA 2VKJA 3ZJ2A 2C5KT 2LSGA 4OHFA 2LHNA 4CI3B 4HTEA 5DQWA 3NRXA 2X9WA 4UF0B 1IAPA 2NW8A 4KUMB 4TN7B 5JVDE 4EXTA 1SA0E 3WAJA 2YU2A 4PJMA 1BR1A 3ZEFB 2YINA 4IE4A 5C8YE 3H3AA 2K5BB 2LSJA 3O1JA 3GN5A 4BA9A 1H7CA 1ZKEA 3NZPA 2YU1A 3ESLA 3VHLA 3PTRB 4N78D 1WYBA 3AA0B 2XAQB 3RRWA 4ERRA 2QA7A 4IHJE 5J2UE 2DHRA 3FHNA 5LGTB 3C98B 3C64A 4QKNA 2ZM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WRD A;  2N2N A;  1WR6 A;  1NAF A;  1O3X A;  1NWM X;  1YD8 G;  1OXZ A;  1X79 A;  2N9D A; 
#chains in the Genus database with same CATH topology
 2VKH A;  5JRC B;  1D0Y A;  4YY3 T;  4HFI A;  3PUW F;  4ADZ A;  2QRX A;  4ZS2 A;  4Q25 A;  3RYC E;  2XQ9 A;  2UXD T;  2YEV C;  3VKG A;  4JEH B;  5E0O A;  5IHY A;  3T1H T;  2IHR 1;  3NKZ A;  3KBU A;  3CQX C;  2WP9 A;  4JI7 T;  5FY0 A;  1MIW A;  4UIG A;  3VR8 A;  4B3T T;  3N9O A;  2DCF A;  4P0B A;  4HWI B;  5JDH A;  1HF8 A;  3A5X A;  2LOS A;  3EHZ A;  4I50 E;  4TNW A;  2OA5 A;  4ZEY A;  1Z8U A;  2L8K A;  5FVK A;  1IZN B;  2I6H A;  3C51 A;  2K9A A;  2KWI B;  5L4H A;  4IDQ A;  3SS1 A;  2N1G A;  2NW7 A;  4LFB T;  2XQA A;  4JI1 T;  3AEF A;  5JDG A;  4AKR B;  1G73 A;  2YN6 A;  1YKE B;  5LA6 E;  2WAU A;  2WMO A;  2VAS A;  1M62 A;  4QH4 A;  5HEU A;  2XAH B;  2IML A;  3PV0 F;  5L3D B;  4JBW F;  4YHJ A;  3ZMT B;  2W62 A;  4CXY A;  4DID B;  1J1J A;  4MLK A;  2CBJ A;  5JQG E;  1VRB A;  2V7L A;  3B57 A;  2RPA A;  1XWM A;  3FB2 A;  2NWB A;  5FVL A;  1KFY A;  2YDS A;  3EDV A;  4JUY A;  1U4Q A;  1J5E T;  5EK4 A;  3N2K E;  2VK9 A;  2YOE A;  2PTF A;  3HR0 A;  3PUY F;  5KMG P;  3TLS A;  2V7I A;  3E22 E;  3ETV A;  5LHG B;  4TUY E;  1KF6 A;  5AQJ B;  3N9L A;  5LMN T;  3O1H A;  5JR9 A;  3M3Z B;  4IGU A;  3FZM B;  2CA5 A;  3RYF E;  4QH1 A;  4QXH B;  2MBG A;  3RC3 A;  3LDQ B;  1T72 A;  5ABE A;  4DR3 T;  3RYI E;  3VRB A;  3UT5 E;  2H3R A;  5J0Z A;  5LJN A;  1FIO A;  2XUE A;  3LG7 A;  2LM2 A;  1N32 T;  2K3W A;  2WY2 A;  2X51 A;  3RIF A;  3LFM A;  4U2Z A;  5FNV E;  3LK3 B;  1IJ5 A;  4Z91 A;  4DV0 T;  3C4Z A;  4IST A;  4DV6 T;  2BG9 C;  1XDO A;  3AEB A;  2LKH A;  4YTM A;  4X1I E;  1ZP0 A;  5AQF B;  4JV5 T;  5L3G B;  3EAM A;  2C5J A;  4IT4 A;  4AXP A;  4U7Y A;  4OYJ A;  4HWH A;  4EYU A;  2J4G A;  4U33 A;  4B6X A;  2W66 A;  4LF5 T;  2R6G F;  1XDP A;  4JI0 T;  3P4P A;  4HWF A;  2X67 A;  2V7J A;  5F8P A;  5HXS A;  4JI6 T;  2WCA A;  2X0H A;  3LK4 2;  4H9Q C;  4ZZB A;  5L3C B;  3FXE B;  2L3L A;  3NVO A;  3TLU A;  4XBF B;  5HEH A;  3D0T A;  4UVA B;  2IAK A;  4A56 A;  3O1I A;  2LEH A;  5AQT B;  2W00 A;  4EOZ B;  2WU2 A;  2E5V A;  3RX6 A;  3F57 A;  5HEO A;  4ZI3 C;  5AQU B;  3PDY A;  3ZN0 B;  2V6Y B;  4CI1 B;  2DL1 A;  1IBL T;  5LP6 E;  5LBM A;  1IJ6 A;  4HN9 A;  2ZLY A;  4A5X A;  1XMQ T;  3CML A;  5L3E B;  2V7K A;  2WQY A;  2UUB T;  5L47 A;  3OYZ A;  2WDQ A;  4G63 A;  2CCQ A;  1W09 A;  3AB3 B;  2WWV A;  1HNW T;  4TV9 E;  4AKI A;  4HFV A;  2E9X B;  3MXZ A;  2QGS A;  3ZYM A;  2P9B A;  4YSZ A;  4TZ4 C;  1EZ3 A;  4CXW A;  4IE5 A;  4ZI3 D;  3ZYL A;  3UUN A;  1D1A A;  5F3J A;  2WS3 A;  4E7S A;  4XZC A;  1D0Z A;  4HWD A;  2N2N A;  4HFE A;  3JAE A;  2FJA A;  1YKH B;  4YLH A;  5HEG A;  5JTG A;  3MAC A;  1ZV4 X;  1KNZ A;  1US7 B;  4LF7 T;  2VKD A;  4DBQ A;  4HE8 A;  5FKY A;  3R6N A;  3RIU A;  3RPU A;  2ZMA A;  3T1Y T;  3RYH E;  1OED B;  2D0T A;  2CE7 A;  3QOF A;  2Q9Q C;  2V1D B;  1R8I A;  1HX8 A;  3J7Y q;  2B76 A;  4EB6 E;  5LHH B;  3P7I A;  4YHH T;  3EAB A;  2VKJ A;  2LSG A;  4HTE A;  5DQW A;  1IAP A;  2NW8 A;  1XNQ T;  1SA0 E;  5CFB A;  3NWI A;  1H7C A;  4LMJ A;  3NZP A;  4KX6 A;  3RLF F;  5F5W A;  1WYB A;  4YSX A;  2XQ7 A;  4A98 A;  4X5T A;  5J2U E;  5LGT B;  2ZM2 A;  3TLT A;  4AKL A;  2H88 A;  4B3S T;  5AQH B;  1CHU A;  3ZMS B;  2BZB A;  3ZST A;  4AIU A;  2RP4 A;  3K1S A;  1YQ4 A;  3AA7 B;  3QK6 A;  4IDP A;  1ZOY A;  4ILA A;  2CHN A;  3NBX X;  4U2Y A;  5FXX A;  3U78 A;  1WR0 A;  2K48 A;  4AKG A;  4UXN B;  4LF9 T;  3P4S A;  4QWN B;  2V7M A;  4I55 E;  2UXB T;  5JDM A;  1WCR A;  4C91 A;  2Y8D A;  4COF A;  4DV3 T;  3UU3 A;  4U7I A;  3AE2 A;  1MIY A;  3AE7 A;  3RI5 A;  4EGW A;  1WYC A;  2V6X A;  4CI2 B;  1OWA A;  3LK2 B;  3AAA B;  3SRZ A;  4CXX A;  3L09 A;  3PUX F;  5ETW A;  2LRL A;  4WYV A;  4E7Z A;  1NAF A;  3N9Q A;  5FY1 A;  3I9W A;  3IBP A;  2XAG B;  2LE8 A;  4OK0 A;  2IDO B;  1S94 A;  3ANW B;  3JAD A;  1HR0 T;  4QH5 A;  4IE0 A;  5C3J A;  2IUB A;  1IBM T;  2XHE B;  4IE7 A;  3Q5E A;  3FZK B;  4UR9 A;  4KHZ F;  1D0X A;  5A1L A;  5L3B B;  2BS4 A;  3I0O A;  4TWF A;  4WNK A;  3HKE E;  4DV2 T;  3E08 A;  4KBM B;  3LSV A;  5LCY A;  5LGN B;  3ZYK A;  4DR6 T;  4EYY R;  1SHZ C;  5FL1 A;  3A8Y C;  1HG2 A;  2AE9 A;  3HA4 A;  4JI4 T;  5JDQ A;  3PUG A;  5AQQ B;  3GMI A;  2CXD A;  3K8P C;  3AVS A;  5DQV A;  4YT0 A;  1GQE A;  3Q9D A;  2F4V T;  3LBX B;  2OLT A;  4LF6 T;  4NUU A;  2OV9 A;  2KZ7 B;  3PU3 A;  4JI2 T;  4LFC T;  2I59 A;  1FEW A;  1W9R A;  3RKO A;  2VVN A;  2A2F X;  4P0A A;  2E9X C;  1KNP A;  3L8R A;  4UEL A;  4AQY T;  1D1B A;  4BJM A;  4U74 A;  2XM2 A;  1W0A A;  4ILB A;  3EDU A;  3IHR A;  2A72 A;  2XQ8 A;  2LSI A;  2UU9 T;  2EHO A;  1O3X A;  2WZI A;  3AA1 B;  2PJQ A;  5HXR A;  1OED C;  3PJA J;  4KP3 C;  3ONX A;  2JMH A;  5HAX A;  5AQP B;  2KXP B;  2V5D A;  5C2T A;  1WR6 A;  2K24 A;  4PK6 A;  4EIW A;  2IIU A;  4WBO A;  2W4X A;  5BMV E;  4YSY A;  2E9X D;  3JAF A;  2Z6E A;  2ODU A;  3KVA A;  4ZS3 A;  3WAK A;  2BS3 A;  4QXB B;  3Q2M A;  3E0Z A;  3JC6 D;  2DWK A;  1N36 T;  4AQF A;  5CA0 E;  3Q5D A;  5CB4 E;  4TV8 E;  4QX7 B;  3IF8 B;  4PK5 A;  3UQ4 A;  5FP3 A;  2XM1 A;  2EHO B;  2KLQ A;  3UU6 A;  2GK9 A;  3AXJ A;  5EZY E;  3RRC A;  4I43 B;  4GIW A;  3KV5 A;  2LSY A;  4X62 T;  4DR2 T;  2NP9 A;  2FJE A;  2DI4 A;  2J1D G;  5JDN A;  1VCS A;  3MJX A;  4JLE A;  4JYA T;  2NTX A;  3FBL A;  4DND A;  4O4H E;  3AE1 A;  1UX4 A;  5KXJ A;  2CLY C;  1OXZ A;  1FMV A;  2QYW A;  3M65 A;  3C4W A;  3TLV A;  4AI6 A;  2MYS A;  2X9X A;  1HTJ F;  1AJ3 A;  2CHO A;  1FMW A;  3V5U A;  3EUH A;  5FXZ A;  4ZXL A;  2VQF T;  2XQ6 A;  3ABV A;  3AXJ B;  2LSK A;  2M6I A;  3CQG B;  3BQK A;  2CWO A;  2X0Y A;  3UUM A;  2WB5 A;  5JR9 B;  3HKC E;  2E2A A;  2CEA A;  1QSD A;  1L0V A;  1KEY A;  2LHR A;  2JRK A;  4TWD A;  3ZJ2 A;  4IDO A;  2X9W A;  3WAJ A;  1BR1 A;  3ZEF B;  2YIN A;  2LSJ A;  3O1J A;  3GN5 A;  3VHL A;  3PTR B;  4JI3 T;  1YQ3 A;  1XMO T;  3RRW A;  4ERR A;  2QA7 A;  4IHJ E;  2NR4 A;  3C64 A;  3KV9 A;  3TLW A;  4M1P A;  2D2S A;  3GWH A;  3CPZ A;  3O9X A;  1J5W A;  5HXC A;  4U31 A;  4X64 T;  1FJG T;  2B1E A;  5JRE A;  4K0K T;  2X9H A;  2ZM6 T;  4IRE A;  4HEA A;  3ZMV B;  1E7P A;  3BQL A;  5H6Q B;  2CXF A;  3JCF A;  2NTY A;  3FBZ A;  2C0S A;  3OTO T;  3MA9 A;  5AQO B;  3AE6 A;  2VKO A;  3P4R A;  3ZC0 A;  4GK5 E;  1CUN A;  3SOL A;  2J47 A;  4O4L E;  2Y6X A;  3VU7 H;  4O4J E;  3B5M A;  1MMG A;  2BBH A;  2DWG A;  2ODV A;  3HL6 A;  3UUL A;  3I0Q A;  5JDF A;  3IEE A;  3ZCI A;  3RC8 A;  1UGO A;  3BQI A;  1Y64 B;  4TX5 A;  2JPF A;  5IYZ E;  5EK2 A;  2BKO A;  5FYM A;  5L3F B;  5LGU B;  2W2U A;  2DNX A;  5AQL B;  3AE8 A;  2LJL A;  2X9Y A;  2KWH A;  4NPP A;  1WRD A;  4TWH A;  3HKB E;  3OYX A;  5LYJ E;  4HWC A;  1NEK A;  2H7V C;  2IW5 B;  1HS7 A;  3DP7 A;  2IC6 A;  3LJC A;  3NRY A;  4X65 T;  3PUR A;  3AVR A;  5FXV A;  4EZ4 A;  3RGL A;  4UVB B;  4UV9 B;  3PUZ F;  3KBT A;  4PFO A;  1ZHC A;  2LOP A;  3UU5 A;  3ZPO A;  4ILU A;  5LNK A;  2I0M A;  4GOU A;  4GKJ T;  4WZX A;  4BAY B;  3AAI A;  4PJN A;  4C90 A;  3ZN1 B;  4ZZC A;  1B7T A;  1Z0P A;  4QHO A;  5FY7 A;  2A3D A;  5HWY A;  1KK7 A;  2AXD S;  4PAG A;  3AAE B;  3J9X 1;  3OBV E;  5KX5 E;  2UXX B;  2LT3 A;  4HFD A;  5ADX L;  5ABF A;  1BR0 A;  2G0U A;  3AE5 A;  1D1C A;  1JNZ A;  2HPJ A;  2BG9 A;  4ISS A;  3ONL C;  2BKN A;  3ZC1 A;  1WLX A;  2J62 A;  1X9B A;  5H6R B;  5LG4 A;  2KND A;  4A97 A;  4QX8 B;  4IE6 A;  3ZT7 A;  3CKD A;  4Z8X A;  5J2T E;  2XZE A;  2FUP A;  3N9P A;  4J2C A;  2EHO D;  4IDN A;  5LOV E;  5CGM A;  4UF0 A;  3C50 A;  2X0L B;  4JEU B;  1T98 A;  2XSA A;  2VWA A;  1I6Z A;  3TKL B;  4H9N C;  3HKD E;  3ZJ1 A;  5AQV B;  4PJL A;  4AKH A;  2D0U A;  4U72 A;  4EEB A;  1N33 T;  5ABF B;  2VL0 A;  4U3C A;  1SE7 A;  5JRC A;  5JR9 C;  3NZQ A;  3F2E A;  3ZCJ A;  4ZI2 D;  5ABH A;  2HPL A;  2FBW A;  3RQU A;  5LXT E;  3AEA A;  2WWU A;  1YW0 A;  2CBI A;  4LML A;  2V5C A;  4MAL A;  2XAS B;  4X1K E;  2IC9 A;  2X66 A;  5L2L A;  3B13 A;  2V26 A;  2M67 A;  2HN1 A;  1X79 A;  5EK3 A;  2UXN B;  4X66 T;  3SFD A;  3L3P A;  2XPK A;  5AQS B;  5AFU L;  3G06 A;  1XZY A;  5HXE A;  4FJO A;  1LVK A;  1T8B A;  1HX1 B;  3AEG A;  1UCU A;  3AE4 A;  2D5U A;  2MPK A;  4PJJ A;  3V5S A;  3N2G E;  2VB6 A;  4GYR A;  2HN2 A;  3VKH A;  5LBQ B;  5DJQ C;  4DV7 T;  3OVU A;  2H89 A;  5HCJ A;  1MND A;  2WDV A;  5M4Y A;  4EZH A;  5LMU T;  1T7S A;  2WZH A;  2Q9Q A;  5J1G A;  2MOZ A;  1LKX A;  4HGA A;  3N5L A;  2VUR A;  2FJB A;  2E8I A;  4L5G A;  1QUU A;  3C4X A;  2RA1 A;  2WBL A;  4YFS A;  4DVD A;  3JC6 C;  3PUQ A;  2UUC T;  4HFB A;  4CN4 A;  3KIN B;  3RKG A;  5L4E A;  2XAJ B;  3P4W A;  5AQN B;  5HEJ A;  2KMF A;  5KDM C;  2FJD A;  2CRB A;  3DJB A;  2W61 A;  4NUV A;  4AQG A;  3UFG A;  4O8S A;  1MIV A;  2V8S V;  2ZM0 A;  3ZT6 A;  5HXH A;  2YDQ A;  3QUJ A;  2C5I T;  1HG5 A;  2LM9 A;  3ZSS A;  2Q9Q B;  2YK0 A;  4DV5 T;  1XNR T;  3CQC B;  3MZK B;  4O2A E;  4DUZ T;  2C5K T;  2LHN A;  4CI3 B;  3NRX A;  5JVD E;  4EXT A;  4JI8 T;  2YKS A;  5C8Y E;  3H3A A;  2K5B B;  4BA9 A;  5CJ5 A;  1ZKE A;  2YU1 A;  3ESL A;  2UUA T;  3A7M A;  4HFC A;  4QKN A;  4GYS A;  2JIW A;  4Z90 A;  3RIU C;  4I4T E;  4UVC B;  2DLR A;  5AQI B;  4YJ3 E;  5FXW A;  1UK5 A;  1VCT A;  3R84 B;  4LMK A;  4V1A v;  5HYA A;  2QVA A;  3I9Y A;  3ZMZ B;  1BR2 A;  1LVF A;  4ANJ A;  3UU8 A;  3UQ7 A;  2XY8 B;  3RIA A;  2VQE T;  4BJN A;  4B3R T;  4JI5 T;  1V9D A;  2BVM A;  1MNE A;  5AQR B;  5ABG A;  2ACZ A;  4YTN A;  2BDE A;  3QC9 A;  3AE9 A;  2W63 A;  4GKK T;  5JH7 E;  2KIN B;  3MK7 C;  3FZL B;  4UV8 B;  1BR4 A;  2W67 A;  2LRK A;  2PFV A;  4H9O C;  4F8H A;  2XJ7 A;  4CZZ B;  2WDR A;  3AEC A;  3AE3 A;  5LJM A;  3ZT5 A;  2NW9 A;  2LLY A;  3UFE A;  2XAF B;  5CA1 E;  4PK4 A;  4LF4 T;  4B3M T;  4K0U A;  3L39 A;  3KFW X;  4IDZ A;  2JQH A;  2V6Y A;  3UUX B;  4WBN E;  3RF1 A;  4DR1 T;  2E5L T;  2Y48 B;  2NOX A;  3CK6 A;  2WMN A;  3T8O A;  4GK0 E;  3P8C D;  3N9N A;  4FI5 A;  3BK9 A;  3EI0 A;  4OYK A;  4PFP A;  4H9P C;  3FZF B;  3ZMU B;  4F6R C;  3FZH B;  2ACX A;  3CWZ B;  4X1Y E;  1N34 T;  2XSB A;  4ZOL E;  4MBQ A;  1YXR A;  2ES0 A;  2JJ9 A;  5AQM B;  3U3I A;  2E9X A;  3WI3 A;  2VL8 A;  4TNV A;  1HFA A;  2JQQ A;  2BVL A;  1DU2 A;  3KV6 A;  3N9M A;  1HCI A;  3PU8 A;  4DMV A;  3P50 A;  1S35 A;  4MHC A;  4H63 H;  2A9U A;  4DV1 T;  3S4U A;  3DTO A;  3OPC A;  4I0U A;  3O4X E;  3KDS E;  4ILC A;  3PJA A;  3SWH A;  5GON E;  3UTK A;  1OED A;  3X1D A;  2JQK A;  2XQ4 A;  3PUV F;  3KVB A;  3ZLI A;  3K3N A;  4ZI7 E;  3FXD B;  3Q5X A;  4IL4 A;  2LKG A;  2CPT A;  4AIS A;  3GN5 B;  4P09 A;  3RQW A;  4NXN T;  2D9D A;  1OED E;  3SFE A;  4EAH A;  4P1N A;  2YDR A;  3OKQ A;  1ZEE A;  4WW0 A;  1U5P A;  2L9Q A;  4YJ2 E;  4H63 V;  2W0G A;  5DAB A;  5HWX A;  3K3O A;  1SUM B;  4DR5 T;  3AA6 B;  4IIJ E;  5LB7 B;  4LF8 T;  3AEE A;  4H9R C;  4CN1 A;  1Y01 A;  3CIR A;  4IL9 A;  2KSR A;  3H3M A;  4OFZ A;  3CX7 B;  4CQI A;  3PUS A;  4NIQ A;  3W15 B;  2BKP A;  3ONJ A;  3VR9 A;  1MMA A;  3HI2 A;  5HCM A;  3K3Q C;  3PUA A;  1W0B A;  1I94 T;  3PE0 A;  3QB5 A;  3ZKR A;  1IBK T;  1UUR A;  1NWM X;  4O2B E;  2CXL A;  3CX8 B;  3H37 A;  1UX5 A;  2EHO C;  1QLB A;  4DUY T;  4LFA T;  3I1A A;  2UXC T;  2SPC A;  4L9I A;  5JDL A;  1YD8 G;  5AQG B;  2MAW A;  1G8X A;  2XQY A;  5IWA T;  3VRA A;  1E2A A;  4KHP T;  1JNR A;  3P4Q A;  4EV6 A;  3F31 A;  2BBJ A;  4XAX B;  3AED A;  2BS2 A;  4YTP A;  5BR8 T;  1MMN A;  4KMC A;  4YXD A;  2PG8 A;  4CN6 A;  3QNU A;  3ETU A;  4O4I E;  2Q9Q D;  2KT9 A;  2MTQ A;  4G2A A;  4ZI2 C;  1UUS A;  4DO0 A;  3GA8 A;  2JMK A;  2BG9 E;  3ANW A;  4ZHQ E;  3RHW A;  3UUB A;  5LHI B;  2HHH T;  4DR4 T;  3UU4 A;  3RH3 A;  4AQF C;  2M6B A;  4DBR A;  4HFH A;  2PBI A;  4EED A;  3IA3 A;  3CVR A;  5AQK B;  2H7O A;  2X68 A;  3EVY A;  1LRZ A;  1M7K A;  2CM0 A;  2XTL A;  2CLY B;  3MKD A;  1E1H B;  5TAO A;  4L0R A;  4PW8 A;  3KV4 A;  1VOM A;  5IUX A;  2ZM8 A;  5LG3 A;  2N9D A;  4PNI A;  3Q5W A;  4H9S E;  2HH7 A;  1MMD A;  2CMR A;  2WU5 A;  2BG9 B;  1HNX T;  4ASK A;  4X20 E;  4UEM A;  1WFD A;  2WSS V;  2VVS A;  3N2O A;  3LBX A;  2CWY A;  2WM9 A;  5FMN A;  3OJA A;  1NEN A;  2JQ9 A;  4QXC B;  4MFR A;  4DMW A;  3CX6 B;  4HKA A;  4NXM T;  4OHF A;  4KI0 F;  4UF0 B;  2XQ3 A;  4KUM B;  4TN7 B;  1KNR A;  2YU2 A;  4PJM A;  4IE4 A;  5FL0 A;  4N78 D;  1HNZ T;  4DV4 T;  3AA0 B;  2XAQ B;  4DR7 T;  2DHR A;  3FHN A;  3C98 B;  3QB5 K;  4OX9 T;  2XQ5 A; 
#chains in the Genus database with same CATH homology
 2VKH A;  4I4T E;  4UVC B;  3KV9 A;  4AKL A;  5JRC B;  2DLR A;  1D0Y A;  4M1P A;  2D2S A;  3GWH A;  4YJ3 E;  3CPZ A;  3O9X A;  5FXW A;  5HXC A;  4ADZ A;  3R84 B;  3ZMS B;  2B1E A;  5JRE A;  2X9H A;  2BZB A;  4V1A v;  4ZS2 A;  5HYA A;  4HEA A;  3RYC E;  3ZMV B;  3BQL A;  3I9Y A;  5H6Q B;  2YEV C;  2CXF A;  3VKG A;  3ZMZ B;  2NTY A;  3FBZ A;  1BR2 A;  2RP4 A;  4JEH B;  2C0S A;  5E0O A;  1LVF A;  3MA9 A;  5IHY A;  4ANJ A;  2VKO A;  3AA7 B;  3QK6 A;  3ZC0 A;  3KBU A;  4GK5 E;  3CQX C;  1CUN A;  3SOL A;  3NBX X;  4O4L E;  4BJN A;  2Y6X A;  5FXX A;  3VU7 H;  4O4J E;  3U78 A;  1MMG A;  1V9D A;  2BVM A;  2K48 A;  5FY0 A;  1MNE A;  4AKG A;  4UXN B;  2DWG A;  1MIW A;  4QWN B;  4UIG A;  2V7M A;  2ODV A;  3HL6 A;  3N9O A;  3UUL A;  2BDE A;  3I0Q A;  2DCF A;  3QC9 A;  4P0B A;  4I55 E;  5JDF A;  3IEE A;  3ZCI A;  1HF8 A;  2W63 A;  5JDH A;  5JDM A;  4C91 A;  2Y8D A;  3RC8 A;  5JH7 E;  3A5X A;  2LOS A;  1MIY A;  2KIN B;  4I50 E;  3MK7 C;  2OA5 A;  1BR4 A;  1WYC A;  3BQI A;  4UV8 B;  1Y64 B;  2L8K A;  4TX5 A;  2JPF A;  1IZN B;  1OWA A;  5IYZ E;  4CI2 B;  3C51 A;  5EK2 A;  2PFV A;  2K9A A;  5FYM A;  3LK2 B;  3AAA B;  2KWI B;  4H9O C;  3SRZ A;  5L3F B;  5LGU B;  4CZZ B;  4CXX A;  3SS1 A;  2DNX A;  3L09 A;  2N1G A;  2NW7 A;  5LJM A;  2LJL A;  2X9Y A;  2NW9 A;  5ETW A;  2KWH A;  3UFE A;  1WRD A;  4E7Z A;  1NAF A;  3HKB E;  2XAF B;  3OYX A;  4PK4 A;  3N9Q A;  5CA1 E;  5FY1 A;  5LYJ E;  2H7V C;  4K0U A;  5JDG A;  3I9W A;  3KFW X;  4IDZ A;  4AKR B;  3IBP A;  2XAG B;  1G73 A;  2LE8 A;  4OK0 A;  2IW5 B;  1HS7 A;  3UUX B;  1S94 A;  4WBN E;  3ANW B;  1YKE B;  3DP7 A;  5LA6 E;  2WAU A;  2WMO A;  2VAS A;  2Y48 B;  2IC6 A;  2NOX A;  3LJC A;  3NRY A;  2XAH B;  3PUR A;  3AVR A;  5FXV A;  2WMN A;  3T8O A;  4GK0 E;  5L3D B;  3P8C D;  4EZ4 A;  4IE0 A;  3N9N A;  4YHJ A;  4FI5 A;  4UVB B;  3ZMT B;  3BK9 A;  4UV9 B;  2W62 A;  4CXY A;  2XHE B;  4IE7 A;  4OYK A;  3KBT A;  4PFP A;  4H9P C;  4PFO A;  1ZHC A;  4MLK A;  3ZMU B;  5JQG E;  2LOP A;  4F6R C;  1VRB A;  1D0X A;  2V7L A;  3B57 A;  2ACX A;  5A1L A;  3ZPO A;  3CWZ B;  5L3B B;  4ILU A;  4X1Y E;  5LNK A;  4GOU A;  3FB2 A;  3I0O A;  4ZOL E;  4BAY B;  3AAI A;  2ES0 A;  4MBQ A;  2JJ9 A;  4PJN A;  3U3I A;  2E9X A;  4WNK A;  4C90 A;  3ZN1 B;  2NWB A;  3HKE E;  3WI3 A;  1B7T A;  2VL8 A;  1Z0P A;  3EDV A;  3E08 A;  4JUY A;  1U4Q A;  4KBM B;  1HFA A;  2JQQ A;  2BVL A;  4QHO A;  5FY7 A;  2A3D A;  5HWY A;  1KK7 A;  5LCY A;  5LGN B;  4PAG A;  3AAE B;  3KV6 A;  5EK4 A;  3N9M A;  3ZYK A;  4EYY R;  3J9X 1;  3N2K E;  1HCI A;  1SHZ C;  2VK9 A;  3OBV E;  1HG2 A;  3PU8 A;  4DMV A;  5KX5 E;  2UXX B;  3HA4 A;  3HR0 A;  2LT3 A;  5JDQ A;  5ADX L;  1S35 A;  3PUG A;  5KMG P;  3GMI A;  2CXD A;  3K8P C;  4MHC A;  1BR0 A;  2V7I A;  2G0U A;  3AVS A;  4H63 H;  1D1C A;  5DQV A;  2HPJ A;  3E22 E;  3ETV A;  3Q9D A;  3LBX B;  3S4U A;  5LHG B;  4ISS A;  4TUY E;  3DTO A;  3O4X E;  3KDS E;  4NUU A;  3N9L A;  3SWH A;  3ZC1 A;  5GON E;  3O1H A;  1WLX A;  2KZ7 B;  3PU3 A;  5JR9 A;  3UTK A;  4IGU A;  5H6R B;  2I59 A;  1FEW A;  5LG4 A;  2KND A;  3KVB A;  3ZLI A;  2CA5 A;  3K3N A;  3RKO A;  4ZI7 E;  3RYF E;  3FXD B;  4QXH B;  3Q5X A;  2MBG A;  2A2F X;  4QX8 B;  3RC3 A;  4IE6 A;  4P0A A;  2E9X C;  3GN5 B;  3CKD A;  3RYI E;  4P09 A;  4Z8X A;  5J2T E;  3UT5 E;  4UEL A;  4EAH A;  3N9P A;  1D1B A;  4J2C A;  4BJM A;  2H3R A;  2EHO D;  4U74 A;  3OKQ A;  5LOV E;  1ZEE A;  5LJN A;  4UF0 A;  3C50 A;  2X0L B;  4WW0 A;  1FIO A;  1U5P A;  2L9Q A;  4JEU B;  1T98 A;  4H63 V;  4YJ2 E;  2W0G A;  2XUE A;  3LG7 A;  2VWA A;  3EDU A;  5DAB A;  2X51 A;  5HWX A;  3K3O A;  3IHR A;  3LFM A;  2A72 A;  5FNV E;  2LSI A;  3LK3 B;  1IJ5 A;  3TKL B;  2EHO A;  4H9N C;  3AA6 B;  3C4Z A;  3HKD E;  4IST A;  1O3X A;  4IIJ E;  3ZJ1 A;  4PJL A;  4AKH A;  2D0U A;  3AA1 B;  4U72 A;  2PJQ A;  4H9R C;  4X1I E;  5JRC A;  5L3G B;  5HXR A;  5JR9 C;  3NZQ A;  2C5J A;  4AXP A;  4KP3 C;  3ONX A;  2JMH A;  3F2E A;  4OYJ A;  5HAX A;  4OFZ A;  3CX7 B;  3ZCJ A;  4CQI A;  2KXP B;  4EYU A;  4ZI2 D;  2HPL A;  3PUS A;  4B6X A;  5LXT E;  1WR6 A;  2K24 A;  4PK6 A;  3W15 B;  4EIW A;  4WBO A;  2WWU A;  5BMV E;  1YW0 A;  1MMA A;  3HI2 A;  2E9X D;  2X67 A;  3K3Q C;  2V7J A;  2Z6E A;  3PUA A;  5F8P A;  5HXS A;  2ODU A;  4MAL A;  2XAS B;  4X1K E;  3PE0 A;  2IC9 A;  2X66 A;  1NWM X;  4O2B E;  2CXL A;  3LK4 2;  5L2L A;  3KVA A;  3B13 A;  4H9Q C;  4ZS3 A;  3WAK A;  2V26 A;  5L3C B;  3FXE B;  3CX8 B;  2M67 A;  2L3L A;  4QXB B;  4XBF B;  3H37 A;  1X79 A;  3Q2M A;  5EK3 A;  3D0T A;  3E0Z A;  2DWK A;  3JC6 D;  2UXN B;  4UVA B;  2IAK A;  4A56 A;  1UX5 A;  2EHO C;  4AQF A;  3I1A A;  3O1I A;  5CA0 E;  2SPC A;  2LEH A;  5CB4 E;  3L3P A;  4TV8 E;  4L9I A;  5JDL A;  4QX7 B;  1YD8 G;  2XQY A;  1G8X A;  3IF8 B;  4PK5 A;  5AFU L;  2W00 A;  5FP3 A;  4EOZ B;  5HXE A;  4FJO A;  2EHO B;  1LVK A;  1UCU A;  2KLQ A;  3RX6 A;  3F57 A;  4ZI3 C;  2D5U A;  2GK9 A;  4PJJ A;  3V5S A;  3N2G E;  5EZY E;  2VB6 A;  4GYR A;  4I43 B;  3F31 A;  3RRC A;  3PDY A;  4GIW A;  4XAX B;  3ZN0 B;  3KV5 A;  1MMN A;  3VKH A;  2LSY A;  4KMC A;  2PG8 A;  5LBQ B;  5DJQ C;  2NP9 A;  4CI1 B;  2DI4 A;  5LBM A;  5LP6 E;  3ETU A;  1MND A;  2J1D G;  4O4I E;  1IJ6 A;  4HN9 A;  2Q9Q D;  2KT9 A;  2MTQ A;  5JDN A;  4G2A A;  2ZLY A;  4ZI2 C;  3CML A;  3MJX A;  4DO0 A;  5L3E B;  2V7K A;  3GA8 A;  2JMK A;  4JLE A;  5M4Y A;  3OYZ A;  3ANW A;  4EZH A;  4G63 A;  4ZHQ E;  2CCQ A;  2Q9Q A;  5J1G A;  5LHI B;  2MOZ A;  2NTX A;  1LKX A;  4HGA A;  3RH3 A;  3N5L A;  3AB3 B;  3FBL A;  4AQF C;  4DBR A;  4TV9 E;  4AKI A;  4DND A;  2PBI A;  4O4H E;  4HFV A;  1UX4 A;  2E9X B;  2CLY C;  2E8I A;  4L5G A;  3CVR A;  1QUU A;  2H7O A;  2X68 A;  3MXZ A;  2QGS A;  3EVY A;  1OXZ A;  3ZYM A;  1FMV A;  1LRZ A;  2RA1 A;  2WBL A;  2P9B A;  3C4X A;  4YFS A;  3JC6 C;  4DVD A;  2CM0 A;  1EZ3 A;  2XTL A;  3M65 A;  4TZ4 C;  4CXW A;  3C4W A;  3PUQ A;  2CLY B;  4IE5 A;  3MKD A;  4AI6 A;  4ZI3 D;  3KIN B;  1E1H B;  2MYS A;  3ZYL A;  2X9X A;  3UUN A;  1HTJ F;  1D1A A;  5TAO A;  4L0R A;  5F3J A;  1AJ3 A;  4PW8 A;  1FMW A;  3KV4 A;  1VOM A;  3V5U A;  3EUH A;  4XZC A;  4E7S A;  5FXZ A;  2XAJ B;  2ZM8 A;  1D0Z A;  2N9D A;  2LSK A;  3Q5W A;  4H9S E;  4GYS A;  4PNI A;  2HH7 A;  1MMD A;  2N2N A;  3CQG B;  2CMR A;  2KMF A;  3BQK A;  5KDM C;  1YKH B;  2CWO A;  4YLH A;  3MAC A;  4ASK A;  1ZV4 X;  1KNZ A;  1US7 B;  2VKD A;  3DJB A;  4DBQ A;  4HE8 A;  4X20 E;  4UEM A;  3R6N A;  3RPU A;  2ZMA A;  2W61 A;  4NUV A;  3RYH E;  3UUM A;  2WSS V;  4AQG A;  3HKC E;  5JR9 B;  4O8S A;  2D0T A;  1MIV A;  2CE7 A;  2ZM0 A;  2CEA A;  2Q9Q C;  1QSD A;  3N2O A;  5HXH A;  2V1D B;  3QUJ A;  2C5I T;  3LBX A;  2CWY A;  2WM9 A;  5FMN A;  3OJA A;  1HG5 A;  2LM9 A;  4QXC B;  4MFR A;  1HX8 A;  3J7Y q;  4DMW A;  2Q9Q B;  2YK0 A;  4EB6 E;  5LHH B;  3CX6 B;  2LHR A;  3CQC B;  2JRK A;  3MZK B;  3P7I A;  4O2A E;  4HKA A;  2VKJ A;  3ZJ2 A;  2C5K T;  2LSG A;  4OHF A;  2LHN A;  4CI3 B;  4HTE A;  5DQW A;  3NRX A;  2X9W A;  4UF0 B;  1IAP A;  2NW8 A;  4KUM B;  4TN7 B;  5JVD E;  4EXT A;  1SA0 E;  3WAJ A;  2YU2 A;  4PJM A;  1BR1 A;  3ZEF B;  2YIN A;  4IE4 A;  5C8Y E;  3H3A A;  2K5B B;  2LSJ A;  3O1J A;  3GN5 A;  4BA9 A;  1H7C A;  1ZKE A;  3NZP A;  2YU1 A;  3ESL A;  3VHL A;  3PTR B;  4N78 D;  1WYB A;  3AA0 B;  2XAQ B;  3RRW A;  4ERR A;  2QA7 A;  4IHJ E;  5J2U E;  2DHR A;  3FHN A;  5LGT B;  3C98 B;  3C64 A;  4QKN A;  2ZM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...