1NWMX

Gat domain of human gga1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
112
structure length
105
Chain Sequence
b'LRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the GAT domain of human GGA1: a syntaxin amino-terminal domain fold in an endosomal trafficking adaptor.
pubmed doi rcsb
molecule keywords ADP-ribosylation factor binding protein GGA1
source organism Homo sapiens
molecule tags Protein transport
total genus 44
structure length 105
sequence length 112
ec nomenclature
pdb deposition date 2003-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03127 GAT GAT domain
X PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1nwmX00
1YD8G 1X79A 1OXZA 1O3XA 1NAFA 1NWMX 1WR6A 2N9DA 2N2NA 1WRDA
chains in the Genus database with same CATH superfamily
4XBFB 1XWMA 5HCMA 3K3QC 3PUQA 1UUSA 5CA0E 4YLHA 3I0QA 2E8IA 3A8YC 4G63A 1YW0A 1HG5A 2XQ3A 5LYJE 4HFBA 4PFOA 3KDSE 2VVSA 2LM2A 3E08A 2E9XA 3FXDB 4JEHB 4MBQA 3RH3A 4UVCB 2JPFA 1KF6A 3CX6B 2V7IA 2E9XD 3LBXA 3T8OA 4X1IE 1IAPA 3BK9A 3P4QA 2NTXA 4JI8T 2V26A 2UXNB 3ANWA 3U78A 1BR1A 2UU9T 2LT3A 4KBMB 4IT4A 2L3LA 3RGLA 4DV1T 2V5DA 3OJAA 4IDZA 4DV4T 4IREA 3E22E 2BVMA 3DTOA 3QK6A 4PJMA 3T1HT 3MJXA 4MFRA 1BR0A 5HYAA 2QYWA 3KV4A 2JIWA 2KWIB 3AVSA 5AQPB 3WI3A 2CBJA 1OEDB 4JI5T 5JDQA 5LHHB 2K48A 3UFEA 2YN6A 2VKOA 4DV0T 2UXDT 3AE9A 5L3DB 3GWHA 1XMOT 1HF8A 4KMCA 3ZT5A 5LG3A 2ZM0A 1FMVA 4COFA 3ZSTA 5HWXA 2ACXA 1XNQT 5LJMA 2VQET 4DV6T 3DP7A 3ESLA 4M1PA 1B7TA 3UT5E 4NUUA 5LA6E 1QSDA 3G06A 4TNVA 4PJLA 4AQFC 4GYRA 3ZCJA 4ERRA 4ILUA 4LFAT 3UFGA 3CX8B 3N9LA 3BQIA 4YJ2E 4IDQA 3VR9A 1YKEB 2VK9A 3EHZA 4PJJA 1ZHCA 5EZYE 4BAYB 2LHRA 1Z0PA 2BG9A 5HXEA 2E9XB 4DIDB 4HGAA 4EEBA 3RIFA 3LBXB 4HN9A 2UUBT 4UF0A 2XUEA 2FUPA 2YU2A 1H7CA 3ANWB 5LMNT 2PBIA 4ADZA 2LSKA 2ZM2A 1W9RA 3RKGA 3EI0A 5LXTE 1UURA 4AKGA 3PUXF 1J5WA 1G8XA 1WYCA 3IF8B 3EDUA 3CQGB 3UU3A 5L3FB 4DMWA 4U74A 4ASKA 4CN4A 3ZMTB 2C5IT 3RYHE 1W0AA 3L3PA 3LDQB 4YSXA 2JQHA 2WB5A 3F31A 1U5PA 5AFUL 2XZEA 3P4SA 3AEBA 2D2SA 4GK5E 2X9XA 3B57A 2V6YA 2LRKA 3F2EA 3TKLB 3HKDE 3UQ4A 2W62A 5KXJA 2H7OA 1HCIA 4IE5A 3A5XA 4TNWA 4UV8B 4PJNA 1KEYA 2WWUA 2D9DA 5IYZE 2WZHA 4KHZF 2YDRA 4HWCA 3HKBE 2CBIA 3M3ZB 3KBTA 1M62A 2LSGA 3N2KE 5LP6E 3JADA 4X64T 3Q5EA 3RQUA 3PUVF 5KX5E 2MBGA 3Q5DA 4LFBT 2W67A 2H89A 3VRBA 2FJDA 3L39A 3P8CD 2A3DA 2H3RA 5HEUA 2G0UA 2NOXA 4ZZBA 3FXEB 2Q9QA 2L8KA 5FXXA 3IA3A 4JI6T 5JVDE 2X9YA 5IUXA 3MZKB 2BG9B 1X79A 3RKOA 4YTMA 2Q9QD 5AQLB 4LF5T 5L4HA 4O4HE 4YT0A 2X0YA 4X66T 4U72A 4UF0B 3IHRA 1Y01A 3AXJA 3AAEB 2IDOB 3CIRA 2ODVA 3UU8A 1HFAA 4EXTA 3TLSA 3GN5A 1GQEA 3V5UA 4EGWA 5FMNA 4DR4T 5FL0A 2W61A 2V7JA 1D0ZA 5AQKB 2JQ9A 4QHOA 2V7KA 3T1YT 1HNXT 2PTFA 3ZCIA 2XQ6A 3AE3A 2CRBA 3NBXX 4QXCB 4IE7A 3VU7H 1JNZA 2X51A 3ZEFB 5LBQB 2V6YB 2CWYA 2FJAA 1WR0A 4QXBB 3N9NA 4ZZCA 3ZT6A 5L3EB 3UTKA 3RC3A 4TX5A 1YQ3A 2DNXA 2V7LA 2X9HA 4OYKA 3PUGA 2HPLA 3ZMUB 3EABA 4CXWA 3FZLB 4JI7T 3HKCE 3R6NA 2BS3A 3AEDA 3QB5K 1NAFA 1MIVA 1ZOYA 5HEJA 3KVAA 4K0KT 5AQTB 2XQ4A 2XQAA 5L3GB 4X62T 3J9X1 1MMNA 4QH1A 5FY7A 4IE0A 3NRYA 3TLUA 2Y8DA 4ZI7E 4I50E 2W2UA 1XDPA 2W4XA 4PW8A 2Q9QB 3Q2MA 1SA0E 4QXHB 4K0UA 4AQGA 3AA6B 3BQLA 4N78D 2CLYB 3SS1A 3N9PA 2X0HA 5HXRA 4YFSA 1KK7A 3PDYA 2R6GF 2AXDS 4H9PC 2IW5B 2L9QA 2WMNA 2MTQA 3JC6C 4I43B 3LK2B 3AXJB 4TV8E 4IDPA 1T72A 4CZZB 2NP9A 3LSVA 2WY2A 5FL1A 5JH7E 4NXNT 3QUJA 1KFYA 4ILAA 2A72A 3ZYMA 3GN5B 2LOPA 3UQ7A 3U3IA 5J2UE 2YINA 4IDNA 3CK6A 4A56A 3BQKA 2YK0A 1U4QA 2J62A 4O4IE 5L3CB 2LLYA 4AI6A 3CMLA 5LNKA 5AQMB 2WM9A 1M7KA 2XAHB 2NW9A 1VOMA 2Y6XA 3ZMSB 1ZKEA 4LMJA 5LOVE 2I6HA 2UUAT 5FVLA 2K9AA 3KFWX 2RA1A 5ABFA 3RIUA 1WLXA 3ONLC 4OYJA 2LKHA 3K3OA 5L2LA 4IE6A 3AE1A 3A7MA 4H9OC 5H6RB 4QH4A 3QB5A 5M4YA 2UXCT 3HKEE 3RPUA 1XMQT 5J2TE 2BZBA 3CQCB 3P50A 1AJ3A 1HG2A 3O1IA 3ZN1B 2V7MA 3IEEA 3K3NA 1W09A 3RC8A 2VKHA 2C0SA 2XAGB 4HE8A 4GKKT 2H7VC 5CFBA 4JLEA 2BDEA 3RRWA 2B1EA 4AISA 4HWIB 2ZMAA 5DABA 4GYSA 5HXCA 5AQHB 4LF9T 2QGSA 2WU5A 3CWZB 2XM2A 4U7IA 2J47A 1N32T 2ACZA 3C50A 4U2YA 2CMRA 1IBLT 4DBRA 5FNVE 2D5UA 3EDVA 2E5LT 4JYAT 2WDQA 3WAKA 4DR2T 1DU2A 3ZT7A 3J7Yq 4YTPA 1N33T 2JMHA 3AAAB 1OEDC 3AECA 4U2ZA 4ZI2D 3RLFF 2BKPA 1HNWT 4DUZT 2MPKA 4A97A 5ABHA 5KDMC 5JDLA 2JJ9A 3M65A 5HXHA 3PU3A 4EYYR 3ZYLA 3DJBA 3MACA 5DJQC 4JI2T 3C51A 2K5BB 2RP4A 4WBOA 2KZ7B 1US7B 4AKHA 1SE7A 4PK4A 5ABFB 3ZPOA 1D1CA 2OA5A 2WDRA 2LSYA 2HPJA 4ILCA 4QWNB 3R84B 5AQQB 3AE8A 1VCTA 2VL0A 3UUNA 1JNRA 1FIOA 3C4XA 2WCAA 4OX9T 5LGNB 3RYFE 3SRZA 5E0OA 2LEHA 2N9DA 3UU6A 3O9XA 5ADXL 2LHNA 3HA4A 4CN6A 2YDQA 4O4JE 2UUCT 4IIJE 4QKNA 4A98A 2XTLA 1HTJF 1ZV4X 2DHRA 4HFCA 2Y48B 2XHEB 2E9XC 3KV6A 2EHOA 4E7SA 4BJNA 1ZP0A 4EV6A 3OTOT 2BBJA 4EZ4A 3SFEA 2X9WA 4WYVA 3VKHA 2EHOD 2CCQA 4JUYA 4YXDA 5C3JA 5C8YE 5AQVB 3NRXA 4P0BA 1N36T 2PJQA 2W00A 5EK3A 1D1AA 5LGUB 2QA7A 1S35A 1WR6A 2ES0A 4CXXA 4OFZA 5LHGB 4F8HA 1XZYA 4IGUA 3N9OA 1BR4A 4L9IA 4BA9A 2E2AA 5LB7B 5HCJA 4GOUA 4LFCT 2WAUA 2W63A 5JDGA 2DCFA 3ABVA 5C2TA 3P4RA 2CHOA 1Z8UA 3TLWA 4JV5T 1Y64B 4ISSA 2KINB 2XQ9A 4CI1B 3VRAA 4TN7B 2WS3A 3PE0A 5J0ZA 4NPPA 3CPZA 3RF1A 4HFHA 3KVBA 2FJEA 4EZHA 4CQIA 2K24A 5LMUT 1I94T 4JI1T 1E7PA 4ZI3D 2YDSA 5AQSB 3PUWF 4IL9A 5AQFB 3AA1B 3UUBA 3Q5WA 2M6BA 3AB3B 1WFDA 1UK5A 4X5TA 3ZC1A 4TWDA 2I0MA 5LGTB 3QNUA 4AIUA 5BMVE 4JI4T 4NIQA 1NWMX 2UXXB 1VCSA 3P7IA 1OEDE 2DI4A 4I55E 3MA9A 2ZLYA 2BG9C 4FI5A 1UX5A 2JQQA 2JMKA 4P09A 2XM1A 2IMLA 5CJ5A 4EEDA 2BS4A 2EHOB 4H9RC 2DL1A 2LRLA 2X67A 2PG8A 3QOFA 4KI0F 5LHIB 2YU1A 4YHJA 4CI2B 3RHWA 1E2AA 4DO0A 3ZJ1A 1XDOA 5AQJB 4UXNB 3RYCE 1OXZA 4WBNE 2WDVA 3FZFB 4IE4A 1FJGT 2N2NA 2GK9A 2YEVC 2LKGA 3NWIA 3LFMA 3ZLIA 3KV9A 4E7ZA 4YHHT 3FBLA 2QRXA 2CXDA 4QX8B 4GKJT 4U3CA 2WZIA 1YD8G 4LF6T 3RRCA 1J1JA 2VURA 1FEWA 4X1KE 1MIYA 5F3JA 1MNEA 3FZKB 4XZCA 1EZ3A 3P4PA 5ABEA 3SFDA 5LG4A 3SOLA 5FP3A 3P4WA 5JQGE 3ZJ2A 4LF7T 1G73A 4HTEA 1KNZA 3LK42 3CVRA 3GMIA 3PUYF 5ETWA 5AQOB 4HWDA 1SHZC 5IHYA 1ZEEA 1T7SA 3AA7B 3ZSSA 3UULA 1J5ET 4HFEA 3PJAJ 2CE7A 1D0YA 2VASA 1MMGA 2LSJA 5GONE 4AQFA 1X9BA 2H88A 4B3RT 3K1SA 3GA8A 1IZNB 2CEAA 2Q9QC 2A9UA 3LG7A 4B3TT 1YXRA 4O2BE 4CI3B 5JDHA 3N5LA 2CLYC 1HX8A 4B3ST 2KNDA 1XNRT 4DV2T 2KMFA 2MOZA 1W0BA 3UUMA 5F5WA 4H63H 2LM9A 2IIUA 2LE8A 4H9NC 4I0UA 3N9QA 5LBMA 2XAJB 1KNRA 1QLBA 1WCRA 4DR6T 3ONXA 4DNDA 5TAOA 1HR0T 3O1JA 3PUZF 5AQGB 4YJ3E 5JDMA 5AQUB 1D0XA 3TLTA 3OPCA 4DV7T 1V9DA 4TV9E 1NEKA 2V1DB 3ZMVB 4I4TE 4OK0A 4H63V 4C90A 3VHLA 5JREA 1S94A 4H9SE 2LOSA 3HR0A 1MNDA 2YKSA 3QC9A 4TWHA 3I9WA 1LVFA 3AAIA 2BKNA 2C5JA 3N2OA 2CM0A 5J1GA 2BG9E 2VKDA 5EK4A 2HN1A 2M6IA 3EVYA 2Z6EA 5JRCA 2DWKA 4JEUB 4DV3T 4EB6E 5A1LA 3KBUA 4ZHQE 4DR5T 3VR8A 4ZEYA 4QX7B 3HI2A 3WAJA 1FMWA 3PJAA 4ZS2A 2N1GA 3C98B 3D0TA 3CQXC 2PFVA 4OHFA 5FKYA 4BJMA 4HKAA 2E5VA 2MAWA 1UGOA 2RPAA 4ISTA 4A5XA 4IDOA 3W15B 3N9MA 4XAXB 3JCFA 2CXLA 5AQRB 2HHHT 1WYBA 4DR3T 1LVKA 4LMLA 4J2CA 4U33A 5H6QB 3IBPA 3EAMA 4TWFA 2WQYA 1HX1B 3ETUA 5IWAT 5HXSA 1CUNA 3RI5A 3FBZA 4CN1A 2FJBA 3NVOA 3PV0F 1WRDA 2FBWA 5FXZA 2BS2A 3ETVA 1YKHB 2WWVA 1O3XA 4U31A 4HWFA 2NTYA 2XQ8A 3K8PC 2VQFT 2XQYA 1IBMT 5AQIB 1QUUA 1HS7A 3E0ZA 4Z90A 4JI0T 4X20E 4AKRB 2WMOA 2IAKA 5DQWA 2CWOA 5KMGP 5JR9A 1NENA 4EYUA 1I6ZA 3FHNA 4H9QC 1L0VA 4DVDA 5HAXA 3TLVA 4JBWF 3NZPA 2IHR1 4UVBB 4AKLA 3FB2A 3AE5A 5FYMA 3NZQA 3OBVE 2HH7A 4UR9A 4B6XA 1HNZT 3X1DA 3H3AA 4NUVA 3I9YA 4CXYA 3PUAA 4KX6A 3EUHA 3C4WA 3RIAA 4PAGA 2XY8B 5JRCB 4MALA 2VWAA 4O2AE 3RIUC 1KNPA 3KINB 3ZC0A 2WBLA 2J1DG 2LSIA 4B3MT 3L8RA 4PNIA 5CGMA 5FXWA 3AEAA 2KWHA 3O4XE 3AE2A 2ODUA 4LF8T 1MMAA 5BR8T 4EIWA 2P9BA 4UELA 3UUXB 1OWAA 2NWBA 1IJ6A 3MKDA 2VL8A 3KV5A 2QVAA 2BKOA 1SUMB 4UIGA 5HEOA 3I1AA 4F6RC 2D0UA 2HN2A 1T98A 3B5MA 5CA1E 5AQNB 2CPTA 1R8IA 2ZM6T 4V1Av 3AE4A 2C5KT 2J4GA 2X0LB 3B13A 4ZOLE 2BVLA 4HFDA 5FXVA 2V8SV 4EAHA 3PTRB 3Q5XA 2NW8A 3UU5A 2WU2A 4AQYT 2NW7A 5JDFA 4HEAA 5JR9B 4DMVA 4Z8XA 1IJ5A 2UXBT 3MXZA 1UX4A 3AEGA 4ZI2C 3JC6D 4DBQA 2CHNA 1LRZA 2DWGA 5JDNA 2XPKA 5HEHA 4HFIA 2MYSA 3PURA 2WP9A 1E1HB 4KP3C 4DUYT 1IBKT 3ZKRA 2W0GA 4JI3T 3C64A 5CB4E 2JQKA 2OV9A 5JR9C 4MHCA 3ONJA 4IHJE 3NKZA 4X65T 4ZS3A 4YSZA 2KSRA 4Z91A 4EOZB 2NR4A 4MLKA 4L5GA 4X1YE 5EK2A 5FVKA 5L4EA 1YQ4A 3SWHA 4DR7T 2XAQB 4Q25A 4FJOA 4UEMA 2V5CA 4QH5A 3RYIE 4C91A 5F8PA 3LK3B 2KT9A 3L09A 2B76A 4ILBA 1UCUA 1LKXA 4KUMB 3RX6A 3OVUA 2BBHA 2OLTA 2D0TA 4UVAB 5L3BB 4HFVA 3AA0B 3I0OA 2WSSV 5LCYA 2SPCA 3AEFA 4O8SA 3JAFA 3V5SA 5DQVA 4WNKA 2EHOC 3AE6A 2JRKA 5HWYA 2XQ5A 1BR2A 3N2GE 3O1HA 3MK7C 4PFPA 4YSYA 4P1NA 2KXPB 5ABGA 2KLQA 2AE9A 1D1BA 4HWHA 3OYXA 2CXFA 1N34T 4L0RA 5L47A 4YTNA 2DLRA 2VVNA 2M67A 2XSBA 5HEGA 3ZYKA 3PUSA 4P0AA 1MMDA 4NXMT 2I59A 4ANJA 2ZM8A 5JTGA 5LJNA 4GIWA 4YY3T 3AEEA 3FZHB 2XASB 3AVRA 4AXPA 3UU4A 5FY1A 2XAFB 2VKJA 1OEDA 3H37A 3FZMB 2A2FX 4G2AA 4WZXA 4AKIA 3PU8A 2YOEA 2VB6A 2X68A 2K3WA 4TZ4C 4UV9B 4ZXLA 3S4UA 4PK5A 4DR1T 2X66A 4ZI3C 3AE7A 3C4ZA 3OYZA 3HL6A 3Q9DA 3CX7B 4TUYE 2IUBA 2XQ7A 3VKGA 4DV5T 4LF4T 3RQWA 2IC6A 2XSAA 4GK0E 2W66A 4PK6A 3OKQA 3F57A 4O4LE 3LJCA 2XJ7A 1VRBA 5FY0A 1T8BA 2IC9A 3CKDA 3ZMZB 1CHUA 2CA5A 2V6XA 2F4VT 2LJLA 3ZN0B 4U7YA 4IL4A 4LMKA 4KHPT 1MIWA 3JAEA 4WW0A 3H3MA
chains in the Genus database with same CATH topology
2DNXA 2DCFA 2V7LA 4XBFB 2X9HA 1QUUA 1HS7A 3E0ZA 4OYKA 3K3QC 3PUQA 4X20E 5CA0E 3PUGA 4YLHA 4AKRB 2WMOA 2HPLA 2IAKA 2E8IA 3I0QA 5DQWA 3ZMUB 2CWOA 4CXWA 1Y64B 5KMGP 4G63A 1YW0A 5JR9A 3HKCE 4ISSA 1HG5A 3R6NA 2KINB 4EYUA 5LYJE 4CI1B 4PFOA 1NAFA 3FHNA 3KDSE 1MIVA 4H9QC 3KVAA 3E08A 2E9XA 3FXDB 5L3GB 4JEHB 4TN7B 4DVDA 4MBQA 5HAXA 3RH3A 3PE0A 4UVCB 2JPFA 3CX6B 3NZPA 3J9X1 1MMNA 3CPZA 5FY7A 4IE0A 3KVBA 4UVBB 4EZHA 2V7IA 2E9XD 3FB2A 3NRYA 4AKLA 4CQIA 5FYMA 2K24A 3LBXA 3T8OA 4X1IE 1IAPA 3BK9A 2Y8DA 3NZQA 4ZI7E 4I50E 2NTXA 2V26A 4ZI3D 3ANWA 2UXNB 3U78A 1BR1A 2LT3A 3OBVE 2HH7A 4KBMB 4PW8A 2Q9QB 3Q2MA 2L3LA 4B6XA 1SA0E 3AA1B 4QXHB 3OJAA 4IDZA 4K0UA 3H3AA 3E22E 3Q5WA 4NUVA 2BVMA 3AA6B 3DTOA 4AQGA 3BQLA 3QK6A 3I9YA 3AB3B 4N78D 4PJMA 2CLYB 3MJXA 3PUAA 4CXYA 4MFRA 3EUHA 3C4WA 3SS1A 4PAGA 3ZC1A 5JRCB 4MALA 3N9PA 5HYAA 1BR0A 2VWAA 4O2AE 5LGTB 3KINB 5HXRA 3ZC0A 4YFSA 5BMVE 1KK7A 2J1DG 2LSIA 2WBLA 3KV4A 3PDYA 4H9PC 4PNIA 1NWMX 2KWIB 2UXXB 3AVSA 2L9QA 2IW5B 2WMNA 5FXWA 2KWHA 3WI3A 2MTQA 3P7IA 3JC6C 3O4XE 2ODUA 4I43B 1MMAA 2DI4A 3LK2B 5JDQA 4I55E 4TV8E 4EIWA 5LHHB 3MA9A 2P9BA 2ZLYA 4CZZB 4FI5A 2K48A 2NP9A 3UFEA 2VKOA 5JH7E 1UX5A 3QUJA 5L3DB 2JQQA 2JMKA 4UELA 3GWHA 4P09A 2A72A 3ZYMA 3UUXB 3GN5B 1HF8A 4KMCA 1OWAA 2EHOB 4H9RC 2NWBA 1IJ6A 2LOPA 2X67A 3MKDA 2VL8A 2PG8A 2ZM0A 3U3IA 3KV5A 1FMVA 5LHIB 5J2UE 2YINA 2YU1A 4YHJA 4CI2B 4DO0A 3ZJ1A 4A56A 4UXNB 3BQKA 3RYCE 1OXZA 4WBNE 4UIGA 5HWXA 2YK0A 2ACXA 3I1AA 4F6RC 2D0UA 1U4QA 5LJMA 4O4IE 5L3CB 3DP7A 3ESLA 4M1PA 4IE4A 1B7TA 4AI6A 1T98A 3UT5E 2N2NA 2GK9A 2YEVC 5CA1E 3CMLA 3LFMA 3ZLIA 4NUUA 5LNKA 5LA6E 3KV9A 4E7ZA 2WM9A 1QSDA 4V1Av 2C5KT 4PJLA 2X0LB 2XAHB 3B13A 1VOMA 3FBLA 4ZOLE 2BVLA 2NW9A 4AQFC 4GYRA 2Y6XA 3ZMSB 3ZCJA 1ZKEA 5FXVA 5LOVE 4ERRA 2CXDA 4ILUA 4QX8B 4EAHA 3CX8B 2K9AA 3N9LA 3KFWX 3BQIA 1YD8G 4YJ2E 2RA1A 3PTRB 3Q5XA 3RRCA 2NW8A 1FEWA 4X1KE 1WLXA 1YKEB 1MIYA 4OYJA 2VK9A 3K3OA 5F3JA 2NW7A 5L2LA 4PJJA 1ZHCA 5JDFA 1MNEA 4IE6A 5EZYE 4XZCA 4HEAA 4BAYB 5JR9B 1EZ3A 4H9OC 2LHRA 5LG4A 1Z0PA 5H6RB 4DMVA 4Z8XA 3SOLA 5FP3A 5JQGE 3ZJ2A 1IJ5A 3MXZA 1UX4A 4ZI2C 5HXEA 2E9XB 5M4YA 3JC6D 4DBQA 1LRZA 3HKEE 2DWGA 3RPUA 5JDNA 5J2TE 1G73A 4HTEA 2BZBA 4HGAA 1KNZA 3CQCB 2MYSA 3LK42 1AJ3A 1HG2A 3O1IA 3ZN1B 3PURA 1E1HB 3CVRA 3LBXB 2V7MA 3GMIA 4HN9A 5ETWA 4UF0A 2XUEA 2YU2A 3IEEA 3K3NA 1SHZC 5IHYA 3RC8A 1H7CA 3ANWB 4KP3C 1ZEEA 2VKHA 3AA7B 2XAGB 2C0SA 2PBIA 2LSKA 2ZM2A 4HE8A 2H7VC 4ADZA 3UULA 4JLEA 2W0GA 2BDEA 3C64A 3RRWA 2CE7A 1D0YA 5LXTE 2B1EA 2VASA 5CB4E 4AKGA 1MMGA 1G8XA 1WYCA 3IF8B 3EDUA 3CQGB 5L3FB 4DMWA 2ZMAA 5DABA 4U74A 4GYSA 5JR9C 4ASKA 2LSJA 4MHCA 5HXCA 5GONE 4IHJE 4AQFA 2QGSA 3ZMTB 4ZS3A 3CWZB 3GA8A 4EOZB 2C5IT 3RYHE 1IZNB 4MLKA 3C50A 2CEAA 4L5GA 2CMRA 4X1YE 2Q9QC 3L3PA 5EK2A 4DBRA 5FNVE 3LG7A 2D5UA 3F31A 3EDVA 1U5PA 3K8PC 3SWHA 5AFUL 4O2BE 3WAKA 2XAQB 4CI3B 5JDHA 2D2SA 3N5LA 4GK5E 2CLYC 4FJOA 1HX8A 2X9XA 4UEMA 3B57A 3RYIE 3F2EA 4C91A 2KNDA 3HKDE 3TKLB 5F8PA 3LK3B 2KMFA 2KT9A 3L09A 2MOZA 3UUMA 2W62A 1UCUA 4H63H 2LM9A 2H7OA 2LE8A 1HCIA 1LKXA 4IE5A 4KUMB 3A5XA 3RX6A 3J7Yq 4H9NC 3N9QA 2JMHA 2D0TA 4UVAB 3AAAB 5L3BB 4UV8B 5LBMA 4HFVA 2XAJB 3AA0B 3I0OA 3ONXA 2WSSV 5TAOA 4PJNA 4DNDA 3O1JA 5LCYA 4ZI2D 4YJ3E 2SPCA 2WWUA 5JDMA 4O8SA 3V5SA 5DQVA 5KDMC 1D0XA 5JDLA 2JJ9A 4WNKA 2EHOC 5IYZE 2JRKA 3M65A 5HWYA 3PU3A 3HKBE 5HXHA 1V9DA 1BR2A 3N2GE 4TV9E 3ZYLA 4EYYR 3DJBA 2V1DB 3O1HA 3ZMVB 4I4TE 3MACA 3MK7C 4OK0A 3KBTA 4H63V 5DJQC 4C90A 3VHLA 4PFPA 5JREA 3C51A 2K5BB 2LSGA 1S94A 3N2KE 2RP4A 4WBOA 2KXPB 2KZ7B 1US7B 5LP6E 4AKHA 4H9SE 4PK4A 5KX5E 2KLQA 2MBGA 3ZPOA 2LOSA 1D1CA 2OA5A 3HR0A 1D1BA 3OYXA 2LSYA 3P8CD 2CXFA 2A3DA 2H3RA 2HPJA 2G0UA 4L0RA 1MNDA 2NOXA 3FXEB 2DLRA 2Q9QA 3QC9A 2L8KA 5FXXA 2M67A 4QWNB 3I9WA 1LVFA 3R84B 5JVDE 3ZYKA 3AAIA 3PUSA 2C5JA 3N2OA 2X9YA 4P0AA 2CM0A 3MZKB 1MMDA 2VKDA 5EK4A 5J1GA 1X79A 2I59A 3RKOA 3UUNA 2Q9QD 3EVYA 2Z6EA 4ANJA 1FIOA 5JRCA 2ZM8A 3C4XA 5LJNA 2DWKA 4GIWA 4JEUB 4O4HE 5LGNB 3RYFE 3SRZA 5E0OA 2LEHA 2N9DA 4EB6E 5JDGA 5A1LA 3KBUA 4ZHQE 3O9XA 5ADXL 2XASB 3AVRA 2LHNA 4U72A 4AXPA 4QX7B 3HI2A 5FY1A 3HA4A 3WAJA 1FMWA 4UF0B 2XAFB 2VKJA 4ZS2A 4O4JE 3H37A 4IIJE 3IHRA 2N1GA 2A2FX 3C98B 3D0TA 4G2AA 3CQXC 4AKIA 2PFVA 3PU8A 3AAEB 4QKNA 2VB6A 2XTLA 1HTJF 1ZV4X 2ODVA 2DHRA 4HKAA 4OHFA 4BJMA 2X68A 2Y48B 4ISTA 2XHEB 2E9XC 1HFAA 4TZ4C 4EXTA 4UV9B 3W15B 3N9MA 4XAXB 3GN5A 2CXLA 3KV6A 3S4UA 2EHOA 4E7SA 4BJNA 4PK5A 2X66A 4ZI3C 3V5UA 5FMNA 3C4ZA 4EZ4A 1WYBA 3OYZA 2X9WA 2W61A 1LVKA 2V7JA 4J2CA 3HL6A 1D0ZA 5H6QB 3Q9DA 3VKHA 2EHOD 2CCQA 2V7KA 3CX7B 3IBPA 4JUYA 4QHOA 4TUYE 3VKGA 5C8YE 3NRXA 4P0BA 3ETUA 5HXSA 2PJQA 1CUNA 2W00A 5EK3A 1D1AA 2IC6A 3ZCIA 3FBZA 5LGUB 4GK0E 2QA7A 4PK6A 3OKQA 1S35A 3NBXX 1WR6A 3F57A 2ES0A 3LJCA 4O4LE 4IE7A 4QXCB 4CXXA 1WRDA 3VU7H 5FXZA 1VRBA 2X51A 4OFZA 5FY0A 3ETVA 3ZEFB 5LBQB 2CWYA 2IC9A 1YKHB 3CKDA 3ZMZB 2CA5A 5LHGB 2LJLA 4QXBB 3N9NA 3ZN0B 1O3XA 4IGUA 3N9OA 5L3EB 3UTKA 2NTYA 3RC3A 1BR4A 4L9IA 1MIWA 4WW0A 4BA9A 4GOUA 4TX5A 2WAUA 2W63A 2XQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YD8 G;  1X79 A;  1OXZ A;  1O3X A;  1NAF A;  1NWM X;  1WR6 A;  2N9D A;  2N2N A;  1WRD A; 
#chains in the Genus database with same CATH topology
 4XBF B;  1XWM A;  5HCM A;  3K3Q C;  3PUQ A;  1UUS A;  5CA0 E;  4YLH A;  3I0Q A;  2E8I A;  3A8Y C;  4G63 A;  1YW0 A;  1HG5 A;  2XQ3 A;  5LYJ E;  4HFB A;  4PFO A;  3KDS E;  2VVS A;  2LM2 A;  3E08 A;  2E9X A;  3FXD B;  4JEH B;  4MBQ A;  3RH3 A;  4UVC B;  2JPF A;  1KF6 A;  3CX6 B;  2V7I A;  2E9X D;  3LBX A;  3T8O A;  4X1I E;  1IAP A;  3BK9 A;  3P4Q A;  2NTX A;  4JI8 T;  2V26 A;  2UXN B;  3ANW A;  3U78 A;  1BR1 A;  2UU9 T;  2LT3 A;  4KBM B;  4IT4 A;  2L3L A;  3RGL A;  4DV1 T;  2V5D A;  3OJA A;  4IDZ A;  4DV4 T;  4IRE A;  3E22 E;  2BVM A;  3DTO A;  3QK6 A;  4PJM A;  3T1H T;  3MJX A;  4MFR A;  1BR0 A;  5HYA A;  2QYW A;  3KV4 A;  2JIW A;  2KWI B;  3AVS A;  5AQP B;  3WI3 A;  2CBJ A;  1OED B;  4JI5 T;  5JDQ A;  5LHH B;  2K48 A;  3UFE A;  2YN6 A;  2VKO A;  4DV0 T;  2UXD T;  3AE9 A;  5L3D B;  3GWH A;  1XMO T;  1HF8 A;  4KMC A;  3ZT5 A;  5LG3 A;  2ZM0 A;  1FMV A;  4COF A;  3ZST A;  5HWX A;  2ACX A;  1XNQ T;  5LJM A;  2VQE T;  4DV6 T;  3DP7 A;  3ESL A;  4M1P A;  1B7T A;  3UT5 E;  4NUU A;  5LA6 E;  1QSD A;  3G06 A;  4TNV A;  4PJL A;  4AQF C;  4GYR A;  3ZCJ A;  4ERR A;  4ILU A;  4LFA T;  3UFG A;  3CX8 B;  3N9L A;  3BQI A;  4YJ2 E;  4IDQ A;  3VR9 A;  1YKE B;  2VK9 A;  3EHZ A;  4PJJ A;  1ZHC A;  5EZY E;  4BAY B;  2LHR A;  1Z0P A;  2BG9 A;  5HXE A;  2E9X B;  4DID B;  4HGA A;  4EEB A;  3RIF A;  3LBX B;  4HN9 A;  2UUB T;  4UF0 A;  2XUE A;  2FUP A;  2YU2 A;  1H7C A;  3ANW B;  5LMN T;  2PBI A;  4ADZ A;  2LSK A;  2ZM2 A;  1W9R A;  3RKG A;  3EI0 A;  5LXT E;  1UUR A;  4AKG A;  3PUX F;  1J5W A;  1G8X A;  1WYC A;  3IF8 B;  3EDU A;  3CQG B;  3UU3 A;  5L3F B;  4DMW A;  4U74 A;  4ASK A;  4CN4 A;  3ZMT B;  2C5I T;  3RYH E;  1W0A A;  3L3P A;  3LDQ B;  4YSX A;  2JQH A;  2WB5 A;  3F31 A;  1U5P A;  5AFU L;  2XZE A;  3P4S A;  3AEB A;  2D2S A;  4GK5 E;  2X9X A;  3B57 A;  2V6Y A;  2LRK A;  3F2E A;  3TKL B;  3HKD E;  3UQ4 A;  2W62 A;  5KXJ A;  2H7O A;  1HCI A;  4IE5 A;  3A5X A;  4TNW A;  4UV8 B;  4PJN A;  1KEY A;  2WWU A;  2D9D A;  5IYZ E;  2WZH A;  4KHZ F;  2YDR A;  4HWC A;  3HKB E;  2CBI A;  3M3Z B;  3KBT A;  1M62 A;  2LSG A;  3N2K E;  5LP6 E;  3JAD A;  4X64 T;  3Q5E A;  3RQU A;  3PUV F;  5KX5 E;  2MBG A;  3Q5D A;  4LFB T;  2W67 A;  2H89 A;  3VRB A;  2FJD A;  3L39 A;  3P8C D;  2A3D A;  2H3R A;  5HEU A;  2G0U A;  2NOX A;  4ZZB A;  3FXE B;  2Q9Q A;  2L8K A;  5FXX A;  3IA3 A;  4JI6 T;  5JVD E;  2X9Y A;  5IUX A;  3MZK B;  2BG9 B;  1X79 A;  3RKO A;  4YTM A;  2Q9Q D;  5AQL B;  4LF5 T;  5L4H A;  4O4H E;  4YT0 A;  2X0Y A;  4X66 T;  4U72 A;  4UF0 B;  3IHR A;  1Y01 A;  3AXJ A;  3AAE B;  2IDO B;  3CIR A;  2ODV A;  3UU8 A;  1HFA A;  4EXT A;  3TLS A;  3GN5 A;  1GQE A;  3V5U A;  4EGW A;  5FMN A;  4DR4 T;  5FL0 A;  2W61 A;  2V7J A;  1D0Z A;  5AQK B;  2JQ9 A;  4QHO A;  2V7K A;  3T1Y T;  1HNX T;  2PTF A;  3ZCI A;  2XQ6 A;  3AE3 A;  2CRB A;  3NBX X;  4QXC B;  4IE7 A;  3VU7 H;  1JNZ A;  2X51 A;  3ZEF B;  5LBQ B;  2V6Y B;  2CWY A;  2FJA A;  1WR0 A;  4QXB B;  3N9N A;  4ZZC A;  3ZT6 A;  5L3E B;  3UTK A;  3RC3 A;  4TX5 A;  1YQ3 A;  2DNX A;  2V7L A;  2X9H A;  4OYK A;  3PUG A;  2HPL A;  3ZMU B;  3EAB A;  4CXW A;  3FZL B;  4JI7 T;  3HKC E;  3R6N A;  2BS3 A;  3AED A;  3QB5 K;  1NAF A;  1MIV A;  1ZOY A;  5HEJ A;  3KVA A;  4K0K T;  5AQT B;  2XQ4 A;  2XQA A;  5L3G B;  4X62 T;  3J9X 1;  1MMN A;  4QH1 A;  5FY7 A;  4IE0 A;  3NRY A;  3TLU A;  2Y8D A;  4ZI7 E;  4I50 E;  2W2U A;  1XDP A;  2W4X A;  4PW8 A;  2Q9Q B;  3Q2M A;  1SA0 E;  4QXH B;  4K0U A;  4AQG A;  3AA6 B;  3BQL A;  4N78 D;  2CLY B;  3SS1 A;  3N9P A;  2X0H A;  5HXR A;  4YFS A;  1KK7 A;  3PDY A;  2R6G F;  2AXD S;  4H9P C;  2IW5 B;  2L9Q A;  2WMN A;  2MTQ A;  3JC6 C;  4I43 B;  3LK2 B;  3AXJ B;  4TV8 E;  4IDP A;  1T72 A;  4CZZ B;  2NP9 A;  3LSV A;  2WY2 A;  5FL1 A;  5JH7 E;  4NXN T;  3QUJ A;  1KFY A;  4ILA A;  2A72 A;  3ZYM A;  3GN5 B;  2LOP A;  3UQ7 A;  3U3I A;  5J2U E;  2YIN A;  4IDN A;  3CK6 A;  4A56 A;  3BQK A;  2YK0 A;  1U4Q A;  2J62 A;  4O4I E;  5L3C B;  2LLY A;  4AI6 A;  3CML A;  5LNK A;  5AQM B;  2WM9 A;  1M7K A;  2XAH B;  2NW9 A;  1VOM A;  2Y6X A;  3ZMS B;  1ZKE A;  4LMJ A;  5LOV E;  2I6H A;  2UUA T;  5FVL A;  2K9A A;  3KFW X;  2RA1 A;  5ABF A;  3RIU A;  1WLX A;  3ONL C;  4OYJ A;  2LKH A;  3K3O A;  5L2L A;  4IE6 A;  3AE1 A;  3A7M A;  4H9O C;  5H6R B;  4QH4 A;  3QB5 A;  5M4Y A;  2UXC T;  3HKE E;  3RPU A;  1XMQ T;  5J2T E;  2BZB A;  3CQC B;  3P50 A;  1AJ3 A;  1HG2 A;  3O1I A;  3ZN1 B;  2V7M A;  3IEE A;  3K3N A;  1W09 A;  3RC8 A;  2VKH A;  2C0S A;  2XAG B;  4HE8 A;  4GKK T;  2H7V C;  5CFB A;  4JLE A;  2BDE A;  3RRW A;  2B1E A;  4AIS A;  4HWI B;  2ZMA A;  5DAB A;  4GYS A;  5HXC A;  5AQH B;  4LF9 T;  2QGS A;  2WU5 A;  3CWZ B;  2XM2 A;  4U7I A;  2J47 A;  1N32 T;  2ACZ A;  3C50 A;  4U2Y A;  2CMR A;  1IBL T;  4DBR A;  5FNV E;  2D5U A;  3EDV A;  2E5L T;  4JYA T;  2WDQ A;  3WAK A;  4DR2 T;  1DU2 A;  3ZT7 A;  3J7Y q;  4YTP A;  1N33 T;  2JMH A;  3AAA B;  1OED C;  3AEC A;  4U2Z A;  4ZI2 D;  3RLF F;  2BKP A;  1HNW T;  4DUZ T;  2MPK A;  4A97 A;  5ABH A;  5KDM C;  5JDL A;  2JJ9 A;  3M65 A;  5HXH A;  3PU3 A;  4EYY R;  3ZYL A;  3DJB A;  3MAC A;  5DJQ C;  4JI2 T;  3C51 A;  2K5B B;  2RP4 A;  4WBO A;  2KZ7 B;  1US7 B;  4AKH A;  1SE7 A;  4PK4 A;  5ABF B;  3ZPO A;  1D1C A;  2OA5 A;  2WDR A;  2LSY A;  2HPJ A;  4ILC A;  4QWN B;  3R84 B;  5AQQ B;  3AE8 A;  1VCT A;  2VL0 A;  3UUN A;  1JNR A;  1FIO A;  3C4X A;  2WCA A;  4OX9 T;  5LGN B;  3RYF E;  3SRZ A;  5E0O A;  2LEH A;  2N9D A;  3UU6 A;  3O9X A;  5ADX L;  2LHN A;  3HA4 A;  4CN6 A;  2YDQ A;  4O4J E;  2UUC T;  4IIJ E;  4QKN A;  4A98 A;  2XTL A;  1HTJ F;  1ZV4 X;  2DHR A;  4HFC A;  2Y48 B;  2XHE B;  2E9X C;  3KV6 A;  2EHO A;  4E7S A;  4BJN A;  1ZP0 A;  4EV6 A;  3OTO T;  2BBJ A;  4EZ4 A;  3SFE A;  2X9W A;  4WYV A;  3VKH A;  2EHO D;  2CCQ A;  4JUY A;  4YXD A;  5C3J A;  5C8Y E;  5AQV B;  3NRX A;  4P0B A;  1N36 T;  2PJQ A;  2W00 A;  5EK3 A;  1D1A A;  5LGU B;  2QA7 A;  1S35 A;  1WR6 A;  2ES0 A;  4CXX A;  4OFZ A;  5LHG B;  4F8H A;  1XZY A;  4IGU A;  3N9O A;  1BR4 A;  4L9I A;  4BA9 A;  2E2A A;  5LB7 B;  5HCJ A;  4GOU A;  4LFC T;  2WAU A;  2W63 A;  5JDG A;  2DCF A;  3ABV A;  5C2T A;  3P4R A;  2CHO A;  1Z8U A;  3TLW A;  4JV5 T;  1Y64 B;  4ISS A;  2KIN B;  2XQ9 A;  4CI1 B;  3VRA A;  4TN7 B;  2WS3 A;  3PE0 A;  5J0Z A;  4NPP A;  3CPZ A;  3RF1 A;  4HFH A;  3KVB A;  2FJE A;  4EZH A;  4CQI A;  2K24 A;  5LMU T;  1I94 T;  4JI1 T;  1E7P A;  4ZI3 D;  2YDS A;  5AQS B;  3PUW F;  4IL9 A;  5AQF B;  3AA1 B;  3UUB A;  3Q5W A;  2M6B A;  3AB3 B;  1WFD A;  1UK5 A;  4X5T A;  3ZC1 A;  4TWD A;  2I0M A;  5LGT B;  3QNU A;  4AIU A;  5BMV E;  4JI4 T;  4NIQ A;  1NWM X;  2UXX B;  1VCS A;  3P7I A;  1OED E;  2DI4 A;  4I55 E;  3MA9 A;  2ZLY A;  2BG9 C;  4FI5 A;  1UX5 A;  2JQQ A;  2JMK A;  4P09 A;  2XM1 A;  2IML A;  5CJ5 A;  4EED A;  2BS4 A;  2EHO B;  4H9R C;  2DL1 A;  2LRL A;  2X67 A;  2PG8 A;  3QOF A;  4KI0 F;  5LHI B;  2YU1 A;  4YHJ A;  4CI2 B;  3RHW A;  1E2A A;  4DO0 A;  3ZJ1 A;  1XDO A;  5AQJ B;  4UXN B;  3RYC E;  1OXZ A;  4WBN E;  2WDV A;  3FZF B;  4IE4 A;  1FJG T;  2N2N A;  2GK9 A;  2YEV C;  2LKG A;  3NWI A;  3LFM A;  3ZLI A;  3KV9 A;  4E7Z A;  4YHH T;  3FBL A;  2QRX A;  2CXD A;  4QX8 B;  4GKJ T;  4U3C A;  2WZI A;  1YD8 G;  4LF6 T;  3RRC A;  1J1J A;  2VUR A;  1FEW A;  4X1K E;  1MIY A;  5F3J A;  1MNE A;  3FZK B;  4XZC A;  1EZ3 A;  3P4P A;  5ABE A;  3SFD A;  5LG4 A;  3SOL A;  5FP3 A;  3P4W A;  5JQG E;  3ZJ2 A;  4LF7 T;  1G73 A;  4HTE A;  1KNZ A;  3LK4 2;  3CVR A;  3GMI A;  3PUY F;  5ETW A;  5AQO B;  4HWD A;  1SHZ C;  5IHY A;  1ZEE A;  1T7S A;  3AA7 B;  3ZSS A;  3UUL A;  1J5E T;  4HFE A;  3PJA J;  2CE7 A;  1D0Y A;  2VAS A;  1MMG A;  2LSJ A;  5GON E;  4AQF A;  1X9B A;  2H88 A;  4B3R T;  3K1S A;  3GA8 A;  1IZN B;  2CEA A;  2Q9Q C;  2A9U A;  3LG7 A;  4B3T T;  1YXR A;  4O2B E;  4CI3 B;  5JDH A;  3N5L A;  2CLY C;  1HX8 A;  4B3S T;  2KND A;  1XNR T;  4DV2 T;  2KMF A;  2MOZ A;  1W0B A;  3UUM A;  5F5W A;  4H63 H;  2LM9 A;  2IIU A;  2LE8 A;  4H9N C;  4I0U A;  3N9Q A;  5LBM A;  2XAJ B;  1KNR A;  1QLB A;  1WCR A;  4DR6 T;  3ONX A;  4DND A;  5TAO A;  1HR0 T;  3O1J A;  3PUZ F;  5AQG B;  4YJ3 E;  5JDM A;  5AQU B;  1D0X A;  3TLT A;  3OPC A;  4DV7 T;  1V9D A;  4TV9 E;  1NEK A;  2V1D B;  3ZMV B;  4I4T E;  4OK0 A;  4H63 V;  4C90 A;  3VHL A;  5JRE A;  1S94 A;  4H9S E;  2LOS A;  3HR0 A;  1MND A;  2YKS A;  3QC9 A;  4TWH A;  3I9W A;  1LVF A;  3AAI A;  2BKN A;  2C5J A;  3N2O A;  2CM0 A;  5J1G A;  2BG9 E;  2VKD A;  5EK4 A;  2HN1 A;  2M6I A;  3EVY A;  2Z6E A;  5JRC A;  2DWK A;  4JEU B;  4DV3 T;  4EB6 E;  5A1L A;  3KBU A;  4ZHQ E;  4DR5 T;  3VR8 A;  4ZEY A;  4QX7 B;  3HI2 A;  3WAJ A;  1FMW A;  3PJA A;  4ZS2 A;  2N1G A;  3C98 B;  3D0T A;  3CQX C;  2PFV A;  4OHF A;  5FKY A;  4BJM A;  4HKA A;  2E5V A;  2MAW A;  1UGO A;  2RPA A;  4IST A;  4A5X A;  4IDO A;  3W15 B;  3N9M A;  4XAX B;  3JCF A;  2CXL A;  5AQR B;  2HHH T;  1WYB A;  4DR3 T;  1LVK A;  4LML A;  4J2C A;  4U33 A;  5H6Q B;  3IBP A;  3EAM A;  4TWF A;  2WQY A;  1HX1 B;  3ETU A;  5IWA T;  5HXS A;  1CUN A;  3RI5 A;  3FBZ A;  4CN1 A;  2FJB A;  3NVO A;  3PV0 F;  1WRD A;  2FBW A;  5FXZ A;  2BS2 A;  3ETV A;  1YKH B;  2WWV A;  1O3X A;  4U31 A;  4HWF A;  2NTY A;  2XQ8 A;  3K8P C;  2VQF T;  2XQY A;  1IBM T;  5AQI B;  1QUU A;  1HS7 A;  3E0Z A;  4Z90 A;  4JI0 T;  4X20 E;  4AKR B;  2WMO A;  2IAK A;  5DQW A;  2CWO A;  5KMG P;  5JR9 A;  1NEN A;  4EYU A;  1I6Z A;  3FHN A;  4H9Q C;  1L0V A;  4DVD A;  5HAX A;  3TLV A;  4JBW F;  3NZP A;  2IHR 1;  4UVB B;  4AKL A;  3FB2 A;  3AE5 A;  5FYM A;  3NZQ A;  3OBV E;  2HH7 A;  4UR9 A;  4B6X A;  1HNZ T;  3X1D A;  3H3A A;  4NUV A;  3I9Y A;  4CXY A;  3PUA A;  4KX6 A;  3EUH A;  3C4W A;  3RIA A;  4PAG A;  2XY8 B;  5JRC B;  4MAL A;  2VWA A;  4O2A E;  3RIU C;  1KNP A;  3KIN B;  3ZC0 A;  2WBL A;  2J1D G;  2LSI A;  4B3M T;  3L8R A;  4PNI A;  5CGM A;  5FXW A;  3AEA A;  2KWH A;  3O4X E;  3AE2 A;  2ODU A;  4LF8 T;  1MMA A;  5BR8 T;  4EIW A;  2P9B A;  4UEL A;  3UUX B;  1OWA A;  2NWB A;  1IJ6 A;  3MKD A;  2VL8 A;  3KV5 A;  2QVA A;  2BKO A;  1SUM B;  4UIG A;  5HEO A;  3I1A A;  4F6R C;  2D0U A;  2HN2 A;  1T98 A;  3B5M A;  5CA1 E;  5AQN B;  2CPT A;  1R8I A;  2ZM6 T;  4V1A v;  3AE4 A;  2C5K T;  2J4G A;  2X0L B;  3B13 A;  4ZOL E;  2BVL A;  4HFD A;  5FXV A;  2V8S V;  4EAH A;  3PTR B;  3Q5X A;  2NW8 A;  3UU5 A;  2WU2 A;  4AQY T;  2NW7 A;  5JDF A;  4HEA A;  5JR9 B;  4DMV A;  4Z8X A;  1IJ5 A;  2UXB T;  3MXZ A;  1UX4 A;  3AEG A;  4ZI2 C;  3JC6 D;  4DBQ A;  2CHN A;  1LRZ A;  2DWG A;  5JDN A;  2XPK A;  5HEH A;  4HFI A;  2MYS A;  3PUR A;  2WP9 A;  1E1H B;  4KP3 C;  4DUY T;  1IBK T;  3ZKR A;  2W0G A;  4JI3 T;  3C64 A;  5CB4 E;  2JQK A;  2OV9 A;  5JR9 C;  4MHC A;  3ONJ A;  4IHJ E;  3NKZ A;  4X65 T;  4ZS3 A;  4YSZ A;  2KSR A;  4Z91 A;  4EOZ B;  2NR4 A;  4MLK A;  4L5G A;  4X1Y E;  5EK2 A;  5FVK A;  5L4E A;  1YQ4 A;  3SWH A;  4DR7 T;  2XAQ B;  4Q25 A;  4FJO A;  4UEM A;  2V5C A;  4QH5 A;  3RYI E;  4C91 A;  5F8P A;  3LK3 B;  2KT9 A;  3L09 A;  2B76 A;  4ILB A;  1UCU A;  1LKX A;  4KUM B;  3RX6 A;  3OVU A;  2BBH A;  2OLT A;  2D0T A;  4UVA B;  5L3B B;  4HFV A;  3AA0 B;  3I0O A;  2WSS V;  5LCY A;  2SPC A;  3AEF A;  4O8S A;  3JAF A;  3V5S A;  5DQV A;  4WNK A;  2EHO C;  3AE6 A;  2JRK A;  5HWY A;  2XQ5 A;  1BR2 A;  3N2G E;  3O1H A;  3MK7 C;  4PFP A;  4YSY A;  4P1N A;  2KXP B;  5ABG A;  2KLQ A;  2AE9 A;  1D1B A;  4HWH A;  3OYX A;  2CXF A;  1N34 T;  4L0R A;  5L47 A;  4YTN A;  2DLR A;  2VVN A;  2M67 A;  2XSB A;  5HEG A;  3ZYK A;  3PUS A;  4P0A A;  1MMD A;  4NXM T;  2I59 A;  4ANJ A;  2ZM8 A;  5JTG A;  5LJN A;  4GIW A;  4YY3 T;  3AEE A;  3FZH B;  2XAS B;  3AVR A;  4AXP A;  3UU4 A;  5FY1 A;  2XAF B;  2VKJ A;  1OED A;  3H37 A;  3FZM B;  2A2F X;  4G2A A;  4WZX A;  4AKI A;  3PU8 A;  2YOE A;  2VB6 A;  2X68 A;  2K3W A;  4TZ4 C;  4UV9 B;  4ZXL A;  3S4U A;  4PK5 A;  4DR1 T;  2X66 A;  4ZI3 C;  3AE7 A;  3C4Z A;  3OYZ A;  3HL6 A;  3Q9D A;  3CX7 B;  4TUY E;  2IUB A;  2XQ7 A;  3VKG A;  4DV5 T;  4LF4 T;  3RQW A;  2IC6 A;  2XSA A;  4GK0 E;  2W66 A;  4PK6 A;  3OKQ A;  3F57 A;  4O4L E;  3LJC A;  2XJ7 A;  1VRB A;  5FY0 A;  1T8B A;  2IC9 A;  3CKD A;  3ZMZ B;  1CHU A;  2CA5 A;  2V6X A;  2F4V T;  2LJL A;  3ZN0 B;  4U7Y A;  4IL4 A;  4LMK A;  4KHP T;  1MIW A;  3JAE A;  4WW0 A;  3H3M A; 
#chains in the Genus database with same CATH homology
 2DNX A;  2DCF A;  2V7L A;  4XBF B;  2X9H A;  1QUU A;  1HS7 A;  3E0Z A;  4OYK A;  3K3Q C;  3PUQ A;  4X20 E;  5CA0 E;  3PUG A;  4YLH A;  4AKR B;  2WMO A;  2HPL A;  2IAK A;  2E8I A;  3I0Q A;  5DQW A;  3ZMU B;  2CWO A;  4CXW A;  1Y64 B;  5KMG P;  4G63 A;  1YW0 A;  5JR9 A;  3HKC E;  4ISS A;  1HG5 A;  3R6N A;  2KIN B;  4EYU A;  5LYJ E;  4CI1 B;  4PFO A;  1NAF A;  3FHN A;  3KDS E;  1MIV A;  4H9Q C;  3KVA A;  3E08 A;  2E9X A;  3FXD B;  5L3G B;  4JEH B;  4TN7 B;  4DVD A;  4MBQ A;  5HAX A;  3RH3 A;  3PE0 A;  4UVC B;  2JPF A;  3CX6 B;  3NZP A;  3J9X 1;  1MMN A;  3CPZ A;  5FY7 A;  4IE0 A;  3KVB A;  4UVB B;  4EZH A;  2V7I A;  2E9X D;  3FB2 A;  3NRY A;  4AKL A;  4CQI A;  5FYM A;  2K24 A;  3LBX A;  3T8O A;  4X1I E;  1IAP A;  3BK9 A;  2Y8D A;  3NZQ A;  4ZI7 E;  4I50 E;  2NTX A;  2V26 A;  4ZI3 D;  3ANW A;  2UXN B;  3U78 A;  1BR1 A;  2LT3 A;  3OBV E;  2HH7 A;  4KBM B;  4PW8 A;  2Q9Q B;  3Q2M A;  2L3L A;  4B6X A;  1SA0 E;  3AA1 B;  4QXH B;  3OJA A;  4IDZ A;  4K0U A;  3H3A A;  3E22 E;  3Q5W A;  4NUV A;  2BVM A;  3AA6 B;  3DTO A;  4AQG A;  3BQL A;  3QK6 A;  3I9Y A;  3AB3 B;  4N78 D;  4PJM A;  2CLY B;  3MJX A;  3PUA A;  4CXY A;  4MFR A;  3EUH A;  3C4W A;  3SS1 A;  4PAG A;  3ZC1 A;  5JRC B;  4MAL A;  3N9P A;  5HYA A;  1BR0 A;  2VWA A;  4O2A E;  5LGT B;  3KIN B;  5HXR A;  3ZC0 A;  4YFS A;  5BMV E;  1KK7 A;  2J1D G;  2LSI A;  2WBL A;  3KV4 A;  3PDY A;  4H9P C;  4PNI A;  1NWM X;  2KWI B;  2UXX B;  3AVS A;  2L9Q A;  2IW5 B;  2WMN A;  5FXW A;  2KWH A;  3WI3 A;  2MTQ A;  3P7I A;  3JC6 C;  3O4X E;  2ODU A;  4I43 B;  1MMA A;  2DI4 A;  3LK2 B;  5JDQ A;  4I55 E;  4TV8 E;  4EIW A;  5LHH B;  3MA9 A;  2P9B A;  2ZLY A;  4CZZ B;  4FI5 A;  2K48 A;  2NP9 A;  3UFE A;  2VKO A;  5JH7 E;  1UX5 A;  3QUJ A;  5L3D B;  2JQQ A;  2JMK A;  4UEL A;  3GWH A;  4P09 A;  2A72 A;  3ZYM A;  3UUX B;  3GN5 B;  1HF8 A;  4KMC A;  1OWA A;  2EHO B;  4H9R C;  2NWB A;  1IJ6 A;  2LOP A;  2X67 A;  3MKD A;  2VL8 A;  2PG8 A;  2ZM0 A;  3U3I A;  3KV5 A;  1FMV A;  5LHI B;  5J2U E;  2YIN A;  2YU1 A;  4YHJ A;  4CI2 B;  4DO0 A;  3ZJ1 A;  4A56 A;  4UXN B;  3BQK A;  3RYC E;  1OXZ A;  4WBN E;  4UIG A;  5HWX A;  2YK0 A;  2ACX A;  3I1A A;  4F6R C;  2D0U A;  1U4Q A;  5LJM A;  4O4I E;  5L3C B;  3DP7 A;  3ESL A;  4M1P A;  4IE4 A;  1B7T A;  4AI6 A;  1T98 A;  3UT5 E;  2N2N A;  2GK9 A;  2YEV C;  5CA1 E;  3CML A;  3LFM A;  3ZLI A;  4NUU A;  5LNK A;  5LA6 E;  3KV9 A;  4E7Z A;  2WM9 A;  1QSD A;  4V1A v;  2C5K T;  4PJL A;  2X0L B;  2XAH B;  3B13 A;  1VOM A;  3FBL A;  4ZOL E;  2BVL A;  2NW9 A;  4AQF C;  4GYR A;  2Y6X A;  3ZMS B;  3ZCJ A;  1ZKE A;  5FXV A;  5LOV E;  4ERR A;  2CXD A;  4ILU A;  4QX8 B;  4EAH A;  3CX8 B;  2K9A A;  3N9L A;  3KFW X;  3BQI A;  1YD8 G;  4YJ2 E;  2RA1 A;  3PTR B;  3Q5X A;  3RRC A;  2NW8 A;  1FEW A;  4X1K E;  1WLX A;  1YKE B;  1MIY A;  4OYJ A;  2VK9 A;  3K3O A;  5F3J A;  2NW7 A;  5L2L A;  4PJJ A;  1ZHC A;  5JDF A;  1MNE A;  4IE6 A;  5EZY E;  4XZC A;  4HEA A;  4BAY B;  5JR9 B;  1EZ3 A;  4H9O C;  2LHR A;  5LG4 A;  1Z0P A;  5H6R B;  4DMV A;  4Z8X A;  3SOL A;  5FP3 A;  5JQG E;  3ZJ2 A;  1IJ5 A;  3MXZ A;  1UX4 A;  4ZI2 C;  5HXE A;  2E9X B;  5M4Y A;  3JC6 D;  4DBQ A;  1LRZ A;  3HKE E;  2DWG A;  3RPU A;  5JDN A;  5J2T E;  1G73 A;  4HTE A;  2BZB A;  4HGA A;  1KNZ A;  3CQC B;  2MYS A;  3LK4 2;  1AJ3 A;  1HG2 A;  3O1I A;  3ZN1 B;  3PUR A;  1E1H B;  3CVR A;  3LBX B;  2V7M A;  3GMI A;  4HN9 A;  5ETW A;  4UF0 A;  2XUE A;  2YU2 A;  3IEE A;  3K3N A;  1SHZ C;  5IHY A;  3RC8 A;  1H7C A;  3ANW B;  4KP3 C;  1ZEE A;  2VKH A;  3AA7 B;  2XAG B;  2C0S A;  2PBI A;  2LSK A;  2ZM2 A;  4HE8 A;  2H7V C;  4ADZ A;  3UUL A;  4JLE A;  2W0G A;  2BDE A;  3C64 A;  3RRW A;  2CE7 A;  1D0Y A;  5LXT E;  2B1E A;  2VAS A;  5CB4 E;  4AKG A;  1MMG A;  1G8X A;  1WYC A;  3IF8 B;  3EDU A;  3CQG B;  5L3F B;  4DMW A;  2ZMA A;  5DAB A;  4U74 A;  4GYS A;  5JR9 C;  4ASK A;  2LSJ A;  4MHC A;  5HXC A;  5GON E;  4IHJ E;  4AQF A;  2QGS A;  3ZMT B;  4ZS3 A;  3CWZ B;  3GA8 A;  4EOZ B;  2C5I T;  3RYH E;  1IZN B;  4MLK A;  3C50 A;  2CEA A;  4L5G A;  2CMR A;  4X1Y E;  2Q9Q C;  3L3P A;  5EK2 A;  4DBR A;  5FNV E;  3LG7 A;  2D5U A;  3F31 A;  3EDV A;  1U5P A;  3K8P C;  3SWH A;  5AFU L;  4O2B E;  3WAK A;  2XAQ B;  4CI3 B;  5JDH A;  2D2S A;  3N5L A;  4GK5 E;  2CLY C;  4FJO A;  1HX8 A;  2X9X A;  4UEM A;  3B57 A;  3RYI E;  3F2E A;  4C91 A;  2KND A;  3HKD E;  3TKL B;  5F8P A;  3LK3 B;  2KMF A;  2KT9 A;  3L09 A;  2MOZ A;  3UUM A;  2W62 A;  1UCU A;  4H63 H;  2LM9 A;  2H7O A;  2LE8 A;  1HCI A;  1LKX A;  4IE5 A;  4KUM B;  3A5X A;  3RX6 A;  3J7Y q;  4H9N C;  3N9Q A;  2JMH A;  2D0T A;  4UVA B;  3AAA B;  5L3B B;  4UV8 B;  5LBM A;  4HFV A;  2XAJ B;  3AA0 B;  3I0O A;  3ONX A;  2WSS V;  5TAO A;  4PJN A;  4DND A;  3O1J A;  5LCY A;  4ZI2 D;  4YJ3 E;  2SPC A;  2WWU A;  5JDM A;  4O8S A;  3V5S A;  5DQV A;  5KDM C;  1D0X A;  5JDL A;  2JJ9 A;  4WNK A;  2EHO C;  5IYZ E;  2JRK A;  3M65 A;  5HWY A;  3PU3 A;  3HKB E;  5HXH A;  1V9D A;  1BR2 A;  3N2G E;  4TV9 E;  3ZYL A;  4EYY R;  3DJB A;  2V1D B;  3O1H A;  3ZMV B;  4I4T E;  3MAC A;  3MK7 C;  4OK0 A;  3KBT A;  4H63 V;  5DJQ C;  4C90 A;  3VHL A;  4PFP A;  5JRE A;  3C51 A;  2K5B B;  2LSG A;  1S94 A;  3N2K E;  2RP4 A;  4WBO A;  2KXP B;  2KZ7 B;  1US7 B;  5LP6 E;  4AKH A;  4H9S E;  4PK4 A;  5KX5 E;  2KLQ A;  2MBG A;  3ZPO A;  2LOS A;  1D1C A;  2OA5 A;  3HR0 A;  1D1B A;  3OYX A;  2LSY A;  3P8C D;  2CXF A;  2A3D A;  2H3R A;  2HPJ A;  2G0U A;  4L0R A;  1MND A;  2NOX A;  3FXE B;  2DLR A;  2Q9Q A;  3QC9 A;  2L8K A;  5FXX A;  2M67 A;  4QWN B;  3I9W A;  1LVF A;  3R84 B;  5JVD E;  3ZYK A;  3AAI A;  3PUS A;  2C5J A;  3N2O A;  2X9Y A;  4P0A A;  2CM0 A;  3MZK B;  1MMD A;  2VKD A;  5EK4 A;  5J1G A;  1X79 A;  2I59 A;  3RKO A;  3UUN A;  2Q9Q D;  3EVY A;  2Z6E A;  4ANJ A;  1FIO A;  5JRC A;  2ZM8 A;  3C4X A;  5LJN A;  2DWK A;  4GIW A;  4JEU B;  4O4H E;  5LGN B;  3RYF E;  3SRZ A;  5E0O A;  2LEH A;  2N9D A;  4EB6 E;  5JDG A;  5A1L A;  3KBU A;  4ZHQ E;  3O9X A;  5ADX L;  2XAS B;  3AVR A;  2LHN A;  4U72 A;  4AXP A;  4QX7 B;  3HI2 A;  5FY1 A;  3HA4 A;  3WAJ A;  1FMW A;  4UF0 B;  2XAF B;  2VKJ A;  4ZS2 A;  4O4J E;  3H37 A;  4IIJ E;  3IHR A;  2N1G A;  2A2F X;  3C98 B;  3D0T A;  4G2A A;  3CQX C;  4AKI A;  2PFV A;  3PU8 A;  3AAE B;  4QKN A;  2VB6 A;  2XTL A;  1HTJ F;  1ZV4 X;  2ODV A;  2DHR A;  4HKA A;  4OHF A;  4BJM A;  2X68 A;  2Y48 B;  4IST A;  2XHE B;  2E9X C;  1HFA A;  4TZ4 C;  4EXT A;  4UV9 B;  3W15 B;  3N9M A;  4XAX B;  3GN5 A;  2CXL A;  3KV6 A;  3S4U A;  2EHO A;  4E7S A;  4BJN A;  4PK5 A;  2X66 A;  4ZI3 C;  3V5U A;  5FMN A;  3C4Z A;  4EZ4 A;  1WYB A;  3OYZ A;  2X9W A;  2W61 A;  1LVK A;  2V7J A;  4J2C A;  3HL6 A;  1D0Z A;  5H6Q B;  3Q9D A;  3VKH A;  2EHO D;  2CCQ A;  2V7K A;  3CX7 B;  3IBP A;  4JUY A;  4QHO A;  4TUY E;  3VKG A;  5C8Y E;  3NRX A;  4P0B A;  3ETU A;  5HXS A;  2PJQ A;  1CUN A;  2W00 A;  5EK3 A;  1D1A A;  2IC6 A;  3ZCI A;  3FBZ A;  5LGU B;  4GK0 E;  2QA7 A;  4PK6 A;  3OKQ A;  1S35 A;  3NBX X;  1WR6 A;  3F57 A;  2ES0 A;  3LJC A;  4O4L E;  4IE7 A;  4QXC B;  4CXX A;  1WRD A;  3VU7 H;  5FXZ A;  1VRB A;  2X51 A;  4OFZ A;  5FY0 A;  3ETV A;  3ZEF B;  5LBQ B;  2CWY A;  2IC9 A;  1YKH B;  3CKD A;  3ZMZ B;  2CA5 A;  5LHG B;  2LJL A;  4QXB B;  3N9N A;  3ZN0 B;  1O3X A;  4IGU A;  3N9O A;  5L3E B;  3UTK A;  2NTY A;  3RC3 A;  1BR4 A;  4L9I A;  1MIW A;  4WW0 A;  4BA9 A;  4GOU A;  4TX5 A;  2WAU A;  2W63 A;  2XQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...