1NWMX

Gat domain of human gga1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
112
structure length
105
Chain Sequence
b'LRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA1
publication title Structure of the GAT domain of human GGA1: a syntaxin amino-terminal domain fold in an endosomal trafficking adaptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 44
structure length 105
sequence length 112
ec nomenclature
pdb deposition date 2003-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF03127 GAT GAT domain
X PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1nwmX00
2N2NA 2N9DA 1NAFA 1WRDA 1OXZA 1YD8G 1WR6A 1O3XA 1X79A 1NWMX
chains in the Genus database with same CATH superfamily
3AAEB 4TZ4C 3ZN0B 2N1GA 2W61A 3C64A 1VOMA 5FL0A 1X9BA 3AECA 4NPPA 2XTLA 2BDEA 2HH7A 5FY0A 2WP9A 4IDNA 4JBWF 4UVBB 3NZPA 1OEDA 5FVKA 2E9XB 4YHHT 2VQFT 5LYJE 3ZPOA 3RYIE 2L3LA 2MAWA 3AA6B 3KDSE 1MNDA 2JQQA 3CMLA 5HEUA 5AQVB 3O1HA 2DWKA 3TKLB 3FXEB 4LMJA 1MMAA 4DV0T 2XQ4A 2CPTA 2YKSA 1NEKA 1W0BA 1OEDE 4OHFA 4TX5A 1E2AA 1U5PA 5LNKA 2YU1A 4X1KE 2LLYA 3ZMVB 2AE9A 2YINA 4HKAA 2QYWA 2UUBT 4UV9B 3I0OA 3ZMTB 3IHRA 2Y6XA 3P4QA 3BQKA 3R84B 5LOVE 5KX5E 3AAIA 2W4XA 4AXPA 3B5MA 2KINB 2NW7A 3H3MA 1KF6A 2CXFA 4O4LE 3RQWA 1WYBA 2V7LA 4PJJA 3PUXF 5AQIB 2V5CA 1ZOYA 3T1HT 2LKHA 4YJ3E 3C4ZA 2V26A 1OEDB 1KNZA 4G63A 5JDGA 3CIRA 3N9OA 3N2KE 1XNRT 2XUEA 1KEYA 4KI0F 2LSGA 2Q9QD 3ZSSA 3C98B 1V9DA 1HX1B 4K0UA 4IE4A 3S4UA 4UF0A 3GMIA 4ILBA 2PG8A 2H7OA 3VHLA 4ISSA 2PJQA 4ANJA 4EYUA 4CXWA 4ZOLE 1OEDC 4EOZB 3Q9DA 4AKIA 3RYFE 4H9RC 1D0YA 3ONJA 5L4EA 2C0SA 2CLYB 2IIUA 1WYCA 3AE6A 4JI1T 4DMWA 3JADA 3AVSA 4GOUA 4XZCA 2W67A 1Z0PA 3SFDA 2BBHA 1Y64B 5FXXA 2E5VA 3QK6A 4YTMA 4CQIA 4Z91A 5FY7A 3ESLA 5HXRA 4N78D 1VRBA 5LHIB 2CBJA 3M65A 3RQUA 4YSZA 4ZI3D 5IYZE 3AEGA 3UFGA 5AQGB 2LSYA 2YEVC 4DV7T 4AKRB 3ZMUB 4UVCB 5LB7B 2LEHA 4EAHA 3UTKA 4ZI2C 4QWNB 3PUAA 1MIVA 5AQRB 2DHRA 5JQGE 3H37A 4L5GA 2F4VT 1N33T 3B13A 3PURA 3ZMZB 5JR9A 4QX7B 4UF0B 4BAYB 4X66T 1L0VA 3QNUA 4H9OC 4UEMA 1NENA 5C3JA 2N9DA 2CM0A 4DV4T 3LDQB 4P0BA 4EYYR 1HS7A 4DBRA 4PFOA 3F2EA 3AE5A 3RH3A 4ILCA 2K3WA 3RRCA 4DIDB 5IHYA 3ZMSB 4DNDA 4I50E 2VL0A 4U2YA 1SUMB 3UUXB 4AQYT 2BG9B 4O2AE 3PU8A 4EXTA 3RX6A 4YLHA 2WDRA 3KVAA 5FNVE 1WR6A 2JMKA 2RPAA 4JEUB 2LOSA 3KBUA 4GKJT 3OBVE 2W00A 2XQAA 4C91A 4QXBB 2FJAA 3UQ7A 3UU8A 5LG4A 4J2CA 4AKLA 1T72A 5EK2A 2MPKA 5BR8T 3RRWA 2XQYA 4PNIA 3OYZA 2KWHA 1ZHCA 2OLTA 3UU5A 4O4IE 3TLTA 2IDOB 4X62T 3KV6A 3A7MA 5CFBA 2BBJA 5JR9B 5FXVA 4YJ2E 3SS1A 4H63H 2D0TA 4CZZB 4JLEA 3K1SA 2XHEB 2JJ9A 2CCQA 3AEFA 4DUYT 1E7PA 2VKJA 4HWHA 1LVFA 4LF4T 2NW9A 5CB4E 2WAUA 5AFUL 3ZC0A 4BA9A 4OYKA 4MFRA 4IT4A 3LJCA 2GK9A 4Q25A 5JR9C 3KBTA 4IE5A 4B3ST 4DR4T 1D1BA 3FZLB 4JV5T 1YQ3A 5L3DB 3FXDB 1BR0A 4GYSA 2NR4A 2X51A 1NWMX 3IF8B 1HG5A 3E22E 2JIWA 4DR7T 3FHNA 1M62A 2C5IT 3UULA 2M67A 4IREA 3ZJ2A 2WB5A 3EHZA 1N32T 3NRXA 2UXNB 1AJ3A 1HG2A 5HWXA 3WI3A 4EV6A 5LBQB 2JQ9A 1HFAA 1IBLT 5KMGP 4JI7T 3UU6A 3A5XA 4TV9E 2KWIB 3VKGA 2K5BB 3I1AA 4U74A 3N5LA 1ZKEA 2EHOD 2YOEA 3ZT7A 2E9XA 2X9XA 3C51A 2FBWA 1I94T 2BS3A 2Q9QA 4HN9A 4HWCA 2H88A 2E8IA 4KX6A 4OX9T 4YHJA 3EAMA 2V7KA 3VKHA 4NUUA 3CKDA 2XSBA 3FZFB 3UU4A 4ZZCA 2YK0A 1YKHB 4TNVA 2A9UA 3VRBA 2W66A 5H6RB 1WFDA 4JUYA 4JI8T 5HWYA 3JC6D 5J0ZA 3KV5A 2CRBA 2D2SA 4X64T 3ZCIA 2DNXA 4QX8B 1US7B 1ZP0A 2VVNA 3CQXC 2A3DA 2IC9A 1MMGA 4F6RC 3GWHA 3MACA 5L2LA 5IUXA 5ADXL 3ANWA 3RIFA 3UU3A 5JRCA 3ETUA 1IAPA 2PBIA 3JAFA 4ADZA 1D0ZA 4DR3T 2YDSA 3BQLA 2UU9T 2WZHA 4GK5E 3NWIA 4GKKT 1OWAA 4O2BE 5LP6E 5AQLB 2XQ3A 2LM2A 1FIOA 5IWAT 2BKOA 4U7YA 5LMNT 2Q9QB 2DCFA 5L3EB 1IZNB 4H63V 3AE8A 4HFDA 5L47A 5AQPB 2A72A 3HL6A 5DQVA 2NWBA 3SWHA 2VKOA 2QRXA 4X1YE 4A98A 4NUVA 4LFCT 1B7TA 4PAGA 5E0OA 1SHZC 1NAFA 2CWOA 3LK2B 5AQQB 4ZEYA 2E9XC 2CA5A 5JDMA 2VKDA 1IBKT 3ONXA 2KT9A 2Q9QC 3RKOA 5KXJA 3ZT6A 4TWDA 3EDVA 4JI0T 3H3AA 5JTGA 2WBLA 1J5WA 4U3CA 3E08A 4B3TT 2WDVA 3ANWB 2XPKA 2B1EA 3HKDE 2NW8A 5JRCB 3L09A 2BVLA 4UR9A 3KVBA 4LF8T 2VL8A 4L0RA 1HNXT 3AA1B 4O4JE 4LF5T 4I0UA 2B76A 5JREA 1SE7A 2ZLYA 4U7IA 1WR0A 4EZHA 4PK6A 5LJNA 3EI0A 2E5LT 3PJAJ 2VASA 4LFBT 5L3FB 2VKHA 3QOFA 3N9NA 4MHCA 2WY2A 2X0HA 3NKZA 1VCTA 4YT0A 2WM9A 2CXLA 4WYVA 3ZYLA 2CEAA 5JDLA 2VK9A 3L3PA 3FB2A 3JAEA 3NRYA 2JQKA 5AQJB 5AQMB 2MBGA 5BMVE 3CPZA 3RHWA 5JDNA 4GIWA 5A1LA 4PJMA 3C4WA 4U72A 4K0KT 3BQIA 3ZLIA 2C5KT 3F57A 3CQGB 2ZM2A 1G8XA 3VR8A 5FVLA 4KHZF 3HR0A 2YN6A 3DTOA 2W62A 2X67A 5FKYA 4PJNA 1S35A 3AE9A 3LG7A 5LXTE 2WU2A 3N9LA 2BG9A 3F31A 5J1GA 1N34T 1D1AA 3RLFF 2LE8A 4DV1T 1LVKA 2QVAA 2X9HA 5HEOA 2CLYC 4QH1A 1XMQT 5ABGA 2X66A 4H9PC 4AQGA 4KUMB 3ONLC 4JYAT 3C4XA 4TWFA 3KV9A 4HEAA 3CVRA 2X0YA 3J7Yq 2ES0A 3O4XE 1HR0T 3AA0B 4UXNB 3LBXB 4A5XA 2LOPA 5FYMA 3OKQA 4AIUA 4ZI7E 4M1PA 2BG9E 5EK3A 1W9RA 2EHOA 2XAHB 4QH5A 2JMHA 3X1DA 2CHOA 2V7JA 3ZT5A 5DABA 3PUYF 1X79A 2RA1A 3SFEA 2VB6A 1SA0E 4IGUA 4IDOA 4L9IA 3V5SA 3TLUA 4CI1B 3NVOA 3RGLA 4WBNE 3AEDA 3O1JA 2FUPA 1LKXA 4KBMB 3QB5K 4NXNT 1UK5A 2CBIA 1FMWA 4TUYE 1W0AA 4HFVA 4DR6T 4CXYA 1CHUA 3AE7A 4FI5A 5HXHA 1Z8UA 5JDFA 4ZI2D 5ABEA 4DR5T 4WW0A 4G2AA 1N36T 2J62A 1UX5A 3HA4A 3TLWA 3N9MA 5HXCA 3WAJA 3W15B 4ZS3A 3AB3B 3CK6A 2H89A 2XQ5A 5EZYE 4TN7B 4HFCA 3DJBA 4X5TA 1YW0A 2CXDA 3I0QA 1T98A 3K8PC 2BG9C 3OYXA 4HTEA 2DWGA 4ILAA 2K24A 2JQHA 3EABA 1JNZA 3FBLA 5J2UE 2HPJA 2IHR1 2EHOB 4DV2T 5HEGA 5FL1A 4AI6A 2LSKA 1T8BA 2OV9A 4WBOA 4GK0E 5FMNA 3O9XA 2W0GA 5GONE 1D0XA 3OPCA 3VR9A 5ETWA 4PW8A 2K9AA 2V6YB 2BZBA 2NTYA 2XAJB 2XQ8A 2LJLA 4MBQA 3P7IA 4GYRA 3HKEE 5AQTB 2EHOC 2KSRA 1BR4A 5AQSB 3Q2MA 2FJDA 4AISA 2DI4A 2LHRA 1FEWA 5DQWA 4ZHQE 3AAAB 2H3RA 5CA1E 4IE0A 4FJOA 3QC9A 3UUNA 2IMLA 5L3CB 2A2FX 2NP9A 5LHHB 2UUAT 1HF8A 3P8CD 2M6BA 4IHJE 3ZCJA 5L4HA 3JC6C 2WWUA 2KNDA 4A56A 5CJ5A 3TLVA 4LF6T 2D5UA 1YQ4A 4ZS2A 4KP3C 2ZMAA 3N9PA 3AVRA 2KXPB 1MMNA 2JPFA 3KV4A 2ODUA 4P0AA 3SOLA 4I4TE 2YDRA 4EEBA 2WQYA 3AXJB 4ILUA 3TLSA 1YD8G 1HTJF 1IJ6A 2XY8B 4PK4A 5FY1A 4PK5A 3L8RA 3EUHA 1WCRA 5LGUB 2NTXA 4O8SA 2BVMA 2LRKA 5HXSA 1UGOA 2WSSV 3G06A 2UXXB 3AA7B 3RIAA 5AQKB 2PTFA 4EIWA 2UXBT 3ZSTA 2LKGA 3M3ZB 2D9DA 5HCMA 3K3QC 2VURA 3ZJ1A 4I55E 2IUBA 4JI4T 2LT3A 3P4WA 4DVDA 3RF1A 2HHHT 2VVSA 3L39A 1XDPA 3ZYMA 2L8KA 3PUWF 4IE6A 2P9BA 2DLRA 5C2TA 5F8PA 1EZ3A 3E0ZA 3HKBE 4DUZT 4IL9A 4MLKA 5L3GB 2C5JA 4DMVA 5LCYA 5M4YA 3BK9A 5TAOA 3AE3A 3P4RA 3MZKB 3CQCB 2H7VC 1UX4A 2OA5A 2I6HA 2NOXA 1J1JA 4JI6T 4IL4A 2IAKA 4DBQA 5CGMA 1IJ5A 2CWYA 1J5ET 2MYSA 2LSJA 3AE4A 5LGNB 3O1IA 5JH7E 5DJQC 5ABHA 3RYHE 1QSDA 2V5DA 3MJXA 3ETVA 3N2OA 3D0TA 3RC3A 4YSXA 4UVAB 3K3NA 2JRKA 3U78A 3T8OA 4IDQA 5FP3A 4ASKA 5LBMA 2ZM0A 2HN1A 2YDQA 1MIWA 3AEEA 3VU7H 1UCUA 1E1HB 4JI2T 3Q5DA 3RYCE 5LJMA 1WRDA 2Z6EA 1KFYA 4CN1A 4LMKA 2XM1A 3AEBA 2XQ6A 4U33A 2V1DB 5AQOB 3HI2A 1HNWT 2WMOA 3RKGA 4H9QC 2ACXA 1BR1A 2BS2A 4COFA 2BKPA 4B3RT 4AKHA 3OJAA 3T1YT 3N9QA 3IBPA 3AEAA 2XJ7A 3AE1A 4YTPA 5HEJA 2LM9A 4ISTA 4Z8XA 5FXZA 1CUNA 4H9SE 4CN4A 3CWZB 3C50A 2J4GA 2QGSA 2V6XA 1XMOT 4OFZA 4NXMT 5L3BB 2SPCA 2Y48B 1LRZA 2IW5B 2WU5A 3IA3A 2XAGB 1YXRA 3ZKRA 2XZEA 2J47A 4EB6E 4EGWA 2MTQA 2E2AA 3LBXA 5KDMC 4ZI3C 1R8IA 2BS4A 5ABFA 3GN5A 4DV6T 2E9XD 3FZHB 4HFBA 4QXCB 2ACZA 4DO0A 1O3XA 3UUMA 3PUSA 4YY3T 3OVUA 1KK7A 3CX6B 1XZYA 1UUSA 2LRLA 1MNEA 4HGAA 2XAFB 2VQET 4KMCA 4Z90A 5HYAA 3I9YA 4PJLA 3CX7B 4OK0A 4HE8A 2V7MA 1QUUA 1MIYA 3RPUA 4JI3T 4KHPT 4QKNA 3PJAA 2V7IA 5JDQA 5HXEA 3PTRB 2UXCT 4XBFB 3SRZA 4P09A 3MXZA 4B3MT 5J2TE 1MMDA 4AQFA 4DV3T 2Y8DA 3RIUA 5AQHB 1HCIA 5F3JA 1UURA 4PFPA 3FZMB 3PE0A 2WS3A 5LMUT 3ABVA 2DL1A 3B57A 3UUBA 3JCFA 3MK7C 3AE2A 2CHNA 3HKCE 1VCSA 4YXDA 3GA8A 2XASB 1GQEA 5ABFB 3GN5B 3OTOT 1HX8A 2LSIA 2X9WA 2I59A 4A97A 3P4PA 3UFEA 2W63A 4X20E 4DR1T 2XM2A 2V6YA 2KMFA 4CN6A 4CI3B 1XWMA 1I6ZA 2HPLA 3NZQA 2CE7A 1KNPA 2AXDS 4HWIB 1DU2A 1XDOA 1OXZA 4F8HA 1YKEB 1FMVA 3P50A 1KNRA 4V1Av 4OYJA 3RC8A 4MALA 3CX8B 4IDPA 3MA9A 1M7KA 3LK42 2MOZA 5EK4A 4HFIA 2R6GF 3A8YC 4U2ZA 2LHNA 2WCAA 3I9WA 3FBZA 1HNZT 4YFSA 2K48A 3PV0F 5AQUB 2XQ9A 5AQFB 1IBMT 4JEHB 2X68A 4YSYA 1FJGT 3PUZF 5LA6E 4UELA 2BKNA 3PUGA 3KFWX 3MKDA 2KLQA 2KZ7B 3R6NA 4BJNA 2I0MA 3NBXX 4TNWA 3ZN1B 4IIJE 4AQFC 2XQ7A 3RIUC 3AXJA 1WLXA 2N2NA 4X65T 4HFEA 5HCJA 2G0UA 2WMNA 4XAXB 5FXWA 4EEDA 5F5WA 4E7SA 5C8YE 3QB5A 4LF7T 2L9QA 4EZ4A 2D0UA 4ZZBA 4LF9T 3V5UA 1BR2A 5HEHA 4DR2T 2WWVA 1JNRA 3PU3A 4I43B 4CI2B 3Q5WA 4O4HE 3UT5E 3LSVA 3DP7A 5LG3A 3N2GE 2ODVA 5LGTB 2ZM6T 3IEEA 3PDYA 4U31A 5CA0E 1W09A 4E7ZA 1D1CA 5LHGB 1U4QA 1ZV4X 2WZIA 4QXHB 2ZM8A 5JDHA 4CXXA 4TWHA 3U3IA 3VRAA 3EVYA 3LK3B 3UQ4A 2IC6A 4P1NA 5H6QB 1G73A 1ZEEA 2X9YA 2PFVA 3FZKB 3WAKA 2UXDT 2CMRA 2FJBA 4ERRA 4IE7A 3Q5XA 4WNKA 5AQNB 1Y01A 2X0LB 1T7SA 2WDQA 3PUVF 4IDZA 2YU2A 4QHOA 1H7CA 4AKGA 4ZXLA 4LFAT 2RP4A 4C90A 2VWAA 3LFMA 4TV8E 2FJEA 4JI5T 3ZC1A 4WZXA 2W2UA 3Q5EA 4H9NC 2XAQB 3PUQA 5JVDE 1S94A 3J9X1 5HAXA 4NIQA 2XSAA 3RI5A 4HWFA 3P4SA 3ZYKA 4UIGA 1QLBA 2HN2A 4HWDA 4QH4A 4B6XA 2J1DG 3QUJA 4LMLA 3ZEFB 4X1IE 4HFHA 2QA7A 2V8SV 3K3OA 4UV8B 4BJMA 2M6IA 3KINB 2UUCT 4DV5T 1XNQT 3EDUA 4YTNA
chains in the Genus database with same CATH topology
2E9XD 3AAEB 3IF8B 4TZ4C 3O1JA 4QXCB 3ZN0B 4DO0A 2N1GA 1HG5A 4WBNE 2W61A 1O3XA 3UUMA 3C64A 3PUSA 1VOMA 1KK7A 3E22E 3CX6B 3FHNA 2XTLA 2C5IT 2BDEA 1LKXA 2HH7A 5FY0A 3UULA 2M67A 4UVBB 1MNEA 3NZPA 4KBMB 3ZJ2A 3NRXA 4HGAA 1FMWA 2E9XB 2XAFB 4TUYE 5LYJE 2UXNB 4HFVA 1AJ3A 3ZPOA 3RYIE 4CXYA 1HG2A 2L3LA 5HWXA 3WI3A 4FI5A 5LBQB 5HXHA 3AA6B 3KDSE 4KMCA 5JDFA 1MNDA 2JQQA 4ZI2D 5HYAA 1HFAA 3I9YA 4WW0A 5KMGP 4G2AA 3CMLA 4PJLA 1UX5A 3CX7B 3A5XA 3HA4A 4OK0A 4TV9E 4HE8A 2KWIB 2V7MA 3VKGA 3N9MA 1QUUA 1MIYA 5HXCA 2K5BB 3O1HA 4QKNA 3RPUA 3W15B 3WAJA 4ZS3A 3I1AA 4U74A 3AB3B 2V7IA 3N5LA 1ZKEA 5JDQA 2DWKA 5HXEA 3PTRB 2EHOD 5EZYE 4XBFB 4TN7B 3TKLB 2E9XA 2X9XA 3C51A 3SRZA 3DJBA 4P09A 3FXEB 3MXZA 1YW0A 2CXDA 3I0QA 5J2TE 1MMAA 1T98A 2Q9QA 3K8PC 1MMDA 3OYXA 4HN9A 4HTEA 4AQFA 2E8IA 2DWGA 2Y8DA 2K24A 3FBLA 5J2UE 1HCIA 5F3JA 4YHJA 2HPJA 4OHFA 4PFPA 4TX5A 3PE0A 1U5PA 2EHOB 2V7KA 5LNKA 3VKHA 4NUUA 2YU1A 4X1KE 3CKDA 2YK0A 1YKHB 3ZMVB 4AI6A 2LSKA 4WBOA 4GK0E 5FMNA 3O9XA 2W0GA 3B57A 5GONE 2YINA 4HKAA 1D0XA 3MK7C 4UV9B 5H6RB 4JUYA 3HKCE 5HWYA 3JC6D 5ETWA 3I0OA 3KV5A 2K9AA 3IHRA 4PW8A 2Y6XA 3ZMTB 3GA8A 3BQKA 2D2SA 3R84B 3ZCIA 2XASB 5LOVE 2BZBA 2DNXA 5KX5E 2NTYA 4QX8B 3AAIA 2XAJB 3GN5B 2LJLA 1US7B 4AXPA 4MBQA 1HX8A 2KINB 2NW7A 3P7IA 2LSIA 2X9WA 3CQXC 2CXFA 2I59A 4O4LE 4GYRA 3HKEE 2EHOC 2A3DA 2IC9A 1WYBA 1BR4A 1MMGA 2V7LA 4PJJA 2W63A 3UFEA 3GWHA 4F6RC 4X20E 3Q2MA 3MACA 5L2LA 4YJ3E 2DI4A 2KMFA 2LHRA 2V26A 3C4ZA 5ADXL 1FEWA 5DQWA 4CI3B 4ZHQE 3ANWA 3AAAB 1KNZA 4G63A 5JDGA 3N9OA 3N2KE 2H3RA 5CA1E 2HPLA 4IE0A 5JRCA 4FJOA 3NZQA 3ETUA 2CE7A 2XUEA 3QC9A 1IAPA 2LSGA 2PBIA 3UUNA 5L3CB 4ADZA 2Q9QD 3C98B 3GN5A 1D0ZA 1V9DA 4K0UA 2A2FX 4IE4A 3BQLA 1OXZA 2NP9A 4GK5E 3S4UA 5LHHB 4UF0A 1HF8A 3GMIA 3P8CD 2PG8A 4IHJE 3ZCJA 1YKEB 2H7OA 3VHLA 1OWAA 4O2BE 5LP6E 4ISSA 1FMVA 2PJQA 4ANJA 3JC6C 4EYUA 2WWUA 4V1Av 4OYJA 1FIOA 4CXWA 2KNDA 3RC8A 4MALA 4A56A 2D5UA 3CX8B 4ZOLE 2Q9QB 3MA9A 2DCFA 5L3EB 1IZNB 4H63V 4ZS2A 4KP3C 3LK42 4EOZB 2ZMAA 3Q9DA 3N9PA 2MOZA 3AVRA 5EK4A 4AKIA 2A72A 3HL6A 3RYFE 4H9RC 1D0YA 5DQVA 2NWBA 3SWHA 2VKOA 2KXPB 4X1YE 1MMNA 2C0SA 2CLYB 2JPFA 3KV4A 2ODUA 4P0AA 1WYCA 2LHNA 3I9WA 3FBZA 4I4TE 3SOLA 4DMWA 4NUVA 1B7TA 4YFSA 2K48A 4PAGA 3AVSA 4GOUA 4ILUA 4XZCA 5E0OA 1SHZC 1NAFA 1YD8G 2CWOA 1HTJF 1IJ6A 3LK2B 4JEHB 1Z0PA 2X68A 1Y64B 2E9XC 2CA5A 5FXXA 5JDMA 4PK4A 3QK6A 4CQIA 5LA6E 5FY1A 2VKDA 4UELA 3PUGA 3KFWX 3MKDA 4PK5A 5FY7A 2KLQA 3ESLA 2KZ7B 3ONXA 5HXRA 3R6NA 3EUHA 2KT9A 2Q9QC 1VRBA 4N78D 4BJNA 3RKOA 3NBXX 5LGUB 5LHIB 2NTXA 3EDVA 4IIJE 3M65A 4O8SA 3ZN1B 4AQFC 3H3AA 2BVMA 4ZI3D 5IYZE 5HXSA 1WLXA 2N2NA 2G0UA 2WSSV 2WMNA 4XAXB 5FXWA 2UXXB 2LSYA 2WBLA 2YEVC 3AA7B 4AKRB 3ZMUB 4UVCB 4EIWA 4E7SA 2LEHA 4EAHA 3E08A 5C8YE 3UTKA 4ZI2C 4QWNB 3ANWB 2B1EA 2L9QA 4EZ4A 3PUAA 2D0UA 3HKDE 3K3QC 1MIVA 2NW8A 3ZJ1A 5JRCB 3L09A 3V5UA 1BR2A 2BVLA 4I55E 3KVBA 2VL8A 2DHRA 5JQGE 3PU3A 3H37A 4L5GA 4I43B 4CI2B 3Q5WA 4L0RA 3B13A 4O4HE 3UT5E 3AA1B 3PURA 4O4JE 3ZMZB 2LT3A 3DP7A 5JR9A 4QX7B 4UF0B 4BAYB 3N2GE 5JREA 2ZLYA 2ODVA 4DVDA 4EZHA 4PK6A 5LGTB 4H9OC 3IEEA 5LJNA 3PDYA 2VASA 3ZYMA 2L8KA 5CA0E 5L3FB 2VKHA 4UEMA 4IE6A 2P9BA 2DLRA 2N9DA 2CM0A 4E7ZA 5F8PA 1EZ3A 3N9NA 4P0BA 4EYYR 1HS7A 4MHCA 3E0ZA 4DBRA 1D1CA 3HKBE 5LHGB 1U4QA 4MLKA 4PFOA 3F2EA 5L3GB 1ZV4X 2WM9A 2CXLA 2C5JA 3ZYLA 4DMVA 4QXHB 2ZM8A 2CEAA 5JDLA 5JDHA 2VK9A 3L3PA 4CXXA 5LCYA 3FB2A 5M4YA 3RH3A 3BK9A 5TAOA 3MZKB 3CQCB 3U3IA 3NRYA 3EVYA 2H7VC 3LK3B 3RRCA 2MBGA 1UX4A 2IC6A 5IHYA 2OA5A 3ZMSB 4DNDA 5BMVE 3CPZA 5H6QB 1G73A 1ZEEA 2NOXA 4I50E 5JDNA 2X9YA 4GIWA 2PFVA 2IAKA 4DBQA 1IJ5A 2CWYA 3WAKA 2CMRA 2MYSA 3UUXB 2LSJA 5A1LA 4PJMA 4ERRA 4IE7A 5LGNB 3O1IA 4O2AE 3C4WA 5JH7E 5DJQC 4U72A 3Q5XA 3PU8A 4EXTA 3BQIA 3RYHE 4WNKA 3ZLIA 2C5KT 3RX6A 3F57A 4YLHA 3CQGB 1QSDA 3MJXA 3KVAA 3ETVA 5FNVE 2ZM2A 1WR6A 2JMKA 2X0LB 1G8XA 3N2OA 2LOSA 4JEUB 3KBUA 3D0TA 3RC3A 4UVAB 3HR0A 3OBVE 2W00A 4IDZA 2YU2A 3DTOA 2W62A 3K3NA 4C91A 4QXBB 2JRKA 2X67A 3U78A 3T8OA 4PJNA 5LG4A 1S35A 4J2CA 4QHOA 4AKLA 5FP3A 1H7CA 3LG7A 4ASKA 5LBMA 5LXTE 3N9LA 2ZM0A 5EK2A 1MIWA 3F31A 5J1GA 3RRWA 2XQYA 1D1AA 4PNIA 3VU7H 4AKGA 3OYZA 1UCUA 1E1HB 2KWHA 1ZHCA 2LE8A 1LVKA 3RYCE 4O4IE 5LJMA 2X9HA 1WRDA 2Z6EA 2RP4A 3KV6A 4C90A 2VWAA 2CLYC 3LFMA 2X66A 5JR9B 5FXVA 4TV8E 4H9PC 4YJ2E 3SS1A 4H63H 3ZC1A 2V1DB 3HI2A 2WMOA 2D0TA 4H9NC 4KUMB 2XAQB 4AQGA 4CZZB 3C4XA 4H9QC 3PUQA 4JLEA 2ACXA 1BR1A 3KV9A 5JVDE 4HEAA 3CVRA 1S94A 3J9X1 5HAXA 4AKHA 3OJAA 3J7Yq 2XHEB 2JJ9A 2ES0A 2CCQA 3N9QA 3IBPA 2VKJA 3O4XE 3ZYKA 4UIGA 3AA0B 4UXNB 3LBXB 1LVFA 2LM9A 4ISTA 2NW9A 2LOPA 4Z8XA 5FYMA 5FXZA 5CB4E 2WAUA 3OKQA 1CUNA 4B6XA 5AFUL 4H9SE 4M1PA 3CWZB 5EK3A 4ZI7E 2J1DG 3C50A 3ZC0A 3QUJA 4BA9A 2QGSA 2EHOA 2XAHB 4OFZA 4OYKA 5L3BB 2SPCA 2Y48B 1LRZA 4MFRA 2JMHA 2IW5B 3ZEFB 3LJCA 2XAGB 4X1IE 2GK9A 5JR9C 2V7JA 4EB6E 3KBTA 4IE5A 5DABA 2QA7A 1D1BA 2MTQA 1X79A 3K3OA 4UV8B 4BJMA 3LBXA 5KDMC 2RA1A 2VB6A 4ZI3C 5L3DB 1SA0E 3KINB 3FXDB 4IGUA 1BR0A 4L9IA 4GYSA 3V5SA 3EDUA 4CI1B 2X51A 1NWMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2N A;  2N9D A;  1NAF A;  1WRD A;  1OXZ A;  1YD8 G;  1WR6 A;  1O3X A;  1X79 A;  1NWM X; 
#chains in the Genus database with same CATH topology
 3AAE B;  4TZ4 C;  3ZN0 B;  2N1G A;  2W61 A;  3C64 A;  1VOM A;  5FL0 A;  1X9B A;  3AEC A;  4NPP A;  2XTL A;  2BDE A;  2HH7 A;  5FY0 A;  2WP9 A;  4IDN A;  4JBW F;  4UVB B;  3NZP A;  1OED A;  5FVK A;  2E9X B;  4YHH T;  2VQF T;  5LYJ E;  3ZPO A;  3RYI E;  2L3L A;  2MAW A;  3AA6 B;  3KDS E;  1MND A;  2JQQ A;  3CML A;  5HEU A;  5AQV B;  3O1H A;  2DWK A;  3TKL B;  3FXE B;  4LMJ A;  1MMA A;  4DV0 T;  2XQ4 A;  2CPT A;  2YKS A;  1NEK A;  1W0B A;  1OED E;  4OHF A;  4TX5 A;  1E2A A;  1U5P A;  5LNK A;  2YU1 A;  4X1K E;  2LLY A;  3ZMV B;  2AE9 A;  2YIN A;  4HKA A;  2QYW A;  2UUB T;  4UV9 B;  3I0O A;  3ZMT B;  3IHR A;  2Y6X A;  3P4Q A;  3BQK A;  3R84 B;  5LOV E;  5KX5 E;  3AAI A;  2W4X A;  4AXP A;  3B5M A;  2KIN B;  2NW7 A;  3H3M A;  1KF6 A;  2CXF A;  4O4L E;  3RQW A;  1WYB A;  2V7L A;  4PJJ A;  3PUX F;  5AQI B;  2V5C A;  1ZOY A;  3T1H T;  2LKH A;  4YJ3 E;  3C4Z A;  2V26 A;  1OED B;  1KNZ A;  4G63 A;  5JDG A;  3CIR A;  3N9O A;  3N2K E;  1XNR T;  2XUE A;  1KEY A;  4KI0 F;  2LSG A;  2Q9Q D;  3ZSS A;  3C98 B;  1V9D A;  1HX1 B;  4K0U A;  4IE4 A;  3S4U A;  4UF0 A;  3GMI A;  4ILB A;  2PG8 A;  2H7O A;  3VHL A;  4ISS A;  2PJQ A;  4ANJ A;  4EYU A;  4CXW A;  4ZOL E;  1OED C;  4EOZ B;  3Q9D A;  4AKI A;  3RYF E;  4H9R C;  1D0Y A;  3ONJ A;  5L4E A;  2C0S A;  2CLY B;  2IIU A;  1WYC A;  3AE6 A;  4JI1 T;  4DMW A;  3JAD A;  3AVS A;  4GOU A;  4XZC A;  2W67 A;  1Z0P A;  3SFD A;  2BBH A;  1Y64 B;  5FXX A;  2E5V A;  3QK6 A;  4YTM A;  4CQI A;  4Z91 A;  5FY7 A;  3ESL A;  5HXR A;  4N78 D;  1VRB A;  5LHI B;  2CBJ A;  3M65 A;  3RQU A;  4YSZ A;  4ZI3 D;  5IYZ E;  3AEG A;  3UFG A;  5AQG B;  2LSY A;  2YEV C;  4DV7 T;  4AKR B;  3ZMU B;  4UVC B;  5LB7 B;  2LEH A;  4EAH A;  3UTK A;  4ZI2 C;  4QWN B;  3PUA A;  1MIV A;  5AQR B;  2DHR A;  5JQG E;  3H37 A;  4L5G A;  2F4V T;  1N33 T;  3B13 A;  3PUR A;  3ZMZ B;  5JR9 A;  4QX7 B;  4UF0 B;  4BAY B;  4X66 T;  1L0V A;  3QNU A;  4H9O C;  4UEM A;  1NEN A;  5C3J A;  2N9D A;  2CM0 A;  4DV4 T;  3LDQ B;  4P0B A;  4EYY R;  1HS7 A;  4DBR A;  4PFO A;  3F2E A;  3AE5 A;  3RH3 A;  4ILC A;  2K3W A;  3RRC A;  4DID B;  5IHY A;  3ZMS B;  4DND A;  4I50 E;  2VL0 A;  4U2Y A;  1SUM B;  3UUX B;  4AQY T;  2BG9 B;  4O2A E;  3PU8 A;  4EXT A;  3RX6 A;  4YLH A;  2WDR A;  3KVA A;  5FNV E;  1WR6 A;  2JMK A;  2RPA A;  4JEU B;  2LOS A;  3KBU A;  4GKJ T;  3OBV E;  2W00 A;  2XQA A;  4C91 A;  4QXB B;  2FJA A;  3UQ7 A;  3UU8 A;  5LG4 A;  4J2C A;  4AKL A;  1T72 A;  5EK2 A;  2MPK A;  5BR8 T;  3RRW A;  2XQY A;  4PNI A;  3OYZ A;  2KWH A;  1ZHC A;  2OLT A;  3UU5 A;  4O4I E;  3TLT A;  2IDO B;  4X62 T;  3KV6 A;  3A7M A;  5CFB A;  2BBJ A;  5JR9 B;  5FXV A;  4YJ2 E;  3SS1 A;  4H63 H;  2D0T A;  4CZZ B;  4JLE A;  3K1S A;  2XHE B;  2JJ9 A;  2CCQ A;  3AEF A;  4DUY T;  1E7P A;  2VKJ A;  4HWH A;  1LVF A;  4LF4 T;  2NW9 A;  5CB4 E;  2WAU A;  5AFU L;  3ZC0 A;  4BA9 A;  4OYK A;  4MFR A;  4IT4 A;  3LJC A;  2GK9 A;  4Q25 A;  5JR9 C;  3KBT A;  4IE5 A;  4B3S T;  4DR4 T;  1D1B A;  3FZL B;  4JV5 T;  1YQ3 A;  5L3D B;  3FXD B;  1BR0 A;  4GYS A;  2NR4 A;  2X51 A;  1NWM X;  3IF8 B;  1HG5 A;  3E22 E;  2JIW A;  4DR7 T;  3FHN A;  1M62 A;  2C5I T;  3UUL A;  2M67 A;  4IRE A;  3ZJ2 A;  2WB5 A;  3EHZ A;  1N32 T;  3NRX A;  2UXN B;  1AJ3 A;  1HG2 A;  5HWX A;  3WI3 A;  4EV6 A;  5LBQ B;  2JQ9 A;  1HFA A;  1IBL T;  5KMG P;  4JI7 T;  3UU6 A;  3A5X A;  4TV9 E;  2KWI B;  3VKG A;  2K5B B;  3I1A A;  4U74 A;  3N5L A;  1ZKE A;  2EHO D;  2YOE A;  3ZT7 A;  2E9X A;  2X9X A;  3C51 A;  2FBW A;  1I94 T;  2BS3 A;  2Q9Q A;  4HN9 A;  4HWC A;  2H88 A;  2E8I A;  4KX6 A;  4OX9 T;  4YHJ A;  3EAM A;  2V7K A;  3VKH A;  4NUU A;  3CKD A;  2XSB A;  3FZF B;  3UU4 A;  4ZZC A;  2YK0 A;  1YKH B;  4TNV A;  2A9U A;  3VRB A;  2W66 A;  5H6R B;  1WFD A;  4JUY A;  4JI8 T;  5HWY A;  3JC6 D;  5J0Z A;  3KV5 A;  2CRB A;  2D2S A;  4X64 T;  3ZCI A;  2DNX A;  4QX8 B;  1US7 B;  1ZP0 A;  2VVN A;  3CQX C;  2A3D A;  2IC9 A;  1MMG A;  4F6R C;  3GWH A;  3MAC A;  5L2L A;  5IUX A;  5ADX L;  3ANW A;  3RIF A;  3UU3 A;  5JRC A;  3ETU A;  1IAP A;  2PBI A;  3JAF A;  4ADZ A;  1D0Z A;  4DR3 T;  2YDS A;  3BQL A;  2UU9 T;  2WZH A;  4GK5 E;  3NWI A;  4GKK T;  1OWA A;  4O2B E;  5LP6 E;  5AQL B;  2XQ3 A;  2LM2 A;  1FIO A;  5IWA T;  2BKO A;  4U7Y A;  5LMN T;  2Q9Q B;  2DCF A;  5L3E B;  1IZN B;  4H63 V;  3AE8 A;  4HFD A;  5L47 A;  5AQP B;  2A72 A;  3HL6 A;  5DQV A;  2NWB A;  3SWH A;  2VKO A;  2QRX A;  4X1Y E;  4A98 A;  4NUV A;  4LFC T;  1B7T A;  4PAG A;  5E0O A;  1SHZ C;  1NAF A;  2CWO A;  3LK2 B;  5AQQ B;  4ZEY A;  2E9X C;  2CA5 A;  5JDM A;  2VKD A;  1IBK T;  3ONX A;  2KT9 A;  2Q9Q C;  3RKO A;  5KXJ A;  3ZT6 A;  4TWD A;  3EDV A;  4JI0 T;  3H3A A;  5JTG A;  2WBL A;  1J5W A;  4U3C A;  3E08 A;  4B3T T;  2WDV A;  3ANW B;  2XPK A;  2B1E A;  3HKD E;  2NW8 A;  5JRC B;  3L09 A;  2BVL A;  4UR9 A;  3KVB A;  4LF8 T;  2VL8 A;  4L0R A;  1HNX T;  3AA1 B;  4O4J E;  4LF5 T;  4I0U A;  2B76 A;  5JRE A;  1SE7 A;  2ZLY A;  4U7I A;  1WR0 A;  4EZH A;  4PK6 A;  5LJN A;  3EI0 A;  2E5L T;  3PJA J;  2VAS A;  4LFB T;  5L3F B;  2VKH A;  3QOF A;  3N9N A;  4MHC A;  2WY2 A;  2X0H A;  3NKZ A;  1VCT A;  4YT0 A;  2WM9 A;  2CXL A;  4WYV A;  3ZYL A;  2CEA A;  5JDL A;  2VK9 A;  3L3P A;  3FB2 A;  3JAE A;  3NRY A;  2JQK A;  5AQJ B;  5AQM B;  2MBG A;  5BMV E;  3CPZ A;  3RHW A;  5JDN A;  4GIW A;  5A1L A;  4PJM A;  3C4W A;  4U72 A;  4K0K T;  3BQI A;  3ZLI A;  2C5K T;  3F57 A;  3CQG B;  2ZM2 A;  1G8X A;  3VR8 A;  5FVL A;  4KHZ F;  3HR0 A;  2YN6 A;  3DTO A;  2W62 A;  2X67 A;  5FKY A;  4PJN A;  1S35 A;  3AE9 A;  3LG7 A;  5LXT E;  2WU2 A;  3N9L A;  2BG9 A;  3F31 A;  5J1G A;  1N34 T;  1D1A A;  3RLF F;  2LE8 A;  4DV1 T;  1LVK A;  2QVA A;  2X9H A;  5HEO A;  2CLY C;  4QH1 A;  1XMQ T;  5ABG A;  2X66 A;  4H9P C;  4AQG A;  4KUM B;  3ONL C;  4JYA T;  3C4X A;  4TWF A;  3KV9 A;  4HEA A;  3CVR A;  2X0Y A;  3J7Y q;  2ES0 A;  3O4X E;  1HR0 T;  3AA0 B;  4UXN B;  3LBX B;  4A5X A;  2LOP A;  5FYM A;  3OKQ A;  4AIU A;  4ZI7 E;  4M1P A;  2BG9 E;  5EK3 A;  1W9R A;  2EHO A;  2XAH B;  4QH5 A;  2JMH A;  3X1D A;  2CHO A;  2V7J A;  3ZT5 A;  5DAB A;  3PUY F;  1X79 A;  2RA1 A;  3SFE A;  2VB6 A;  1SA0 E;  4IGU A;  4IDO A;  4L9I A;  3V5S A;  3TLU A;  4CI1 B;  3NVO A;  3RGL A;  4WBN E;  3AED A;  3O1J A;  2FUP A;  1LKX A;  4KBM B;  3QB5 K;  4NXN T;  1UK5 A;  2CBI A;  1FMW A;  4TUY E;  1W0A A;  4HFV A;  4DR6 T;  4CXY A;  1CHU A;  3AE7 A;  4FI5 A;  5HXH A;  1Z8U A;  5JDF A;  4ZI2 D;  5ABE A;  4DR5 T;  4WW0 A;  4G2A A;  1N36 T;  2J62 A;  1UX5 A;  3HA4 A;  3TLW A;  3N9M A;  5HXC A;  3WAJ A;  3W15 B;  4ZS3 A;  3AB3 B;  3CK6 A;  2H89 A;  2XQ5 A;  5EZY E;  4TN7 B;  4HFC A;  3DJB A;  4X5T A;  1YW0 A;  2CXD A;  3I0Q A;  1T98 A;  3K8P C;  2BG9 C;  3OYX A;  4HTE A;  2DWG A;  4ILA A;  2K24 A;  2JQH A;  3EAB A;  1JNZ A;  3FBL A;  5J2U E;  2HPJ A;  2IHR 1;  2EHO B;  4DV2 T;  5HEG A;  5FL1 A;  4AI6 A;  2LSK A;  1T8B A;  2OV9 A;  4WBO A;  4GK0 E;  5FMN A;  3O9X A;  2W0G A;  5GON E;  1D0X A;  3OPC A;  3VR9 A;  5ETW A;  4PW8 A;  2K9A A;  2V6Y B;  2BZB A;  2NTY A;  2XAJ B;  2XQ8 A;  2LJL A;  4MBQ A;  3P7I A;  4GYR A;  3HKE E;  5AQT B;  2EHO C;  2KSR A;  1BR4 A;  5AQS B;  3Q2M A;  2FJD A;  4AIS A;  2DI4 A;  2LHR A;  1FEW A;  5DQW A;  4ZHQ E;  3AAA B;  2H3R A;  5CA1 E;  4IE0 A;  4FJO A;  3QC9 A;  3UUN A;  2IML A;  5L3C B;  2A2F X;  2NP9 A;  5LHH B;  2UUA T;  1HF8 A;  3P8C D;  2M6B A;  4IHJ E;  3ZCJ A;  5L4H A;  3JC6 C;  2WWU A;  2KND A;  4A56 A;  5CJ5 A;  3TLV A;  4LF6 T;  2D5U A;  1YQ4 A;  4ZS2 A;  4KP3 C;  2ZMA A;  3N9P A;  3AVR A;  2KXP B;  1MMN A;  2JPF A;  3KV4 A;  2ODU A;  4P0A A;  3SOL A;  4I4T E;  2YDR A;  4EEB A;  2WQY A;  3AXJ B;  4ILU A;  3TLS A;  1YD8 G;  1HTJ F;  1IJ6 A;  2XY8 B;  4PK4 A;  5FY1 A;  4PK5 A;  3L8R A;  3EUH A;  1WCR A;  5LGU B;  2NTX A;  4O8S A;  2BVM A;  2LRK A;  5HXS A;  1UGO A;  2WSS V;  3G06 A;  2UXX B;  3AA7 B;  3RIA A;  5AQK B;  2PTF A;  4EIW A;  2UXB T;  3ZST A;  2LKG A;  3M3Z B;  2D9D A;  5HCM A;  3K3Q C;  2VUR A;  3ZJ1 A;  4I55 E;  2IUB A;  4JI4 T;  2LT3 A;  3P4W A;  4DVD A;  3RF1 A;  2HHH T;  2VVS A;  3L39 A;  1XDP A;  3ZYM A;  2L8K A;  3PUW F;  4IE6 A;  2P9B A;  2DLR A;  5C2T A;  5F8P A;  1EZ3 A;  3E0Z A;  3HKB E;  4DUZ T;  4IL9 A;  4MLK A;  5L3G B;  2C5J A;  4DMV A;  5LCY A;  5M4Y A;  3BK9 A;  5TAO A;  3AE3 A;  3P4R A;  3MZK B;  3CQC B;  2H7V C;  1UX4 A;  2OA5 A;  2I6H A;  2NOX A;  1J1J A;  4JI6 T;  4IL4 A;  2IAK A;  4DBQ A;  5CGM A;  1IJ5 A;  2CWY A;  1J5E T;  2MYS A;  2LSJ A;  3AE4 A;  5LGN B;  3O1I A;  5JH7 E;  5DJQ C;  5ABH A;  3RYH E;  1QSD A;  2V5D A;  3MJX A;  3ETV A;  3N2O A;  3D0T A;  3RC3 A;  4YSX A;  4UVA B;  3K3N A;  2JRK A;  3U78 A;  3T8O A;  4IDQ A;  5FP3 A;  4ASK A;  5LBM A;  2ZM0 A;  2HN1 A;  2YDQ A;  1MIW A;  3AEE A;  3VU7 H;  1UCU A;  1E1H B;  4JI2 T;  3Q5D A;  3RYC E;  5LJM A;  1WRD A;  2Z6E A;  1KFY A;  4CN1 A;  4LMK A;  2XM1 A;  3AEB A;  2XQ6 A;  4U33 A;  2V1D B;  5AQO B;  3HI2 A;  1HNW T;  2WMO A;  3RKG A;  4H9Q C;  2ACX A;  1BR1 A;  2BS2 A;  4COF A;  2BKP A;  4B3R T;  4AKH A;  3OJA A;  3T1Y T;  3N9Q A;  3IBP A;  3AEA A;  2XJ7 A;  3AE1 A;  4YTP A;  5HEJ A;  2LM9 A;  4IST A;  4Z8X A;  5FXZ A;  1CUN A;  4H9S E;  4CN4 A;  3CWZ B;  3C50 A;  2J4G A;  2QGS A;  2V6X A;  1XMO T;  4OFZ A;  4NXM T;  5L3B B;  2SPC A;  2Y48 B;  1LRZ A;  2IW5 B;  2WU5 A;  3IA3 A;  2XAG B;  1YXR A;  3ZKR A;  2XZE A;  2J47 A;  4EB6 E;  4EGW A;  2MTQ A;  2E2A A;  3LBX A;  5KDM C;  4ZI3 C;  1R8I A;  2BS4 A;  5ABF A;  3GN5 A;  4DV6 T;  2E9X D;  3FZH B;  4HFB A;  4QXC B;  2ACZ A;  4DO0 A;  1O3X A;  3UUM A;  3PUS A;  4YY3 T;  3OVU A;  1KK7 A;  3CX6 B;  1XZY A;  1UUS A;  2LRL A;  1MNE A;  4HGA A;  2XAF B;  2VQE T;  4KMC A;  4Z90 A;  5HYA A;  3I9Y A;  4PJL A;  3CX7 B;  4OK0 A;  4HE8 A;  2V7M A;  1QUU A;  1MIY A;  3RPU A;  4JI3 T;  4KHP T;  4QKN A;  3PJA A;  2V7I A;  5JDQ A;  5HXE A;  3PTR B;  2UXC T;  4XBF B;  3SRZ A;  4P09 A;  3MXZ A;  4B3M T;  5J2T E;  1MMD A;  4AQF A;  4DV3 T;  2Y8D A;  3RIU A;  5AQH B;  1HCI A;  5F3J A;  1UUR A;  4PFP A;  3FZM B;  3PE0 A;  2WS3 A;  5LMU T;  3ABV A;  2DL1 A;  3B57 A;  3UUB A;  3JCF A;  3MK7 C;  3AE2 A;  2CHN A;  3HKC E;  1VCS A;  4YXD A;  3GA8 A;  2XAS B;  1GQE A;  5ABF B;  3GN5 B;  3OTO T;  1HX8 A;  2LSI A;  2X9W A;  2I59 A;  4A97 A;  3P4P A;  3UFE A;  2W63 A;  4X20 E;  4DR1 T;  2XM2 A;  2V6Y A;  2KMF A;  4CN6 A;  4CI3 B;  1XWM A;  1I6Z A;  2HPL A;  3NZQ A;  2CE7 A;  1KNP A;  2AXD S;  4HWI B;  1DU2 A;  1XDO A;  1OXZ A;  4F8H A;  1YKE B;  1FMV A;  3P50 A;  1KNR A;  4V1A v;  4OYJ A;  3RC8 A;  4MAL A;  3CX8 B;  4IDP A;  3MA9 A;  1M7K A;  3LK4 2;  2MOZ A;  5EK4 A;  4HFI A;  2R6G F;  3A8Y C;  4U2Z A;  2LHN A;  2WCA A;  3I9W A;  3FBZ A;  1HNZ T;  4YFS A;  2K48 A;  3PV0 F;  5AQU B;  2XQ9 A;  5AQF B;  1IBM T;  4JEH B;  2X68 A;  4YSY A;  1FJG T;  3PUZ F;  5LA6 E;  4UEL A;  2BKN A;  3PUG A;  3KFW X;  3MKD A;  2KLQ A;  2KZ7 B;  3R6N A;  4BJN A;  2I0M A;  3NBX X;  4TNW A;  3ZN1 B;  4IIJ E;  4AQF C;  2XQ7 A;  3RIU C;  3AXJ A;  1WLX A;  2N2N A;  4X65 T;  4HFE A;  5HCJ A;  2G0U A;  2WMN A;  4XAX B;  5FXW A;  4EED A;  5F5W A;  4E7S A;  5C8Y E;  3QB5 A;  4LF7 T;  2L9Q A;  4EZ4 A;  2D0U A;  4ZZB A;  4LF9 T;  3V5U A;  1BR2 A;  5HEH A;  4DR2 T;  2WWV A;  1JNR A;  3PU3 A;  4I43 B;  4CI2 B;  3Q5W A;  4O4H E;  3UT5 E;  3LSV A;  3DP7 A;  5LG3 A;  3N2G E;  2ODV A;  5LGT B;  2ZM6 T;  3IEE A;  3PDY A;  4U31 A;  5CA0 E;  1W09 A;  4E7Z A;  1D1C A;  5LHG B;  1U4Q A;  1ZV4 X;  2WZI A;  4QXH B;  2ZM8 A;  5JDH A;  4CXX A;  4TWH A;  3U3I A;  3VRA A;  3EVY A;  3LK3 B;  3UQ4 A;  2IC6 A;  4P1N A;  5H6Q B;  1G73 A;  1ZEE A;  2X9Y A;  2PFV A;  3FZK B;  3WAK A;  2UXD T;  2CMR A;  2FJB A;  4ERR A;  4IE7 A;  3Q5X A;  4WNK A;  5AQN B;  1Y01 A;  2X0L B;  1T7S A;  2WDQ A;  3PUV F;  4IDZ A;  2YU2 A;  4QHO A;  1H7C A;  4AKG A;  4ZXL A;  4LFA T;  2RP4 A;  4C90 A;  2VWA A;  3LFM A;  4TV8 E;  2FJE A;  4JI5 T;  3ZC1 A;  4WZX A;  2W2U A;  3Q5E A;  4H9N C;  2XAQ B;  3PUQ A;  5JVD E;  1S94 A;  3J9X 1;  5HAX A;  4NIQ A;  2XSA A;  3RI5 A;  4HWF A;  3P4S A;  3ZYK A;  4UIG A;  1QLB A;  2HN2 A;  4HWD A;  4QH4 A;  4B6X A;  2J1D G;  3QUJ A;  4LML A;  3ZEF B;  4X1I E;  4HFH A;  2QA7 A;  2V8S V;  3K3O A;  4UV8 B;  4BJM A;  2M6I A;  3KIN B;  2UUC T;  4DV5 T;  1XNQ T;  3EDU A;  4YTN A; 
#chains in the Genus database with same CATH homology
 2E9X D;  3AAE B;  3IF8 B;  4TZ4 C;  3O1J A;  4QXC B;  3ZN0 B;  4DO0 A;  2N1G A;  1HG5 A;  4WBN E;  2W61 A;  1O3X A;  3UUM A;  3C64 A;  3PUS A;  1VOM A;  1KK7 A;  3E22 E;  3CX6 B;  3FHN A;  2XTL A;  2C5I T;  2BDE A;  1LKX A;  2HH7 A;  5FY0 A;  3UUL A;  2M67 A;  4UVB B;  1MNE A;  3NZP A;  4KBM B;  3ZJ2 A;  3NRX A;  4HGA A;  1FMW A;  2E9X B;  2XAF B;  4TUY E;  5LYJ E;  2UXN B;  4HFV A;  1AJ3 A;  3ZPO A;  3RYI E;  4CXY A;  1HG2 A;  2L3L A;  5HWX A;  3WI3 A;  4FI5 A;  5LBQ B;  5HXH A;  3AA6 B;  3KDS E;  4KMC A;  5JDF A;  1MND A;  2JQQ A;  4ZI2 D;  5HYA A;  1HFA A;  3I9Y A;  4WW0 A;  5KMG P;  4G2A A;  3CML A;  4PJL A;  1UX5 A;  3CX7 B;  3A5X A;  3HA4 A;  4OK0 A;  4TV9 E;  4HE8 A;  2KWI B;  2V7M A;  3VKG A;  3N9M A;  1QUU A;  1MIY A;  5HXC A;  2K5B B;  3O1H A;  4QKN A;  3RPU A;  3W15 B;  3WAJ A;  4ZS3 A;  3I1A A;  4U74 A;  3AB3 B;  2V7I A;  3N5L A;  1ZKE A;  5JDQ A;  2DWK A;  5HXE A;  3PTR B;  2EHO D;  5EZY E;  4XBF B;  4TN7 B;  3TKL B;  2E9X A;  2X9X A;  3C51 A;  3SRZ A;  3DJB A;  4P09 A;  3FXE B;  3MXZ A;  1YW0 A;  2CXD A;  3I0Q A;  5J2T E;  1MMA A;  1T98 A;  2Q9Q A;  3K8P C;  1MMD A;  3OYX A;  4HN9 A;  4HTE A;  4AQF A;  2E8I A;  2DWG A;  2Y8D A;  2K24 A;  3FBL A;  5J2U E;  1HCI A;  5F3J A;  4YHJ A;  2HPJ A;  4OHF A;  4PFP A;  4TX5 A;  3PE0 A;  1U5P A;  2EHO B;  2V7K A;  5LNK A;  3VKH A;  4NUU A;  2YU1 A;  4X1K E;  3CKD A;  2YK0 A;  1YKH B;  3ZMV B;  4AI6 A;  2LSK A;  4WBO A;  4GK0 E;  5FMN A;  3O9X A;  2W0G A;  3B57 A;  5GON E;  2YIN A;  4HKA A;  1D0X A;  3MK7 C;  4UV9 B;  5H6R B;  4JUY A;  3HKC E;  5HWY A;  3JC6 D;  5ETW A;  3I0O A;  3KV5 A;  2K9A A;  3IHR A;  4PW8 A;  2Y6X A;  3ZMT B;  3GA8 A;  3BQK A;  2D2S A;  3R84 B;  3ZCI A;  2XAS B;  5LOV E;  2BZB A;  2DNX A;  5KX5 E;  2NTY A;  4QX8 B;  3AAI A;  2XAJ B;  3GN5 B;  2LJL A;  1US7 B;  4AXP A;  4MBQ A;  1HX8 A;  2KIN B;  2NW7 A;  3P7I A;  2LSI A;  2X9W A;  3CQX C;  2CXF A;  2I59 A;  4O4L E;  4GYR A;  3HKE E;  2EHO C;  2A3D A;  2IC9 A;  1WYB A;  1BR4 A;  1MMG A;  2V7L A;  4PJJ A;  2W63 A;  3UFE A;  3GWH A;  4F6R C;  4X20 E;  3Q2M A;  3MAC A;  5L2L A;  4YJ3 E;  2DI4 A;  2KMF A;  2LHR A;  2V26 A;  3C4Z A;  5ADX L;  1FEW A;  5DQW A;  4CI3 B;  4ZHQ E;  3ANW A;  3AAA B;  1KNZ A;  4G63 A;  5JDG A;  3N9O A;  3N2K E;  2H3R A;  5CA1 E;  2HPL A;  4IE0 A;  5JRC A;  4FJO A;  3NZQ A;  3ETU A;  2CE7 A;  2XUE A;  3QC9 A;  1IAP A;  2LSG A;  2PBI A;  3UUN A;  5L3C B;  4ADZ A;  2Q9Q D;  3C98 B;  3GN5 A;  1D0Z A;  1V9D A;  4K0U A;  2A2F X;  4IE4 A;  3BQL A;  1OXZ A;  2NP9 A;  4GK5 E;  3S4U A;  5LHH B;  4UF0 A;  1HF8 A;  3GMI A;  3P8C D;  2PG8 A;  4IHJ E;  3ZCJ A;  1YKE B;  2H7O A;  3VHL A;  1OWA A;  4O2B E;  5LP6 E;  4ISS A;  1FMV A;  2PJQ A;  4ANJ A;  3JC6 C;  4EYU A;  2WWU A;  4V1A v;  4OYJ A;  1FIO A;  4CXW A;  2KND A;  3RC8 A;  4MAL A;  4A56 A;  2D5U A;  3CX8 B;  4ZOL E;  2Q9Q B;  3MA9 A;  2DCF A;  5L3E B;  1IZN B;  4H63 V;  4ZS2 A;  4KP3 C;  3LK4 2;  4EOZ B;  2ZMA A;  3Q9D A;  3N9P A;  2MOZ A;  3AVR A;  5EK4 A;  4AKI A;  2A72 A;  3HL6 A;  3RYF E;  4H9R C;  1D0Y A;  5DQV A;  2NWB A;  3SWH A;  2VKO A;  2KXP B;  4X1Y E;  1MMN A;  2C0S A;  2CLY B;  2JPF A;  3KV4 A;  2ODU A;  4P0A A;  1WYC A;  2LHN A;  3I9W A;  3FBZ A;  4I4T E;  3SOL A;  4DMW A;  4NUV A;  1B7T A;  4YFS A;  2K48 A;  4PAG A;  3AVS A;  4GOU A;  4ILU A;  4XZC A;  5E0O A;  1SHZ C;  1NAF A;  1YD8 G;  2CWO A;  1HTJ F;  1IJ6 A;  3LK2 B;  4JEH B;  1Z0P A;  2X68 A;  1Y64 B;  2E9X C;  2CA5 A;  5FXX A;  5JDM A;  4PK4 A;  3QK6 A;  4CQI A;  5LA6 E;  5FY1 A;  2VKD A;  4UEL A;  3PUG A;  3KFW X;  3MKD A;  4PK5 A;  5FY7 A;  2KLQ A;  3ESL A;  2KZ7 B;  3ONX A;  5HXR A;  3R6N A;  3EUH A;  2KT9 A;  2Q9Q C;  1VRB A;  4N78 D;  4BJN A;  3RKO A;  3NBX X;  5LGU B;  5LHI B;  2NTX A;  3EDV A;  4IIJ E;  3M65 A;  4O8S A;  3ZN1 B;  4AQF C;  3H3A A;  2BVM A;  4ZI3 D;  5IYZ E;  5HXS A;  1WLX A;  2N2N A;  2G0U A;  2WSS V;  2WMN A;  4XAX B;  5FXW A;  2UXX B;  2LSY A;  2WBL A;  2YEV C;  3AA7 B;  4AKR B;  3ZMU B;  4UVC B;  4EIW A;  4E7S A;  2LEH A;  4EAH A;  3E08 A;  5C8Y E;  3UTK A;  4ZI2 C;  4QWN B;  3ANW B;  2B1E A;  2L9Q A;  4EZ4 A;  3PUA A;  2D0U A;  3HKD E;  3K3Q C;  1MIV A;  2NW8 A;  3ZJ1 A;  5JRC B;  3L09 A;  3V5U A;  1BR2 A;  2BVL A;  4I55 E;  3KVB A;  2VL8 A;  2DHR A;  5JQG E;  3PU3 A;  3H37 A;  4L5G A;  4I43 B;  4CI2 B;  3Q5W A;  4L0R A;  3B13 A;  4O4H E;  3UT5 E;  3AA1 B;  3PUR A;  4O4J E;  3ZMZ B;  2LT3 A;  3DP7 A;  5JR9 A;  4QX7 B;  4UF0 B;  4BAY B;  3N2G E;  5JRE A;  2ZLY A;  2ODV A;  4DVD A;  4EZH A;  4PK6 A;  5LGT B;  4H9O C;  3IEE A;  5LJN A;  3PDY A;  2VAS A;  3ZYM A;  2L8K A;  5CA0 E;  5L3F B;  2VKH A;  4UEM A;  4IE6 A;  2P9B A;  2DLR A;  2N9D A;  2CM0 A;  4E7Z A;  5F8P A;  1EZ3 A;  3N9N A;  4P0B A;  4EYY R;  1HS7 A;  4MHC A;  3E0Z A;  4DBR A;  1D1C A;  3HKB E;  5LHG B;  1U4Q A;  4MLK A;  4PFO A;  3F2E A;  5L3G B;  1ZV4 X;  2WM9 A;  2CXL A;  2C5J A;  3ZYL A;  4DMV A;  4QXH B;  2ZM8 A;  2CEA A;  5JDL A;  5JDH A;  2VK9 A;  3L3P A;  4CXX A;  5LCY A;  3FB2 A;  5M4Y A;  3RH3 A;  3BK9 A;  5TAO A;  3MZK B;  3CQC B;  3U3I A;  3NRY A;  3EVY A;  2H7V C;  3LK3 B;  3RRC A;  2MBG A;  1UX4 A;  2IC6 A;  5IHY A;  2OA5 A;  3ZMS B;  4DND A;  5BMV E;  3CPZ A;  5H6Q B;  1G73 A;  1ZEE A;  2NOX A;  4I50 E;  5JDN A;  2X9Y A;  4GIW A;  2PFV A;  2IAK A;  4DBQ A;  1IJ5 A;  2CWY A;  3WAK A;  2CMR A;  2MYS A;  3UUX B;  2LSJ A;  5A1L A;  4PJM A;  4ERR A;  4IE7 A;  5LGN B;  3O1I A;  4O2A E;  3C4W A;  5JH7 E;  5DJQ C;  4U72 A;  3Q5X A;  3PU8 A;  4EXT A;  3BQI A;  3RYH E;  4WNK A;  3ZLI A;  2C5K T;  3RX6 A;  3F57 A;  4YLH A;  3CQG B;  1QSD A;  3MJX A;  3KVA A;  3ETV A;  5FNV E;  2ZM2 A;  1WR6 A;  2JMK A;  2X0L B;  1G8X A;  3N2O A;  2LOS A;  4JEU B;  3KBU A;  3D0T A;  3RC3 A;  4UVA B;  3HR0 A;  3OBV E;  2W00 A;  4IDZ A;  2YU2 A;  3DTO A;  2W62 A;  3K3N A;  4C91 A;  4QXB B;  2JRK A;  2X67 A;  3U78 A;  3T8O A;  4PJN A;  5LG4 A;  1S35 A;  4J2C A;  4QHO A;  4AKL A;  5FP3 A;  1H7C A;  3LG7 A;  4ASK A;  5LBM A;  5LXT E;  3N9L A;  2ZM0 A;  5EK2 A;  1MIW A;  3F31 A;  5J1G A;  3RRW A;  2XQY A;  1D1A A;  4PNI A;  3VU7 H;  4AKG A;  3OYZ A;  1UCU A;  1E1H B;  2KWH A;  1ZHC A;  2LE8 A;  1LVK A;  3RYC E;  4O4I E;  5LJM A;  2X9H A;  1WRD A;  2Z6E A;  2RP4 A;  3KV6 A;  4C90 A;  2VWA A;  2CLY C;  3LFM A;  2X66 A;  5JR9 B;  5FXV A;  4TV8 E;  4H9P C;  4YJ2 E;  3SS1 A;  4H63 H;  3ZC1 A;  2V1D B;  3HI2 A;  2WMO A;  2D0T A;  4H9N C;  4KUM B;  2XAQ B;  4AQG A;  4CZZ B;  3C4X A;  4H9Q C;  3PUQ A;  4JLE A;  2ACX A;  1BR1 A;  3KV9 A;  5JVD E;  4HEA A;  3CVR A;  1S94 A;  3J9X 1;  5HAX A;  4AKH A;  3OJA A;  3J7Y q;  2XHE B;  2JJ9 A;  2ES0 A;  2CCQ A;  3N9Q A;  3IBP A;  2VKJ A;  3O4X E;  3ZYK A;  4UIG A;  3AA0 B;  4UXN B;  3LBX B;  1LVF A;  2LM9 A;  4IST A;  2NW9 A;  2LOP A;  4Z8X A;  5FYM A;  5FXZ A;  5CB4 E;  2WAU A;  3OKQ A;  1CUN A;  4B6X A;  5AFU L;  4H9S E;  4M1P A;  3CWZ B;  5EK3 A;  4ZI7 E;  2J1D G;  3C50 A;  3ZC0 A;  3QUJ A;  4BA9 A;  2QGS A;  2EHO A;  2XAH B;  4OFZ A;  4OYK A;  5L3B B;  2SPC A;  2Y48 B;  1LRZ A;  4MFR A;  2JMH A;  2IW5 B;  3ZEF B;  3LJC A;  2XAG B;  4X1I E;  2GK9 A;  5JR9 C;  2V7J A;  4EB6 E;  3KBT A;  4IE5 A;  5DAB A;  2QA7 A;  1D1B A;  2MTQ A;  1X79 A;  3K3O A;  4UV8 B;  4BJM A;  3LBX A;  5KDM C;  2RA1 A;  2VB6 A;  4ZI3 C;  5L3D B;  1SA0 E;  3KIN B;  3FXD B;  4IGU A;  1BR0 A;  4L9I A;  4GYS A;  3V5S A;  3EDU A;  4CI1 B;  2X51 A;  1NWM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...