1NWVA

Solution structure of a functionally active component of decay accelerating factor
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
129
structure length
129
Chain Sequence
FRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement decay-accelerating factor
publication title Solution structure of a functionally active fragment of decay-accelerating factor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Biosynthetic protein
total genus 8
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2003-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1nwvA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1nwvA01
2WIIC 1H2PP 4FXGG 2MCYA 4YNXA 2RL0A 2RLQA 3OEDC 1OK9A 4KKDA 2YRAA 4J38B 1E88A 1FBRA 1E8BA 4A5WB 5HYPA 5HZPB 1VVDA 2UWNA 4AYIA 3IX0A 4LOTA 3L89M 4B2RA 4WJG2 2MCZA 3TVJA 1MD7A 1U5MA 1CKLA 1H03P 4CSYA 2JGXA 4PZ5A 1E5GA 1OJVA 4B2SA 1G4GA 5JPMG 2CKUA 3ZD2A 4AYMA 5HYTB 2W81A 3GXEA 1C1ZA 1QGBA 3T5OA 3ZRZA 1QUBA 3OP8A 1Z92B 2BZMA 2LOJA 4DJZA 2KMSA 2IZ3A 5FO8C 4AYEA 1OK2A 5HYUB 2JRAA 1GKNA 1ZJKA 2RKZA 1TPMA 1H2QP 2W80A 1GPZA 4AYDA 1HFIA 2JGWA 2RKYA 3EJHA 3INBC 2YBYA 1HFHA 1O9AA 2V8EA 3NFPI 2XWJI 4F4OC 3IU3I 4ZH1D 2XWBF 1UOTP 2B5ID 2XRDA 1H04P 5I0QB 1OK1A 2CG7A 3CALA 3OXUD 4C16A 1MD8A 4IGDA 2IZ4A 3GOVA 1GHQB 1PPQA 3ZD1A 2RLPA 1HCCA 3KXVA 1VVCA 2ERJA 1LY2A 4MUCA 1OK3A 2KRIA 2G7IA 3RJ3D 1TPGA 4LOSA 2QY0A 2A55A 2XRBA 4ONTD 1SS2A 1SRZA 4K12A 1GKGA 3KZJA 3ERBA 3O8EB 1ELVA 1Q3XA 2CG6A 4JHSA 3MQLA 1OJYA 1QO6A 1OJWA 2EC3A 2EHFA 3M7PA 3R62A 1TPNA 1G4FA 3SW0X 1NWVA 2O39C 2XQWC
chains in the Genus database with same CATH superfamily
2WIIC 1H2PP 4FXGG 2MCYA 4YNXA 2RL0A 2RLQA 3OEDC 1OK9A 4KKDA 4APLA 2YRAA 4J38B 1E88A 1FBRA 1E8BA 4A5WB 5HYPA 5HZPB 2I2LA 1VVDA 2UWNA 4N7EA 3IX0A 4LOTA 3L89M 4AYIA 4B2RA 4WJG2 2MCZA 3ZLDA 3TVJA 1MD7A 1U5MA 1CKLA 1H03P 3ZLEA 4CSYA 1RLHA 2JGXA 4PZ5A 1E5GA 1OJVA 4B2SA 1G4GA 5JPMG 2CKUA 3ZD2A 4AYMA 5HYTB 2ZYCA 2Y8SA 2W81A 3GXEA 1C1ZA 1QGBA 5DN5A 3T5OA 2Y8TA 3ZRZA 1QUBA 3NJAA 3OP8A 3FGTA 1Z92B 2BZMA 2LOJA 4DJZA 2KMSA 2IZ3A 5FO8C 4AYEA 1OK2A 4PO7A 5HYUB 2JRAA 4YIZA 1GKNA 1ZJKA 2RKZA 1TPMA 1H2QP 2W80A 1GPZA 4AYDA 1HFIA 2JGWA 2RKYA 3EJHA 3INBC 2YBYA 1HFHA 3F6KA 5DN4A 1O9AA 2V8EA 3NFPI 2XWJI 4F4OC 3IU3I 4ZH1D 2XWBF 1UOTP 2B5ID 2XRDA 1H04P 5I0QB 1OK1A 4MSLA 2CG7A 3CALA 3OXUD 3CI0J 4C16A 4BWCA 1MD8A 4IGDA 2IZ4A 3GOVA 1GHQB 1PPQA 3ZD1A 2RLPA 3WSXA 1HCCA 3KXVA 1VVCA 3K3TA 2ERJA 1LY2A 4MUCA 1OK3A 2KRIA 2G7IA 3RJ3D 1TPGA 4LOSA 2QY0A 2A55A 2XRBA 4ONTD 1SS2A 1SRZA 4K12A 1GKGA 3KZJA 3VWOA 3ERBA 3O8EB 1ELVA 3WSYA 1Q3XA 2CG6A 2X2ZA 4JHSA 2Y8RA 3MQLA 1OJYA 1QO6A 1OJWA 2EC3A 2EHFA 3FGRA 3M7PA 3R62A 1TPNA 1G4FA 3SW0X 1NWVA 2O39C 2XQWC
chains in the Genus database with same CATH topology
2WIIC 1H2PP 4FXGG 2MCYA 4YNXA 2RL0A 2RLQA 3OEDC 1OK9A 4KKDA 2YRAA 4J38B 1E88A 1FBRA 1E8BA 4A5WB 5HYPA 5HZPB 1VVDA 2UWNA 4AYIA 3IX0A 4LOTA 3L89M 4B2RA 4WJG2 2MCZA 3TVJA 1MD7A 1U5MA 1CKLA 1H03P 4CSYA 2JGXA 4PZ5A 1E5GA 1OJVA 4B2SA 1G4GA 5JPMG 2CKUA 3ZD2A 4AYMA 5HYTB 2W81A 3GXEA 1C1ZA 1QGBA 3T5OA 3ZRZA 1QUBA 3OP8A 1Z92B 2BZMA 2LOJA 4DJZA 2KMSA 2IZ3A 5FO8C 4AYEA 1OK2A 5HYUB 2JRAA 1GKNA 1ZJKA 2RKZA 1TPMA 1H2QP 2W80A 1GPZA 4AYDA 1HFIA 2JGWA 2RKYA 3EJHA 3INBC 2YBYA 1HFHA 1O9AA 2V8EA 3NFPI 2XWJI 4F4OC 3IU3I 4ZH1D 2XWBF 1UOTP 2B5ID 2XRDA 1H04P 5I0QB 1OK1A 2CG7A 3CALA 3OXUD 4C16A 1MD8A 4IGDA 2IZ4A 3GOVA 1GHQB 1PPQA 3ZD1A 2RLPA 1HCCA 3KXVA 1VVCA 2ERJA 1LY2A 4MUCA 1OK3A 2KRIA 2G7IA 3RJ3D 1TPGA 4LOSA 2QY0A 2A55A 2XRBA 4ONTD 1SS2A 1SRZA 4K12A 1GKGA 3KZJA 3ERBA 3O8EB 1ELVA 1Q3XA 2CG6A 4JHSA 3MQLA 1OJYA 1QO6A 1OJWA 2EC3A 2EHFA 3M7PA 3R62A 1TPNA 1G4FA 3SW0X 1NWVA 2O39C 2XQWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WII C;  1H2P P;  4FXG G;  2MCY A;  4YNX A;  2RL0 A;  2RLQ A;  3OED C;  1OK9 A;  4KKD A;  2YRA A;  4J38 B;  1E88 A;  1FBR A;  1E8B A;  4A5W B;  5HYP A;  5HZP B;  1VVD A;  2UWN A;  4AYI A;  3IX0 A;  4LOT A;  3L89 M;  4B2R A;  4WJG 2;  2MCZ A;  3TVJ A;  1MD7 A;  1U5M A;  1CKL A;  1H03 P;  4CSY A;  2JGX A;  4PZ5 A;  1E5G A;  1OJV A;  4B2S A;  1G4G A;  5JPM G;  2CKU A;  3ZD2 A;  4AYM A;  5HYT B;  2W81 A;  3GXE A;  1C1Z A;  1QGB A;  3T5O A;  3ZRZ A;  1QUB A;  3OP8 A;  1Z92 B;  2BZM A;  2LOJ A;  4DJZ A;  2KMS A;  2IZ3 A;  5FO8 C;  4AYE A;  1OK2 A;  5HYU B;  2JRA A;  1GKN A;  1ZJK A;  2RKZ A;  1TPM A;  1H2Q P;  2W80 A;  1GPZ A;  4AYD A;  1HFI A;  2JGW A;  2RKY A;  3EJH A;  3INB C;  2YBY A;  1HFH A;  1O9A A;  2V8E A;  3NFP I;  2XWJ I;  4F4O C;  3IU3 I;  4ZH1 D;  2XWB F;  1UOT P;  2B5I D;  2XRD A;  1H04 P;  5I0Q B;  1OK1 A;  2CG7 A;  3CAL A;  3OXU D;  4C16 A;  1MD8 A;  4IGD A;  2IZ4 A;  3GOV A;  1GHQ B;  1PPQ A;  3ZD1 A;  2RLP A;  1HCC A;  3KXV A;  1VVC A;  2ERJ A;  1LY2 A;  4MUC A;  1OK3 A;  2KRI A;  2G7I A;  3RJ3 D;  1TPG A;  4LOS A;  2QY0 A;  2A55 A;  2XRB A;  4ONT D;  1SS2 A;  1SRZ A;  4K12 A;  1GKG A;  3KZJ A;  3ERB A;  3O8E B;  1ELV A;  1Q3X A;  2CG6 A;  4JHS A;  3MQL A;  1OJY A;  1QO6 A;  1OJW A;  2EC3 A;  2EHF A;  3M7P A;  3R62 A;  1TPN A;  1G4F A;  3SW0 X;  1NWV A;  2O39 C;  2XQW C; 
#chains in the Genus database with same CATH topology
 2WII C;  1H2P P;  4FXG G;  2MCY A;  4YNX A;  2RL0 A;  2RLQ A;  3OED C;  1OK9 A;  4KKD A;  4APL A;  2YRA A;  4J38 B;  1E88 A;  1FBR A;  1E8B A;  4A5W B;  5HYP A;  5HZP B;  2I2L A;  1VVD A;  2UWN A;  4N7E A;  3IX0 A;  4LOT A;  3L89 M;  4AYI A;  4B2R A;  4WJG 2;  2MCZ A;  3ZLD A;  3TVJ A;  1MD7 A;  1U5M A;  1CKL A;  1H03 P;  3ZLE A;  4CSY A;  1RLH A;  2JGX A;  4PZ5 A;  1E5G A;  1OJV A;  4B2S A;  1G4G A;  5JPM G;  2CKU A;  3ZD2 A;  4AYM A;  5HYT B;  2ZYC A;  2Y8S A;  2W81 A;  3GXE A;  1C1Z A;  1QGB A;  5DN5 A;  3T5O A;  2Y8T A;  3ZRZ A;  1QUB A;  3NJA A;  3OP8 A;  3FGT A;  1Z92 B;  2BZM A;  2LOJ A;  4DJZ A;  2KMS A;  2IZ3 A;  5FO8 C;  4AYE A;  1OK2 A;  4PO7 A;  5HYU B;  2JRA A;  4YIZ A;  1GKN A;  1ZJK A;  2RKZ A;  1TPM A;  1H2Q P;  2W80 A;  1GPZ A;  4AYD A;  1HFI A;  2JGW A;  2RKY A;  3EJH A;  3INB C;  2YBY A;  1HFH A;  3F6K A;  5DN4 A;  1O9A A;  2V8E A;  3NFP I;  2XWJ I;  4F4O C;  3IU3 I;  4ZH1 D;  2XWB F;  1UOT P;  2B5I D;  2XRD A;  1H04 P;  5I0Q B;  1OK1 A;  4MSL A;  2CG7 A;  3CAL A;  3OXU D;  3CI0 J;  4C16 A;  4BWC A;  1MD8 A;  4IGD A;  2IZ4 A;  3GOV A;  1GHQ B;  1PPQ A;  3ZD1 A;  2RLP A;  3WSX A;  1HCC A;  3KXV A;  1VVC A;  3K3T A;  2ERJ A;  1LY2 A;  4MUC A;  1OK3 A;  2KRI A;  2G7I A;  3RJ3 D;  1TPG A;  4LOS A;  2QY0 A;  2A55 A;  2XRB A;  4ONT D;  1SS2 A;  1SRZ A;  4K12 A;  1GKG A;  3KZJ A;  3VWO A;  3ERB A;  3O8E B;  1ELV A;  3WSY A;  1Q3X A;  2CG6 A;  2X2Z A;  4JHS A;  2Y8R A;  3MQL A;  1OJY A;  1QO6 A;  1OJW A;  2EC3 A;  2EHF A;  3FGR A;  3M7P A;  3R62 A;  1TPN A;  1G4F A;  3SW0 X;  1NWV A;  2O39 C;  2XQW C; 
#chains in the Genus database with same CATH homology
 2WII C;  1H2P P;  4FXG G;  2MCY A;  4YNX A;  2RL0 A;  2RLQ A;  3OED C;  1OK9 A;  4KKD A;  2YRA A;  4J38 B;  1E88 A;  1FBR A;  1E8B A;  4A5W B;  5HYP A;  5HZP B;  1VVD A;  2UWN A;  4AYI A;  3IX0 A;  4LOT A;  3L89 M;  4B2R A;  4WJG 2;  2MCZ A;  3TVJ A;  1MD7 A;  1U5M A;  1CKL A;  1H03 P;  4CSY A;  2JGX A;  4PZ5 A;  1E5G A;  1OJV A;  4B2S A;  1G4G A;  5JPM G;  2CKU A;  3ZD2 A;  4AYM A;  5HYT B;  2W81 A;  3GXE A;  1C1Z A;  1QGB A;  3T5O A;  3ZRZ A;  1QUB A;  3OP8 A;  1Z92 B;  2BZM A;  2LOJ A;  4DJZ A;  2KMS A;  2IZ3 A;  5FO8 C;  4AYE A;  1OK2 A;  5HYU B;  2JRA A;  1GKN A;  1ZJK A;  2RKZ A;  1TPM A;  1H2Q P;  2W80 A;  1GPZ A;  4AYD A;  1HFI A;  2JGW A;  2RKY A;  3EJH A;  3INB C;  2YBY A;  1HFH A;  1O9A A;  2V8E A;  3NFP I;  2XWJ I;  4F4O C;  3IU3 I;  4ZH1 D;  2XWB F;  1UOT P;  2B5I D;  2XRD A;  1H04 P;  5I0Q B;  1OK1 A;  2CG7 A;  3CAL A;  3OXU D;  4C16 A;  1MD8 A;  4IGD A;  2IZ4 A;  3GOV A;  1GHQ B;  1PPQ A;  3ZD1 A;  2RLP A;  1HCC A;  3KXV A;  1VVC A;  2ERJ A;  1LY2 A;  4MUC A;  1OK3 A;  2KRI A;  2G7I A;  3RJ3 D;  1TPG A;  4LOS A;  2QY0 A;  2A55 A;  2XRB A;  4ONT D;  1SS2 A;  1SRZ A;  4K12 A;  1GKG A;  3KZJ A;  3ERB A;  3O8E B;  1ELV A;  1Q3X A;  2CG6 A;  4JHS A;  3MQL A;  1OJY A;  1QO6 A;  1OJW A;  2EC3 A;  2EHF A;  3M7P A;  3R62 A;  1TPN A;  1G4F A;  3SW0 X;  1NWV A;  2O39 C;  2XQW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...